1A1IA

Radr (zif268 variant) zinc finger-dna complex (gcac site)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
85
structure length
85
Chain Sequence
RPYACPVESCDRRFSRSADLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*AP*C)-3')
total genus 27
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1iA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1iA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1iA03
1ZR9A 4F6NA 4R2PA 2YTDA 2ENHA 4IJDA 2YRHA 2YTGA 2EN4A 1ZAAC 2EP3A 5KL5A 1G2DC 1UBDC 2EPAA 3MHSC 2ELYA 2WBSA 2EMIA 1F2IG 1NCSA 1UN6B 1MEYC 2YTFA 3EPJA 1ZU1A 2EMWA 2EMBA 2LV2A 2EMGA 3M99B 2PRTA 1YUJA 2RPCA 2DLKA 5KL3A 1X6HA 2YSOA 4R2AA 2EQ1A 2YSPA 4M9VC 1KJKA 2YTOA 2YTNA 2D9HA 1G2FC 1WJPA 2EMKA 2EMXA 5KL2A 2EN8A 2I13A 2EPPA 2LCEA 5KL7A 2DLQA 1Z1BA 4F2JC 2EPRA 4R2DA 2EOEA 2YRKA 2EMZA 4R2QA 2EL5A 1JK2A 2YTEA 2EMFA 2EOJA 2YU5A 2EPZA 1TF3A 2YU8A 2YTQA 1X5WA 2EM9A 1RMDA 2MKDA 3MHHC 4WSGA 5KL6A 1YSAC 2CT1A 4X9JA 2EM0A 2EN2A 3UK3C 2DGCA 2EM4A 4IS1C 2EMLA 2R1FA 2EOFA 4R2SA 2MKNA 2ELZA 2EORA 4R2EA 2EMCA 1BB8A 2EE8A 2EJ4A 2J7JA 2DRPA 4FK5C 2ENAA 2EMYA 1A1HA 2WBTA 1AAYA 2HGHA 1A1KA 2EOSA 4GZNC 2EOZA 4R2RA 2EOYA 2EQ0A 2EPUA 5KL4A 2EQ3A 1TF6A 2DMIA 2LT7A 1X6FA 2RSIA 3VHTB 2EPCA 2YTPA 1DGCA 2YTIA 2EN1A 2EM5A 2EM6A 2JP9A 4R2CA 2JPAA 1A1JA 2M9AA 2WCC3 2ADRA 2EM7A 1A1LA 4F6MA 2EOOA 1X3CA 1P47A 2EM2A 1BBOA 2EL4A 3EPLA 2YTJA 3EPKA 2BB8A 1TN9A 2E72A 2EL6A 2EPXA 2EOIA 2EMHA 1JK1A 2EOHA 2GHFA 2A25A 2EOMA 2EMAA 2YRMA 1A1GA 1LLMC 2CSHA 2EN6A 1YUIA 2EM3A 1A1FA 2MDGA 2EOXA 2LO3A 1A1IA 2NABA 3EPHA 2GLIA 1X6EA 2EOQA 2EM8A 2CTDA 2EN3A 2VRDA 2EN7A 2LVHA 2WBUA 2ENCA 1B69A
chains in the Genus database with same CATH superfamily
