1A1IA

Radr (zif268 variant) zinc finger-dna complex (gcac site)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
85
structure length
85
Chain Sequence
b'RPYACPVESCDRRFSRSADLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*AP*C)-3')
publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 27
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1iA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1iA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1iA03
4R2PA 2CTDA 2EORA 2YTDA 2EL4A 4R2CA 5KL6A 2EL5A 1YUIA 2EQ0A 5KL4A 4R2DA 2EQ1A 1ZU1A 2EQ3A 1UBDC 2YRKA 2EPUA 1G2FC 2R1FA 2EM0A 2RSIA 4R2SA 3EPKA 2JPAA 2EM6A 2YTJA 2EPXA 1MEYC 1A1HA 2YTIA 1YSAC 4GZNC 2ENAA 2YTGA 4R2QA 2EM7A 2EPCA 3EPJA 2YSOA 2EOSA 2YTPA 2DMIA 2YU5A 1A1GA 4FK5C 4M9VC 2EMZA 2GHFA 2EPRA 1X6HA 2LO3A 5KL7A 2GLIA 2EMWA 2HGHA 2PRTA 1RMDA 2ADRA 2D9HA 2M9AA 2EOFA 1A1KA 2EN8A 2EMLA 2EN6A 2EPZA 1ZAAC 2DGCA 2EN4A 2EJ4A 2EOZA 2DLQA 2YTFA 2ELZA 4X9JA 2WBSA 1ZR9A 2ELYA 3MHHC 5KL5A 2LT7A 1A1FA 2EOXA 2EMGA 1A1LA 2RPCA 2EMAA 1X3CA 2E72A 1F2IG 1AAYA 2EM8A 2A25A 2ENCA 2CT1A 2EMBA 1DGCA 2EOEA 1UN6B 2LVHA 4F6NA 3EPHA 3VHTB 1X5WA 2YTNA 2EOYA 2NABA 2EMHA 2YRHA 2EMCA 2YTQA 1TN9A 2BB8A 2EMFA 2WBTA 2EOOA 2EN2A 1X6EA 2EMKA 2EM3A 1X6FA 2EE8A 5KL2A 2JP9A 2EOQA 4R2RA 2J7JA 1YUJA 2EOIA 2EN3A 2YU8A 1JK2A 1JK1A 2YTEA 4R2EA 2EM9A 2I13A 1KJKA 1A1JA 3EPLA 1TF3A 4F2JC 1P47A 4WSGA 2MDGA 1BBOA 3UK3C 4R2AA 2YSPA 2YTOA 2DRPA 2EM5A 4IJDA 2WCC3 1B69A 1TF6A 5KL3A 2EOMA 1NCSA 2EMIA 1Z1BA 2EOHA 1A1IA 2YRMA 2LV2A 2MKDA 2EM4A 2EPAA 4IS1C 1WJPA 2VRDA 2ENHA 2CSHA 2EMYA 2EN7A 3MHSC 4F6MA 2EL6A 2EPPA 2EP3A 1BB8A 2MKNA 2EM2A 2EN1A 2WBUA 2EOJA 3M99B 1LLMC 2LCEA 2DLKA 1G2DC 2EMXA
chains in the Genus database with same CATH superfamily
