1A1IA

Radr (zif268 variant) zinc finger-dna complex (gcac site)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
85
structure length
85
Chain Sequence
RPYACPVESCDRRFSRSADLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*AP*C)-3')
publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 27
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1iA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1iA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1iA03
4R2QA 2EMHA 1A1GA 2EOIA 2EMAA 1YUJA 4M9VC 2EM5A 2MDGA 4R2SA 4R2AA 2ADRA 2ENAA 2EMZA 2EMWA 2EOSA 2LCEA 3VHTB 2EMGA 2CTDA 2EN4A 2YRKA 1ZAAC 2ENHA 1YSAC 2EOXA 4F6MA 2EMFA 2ELZA 1A1KA 2JP9A 1TF3A 2EOOA 2EL4A 1A1LA 4IJDA 2EN3A 2PRTA 2WBTA 1JK2A 2EN2A 2CSHA 2EQ0A 2EP3A 4R2PA 2JPAA 1A1HA 2EPPA 4X9JA 1X6HA 2ELYA 2VRDA 3MHSC 1JK1A 2EMKA 2BB8A 1MEYC 2YU8A 2YTIA 2YTPA 2EOQA 2LT7A 2EMBA 1TF6A 1RMDA 2EOFA 2EPRA 2ENCA 1P47A 2DMIA 4FK5C 1TN9A 1LLMC 2NABA 4IS1C 4R2RA 2EJ4A 2M9AA 2DLQA 2RPCA 2EMCA 2YTFA 2EM6A 4R2EA 5KL6A 2EPUA 2EMXA 2EMIA 2EM7A 2EORA 2YRHA 2WBUA 2YTEA 4WSGA 4F2JC 1X6EA 3EPHA 2EM0A 2YTJA 2YSPA 2EM9A 2E72A 2J7JA 2EOJA 2DRPA 2YTOA 1UBDC 2YTDA 2YTNA 2EQ1A 2MKNA 1A1IA 2EOYA 2EPXA 1AAYA 1G2FC 2WCC3 2EPZA 1A1FA 1UN6B 1X3CA 1B69A 2EMYA 1NCSA 2EOHA 1WJPA 2YSOA 5KL4A 2EMLA 2EOMA 2EOZA 4GZNC 1BBOA 5KL5A 2EN6A 2YU5A 2D9HA 2GHFA 2EPAA 1ZR9A 2WBSA 2A25A 1X5WA 2R1FA 1A1JA 2EN1A 1Z1BA 3EPKA 2YRMA 2DLKA 2EN7A 2LVHA 3EPLA 2EM4A 1DGCA 4R2CA 2CT1A 4F6NA 2EE8A 2RSIA 2EPCA 2LV2A 5KL3A 1YUIA 2DGCA 1KJKA 1G2DC 2YTGA 2HGHA 4R2DA 1X6FA 2EL6A 2LO3A 3MHHC 2GLIA 1F2IG 2EOEA 2I13A 2EL5A 3EPJA 5KL7A 2EM3A 2EQ3A 2EM8A 1BB8A 5KL2A 2EN8A 1ZU1A 3M99B 2YTQA 2MKDA 2EM2A 3UK3C
chains in the Genus database with same CATH superfamily
2KONA 4R2QA 1YZ9A 2JR1A 4NZVA 2NUGA 2L6MA 3DF6A 2L2MA 5AC4A 2E1MA 1DQ3A 1EH7A 4R2SA 4DKKA 4R2AA 3VYYA 3BF2A 1HNWE 2EMZA 2EMWA 3VHTB 2EMGA 2EN4A 5LMUE 2I9IA 2YRKA 2EPKX 1XNQE 4F6MA 3F6HA 2EMFA 2LE2A 2ELZA 2LRSA 2EOOA 3ADIA 2NA2A 4LF5E 2JOXA 3BGHA 5A6AA 3T1HE 1A1HA 4NXME 2V86A 4TUGA 4JYAE 3ECRA 5IWAE 1IQSA 4O4KA 