1ZR9A 4F6NA 2NUGA 2YTDA 1T38A 5AASA 3HPSA 3J81C 4RH8A 1G2DC 4K0KE 4P7DA 2WBSA 1F2IG 1IBLE 2LJHA 1NCSA 4WX9A 4F54A 3EPJA 4BBYA 2LJUA 3VYYA 4X62E 1J26A 2EMGA 2PRTA 2LUQA 2RPCA 4ZYDA 2DLKA 1BBGA 1X6HA 2YSOA 2V86A 1XNQE 4F9BB 2YTOA 5AE1A 2D9HA 4JI6E 1WJPA 4NXME 2EPPA 4GEQB 4RHBB 2EOEA 4DV3E 1WXRA 2ZM6E 1N33E 5AC5A 4HTGA 2K4VA 4R2QA 4NZVA 2EL5A 2L92A 2EMFA 3K6QA 2EPZA 3LMLA 2YTQA 5FLXC 3BF2A 1O0WA 3ADGA 3MHHC 4WYQB 2RQLA 5KL6A 4N4RB 2JOXA 1FJGE 5IWAE 2EM0A 1N36E 2YT4A 5LMUE 4R03A 3JAMC 4DR6E 1GZ6A 3ADLA 5BR8E 1XNRE 2ELZA 2EORA 4F9AB 4JI7E 3VK6A 2WZOA 1SFEA 2EJ4A 2V88A 2DRPA 2EMYA 1A1KA 1PJTA 2EOZA 3RMPA 2GPIA 2DB2A 2LTRA 2EPCA 4WFTA 3IWCA 3ZOQB 1HNZE 2FV4B 2YTIA 4DR3E 4DR7E 2EM5A 4WXCA 2M9AA 1EH8A 1I94E 4BC7A 2EZ6A 3DJWA 4LF9E 1NEIA 4F6MA 2LMZA 4LFBE 2EPMX 4KWYA 3EPKA 3KZYA 3THOB 2JWOA 3J7AG 5AE3A 2B7VA 1FKAE 1T4NA 2EOHA 2A25A 3C6KA 1LLMC 1YUIA 1HR0E 2MDGA 4Q28A 1N32E 4DV0E 1DI2A 1T4OA 2NABA 2HHHE 1X6EA 2EN3A 5LMNE 4B3TE 1B69A 3BGHA 5F3WA 1YYKA 1SR9A 1ZAAC 2EN4A 2EP3A 4DR5E 5A6BD 2MC6A 2ODRC 3KZZA 1UBDC 2EPAA 3T1YE 1MEYC 2YTFA 1ZU1A 2EMWA 1UHZA 2LV2A 2I9IA 2EWLA 4R2AA 2EQ1A 5T6JA 1KJKA 4JYAE 5TSEA 4DKKA 2F8BA 2YTNA 1YZ9A 2DLQA 1Z1BA 4R2DA 1EH6A 2EMZA 3AV0A 1JK2A 4DV2E 3JU0A 1TF3A 5A6BA 5A6KA 1X5WA 4J8ZA 3KWRA 1PJQA 1IBME 1RMDA 2UXBE 3H09A 3C4TA 1YSAC 4KZSA 2R76A 2M7QA 3IWDA 3P1XA 1RQ0A 2N3GA 2ODRD 2DGCA 2RSMA 3MSWA 1UILA 4DV5E 2B7TA 2EMLA 5IV8B 2R1FA 2EOFA 4JI5E 2LUPB 1GQEA 2EE8A 4O5GA 2JYAA 2J7JA 3HPZA 4X65E 4TUGA 2HGHA 3FIGA 1XMQE 4GZNC 3DF6A 2M4IA 4P78A 2N3HA 2EOYA 4JI1E 5KL4A 2EQ3A 2DMIA 2LT7A 2JY9A 1DGCA 4DV7E 2EN1A 2JP9A 2V83A 4LU9A 4ZYGA 1J5EE 4BS9A 2WCC3 1QNTA 2ADRA 1P47A 2EM2A 2EL4A 2L3CA 1YPNA 4NXNE 4LF5E 2NA2A 2F4VE 1TN9A 5ADZA 1QU6A 2EOIA 2EMHA 1N3GA 2LTSA 4JI8E 5A2QC 3F6HA 2YRMA 5DNYA 2CSHA 4BC9A 1YFHA 5A6AA 1A1FA 4DUYE 4X8WA 1A1IA 1STUA 2NUEA 2G7HA 3THNA 1IMUA 2EM8A 2CTDA 2VRDA 2EN7A 4BHCA 2LVHA 4DR2E 2VQFE 2ENHA 3HXLA 2KONA 2YRHA 4LFCE 4M0VA 5KL5A 2ELYA 4B3ME 1UN6B 2L2NA 2EPKX 2UUBE 1YUJA 4M2ZA 4X66E 4GKKE 5KL3A 1XMOE 2YSPA 2M1SA 5LL6R 5KL2A 2EMKA 2EMXA 2JR1A 3QG5C 2EN8A 4M30A 1IBKE 2I13A 2UXDE 4OX9E 5KL7A 4F2JC 1EKZA 2E1MA 4WXDA 1ZBQA 4OOGC 4Q35B 4MLQA 1KYQA 3T1HE 3EQ1A 2YTEA 2EOJA 3OMLA 2YU8A 3AUZA 3ECRA 4AQYE 2RS6A 