2I9IA 3IWCA 2EORA 2YTDA 4DR1E 4R2CA 5KL6A 2N3HA 3T1YE 5KL4A 4RHBB 4R2DA 2GPIA 1UBDC 4I8OA 2R1FA 4BC9A 4LF6E 2JWOA 1A1HA 4GZNC 2YTGA 2KHXA 4K0KE 4TUIA 1KYQA 2YTPA 5TSEA 2CPNA 5AE3A 1A1GA 2B7TA 2VF1A 1EH8A 1GTKA 2EMWA 2L3JA 2EOFA 2EN8A 2EMLA 4X64E 1XMOE 1XNQE 2EN4A 1HNXE 2B3TB 3MHHC 2WZOA 2EPNA 4ZYEA 3VYYA 4NXME 2VQFE 1A1LA 4NHRA 1WXRA 1DGCA 4F6NA 2MC5A 1QNTA 2YTNA 2L2NA 2RQLA 1YYWA 2VQEE 1QU6A 2YRHA 3VK6A 2V83A 1TN9A 4ZYHA 2BB8A 2EOOA 2EM3A 2FV4B 1SR9A 2EE8A 4LFAE 4BMJA 2JVAA 3H09A 4HTGA 4L8NA 4R2EA 2EM9A 3J80C 2NA2A 4M30A 4LF4E 1N33E 1PJSA 3EPLA 4DUZE 1TF3A 2KOUA 4WXDA 2MC6A 2ODRC 2DRPA 1B69A 4ZYGA 1J26A 4LTYA 4R03A 4DMIA 5KL3A 3LMLA 3HTXA 1T4NA 1Z1BA 2LV2A 4OOGC 2EPAA 5IT9C 1AH5A 1IBKE 3JTZA 2LUQA 3DF6A 3MHSC 2G7HA 2V85A 4JI2E 4MLQA 3M99B 4KWYA 2L2MA 5AE1A 5A6JA 5A6BA 4P78A 2L92A 4L5NC 4DR2E 4TUGA 3HPSA 2EL5A 2EQ0A 1T4LB 2UXCE 2HJJA 2EQ1A 2EQ3A 1ZBTA 5A6AA 4NZVA 3HQ1A 2JR1A 2YRKA 2EPUA 3FIGA 1G2FC 4O24A 4R2SA 4BC7A 3MSWA 2L2KB 2YTIA 1O0WA 1WHQA 2H36X 2EPOA 2EOSA 4LU9A 4RH8A 2YU5A 4DV0E 2HC5A 2M1SA 3THOB 1L4SA 5KL7A 5A69A 2HGHA 2PRTA 1X49A 2ADRA 2D9HA 2M9AA 1A1KA 2HHHE 1UILA 4ZYDA 2EN6A 2EPZA 2V87A 1T38A 1ZAAC 2DGCA 4JI0E 4JYAE 2DLQA 4X9JA 3HPZA 4WFTA 1ZR9A 2ELYA 5KL5A 2WBSA 2LT7A 2UUBE 2Q8UA 1HNZE 1MGTA 4JI1E 2EOXA 2EMGA 1PJTA 1RC7A 2RPCA 2L3CA 1PKPA 1PJQA 2DMYA 4X66E 2EOEA 2LVHA 1WRJA 3DJWA 2B9DA 5LLQA 2EWLA 1SFEA 2LMZA 2EMHA 3IWDA 4B3ME 3KZYA 4N4RB 3ADGA 2YTQA 2F4VE 4P7DA 1X48A 2EMFA 4WXCA 1HR0E 2EN2A 1YYKA 2EMKA 3OTOE 1X6FA 2YPNA 3IWBA 4JI6E 5KL2A 4J8ZA 4LF9E 2KONA 2JP9A 5CFFE 3LLHA 1YPNA 1JK1A 4B3TE 1YYOA 4LF7E 4KZSA 2LBSB 4WSGA 4BHBA 2EM5A 2WCC3 2K4VA 1DI2A 2RS7A 5F3WA 4DR7E 2DSYA 2EOHA 4O4KA 1A1IA 2EM4A 2B7VA 4WSPA 5A6BD 4WPYA 4DR4E 4F9AB 2EMYA 2N8XA 2EL6A 2L33A 3QG5C 4MLVA 5LL6R 1EKZA 4DR3E 1LLMC 2UXBE 2JOXA 2LCEA 2ZM6E 2ODRD 4AQYE 2CTDA 2L6MA 3F6GA 3KWRA 2EL4A 4DR5E 4WYQB 1YUIA 1ZU1A 2EM0A 2FGGA 4X62E 4JI8E 2JPAA 1IMUA 3JAMC 2EPXA 2L8TA 2ENAA 5LMNE 2FTXB 2LRSA 4R2QA 2EM7A 2YSOA 3OMLA 2DMIA 2YT4A 2LTSA 4FK5C 1IBME 4DR6E 2EMZA 4R8OA 4DV4E 1X6HA 2UXDE 2LO3A 2GLIA 1RMDA 3J7AG 4YY3E 2EPLX 4WX9A 2EJ4A 2EOZA 5AASA 2YTFA 4JI4E 3ZOQB 2VE7C 3BF2A 3KZZA 1A1FA 1AAYA 2EM8A 2A25A 1DQ3A 4BS9A 2R76A 