2F4VE 1EKZA 5LL6R 4NHRA 1RMDA 5A6BD 2ENCA 1T4LB 5AE2A 1FJGE 5A6JA 4P7DA 5LLQA 2DB2A 4F54A 5AC5A 5ADZA 3K6QA 5T6JA 2EMCA 5TSEA 4YY3E 2HC5A 3JTZA 1NEIA 2YTEA 4DR1E 1WRJA 1X6EA 1T39A 3EPHA 1ZBTA 2YTJA 4ZYGA 1IBME 2EZ6A 2EM9A 1PKPA 4DUZE 2EOJA 3JU0A 1A1IA 2EPXA 4B3TE 1A1FA 1B69A 2EOHA 1J26A 1WJPA 3TQMA 3P1XA 2YSOA 5KL4A 2EOMA 1BBOA 2M4IA 2L2KB 4ZYEA 1KYQA 2LUQA 2A25A 2R1FA 1UILA 2EN1A 3KWRA 2EN7A 1PJSA 4R2CA 3LMLA 3C4BA 3EQ1A 2EPNA 2DGCA 1G2DC 1X6FA 2LO3A 1XNRE 2EOEA 2FTXB 3EPJA 1GZ6A 1BB8A 2B7TA 3MSWA 3M99B 4GKJE 2MDRA 2EM2A 3JAMC 3UK3C 2UXDE 1SFEA 2EMHA 2YZTA 4R8OA 2B9DA 3C6MA 2K4VA 1HNZE 3BIDA 4X65E 2JY9A 4M9VC 4BC9A 4O24A 4P78A 3HPSA 2ZM6E 1A1KA 1FKAE 2HHHE 4MLVA 4IJDA 2EN3A 4F9BB 2WBTA 4ZYHA 2PRTA 2EN2A 2VQEE 2EP3A 3ZOQB 4LF7E 2N8XA 2LTSA 5F3WA 2VRDA 2L92A 2BB8A 4JI0E 2UU9E 2YTIA 2L3CA 4B3ME 2EOQA 2LT7A 4JI4E 4BMJA 1IQOA 2LMZA 2EPRA 1MGTA 3H09A 1TN9A 4B3SE 5A6BA 4X62E 3J7Yp 4LFBE 2LUPB 5LMNE 2FV4B 2EPUA 2EMXA 5KL6A 2EM7A 2EORA 4F2JC 4DR7E 2RTXA 3RMPA 4JI5E 4Q35B 2E72A 2DRPA 1X47A 2YTDA 3VYXA 1T4NA 1WHQA 4M2ZA 3THNA 4JI1E 2YT4A 3IWDA 1X48A 2MKNA 1YYWA 2WZOA 4AQYE 4J8ZA 5A69A 1YYKA 3J7AG 2EMYA 1I94E 1NCSA 2F8BA 2EMLA 2EOZA 4JI6E 2EN6A 2YU5A 4O43A 2EPAA 2VF1A 2DSYA 2NUEA 2YRMA 2G7HA 3IWBA 4LTYA 3HPZA 2EPCA 5KL3A 4K0KE 1GQEA 2JXPA 4X64E 1STUA 4BBYA 2L3JA 1N3GA 2I13A 4DV0E 4DR3E 5BR8E 2UXCE 2V85A 2KHXA 1GTKA 5KL7A 1PDAA 4DV5E 1ZU1A 2YTQA 4LFCE 4KZSA 2MKDA 2VQFE 1QU6A 4TUIA 1N34E 1MEYC 1UHZA 1A1GA 2EOIA 3KZYA 3KZZA 4WXCA 1XMQE 2JWOA 2ADRA 2EOSA 5DNYA 1IMUA 3DJWA 1ZAAC 2ENHA 2R76A 2IHR1 1DI2A 1O0WA 1A1LA 2CSHA 2MC5A 4R2PA 2JPAA 2JYAA 2EPPA 1PJTA 2GPIA 4DV2E 1L4SA 3HTXA 2K7IA 4GEQB 1HNXE 1X6HA 2ELYA 1JK1A 2UXBE 2EMKA 2V83A 5CFFE 2KOUA 2YTPA 3IWCA 4LU9A 2N3HA 3VK6A 2EPOA 4JI2E 2LTRA 4F9CB 4HTGA 2DMIA 2M1SA 4L8NA 4DR2E 2B3TB 4M0VA 4R2RA 4DR5E 2DLQA 2YTFA 3HXLA 4BS9A 4RHBB 5A2QC 2HJJA 1PJQA 2JVAA 4WSGA 4DMIA 4DV4E 2RS6A 3C6KA 2EM0A 3BBGA 2LJHA 2DMYA 2CPNA 4DV3E 4N4RB 4B3RE 2EQ1A 2EWLA 2EOYA 2YPNA 1AAYA 1T4OA 1G2FC 2WCC3 2EPZA 4BCAA 1UN6B 1X49A 4LFAE 5A6KA 1X3CA 3HQ1A 5IT9C 