4WSGA 4BMJA 2CT1A 4X9JA 3BIDA 3UK3C 2UU9E 4IS1C 2YZTA 2LRSA 4DV6E 3ADJA 2MKNA 2VQEE 2EMCA 2E5LE 2B3TB 4FK5C 3ADIA 2EPLX 1AAYA 2WBTA 2DSYA 4L8NA 2KOUA 3IWBA 2V8QB 4R2RA 2EQ0A 2EPUA 4L5NC 1L4SA 1HNWE 2N8XA 2RSIA 2RS7A 1WRJA 2EPOA 4MLVA 4DMIA 2EM6A 4R2CA 4DR1E 1A1JA 4DV1E 4JI4E 2EM7A 2LBSB 2UUCE 1BBOA 4TUIA 3EPLA 1RC7A 4LF6E 2BB8A 2E72A 2EL6A 2H36X 1GTKA 2MDRA 4B3RE 4O24A 1JK1A 2GHFA 3HQ1A 4DR4E 3C4BA 1A1GA 5AE2A 3BBGA 2LO3A 4WPYA 3EPHA 2GLIA 2EOQA 3C6MA 2WBUA 1YYWA 1X47A 4I8OA 4R2PA 4IJDA 2YTGA 1HNXE 2HC5A 2VE7C 2YWQA 4HEIA 3J80C 3MHSC 2MC5A 2EMIA 2FGGA 2L8TA 1PJSA 1PKPA 2JOBA 2EMBA 4X64E 2L6MA 3M99B 2NUFA 3J7Yp 4B3SE 4M9VC 1EH7A 1WHNA 3JTZA 1G2FC 2LE2A 1T4LB 1DQ3A 2LCEA 5IXMB 4DUZE 2KHXA 2EPRA 2YRKA 5AC4A 4BHBA 2V87A 4O43A 1X48A 2UXCE 4JI0E 4YHHE 2YU5A 4LF4E 2K7IA 1T39A 2EM9A 2MKDA 5A69A 5IT9C 1WHQA 2V89A 4YY3E 2IHR1 2EN2A 2EM4A 4LFAE 2EPNA 2DIXA 2JXPA 4R2SA 1PDAA 4R2EA 5LLQA 1BB8A 3L00A 2ENAA 1A1HA 2YPNA 4JV5E 2EOSA 1IQSA 2Q8UA 2HJJA 5CFFE 3F6GA 4BCAA 3HTXA 1ZBTA 2JVAA 1AH5A 1TF6A 2DMYA 4LF8E 1X6FA 3VHTB 2YTPA 4O4KA 5A6JA 4F9CB 2CPNA 2L3JA 2JPAA 2V85A 1N34E 2L2KB 1MGTA 4R8OA 1A1LA 4LTYA 4NHRA 2EOOA 4JI2E 1X3CA 4ZYEA 2BBGA 2YTJA 4LF7E 1X49A 1YYOA 4DV4E 1IQOA 2RTXA 3TQMA 2EPXA 3VYXA 2B9DA 2UUAE 2FTXB 2EOMA 4JI3E 2EMAA 3OTOE 2EN6A 2EM3A 2EOXA 2VF1A 4ZYHA 4WSPA 4GKJE 3LLHA 4KHPE 2L33A 2L2MA 2ENCA
chains in the Genus database with same CATH topology
1ZR9A 4F6NA 4R2PA 2YTDA 2ENHA 4IJDA 2YRHA 2YTGA 2EN4A 1ZAAC 2EP3A 5KL5A 1G2DC 1UBDC 2EPAA 3MHSC 2ELYA 2WBSA 2EMIA 1F2IG 1NCSA 1UN6B 1MEYC 2YTFA 3EPJA 1ZU1A 2EMWA 2EMBA 2LV2A 2EMGA 3M99B 2PRTA 1YUJA 2RPCA 2DLKA 5KL3A 1X6HA 2YSOA 4R2AA 2EQ1A 2YSPA 4M9VC 1KJKA 2YTOA 2YTNA 2D9HA 1G2FC 1WJPA 2EMKA 2EMXA 5KL2A 2EN8A 2I13A 2EPPA 2LCEA 5KL7A 2DLQA 1Z1BA 4F2JC 2EPRA 4R2DA 2EOEA 2YRKA 2EMZA 4R2QA 2EL5A 1JK2A 2YTEA 2EMFA 2EOJA 2YU5A 2EPZA 1TF3A 2YU8A 2YTQA 1X5WA 2EM9A 1RMDA 2MKDA 3MHHC 4WSGA 5KL6A 1YSAC 2CT1A 4X9JA 2EM0A 2EN2A 3UK3C 2DGCA 2EM4A 