4B3RE 1UN6B 2EOYA 3VYXA 2NABA 5LMUE 4O43A 3RMPA 3C4TA 5AE2A 4DUYE 2UU9E 1X6EA 2EOQA 2YZTA 4JI7E 2YWQA 1YZ9A 2YU8A 1BBGA 2EN3A 1JK2A 1EH6A 3ADIA 4X8WA 1KJKA 1A1JA 2UUAE 1EH7A 2MDGA 2V8QB 4R2AA 2YSPA 2YTOA 4BHCA 5DNYA 2EPMX 4IJDA 1XNRE 1TF6A 2JY9A 5IXMB 4GKKE 4JI3E 4LFBE 2MKDA 2LE2A 2E5LE 1WJPA 3THNA 1PDAA 2VRDA 2CSHA 5T6JA 2EPPA 4M2ZA 4BBYA 2WBUA 2EOJA 4LF8E 2M4IA 2DLKA 5A6KA 2EMXA 3P1XA 2N3GA 4R2PA 2NUFA 2DIXA 5FLXC 5AC4A 1UHZA 3AUZA 3C4BA 4DV2E 4GEQB 2V89A 4F54A 2RSIA 2LUPB 1T39A 1GQEA 3EPKA 4DKKA 3T1HE 2EM6A 1I94E 3EQ1A 2YTJA 1MEYC 1YSAC 2LJUA 1ZBQA 4JI5E 2EPCA 3EPJA 1T4OA 4DV5E 3K6QA 1N34E 4M9VC 2GHFA 2EPRA 4Q28A 4DV1E 3ADLA 1WHNA 1N3GA 1N36E 2E1MA 4B3SE 4GKJE 4DV6E 4NXNE 2ELZA 4OX9E 3BIDA 2JYAA 1X47A 1FJGE 4O5GA 4F9BB 2EMAA 1X3CA 2E72A 3HXLA 1F2IG 2ENCA 1FKAE 3BGHA 4LF5E 1N32E 2CT1A 1IQOA 2EMBA 5ADZA 3EPHA 3J7Yp 2RTXA 3VHTB 1X5WA 2F8BA 5IV8B 4YHHE 2EMCA 2RSMA 4JV5E 5IWAE 2WBTA 2IHR1 1YFHA 2V88A 4DV7E 4LFCE 4X65E 2LTRA 4R2RA 1NEIA 2J7JA 1YUJA 2EOIA 3BBGA 1IQSA 2YTEA 4BCAA 4Q35B 2EPKX 5A2QC 2I13A 1RQ0A 2LJHA 4HEIA 1IBLE 3JU0A 4F2JC 1P47A 2EZ6A 1BBOA 3UK3C 4DV3E 3ECRA 1HNWE 2EOMA 1NCSA 2V86A 3TQMA 2EMIA 5BR8E 2NUEA 2JXPA 2K7IA 3ADJA 2YRMA 4KHPE 2DB2A 2MDRA 2M7QA 4IS1C 3AV0A 3C6KA 2UUCE 2BBGA 2ENHA 1J5EE 3J81C 3F6HA 4F9CB 2EN7A 2RS6A 4F6MA 2EP3A 1STUA 1BB8A 2MKNA 2NUGA 2EM2A 3C6MA 2EN1A 1XMQE 3L00A 5AC5A 1G2DC 2JOBA 1GZ6A 4M0VA
chains in the Genus database with same CATH topology
4R2PA 2CTDA 2EORA 2YTDA 2EL4A 4R2CA 5KL6A 2EL5A 1YUIA 2EQ0A 5KL4A 4R2DA 2EQ1A 1ZU1A 2EQ3A 1UBDC 2YRKA 2EPUA 1G2FC 2R1FA 2EM0A 2RSIA 4R2SA 3EPKA 2JPAA 2EM6A 2YTJA 2EPXA 1MEYC 1A1HA 2YTIA 1YSAC 4GZNC 2ENAA 2YTGA 4R2QA 2EM7A 2EPCA 3EPJA 2YSOA 2EOSA 2YTPA 2DMIA 2YU5A 1A1GA 4FK5C 4M9VC 2EMZA 2GHFA 2EPRA 1X6HA 2LO3A 5KL7A 2GLIA 2EMWA 2HGHA 2PRTA 1RMDA 2ADRA 2D9HA 2M9AA 2EOFA 1A1KA 2EN8A 2EMLA 2EN6A 2EPZA 1ZAAC 2DGCA 2EN4A 2EJ4A 2EOZA 2DLQA 2YTFA 2ELZA 4X9JA 2WBSA 1ZR9A 2ELYA 3MHHC 5KL5A 2LT7A 1A1FA 2EOXA 2EMGA 