1EH6A 2ODRC 4R03A 4DV7E 5KL5A 2GHFA 1T38A 4BC7A 4KWYA 1X5WA 5IV8B 1A1JA 4DV1E 1Z1BA 1RC7A 3EPKA 2DLKA 2LVHA 1ZBQA 5AASA 2H36X 4F6NA 1YFHA 1SR9A 2RSIA 2LV2A 2YWQA 4LF4E 1KJKA 2YTGA 3OTOE 2B7VA 3QG5C 2UUAE 2EL6A 2GLIA 1F2IG 1YYOA 2EL5A 1IBLE 2EM3A 3ADLA 2EM8A 2EN8A 2UUCE 4ZYDA 2FGGA 1XMOE 4JV5E 2UUBE 2LBSB 2ODRD 4LF8E 4Q28A 2EMAA 1QNTA 4WX9A 1YUJA 5AE1A 1WXRA 3FIGA 2EM5A 2MDGA 2EPMX 2ENAA 2LCEA 2Q8UA 2CTDA 2V89A 1YSAC 2EOXA 2JP9A 1TF3A 2DIXA 4GKKE 2EL4A 1JK2A 2EQ0A 4DUYE 1J5EE 4WYQB 4DV6E 2EPLX 4X9JA 3F6GA 3MHSC 1N32E 5FLXC 2RS7A 3OMLA 2YU8A 5IXMB 2EMBA 3THOB 1TF6A 2EOFA 4X66E 1P47A 4RH8A 4FK5C 2V87A 4X8WA 2NABA 3J80C 4IS1C 4WSPA 1LLMC 2EJ4A 1IBKE 4JI8E 2M9AA 2M7QA 2RPCA 3C4TA 2EM6A 4R2EA 4BHBA 3J81C 2EMIA 4MLQA 2YRHA 2WBUA 4LF9E 4F9AB 4M30A 4I8OA 2YSPA 3AV0A 4YHHE 2J7JA 2L33A 3ADGA 1RQ0A 2YTOA 4LF6E 2RQLA 1UBDC 2YTNA 4JI7E 2VE7C 3T1YE 2V8QB 4L5NC 3AUZA 2NUFA 2L8TA 1HR0E 1N36E 4GZNC 1AH5A 4WFTA 1N33E 3L00A 4BHCA 2D9HA 4JI3E 4KHPE 1ZR9A 4NXNE 2WBSA 2RSMA 1YPNA 3EPLA 2L2NA 2EM4A 1DGCA 2CT1A 3LLHA 2EE8A 2E5LE 1EH8A 1BBGA 1YUIA 4WXDA 2LJUA 4DR4E 4HEIA 2HGHA 2JOBA 3ADJA 4R2DA 3MHHC 4OOGC 4DR6E 2BBGA 4O5GA 2EQ3A 5KL2A 4OX9E 2N3GA 4WPYA 2MC6A 1WHNA 2V88A 5AE3A
chains in the Genus database with same CATH topology
4R2QA 2EMHA 1A1GA 2EOIA 2EMAA 1YUJA 4M9VC 2EM5A 2MDGA 4R2SA 4R2AA 2ADRA 2ENAA 2EMZA 2EMWA 2EOSA 2LCEA 3VHTB 2EMGA 2CTDA 2EN4A 2YRKA 1ZAAC 2ENHA 1YSAC 2EOXA 4F6MA 2EMFA 2ELZA 1A1KA 2JP9A 1TF3A 2EOOA 2EL4A 1A1LA 4IJDA 2EN3A 2PRTA 2WBTA 1JK2A 2EN2A 2CSHA 2EQ0A 2EP3A 4R2PA 2JPAA 1A1HA 2EPPA 4X9JA 1X6HA 2ELYA 2VRDA 3MHSC 1JK1A 2EMKA 2BB8A 1MEYC 2YU8A 2YTIA 2YTPA 2EOQA 2LT7A 2EMBA 1TF6A 1RMDA 2EOFA 2EPRA 2ENCA 1P47A 2DMIA 4FK5C 1TN9A 1LLMC 2NABA 4IS1C 4R2RA 2EJ4A 2M9AA 2DLQA 2RPCA 2EMCA 2YTFA 2EM6A 4R2EA 5KL6A 2EPUA 2EMXA 2EMIA 2EM7A 2EORA 2YRHA 2WBUA 2YTEA 4WSGA 4F2JC 1X6EA 3EPHA 2EM0A 2YTJA 2YSPA 2EM9A 2E72A 2J7JA 2EOJA 2DRPA 2YTOA 1UBDC 2YTDA 2YTNA 2EQ1A 2MKNA 1A1IA 2EOYA 2EPXA 1AAYA 1G2FC 2WCC3 2EPZA 1A1FA 1UN6B 1X3CA 1B69A 2EMYA 1NCSA 2EOHA 1WJPA 2YSOA 5KL4A 2EMLA 