4IS1C 2EMLA 2R1FA 2EOFA 4R2SA 2MKNA 2ELZA 2EORA 4R2EA 2EMCA 1BB8A 2EE8A 2EJ4A 2J7JA 2DRPA 4FK5C 2ENAA 2EMYA 1A1HA 2WBTA 1AAYA 2HGHA 1A1KA 2EOSA 4GZNC 2EOZA 4R2RA 2EOYA 2EQ0A 2EPUA 5KL4A 2EQ3A 1TF6A 2DMIA 2LT7A 1X6FA 2RSIA 3VHTB 2EPCA 2YTPA 1DGCA 2YTIA 2EN1A 2EM5A 2EM6A 2JP9A 4R2CA 2JPAA 1A1JA 2M9AA 2WCC3 2ADRA 2EM7A 1A1LA 4F6MA 2EOOA 1X3CA 1P47A 2EM2A 1BBOA 2EL4A 3EPLA 2YTJA 3EPKA 2BB8A 1TN9A 2E72A 2EL6A 2EPXA 2EOIA 2EMHA 1JK1A 2EOHA 2GHFA 2A25A 2EOMA 2EMAA 2YRMA 1A1GA 1LLMC 2CSHA 2EN6A 1YUIA 2EM3A 1A1FA 2MDGA 2EOXA 2LO3A 1A1IA 2NABA 3EPHA 2GLIA 1X6EA 2EOQA 2EM8A 2CTDA 2EN3A 2VRDA 2EN7A 2LVHA 2WBUA 2ENCA 1B69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZR9 A;  4F6N A;  4R2P A;  2YTD A;  2ENH A;  4IJD A;  2YRH A;  2YTG A;  2EN4 A;  1ZAA C;  2EP3 A;  5KL5 A;  1G2D C;  1UBD C;  2EPA A;  3MHS C;  2ELY A;  2WBS A;  2EMI A;  1F2I G;  1NCS A;  1UN6 B;  1MEY C;  2YTF A;  3EPJ A;  1ZU1 A;  2EMW A;  2EMB A;  2LV2 A;  2EMG A;  3M99 B;  2PRT A;  1YUJ A;  2RPC A;  2DLK A;  5KL3 A;  1X6H A;  2YSO A;  4R2A A;  2EQ1 A;  2YSP A;  4M9V C;  1KJK A;  2YTO A;  2YTN A;  2D9H A;  1G2F C;  1WJP A;  2EMK A;  2EMX A;  5KL2 A;  2EN8 A;  2I13 A;  2EPP A;  2LCE A;  5KL7 A;  2DLQ A;  1Z1B A;  4F2J C;  2EPR A;  4R2D A;  2EOE A;  2YRK A;  2EMZ A;  4R2Q A;  2EL5 A;  1JK2 A;  2YTE A;  2EMF A;  2EOJ A;  2YU5 A;  2EPZ A;  1TF3 A;  2YU8 A;  2YTQ A;  1X5W A;  2EM9 A;  1RMD A;  2MKD A;  3MHH C;  4WSG A;  5KL6 A;  1YSA C;  2CT1 A;  4X9J A;  2EM0 A;  2EN2 A;  3UK3 C;  2DGC A;  2EM4 A;  4IS1 C;  2EML A;  2R1F A;  2EOF A;  4R2S A;  2MKN A;  2ELZ A;  2EOR A;  4R2E A;  2EMC A;  1BB8 A;  2EE8 A;  2EJ4 A;  2J7J A;  2DRP A;  4FK5 C;  2ENA A;  2EMY A;  1A1H A;  2WBT A;  1AAY A;  2HGH A;  1A1K A;  2EOS A;  4GZN C;  2EOZ A;  4R2R A;  2EOY A;  2EQ0 A;  2EPU A;  5KL4 A;  2EQ3 A;  1TF6 A;  2DMI A;  2LT7 A;  1X6F A;  2RSI A;  3VHT B;  2EPC A;  2YTP A;  1DGC A;  2YTI A;  2EN1 A;  2EM5 A;  2EM6 A;  2JP9 A;  4R2C A;  2JPA