1A1LA 2RPCA 2EMAA 1X3CA 2E72A 1F2IG 1AAYA 2EM8A 2A25A 2ENCA 2CT1A 2EMBA 1DGCA 2EOEA 1UN6B 2LVHA 4F6NA 3EPHA 3VHTB 1X5WA 2YTNA 2EOYA 2NABA 2EMHA 2YRHA 2EMCA 2YTQA 1TN9A 2BB8A 2EMFA 2WBTA 2EOOA 2EN2A 1X6EA 2EMKA 2EM3A 1X6FA 2EE8A 5KL2A 2JP9A 2EOQA 4R2RA 2J7JA 1YUJA 2EOIA 2EN3A 2YU8A 1JK2A 1JK1A 2YTEA 4R2EA 2EM9A 2I13A 1KJKA 1A1JA 3EPLA 1TF3A 4F2JC 1P47A 4WSGA 2MDGA 1BBOA 3UK3C 4R2AA 2YSPA 2YTOA 2DRPA 2EM5A 4IJDA 2WCC3 1B69A 1TF6A 5KL3A 2EOMA 1NCSA 2EMIA 1Z1BA 2EOHA 1A1IA 2YRMA 2LV2A 2MKDA 2EM4A 2EPAA 4IS1C 1WJPA 2VRDA 2ENHA 2CSHA 2EMYA 2EN7A 3MHSC 4F6MA 2EL6A 2EPPA 2EP3A 1BB8A 2MKNA 2EM2A 2EN1A 2WBUA 2EOJA 3M99B 1LLMC 2LCEA 2DLKA 1G2DC 2EMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2P A;  2CTD A;  2EOR A;  2YTD A;  2EL4 A;  4R2C A;  5KL6 A;  2EL5 A;  1YUI A;  2EQ0 A;  5KL4 A;  4R2D A;  2EQ1 A;  1ZU1 A;  2EQ3 A;  1UBD C;  2YRK A;  2EPU A;  1G2F C;  2R1F A;  2EM0 A;  2RSI A;  4R2S A;  3EPK A;  2JPA A;  2EM6 A;  2YTJ A;  2EPX A;  1MEY C;  1A1H A;  2YTI A;  1YSA C;  4GZN C;  2ENA A;  2YTG A;  4R2Q A;  2EM7 A;  2EPC A;  3EPJ A;  2YSO A;  2EOS A;  2YTP A;  2DMI A;  2YU5 A;  1A1G A;  4FK5 C;  4M9V C;  2EMZ A;  2GHF A;  2EPR A;  1X6H A;  2LO3 A;  5KL7 A;  2GLI A;  2EMW A;  2HGH A;  2PRT A;  1RMD A;  2ADR A;  2D9H A;  2M9A A;  2EOF A;  1A1K A;  2EN8 A;  2EML A;  2EN6 A;  2EPZ A;  1ZAA C;  2DGC A;  2EN4 A;  2EJ4 A;  2EOZ A;  2DLQ A;  2YTF A;  2ELZ A;  4X9J A;  2WBS A;  1ZR9 A;  2ELY A;  3MHH C;  5KL5 A;  2LT7 A;  1A1F A;  2EOX A;  2EMG A;  1A1L A;  2RPC A;  2EMA A;  1X3C A;  2E72 A;  1F2I G;  1AAY A;  2EM8 A;  2A25 A;  2ENC A;  2CT1 A;  2EMB A;  1DGC A;  2EOE A;  1UN6 B;  2LVH A;  4F6N A;  3EPH A;  3VHT B;  1X5W A;  2YTN A;  2EOY A;  2NAB A;  2EMH A;  2YRH A;  2EMC A;  2YTQ A;  1TN9 A;  2BB8 A;  2EMF A;  2WBT A;  2EOO A;  2EN2 A;  1X6E A;  2EMK A;  2EM3 A;  1X6F A;  2EE8 A;  5KL2 A;  2JP9 A;  2EOQ A;  4R2R A;  2J7J A;  1YUJ A;  2EOI A;  2EN3 A;  2YU8 A;  1JK2 A;  1JK1 A;  2YTE A;  