2EOMA 2EOZA 4GZNC 1BBOA 5KL5A 2EN6A 2YU5A 2D9HA 2GHFA 2EPAA 1ZR9A 2WBSA 2A25A 1X5WA 2R1FA 1A1JA 2EN1A 1Z1BA 3EPKA 2YRMA 2DLKA 2EN7A 2LVHA 3EPLA 2EM4A 1DGCA 4R2CA 2CT1A 4F6NA 2EE8A 2RSIA 2EPCA 2LV2A 5KL3A 1YUIA 2DGCA 1KJKA 1G2DC 2YTGA 2HGHA 4R2DA 1X6FA 2EL6A 2LO3A 3MHHC 2GLIA 1F2IG 2EOEA 2I13A 2EL5A 3EPJA 5KL7A 2EM3A 2EQ3A 2EM8A 1BB8A 5KL2A 2EN8A 1ZU1A 3M99B 2YTQA 2MKDA 2EM2A 3UK3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2Q A;  2EMH A;  1A1G A;  2EOI A;  2EMA A;  1YUJ A;  4M9V C;  2EM5 A;  2MDG A;  4R2S A;  4R2A A;  2ADR A;  2ENA A;  2EMZ A;  2EMW A;  2EOS A;  2LCE A;  3VHT B;  2EMG A;  2CTD A;  2EN4 A;  2YRK A;  1ZAA C;  2ENH A;  1YSA C;  2EOX A;  4F6M A;  2EMF A;  2ELZ A;  1A1K A;  2JP9 A;  1TF3 A;  2EOO A;  2EL4 A;  1A1L A;  4IJD A;  2EN3 A;  2PRT A;  2WBT A;  1JK2 A;  2EN2 A;  2CSH A;  2EQ0 A;  2EP3 A;  4R2P A;  2JPA A;  1A1H A;  2EPP A;  4X9J A;  1X6H A;  2ELY A;  2VRD A;  3MHS C;  1JK1 A;  2EMK A;  2BB8 A;  1MEY C;  2YU8 A;  2YTI A;  2YTP A;  2EOQ A;  2LT7 A;  2EMB A;  1TF6 A;  1RMD A;  2EOF A;  2EPR A;  2ENC A;  1P47 A;  2DMI A;  4FK5 C;  1TN9 A;  1LLM C;  2NAB A;  4IS1 C;  4R2R A;  2EJ4 A;  2M9A A;  2DLQ A;  2RPC A;  2EMC A;  2YTF A;  2EM6 A;  4R2E A;  5KL6 A;  2EPU A;  2EMX A;  2EMI A;  2EM7 A;  2EOR A;  2YRH A;  2WBU A;  2YTE A;  4WSG A;  4F2J C;  1X6E A;  3EPH A;  2EM0 A;  2YTJ A;  2YSP A;  2EM9 A;  2E72 A;  2J7J A;  2EOJ A;  2DRP A;  2YTO A;  1UBD C;  2YTD A;  2YTN A;  2EQ1 A;  2MKN A;  1A1I A;  2EOY A;  2EPX A;  1AAY A;  1G2F C;  2WCC 3;  2EPZ A;  1A1F A;  1UN6 B;  1X3C A;  1B69 A;  2EMY A;  1NCS A;  2EOH A;  1WJP A;  2YSO A;  5KL4 A;  2EML A;  2EOM A;  2EOZ A;  4GZN C;  1BBO A;  5KL5 A;  2EN6 A;  2YU5 A;  2D9H A;  2GHF A;  2EPA A;  1ZR9 A;  2WBS A;  2A25 A;  1X5W A;  2R1F A;  1A1J A;  2EN1 A;  1Z1B A;  3EPK A;  2YRM A;  2DLK A;  2EN7 A;  2LVH A;  3EPL A;  2EM4 A;  1DGC A;  4R2C A;  2CT1 A;  4F6N A;  2EE8 A;  2RSI A;  2EPC A;  2LV2 A;  5KL3 A;  1YUI A;  2DGC A;  1KJK A;  1G2D C;  2YTG A;  2HGH A;  4R2D A;  1X6F A;  2EL6 A;  2LO3 A;  3MHH C;  2GLI A;  1F2I G;  2EOE A;  2I13 A;  2EL5 A;  3EPJ A;  5KL7 A;  2EM3 A;  2EQ3 A;  2EM8 A;  1BB8 A;  5KL2 A;  2EN8 A;  1ZU1 A;  3M99 B;  2YTQ A;  2MKD A;  2EM2 A;  3UK3 C; 