A;  1A1J A;  2M9A A;  2WCC 3;  2ADR A;  2EM7 A;  1A1L A;  4F6M A;  2EOO A;  1X3C A;  1P47 A;  2EM2 A;  1BBO A;  2EL4 A;  3EPL A;  2YTJ A;  3EPK A;  2BB8 A;  1TN9 A;  2E72 A;  2EL6 A;  2EPX A;  2EOI A;  2EMH A;  1JK1 A;  2EOH A;  2GHF A;  2A25 A;  2EOM A;  2EMA A;  2YRM A;  1A1G A;  1LLM C;  2CSH A;  2EN6 A;  1YUI A;  2EM3 A;  1A1F A;  2MDG A;  2EOX A;  2LO3 A;  1A1I A;  2NAB A;  3EPH A;  2GLI A;  1X6E A;  2EOQ A;  2EM8 A;  2CTD A;  2EN3 A;  2VRD A;  2EN7 A;  2LVH A;  2WBU A;  2ENC A;  1B69 A; 
#chains in the Genus database with same CATH topology
 1ZR9 A;  4F6N A;  2NUG A;  2YTD A;  1T38 A;  5AAS A;  3HPS A;  3J81 C;  4RH8 A;  1G2D C;  4K0K E;  4P7D A;  2WBS A;  1F2I G;  1IBL E;  2LJH A;  1NCS A;  4WX9 A;  4F54 A;  3EPJ A;  4BBY A;  2LJU A;  3VYY A;  4X62 E;  1J26 A;  2EMG A;  2PRT A;  2LUQ A;  2RPC A;  4ZYD A;  2DLK A;  1BBG A;  1X6H A;  2YSO A;  2V86 A;  1XNQ E;  4F9B B;  2YTO A;  5AE1 A;  2D9H A;  4JI6 E;  1WJP A;  4NXM E;  2EPP A;  4GEQ B;  4RHB B;  2EOE A;  4DV3 E;  1WXR A;  2ZM6 E;  1N33 E;  5AC5 A;  4HTG A;  2K4V A;  4R2Q A;  4NZV A;  2EL5 A;  2L92 A;  2EMF A;  3K6Q A;  2EPZ A;  3LML A;  2YTQ A;  5FLX C;  3BF2 A;  1O0W A;  3ADG A;  3MHH C;  4WYQ B;  2RQL A;  5KL6 A;  4N4R B;  2JOX A;  1FJG E;  5IWA E;  2EM0 A;  1N36 E;  2YT4 A;  5LMU E;  4R03 A;  3JAM C;  4DR6 E;  1GZ6 A;  3ADL A;  5BR8 E;  1XNR E;  2ELZ A;  2EOR A;  4F9A B;  4JI7 E;  3VK6 A;  2WZO A;  1SFE A;  2EJ4 A;  2V88 A;  2DRP A;  2EMY A;  1A1K A;  1PJT A;  2EOZ A;  3RMP A;  2GPI A;  2DB2 A;  2LTR A;  2EPC A;  4WFT A;  3IWC A;  3ZOQ B;  1HNZ E;  2FV4 B;  2YTI A;  4DR3 E;  4DR7 E;  2EM5 A;  4WXC A;  2M9A A;  1EH8 A;  1I94 E;  4BC7 A;  2EZ6 A;  3DJW A;  4LF9 E;  1NEI A;  4F6M A;  2LMZ A;  4LFB E;  2EPM X;  4KWY A;  3EPK A;  3KZY A;  3THO B;  2JWO A;  3J7A G;  5AE3 A;  2B7V A;  1FKA E;  1T4N A;  2EOH A;  2A25 A;  3C6K A;  1LLM C;  1YUI A;  1HR0 E;  2MDG A;  4Q28 A;  1N32 E;  4DV0 E;  1DI2 A;  1T4O A;  2NAB A;  