4R2E A;  2EM9 A;  2I13 A;  1KJK A;  1A1J A;  3EPL A;  1TF3 A;  4F2J C;  1P47 A;  4WSG A;  2MDG A;  1BBO A;  3UK3 C;  4R2A A;  2YSP A;  2YTO A;  2DRP A;  2EM5 A;  4IJD A;  2WCC 3;  1B69 A;  1TF6 A;  5KL3 A;  2EOM A;  1NCS A;  2EMI A;  1Z1B A;  2EOH A;  1A1I A;  2YRM A;  2LV2 A;  2MKD A;  2EM4 A;  2EPA A;  4IS1 C;  1WJP A;  2VRD A;  2ENH A;  2CSH A;  2EMY A;  2EN7 A;  3MHS C;  4F6M A;  2EL6 A;  2EPP A;  2EP3 A;  1BB8 A;  2MKN A;  2EM2 A;  2EN1 A;  2WBU A;  2EOJ A;  3M99 B;  1LLM C;  2LCE A;  2DLK A;  1G2D C;  2EMX A; 
#chains in the Genus database with same CATH topology
 2I9I A;  3IWC A;  2EOR A;  2YTD A;  4DR1 E;  4R2C A;  5KL6 A;  2N3H A;  3T1Y E;  5KL4 A;  4RHB B;  4R2D A;  2GPI A;  1UBD C;  4I8O A;  2R1F A;  4BC9 A;  4LF6 E;  2JWO A;  1A1H A;  4GZN C;  2YTG A;  2KHX A;  4K0K E;  4TUI A;  1KYQ A;  2YTP A;  5TSE A;  2CPN A;  5AE3 A;  1A1G A;  2B7T A;  2VF1 A;  1EH8 A;  1GTK A;  2EMW A;  2L3J A;  2EOF A;  2EN8 A;  2EML A;  4X64 E;  1XMO E;  1XNQ E;  2EN4 A;  1HNX E;  2B3T B;  3MHH C;  2WZO A;  2EPN A;  4ZYE A;  3VYY A;  4NXM E;  2VQF E;  1A1L A;  4NHR A;  1WXR A;  1DGC A;  4F6N A;  2MC5 A;  1QNT A;  2YTN A;  2L2N A;  2RQL A;  1YYW A;  2VQE E;  1QU6 A;  2YRH A;  3VK6 A;  2V83 A;  1TN9 A;  4ZYH A;  2BB8 A;  2EOO A;  2EM3 A;  2FV4 B;  1SR9 A;  2EE8 A;  4LFA E;  4BMJ A;  2JVA A;  3H09 A;  4HTG A;  4L8N A;  4R2E A;  2EM9 A;  3J80 C;  2NA2 A;  4M30 A;  4LF4 E;  1N33 E;  1PJS A;  3EPL A;  4DUZ E;  1TF3 A;  2KOU A;  4WXD A;  2MC6 A;  2ODR C;  2DRP A;  1B69 A;  4ZYG A;  1J26 A;  4LTY A;  4R03 A;  4DMI A;  5KL3 A;  3LML A;  3HTX A;  1T4N A;  1Z1B A;  2LV2 A;  4OOG C;  2EPA A;  5IT9 C;  1AH5 A;  1IBK E;  3JTZ A;  2LUQ A;  3DF6 A;  3MHS C;  2G7H A;  2V85 A;  4JI2 E;  4MLQ A;  3M99 B;  4KWY A;  2L2M A;  5AE1 A;  5A6J A;  5A6B A;  4P78 A;  2L92 A;  4L5N C;  4DR2 E;  4TUG A;  3HPS A;  2EL5 A;  2EQ0 A;  1T4L B;  2UXC E;  2HJJ A;  2EQ1 A;  2EQ3 A;  1ZBT A;  5A6A A;  4NZV A;  3HQ1 A;  2JR1 A;  