#chains in the Genus database with same CATH topology
 2KON A;  4R2Q A;  1YZ9 A;  2JR1 A;  4NZV A;  2NUG A;  2L6M A;  3DF6 A;  2L2M A;  5AC4 A;  2E1M A;  1DQ3 A;  1EH7 A;  4R2S A;  4DKK A;  4R2A A;  3VYY A;  3BF2 A;  1HNW E;  2EMZ A;  2EMW A;  3VHT B;  2EMG A;  2EN4 A;  5LMU E;  2I9I A;  2YRK A;  2EPK X;  1XNQ E;  4F6M A;  3F6H A;  2EMF A;  2LE2 A;  2ELZ A;  2LRS A;  2EOO A;  3ADI A;  2NA2 A;  4LF5 E;  2JOX A;  3BGH A;  5A6A A;  3T1H E;  1A1H A;  4NXM E;  2V86 A;  4TUG A;  4JYA E;  3ECR A;  5IWA E;  1IQS A;  4O4K A;  2F4V E;  1EKZ A;  5LL6 R;  4NHR A;  1RMD A;  5A6B D;  2ENC A;  1T4L B;  5AE2 A;  1FJG E;  5A6J A;  4P7D A;  5LLQ A;  2DB2 A;  4F54 A;  5AC5 A;  5ADZ A;  3K6Q A;  5T6J A;  2EMC A;  5TSE A;  4YY3 E;  2HC5 A;  3JTZ A;  1NEI A;  2YTE A;  4DR1 E;  1WRJ A;  1X6E A;  1T39 A;  3EPH A;  1ZBT A;  2YTJ A;  4ZYG A;  1IBM E;  2EZ6 A;  2EM9 A;  1PKP A;  4DUZ E;  2EOJ A;  3JU0 A;  1A1I A;  2EPX A;  4B3T E;  1A1F A;  1B69 A;  2EOH A;  1J26 A;  1WJP A;  3TQM A;  3P1X A;  2YSO A;  5KL4 A;  2EOM A;  1BBO A;  2M4I A;  2L2K B;  4ZYE A;  1KYQ A;  2LUQ A;  2A25 A;  2R1F A;  1UIL A;  2EN1 A;  3KWR A;  2EN7 A;  1PJS A;  4R2C A;  3LML A;  3C4B A;  3EQ1 A;  2EPN A;  2DGC A;  1G2D C;  1X6F A;  2LO3 A;  1XNR E;  2EOE A;  2FTX B;  3EPJ A;  1GZ6 A;  1BB8 A;  2B7T A;  3MSW A;  3M99 B;  4GKJ E;  2MDR A;  2EM2 A;  3JAM C;  3UK3 C;  2UXD E;  1SFE A;  2EMH A;  2YZT A;  4R8O A;  2B9D A;  3C6M A;  2K4V A;  1HNZ E;  3BID A;  4X65 E;  2JY9 A;  4M9V C;  4BC9 A;  4O24 A;  4P78 A;  3HPS A;  2ZM6 E;  1A1K A;  1FKA E;  2HHH E;  4MLV A;  4IJD A;  2EN3 A;  4F9B B;  2WBT A;  4ZYH A;  2PRT A;  2EN2 A;  2VQE E;  2EP3 A;  3ZOQ B;  4LF7 E;  2N8X A;  2LTS A;  5F3W A;  2VRD A;  2L92 A;  2BB8 A;  4JI0 E;  2UU9 E;  2YTI A;  2L3C A;  4B3M E;  2EOQ A;  2LT7 A;  4JI4 E;  4BMJ A;  1IQO A;  2LMZ A;  2EPR A;  1MGT A;  3H09 A;  1TN9 A;  4B3S E;  