2HHH E;  1X6E A;  2EN3 A;  5LMN E;  4B3T E;  1B69 A;  3BGH A;  5F3W A;  1YYK A;  1SR9 A;  1ZAA C;  2EN4 A;  2EP3 A;  4DR5 E;  5A6B D;  2MC6 A;  2ODR C;  3KZZ A;  1UBD C;  2EPA A;  3T1Y E;  1MEY C;  2YTF A;  1ZU1 A;  2EMW A;  1UHZ A;  2LV2 A;  2I9I A;  2EWL A;  4R2A A;  2EQ1 A;  5T6J A;  1KJK A;  4JYA E;  5TSE A;  4DKK A;  2F8B A;  2YTN A;  1YZ9 A;  2DLQ A;  1Z1B A;  4R2D A;  1EH6 A;  2EMZ A;  3AV0 A;  1JK2 A;  4DV2 E;  3JU0 A;  1TF3 A;  5A6B A;  5A6K A;  1X5W A;  4J8Z A;  3KWR A;  1PJQ A;  1IBM E;  1RMD A;  2UXB E;  3H09 A;  3C4T A;  1YSA C;  4KZS A;  2R76 A;  2M7Q A;  3IWD A;  3P1X A;  1RQ0 A;  2N3G A;  2ODR D;  2DGC A;  2RSM A;  3MSW A;  1UIL A;  4DV5 E;  2B7T A;  2EML A;  5IV8 B;  2R1F A;  2EOF A;  4JI5 E;  2LUP B;  1GQE A;  2EE8 A;  4O5G A;  2JYA A;  2J7J A;  3HPZ A;  4X65 E;  4TUG A;  2HGH A;  3FIG A;  1XMQ E;  4GZN C;  3DF6 A;  2M4I A;  4P78 A;  2N3H A;  2EOY A;  4JI1 E;  5KL4 A;  2EQ3 A;  2DMI A;  2LT7 A;  2JY9 A;  1DGC A;  4DV7 E;  2EN1 A;  2JP9 A;  2V83 A;  4LU9 A;  4ZYG A;  1J5E E;  4BS9 A;  2WCC 3;  1QNT A;  2ADR A;  1P47 A;  2EM2 A;  2EL4 A;  2L3C A;  1YPN A;  4NXN E;  4LF5 E;  2NA2 A;  2F4V E;  1TN9 A;  5ADZ A;  1QU6 A;  2EOI A;  2EMH A;  1N3G A;  2LTS A;  4JI8 E;  5A2Q C;  3F6H A;  2YRM A;  5DNY A;  2CSH A;  4BC9 A;  1YFH A;  5A6A A;  1A1F A;  4DUY E;  4X8W A;  1A1I A;  1STU A;  2NUE A;  2G7H A;  3THN A;  1IMU A;  2EM8 A;  2CTD A;  2VRD A;  2EN7 A;  4BHC A;  2LVH A;  4DR2 E;  2VQF E;  2ENH A;  3HXL A;  2KON A;  2YRH A;  4LFC E;  4M0V A;  5KL5 A;  2ELY A;  4B3M E;  1UN6 B;  2L2N A;  2EPK X;  2UUB E;  1YUJ A;  4M2Z A;  4X66 E;  4GKK E;  5KL3 A;  1XMO E;  2YSP A;  2M1S A;  5LL6 R;  5KL2 A;  2EMK A;  2EMX A;  2JR1 A;  3QG5 C;  2EN8 A;  4M30 A;  1IBK E;  2I13 A;  2UXD E;  4OX9 E;  5KL7 A;  4F2J C;  1EKZ A;  2E1M A;  4WXD A;  1ZBQ A;  4OOG C;  4Q35 B;  4MLQ A;  1KYQ A;  3T1H E;  3EQ1 A;  2YTE A;  2EOJ A;  3OML A;  2YU8 A;  3AUZ A;  3ECR A;  4AQY E;  2RS6 A;  4WSG