2YRK A;  2EPU A;  3FIG A;  1G2F C;  4O24 A;  4R2S A;  4BC7 A;  3MSW A;  2L2K B;  2YTI A;  1O0W A;  1WHQ A;  2H36 X;  2EPO A;  2EOS A;  4LU9 A;  4RH8 A;  2YU5 A;  4DV0 E;  2HC5 A;  2M1S A;  3THO B;  1L4S A;  5KL7 A;  5A69 A;  2HGH A;  2PRT A;  1X49 A;  2ADR A;  2D9H A;  2M9A A;  1A1K A;  2HHH E;  1UIL A;  4ZYD A;  2EN6 A;  2EPZ A;  2V87 A;  1T38 A;  1ZAA C;  2DGC A;  4JI0 E;  4JYA E;  2DLQ A;  4X9J A;  3HPZ A;  4WFT A;  1ZR9 A;  2ELY A;  5KL5 A;  2WBS A;  2LT7 A;  2UUB E;  2Q8U A;  1HNZ E;  1MGT A;  4JI1 E;  2EOX A;  2EMG A;  1PJT A;  1RC7 A;  2RPC A;  2L3C A;  1PKP A;  1PJQ A;  2DMY A;  4X66 E;  2EOE A;  2LVH A;  1WRJ A;  3DJW A;  2B9D A;  5LLQ A;  2EWL A;  1SFE A;  2LMZ A;  2EMH A;  3IWD A;  4B3M E;  3KZY A;  4N4R B;  3ADG A;  2YTQ A;  2F4V E;  4P7D A;  1X48 A;  2EMF A;  4WXC A;  1HR0 E;  2EN2 A;  1YYK A;  2EMK A;  3OTO E;  1X6F A;  2YPN A;  3IWB A;  4JI6 E;  5KL2 A;  4J8Z A;  4LF9 E;  2KON A;  2JP9 A;  5CFF E;  3LLH A;  1YPN A;  1JK1 A;  4B3T E;  1YYO A;  4LF7 E;  4KZS A;  2LBS B;  4WSG A;  4BHB A;  2EM5 A;  2WCC 3;  2K4V A;  1DI2 A;  2RS7 A;  5F3W A;  4DR7 E;  2DSY A;  2EOH A;  4O4K A;  1A1I A;  2EM4 A;  2B7V A;  4WSP A;  5A6B D;  4WPY A;  4DR4 E;  4F9A B;  2EMY A;  2N8X A;  2EL6 A;  2L33 A;  3QG5 C;  4MLV A;  5LL6 R;  1EKZ A;  4DR3 E;  1LLM C;  2UXB E;  2JOX A;  2LCE A;  2ZM6 E;  2ODR D;  4AQY E;  2CTD A;  2L6M A;  3F6G A;  3KWR A;  2EL4 A;  4DR5 E;  4WYQ B;  1YUI A;  1ZU1 A;  2EM0 A;  2FGG A;  4X62 E;  4JI8 E;  2JPA A;  1IMU A;  3JAM C;  2EPX A;  2L8T A;  2ENA A;  5LMN E;  2FTX B;  2LRS A;  4R2Q A;  2EM7 A;  2YSO A;  3OML A;  2DMI A;  2YT4 A;  2LTS A;  4FK5 C;  1IBM E;  4DR6 E;  2EMZ A;  4R8O A;  4DV4 E;  1X6H A;  2UXD E;  2LO3 A;  2GLI A;  1RMD A;  3J7A G;  4YY3 E;  2EPL X;  4WX9 A;  2EJ4 A;  2EOZ A;  5AAS A;  2YTF A;  4JI4 E;  3ZOQ B;  2VE7 C;  3BF2 A;  3KZZ A;  1A1F A;  1AAY A;  2EM8 A;  2A25 A;  1DQ3 A;  4BS9 A;  2R76 A;  4B3R E;  1UN6 B;  2EOY A;  3VYX A;  2NAB A;  