5A6B A;  4X62 E;  3J7Y p;  4LFB E;  2LUP B;  5LMN E;  2FV4 B;  2EPU A;  2EMX A;  5KL6 A;  2EM7 A;  2EOR A;  4F2J C;  4DR7 E;  2RTX A;  3RMP A;  4JI5 E;  4Q35 B;  2E72 A;  2DRP A;  1X47 A;  2YTD A;  3VYX A;  1T4N A;  1WHQ A;  4M2Z A;  3THN A;  4JI1 E;  2YT4 A;  3IWD A;  1X48 A;  2MKN A;  1YYW A;  2WZO A;  4AQY E;  4J8Z A;  5A69 A;  1YYK A;  3J7A G;  2EMY A;  1I94 E;  1NCS A;  2F8B A;  2EML A;  2EOZ A;  4JI6 E;  2EN6 A;  2YU5 A;  4O43 A;  2EPA A;  2VF1 A;  2DSY A;  2NUE A;  2YRM A;  2G7H A;  3IWB A;  4LTY A;  3HPZ A;  2EPC A;  5KL3 A;  4K0K E;  1GQE A;  2JXP A;  4X64 E;  1STU A;  4BBY A;  2L3J A;  1N3G A;  2I13 A;  4DV0 E;  4DR3 E;  5BR8 E;  2UXC E;  2V85 A;  2KHX A;  1GTK A;  5KL7 A;  1PDA A;  4DV5 E;  1ZU1 A;  2YTQ A;  4LFC E;  4KZS A;  2MKD A;  2VQF E;  1QU6 A;  4TUI A;  1N34 E;  1MEY C;  1UHZ A;  1A1G A;  2EOI A;  3KZY A;  3KZZ A;  4WXC A;  1XMQ E;  2JWO A;  2ADR A;  2EOS A;  5DNY A;  1IMU A;  3DJW A;  1ZAA C;  2ENH A;  2R76 A;  2IHR 1;  1DI2 A;  1O0W A;  1A1L A;  2CSH A;  2MC5 A;  4R2P A;  2JPA A;  2JYA A;  2EPP A;  1PJT A;  2GPI A;  4DV2 E;  1L4S A;  3HTX A;  2K7I A;  4GEQ B;  1HNX E;  1X6H A;  2ELY A;  1JK1 A;  2UXB E;  2EMK A;  2V83 A;  5CFF E;  2KOU A;  2YTP A;  3IWC A;  4LU9 A;  2N3H A;  3VK6 A;  2EPO A;  4JI2 E;  2LTR A;  4F9C B;  4HTG A;  2DMI A;  2M1S A;  4L8N A;  4DR2 E;  2B3T B;  4M0V A;  4R2R A;  4DR5 E;  2DLQ A;  2YTF A;  3HXL A;  4BS9 A;  4RHB B;  5A2Q C;  2HJJ A;  1PJQ A;  2JVA A;  4WSG A;  4DMI A;  4DV4 E;  2RS6 A;  3C6K A;  2EM0 A;  3BBG A;  2LJH A;  2DMY A;  2CPN A;  4DV3 E;  4N4R B;  4B3R E;  2EQ1 A;  2EWL A;  2EOY A;  2YPN A;  1AAY A;  1T4O A;  1G2F C;  2WCC 3;  2EPZ A;  4BCA A;  1UN6 B;  1X49 A;  4LFA E;  5A6K A;  1X3C A;  3HQ1 A;  5IT9 C;  1EH6 A;  2ODR C;  4R03 A;  4DV7 E;  5KL5 A;  2GHF A;  1T38 A;  4BC7 A;  4KWY A;  1X5W A;  5IV8 B;  1A1J A;  4DV1 E;  1Z1B A;  1RC7 A;  3EPK A;  2DLK A;  2LVH A;  1ZBQ A;  5AAS A;  2H36 X;  4F6N A;  1YFH A;  1SR9 A;  2RSI A;  2LV2 A;  2YWQ A;  4LF4 E;  1KJK A;  2YTG A;  3OTO E;  2B7V A;  3QG5 C;  2UUA E;  