A;  4BMJ A;  2CT1 A;  4X9J A;  3BID A;  3UK3 C;  2UU9 E;  4IS1 C;  2YZT A;  2LRS A;  4DV6 E;  3ADJ A;  2MKN A;  2VQE E;  2EMC A;  2E5L E;  2B3T B;  4FK5 C;  3ADI A;  2EPL X;  1AAY A;  2WBT A;  2DSY A;  4L8N A;  2KOU A;  3IWB A;  2V8Q B;  4R2R A;  2EQ0 A;  2EPU A;  4L5N C;  1L4S A;  1HNW E;  2N8X A;  2RSI A;  2RS7 A;  1WRJ A;  2EPO A;  4MLV A;  4DMI A;  2EM6 A;  4R2C A;  4DR1 E;  1A1J A;  4DV1 E;  4JI4 E;  2EM7 A;  2LBS B;  2UUC E;  1BBO A;  4TUI A;  3EPL A;  1RC7 A;  4LF6 E;  2BB8 A;  2E72 A;  2EL6 A;  2H36 X;  1GTK A;  2MDR A;  4B3R E;  4O24 A;  1JK1 A;  2GHF A;  3HQ1 A;  4DR4 E;  3C4B A;  1A1G A;  5AE2 A;  3BBG A;  2LO3 A;  4WPY A;  3EPH A;  2GLI A;  2EOQ A;  3C6M A;  2WBU A;  1YYW A;  1X47 A;  4I8O A;  4R2P A;  4IJD A;  2YTG A;  1HNX E;  2HC5 A;  2VE7 C;  2YWQ A;  4HEI A;  3J80 C;  3MHS C;  2MC5 A;  2EMI A;  2FGG A;  2L8T A;  1PJS A;  1PKP A;  2JOB A;  2EMB A;  4X64 E;  2L6M A;  3M99 B;  2NUF A;  3J7Y p;  4B3S E;  4M9V C;  1EH7 A;  1WHN A;  3JTZ A;  1G2F C;  2LE2 A;  1T4L B;  1DQ3 A;  2LCE A;  5IXM B;  4DUZ E;  2KHX A;  2EPR A;  2YRK A;  5AC4 A;  4BHB A;  2V87 A;  4O43 A;  1X48 A;  2UXC E;  4JI0 E;  4YHH E;  2YU5 A;  4LF4 E;  2K7I A;  1T39 A;  2EM9 A;  2MKD A;  5A69 A;  5IT9 C;  1WHQ A;  2V89 A;  4YY3 E;  2IHR 1;  2EN2 A;  2EM4 A;  4LFA E;  2EPN A;  2DIX A;  2JXP A;  4R2S A;  1PDA A;  4R2E A;  5LLQ A;  1BB8 A;  3L00 A;  2ENA A;  1A1H A;  2YPN A;  4JV5 E;  2EOS A;  1IQS A;  2Q8U A;  2HJJ A;  5CFF E;  3F6G A;  4BCA A;  3HTX A;  1ZBT A;  2JVA A;  1AH5 A;  1TF6 A;  2DMY A;  4LF8 E;  1X6F A;  3VHT B;  2YTP A;  4O4K A;  5A6J A;  4F9C B;  2CPN A;  2L3J A;  2JPA A;  2V85 A;  1N34 E;  2L2K B;  1MGT A;  4R8O A;  1A1L A;  4LTY A;  4NHR A;  2EOO A;  4JI2 E;  1X3C A;  4ZYE A;  2BBG A;  2YTJ A;  4LF7 E;  1X49 A;  1YYO A;  4DV4 E;  1IQO A;  2RTX A;  3TQM A;  2EPX A;  3VYX A;  2B9D A;  2UUA E;  2FTX B;  2EOM A;  4JI3 E;  2EMA A;  3OTO E;  2EN6 A;  2EM3 A;  2EOX A;  2VF1 A;  4ZYH A;  4WSP A;  4GKJ E;  3LLH A;  4KHP E;  2L33 A;  2L2M A;  2ENC A; 