5LMU E;  4O43 A;  3RMP A;  3C4T A;  5AE2 A;  4DUY E;  2UU9 E;  1X6E A;  2EOQ A;  2YZT A;  4JI7 E;  2YWQ A;  1YZ9 A;  2YU8 A;  1BBG A;  2EN3 A;  1JK2 A;  1EH6 A;  3ADI A;  4X8W A;  1KJK A;  1A1J A;  2UUA E;  1EH7 A;  2MDG A;  2V8Q B;  4R2A A;  2YSP A;  2YTO A;  4BHC A;  5DNY A;  2EPM X;  4IJD A;  1XNR E;  1TF6 A;  2JY9 A;  5IXM B;  4GKK E;  4JI3 E;  4LFB E;  2MKD A;  2LE2 A;  2E5L E;  1WJP A;  3THN A;  1PDA A;  2VRD A;  2CSH A;  5T6J A;  2EPP A;  4M2Z A;  4BBY A;  2WBU A;  2EOJ A;  4LF8 E;  2M4I A;  2DLK A;  5A6K A;  2EMX A;  3P1X A;  2N3G A;  4R2P A;  2NUF A;  2DIX A;  5FLX C;  5AC4 A;  1UHZ A;  3AUZ A;  3C4B A;  4DV2 E;  4GEQ B;  2V89 A;  4F54 A;  2RSI A;  2LUP B;  1T39 A;  1GQE A;  3EPK A;  4DKK A;  3T1H E;  2EM6 A;  1I94 E;  3EQ1 A;  2YTJ A;  1MEY C;  1YSA C;  2LJU A;  1ZBQ A;  4JI5 E;  2EPC A;  3EPJ A;  1T4O A;  4DV5 E;  3K6Q A;  1N34 E;  4M9V C;  2GHF A;  2EPR A;  4Q28 A;  4DV1 E;  3ADL A;  1WHN A;  1N3G A;  1N36 E;  2E1M A;  4B3S E;  4GKJ E;  4DV6 E;  4NXN E;  2ELZ A;  4OX9 E;  3BID A;  2JYA A;  1X47 A;  1FJG E;  4O5G A;  4F9B B;  2EMA A;  1X3C A;  2E72 A;  3HXL A;  1F2I G;  2ENC A;  1FKA E;  3BGH A;  4LF5 E;  1N32 E;  2CT1 A;  1IQO A;  2EMB A;  5ADZ A;  3EPH A;  3J7Y p;  2RTX A;  3VHT B;  1X5W A;  2F8B A;  5IV8 B;  4YHH E;  2EMC A;  2RSM A;  4JV5 E;  5IWA E;  2WBT A;  2IHR 1;  1YFH A;  2V88 A;  4DV7 E;  4LFC E;  4X65 E;  2LTR A;  4R2R A;  1NEI A;  2J7J A;  1YUJ A;  2EOI A;  3BBG A;  1IQS A;  2YTE A;  4BCA A;  4Q35 B;  2EPK X;  5A2Q C;  2I13 A;  1RQ0 A;  2LJH A;  4HEI A;  1IBL E;  3JU0 A;  4F2J C;  1P47 A;  2EZ6 A;  1BBO A;  3UK3 C;  4DV3 E;  3ECR A;  1HNW E;  2EOM A;  1NCS A;  2V86 A;  3TQM A;  2EMI A;  5BR8 E;  2NUE A;  2JXP A;  2K7I A;  3ADJ A;  2YRM A;  4KHP E;  2DB2 A;  2MDR A;  2M7Q A;  4IS1 C;  3AV0 A;  3C6K A;  2UUC E;  2BBG A;  2ENH A;  1J5E E;  3J81 C;  3F6H A;  4F9C B;  2EN7 A;  2RS6 A;  4F6M A;  2EP3 A;  1STU A;  1BB8 A;  2MKN A;  2NUG A;  2EM2 A;  3C6M A;  2EN1 A;  1XMQ E;  3L00 A;  5AC5 A;  1G2D C;  2JOB A;  1GZ6 A;  4M0V A; 