#chains in the Genus database with same CATH homology
 1ZR9 A;  4F6N A;  4R2P A;  2YTD A;  2ENH A;  4IJD A;  2YRH A;  2YTG A;  2EN4 A;  1ZAA C;  2EP3 A;  5KL5 A;  1G2D C;  1UBD C;  2EPA A;  3MHS C;  2ELY A;  2WBS A;  2EMI A;  1F2I G;  1NCS A;  1UN6 B;  1MEY C;  2YTF A;  3EPJ A;  1ZU1 A;  2EMW A;  2EMB A;  2LV2 A;  2EMG A;  3M99 B;  2PRT A;  1YUJ A;  2RPC A;  2DLK A;  5KL3 A;  1X6H A;  2YSO A;  4R2A A;  2EQ1 A;  2YSP A;  4M9V C;  1KJK A;  2YTO A;  2YTN A;  2D9H A;  1G2F C;  1WJP A;  2EMK A;  2EMX A;  5KL2 A;  2EN8 A;  2I13 A;  2EPP A;  2LCE A;  5KL7 A;  2DLQ A;  1Z1B A;  4F2J C;  2EPR A;  4R2D A;  2EOE A;  2YRK A;  2EMZ A;  4R2Q A;  2EL5 A;  1JK2 A;  2YTE A;  2EMF A;  2EOJ A;  2YU5 A;  2EPZ A;  1TF3 A;  2YU8 A;  2YTQ A;  1X5W A;  2EM9 A;  1RMD A;  2MKD A;  3MHH C;  4WSG A;  5KL6 A;  1YSA C;  2CT1 A;  4X9J A;  2EM0 A;  2EN2 A;  3UK3 C;  2DGC A;  2EM4 A;  4IS1 C;  2EML A;  2R1F A;  2EOF A;  4R2S A;  2MKN A;  2ELZ A;  2EOR A;  4R2E A;  2EMC A;  1BB8 A;  2EE8 A;  2EJ4 A;  2J7J A;  2DRP A;  4FK5 C;  2ENA A;  2EMY A;  1A1H A;  2WBT A;  1AAY A;  2HGH A;  1A1K A;  2EOS A;  4GZN C;  2EOZ A;  4R2R A;  2EOY A;  2EQ0 A;  2EPU A;  5KL4 A;  2EQ3 A;  1TF6 A;  2DMI A;  2LT7 A;  1X6F A;  2RSI A;  3VHT B;  2EPC A;  2YTP A;  1DGC A;  2YTI A;  2EN1 A;  2EM5 A;  2EM6 A;  2JP9 A;  4R2C A;  2JPA A;  1A1J A;  2M9A A;  2WCC 3;  2ADR A;  2EM7 A;  1A1L A;  4F6M A;  2EOO A;  1X3C A;  1P47 A;  2EM2 A;  1BBO A;  2EL4 A;  3EPL A;  2YTJ A;  3EPK A;  2BB8 A;  1TN9 A;  2E72 A;  2EL6 A;  2EPX A;  2EOI A;  2EMH A;  1JK1 A;  2EOH A;  2GHF A;  2A25 A;  2EOM A;  2EMA A;  2YRM A;  1A1G A;  1LLM C;  2CSH A;  2EN6 A;  1YUI A;  2EM3 A;  1A1F A;  2MDG A;  2EOX A;  2LO3 A;  1A1I A;  2NAB A;  3EPH A;  2GLI A;  1X6E A;  2EOQ A;  2EM8 A;  2CTD A;  2EN3 A;  2VRD A;  2EN7 A;  2LVH A;  2WBU A;  2ENC A;  1B69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...