#chains in the Genus database with same CATH homology
 4R2P A;  2CTD A;  2EOR A;  2YTD A;  2EL4 A;  4R2C A;  5KL6 A;  2EL5 A;  1YUI A;  2EQ0 A;  5KL4 A;  4R2D A;  2EQ1 A;  1ZU1 A;  2EQ3 A;  1UBD C;  2YRK A;  2EPU A;  1G2F C;  2R1F A;  2EM0 A;  2RSI A;  4R2S A;  3EPK A;  2JPA A;  2EM6 A;  2YTJ A;  2EPX A;  1MEY C;  1A1H A;  2YTI A;  1YSA C;  4GZN C;  2ENA A;  2YTG A;  4R2Q A;  2EM7 A;  2EPC A;  3EPJ A;  2YSO A;  2EOS A;  2YTP A;  2DMI A;  2YU5 A;  1A1G A;  4FK5 C;  4M9V C;  2EMZ A;  2GHF A;  2EPR A;  1X6H A;  2LO3 A;  5KL7 A;  2GLI A;  2EMW A;  2HGH A;  2PRT A;  1RMD A;  2ADR A;  2D9H A;  2M9A A;  2EOF A;  1A1K A;  2EN8 A;  2EML A;  2EN6 A;  2EPZ A;  1ZAA C;  2DGC A;  2EN4 A;  2EJ4 A;  2EOZ A;  2DLQ A;  2YTF A;  2ELZ A;  4X9J A;  2WBS A;  1ZR9 A;  2ELY A;  3MHH C;  5KL5 A;  2LT7 A;  1A1F A;  2EOX A;  2EMG A;  1A1L A;  2RPC A;  2EMA A;  1X3C A;  2E72 A;  1F2I G;  1AAY A;  2EM8 A;  2A25 A;  2ENC A;  2CT1 A;  2EMB A;  1DGC A;  2EOE A;  1UN6 B;  2LVH A;  4F6N A;  3EPH A;  3VHT B;  1X5W A;  2YTN A;  2EOY A;  2NAB A;  2EMH A;  2YRH A;  2EMC A;  2YTQ A;  1TN9 A;  2BB8 A;  2EMF A;  2WBT A;  2EOO A;  2EN2 A;  1X6E A;  2EMK A;  2EM3 A;  1X6F A;  2EE8 A;  5KL2 A;  2JP9 A;  2EOQ A;  4R2R A;  2J7J A;  1YUJ A;  2EOI A;  2EN3 A;  2YU8 A;  1JK2 A;  1JK1 A;  2YTE A;  4R2E A;  2EM9 A;  2I13 A;  1KJK A;  1A1J A;  3EPL A;  1TF3 A;  4F2J C;  1P47 A;  4WSG A;  2MDG A;  1BBO A;  3UK3 C;  4R2A A;  2YSP A;  2YTO A;  2DRP A;  2EM5 A;  4IJD A;  2WCC 3;  1B69 A;  1TF6 A;  5KL3 A;  2EOM A;  1NCS A;  2EMI A;  1Z1B A;  2EOH A;  1A1I A;  2YRM A;  2LV2 A;  2MKD A;  2EM4 A;  2EPA A;  4IS1 C;  1WJP A;  2VRD A;  2ENH A;  2CSH A;  2EMY A;  2EN7 A;  3MHS C;  4F6M A;  2EL6 A;  2EPP A;  2EP3 A;  1BB8 A;  2MKN A;  2EM2 A;  2EN1 A;  2WBU A;  2EOJ A;  3M99 B;  1LLM C;  2LCE A;  2DLK A;  1G2D C;  2EMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...