2EL6 A;  2GLI A;  1F2I G;  1YYO A;  2EL5 A;  1IBL E;  2EM3 A;  3ADL A;  2EM8 A;  2EN8 A;  2UUC E;  4ZYD A;  2FGG A;  1XMO E;  4JV5 E;  2UUB E;  2LBS B;  2ODR D;  4LF8 E;  4Q28 A;  2EMA A;  1QNT A;  4WX9 A;  1YUJ A;  5AE1 A;  1WXR A;  3FIG A;  2EM5 A;  2MDG A;  2EPM X;  2ENA A;  2LCE A;  2Q8U A;  2CTD A;  2V89 A;  1YSA C;  2EOX A;  2JP9 A;  1TF3 A;  2DIX A;  4GKK E;  2EL4 A;  1JK2 A;  2EQ0 A;  4DUY E;  1J5E E;  4WYQ B;  4DV6 E;  2EPL X;  4X9J A;  3F6G A;  3MHS C;  1N32 E;  5FLX C;  2RS7 A;  3OML A;  2YU8 A;  5IXM B;  2EMB A;  3THO B;  1TF6 A;  2EOF A;  4X66 E;  1P47 A;  4RH8 A;  4FK5 C;  2V87 A;  4X8W A;  2NAB A;  3J80 C;  4IS1 C;  4WSP A;  1LLM C;  2EJ4 A;  1IBK E;  4JI8 E;  2M9A A;  2M7Q A;  2RPC A;  3C4T A;  2EM6 A;  4R2E A;  4BHB A;  3J81 C;  2EMI A;  4MLQ A;  2YRH A;  2WBU A;  4LF9 E;  4F9A B;  4M30 A;  4I8O A;  2YSP A;  3AV0 A;  4YHH E;  2J7J A;  2L33 A;  3ADG A;  1RQ0 A;  2YTO A;  4LF6 E;  2RQL A;  1UBD C;  2YTN A;  4JI7 E;  2VE7 C;  3T1Y E;  2V8Q B;  4L5N C;  3AUZ A;  2NUF A;  2L8T A;  1HR0 E;  1N36 E;  4GZN C;  1AH5 A;  4WFT A;  1N33 E;  3L00 A;  4BHC A;  2D9H A;  4JI3 E;  4KHP E;  1ZR9 A;  4NXN E;  2WBS A;  2RSM A;  1YPN A;  3EPL A;  2L2N A;  2EM4 A;  1DGC A;  2CT1 A;  3LLH A;  2EE8 A;  2E5L E;  1EH8 A;  1BBG A;  1YUI A;  4WXD A;  2LJU A;  4DR4 E;  4HEI A;  2HGH A;  2JOB A;  3ADJ A;  4R2D A;  3MHH C;  4OOG C;  4DR6 E;  2BBG A;  4O5G A;  2EQ3 A;  5KL2 A;  4OX9 E;  2N3G A;  4WPY A;  2MC6 A;  1WHN A;  2V88 A;  5AE3 A; 
#chains in the Genus database with same CATH homology
 4R2Q A;  2EMH A;  1A1G A;  2EOI A;  2EMA A;  1YUJ A;  4M9V C;  2EM5 A;  2MDG A;  4R2S A;  4R2A A;  2ADR A;  2ENA A;  2EMZ A;  2EMW A;  2EOS A;  2LCE A;  3VHT B;  2EMG A;  2CTD A;  2EN4 A;  2YRK A;  1ZAA C;  2ENH A;  1YSA C;  2EOX A;  4F6M A;  2EMF A;  2ELZ A;  1A1K A;  2JP9 A;  1TF3 A;  2EOO A;  2EL4 A;  1A1L A;  4IJD A;  2EN3 A;  2PRT A;  2WBT A;  1JK2 A;  2EN2 A;  2CSH A;  2EQ0 A;  2EP3 A;  4R2P A;  2JPA A;  1A1H A;  2EPP A;  4X9J A;  1X6H A;  2ELY A;  2VRD A;  3MHS C;  1JK1 A;  2EMK A;  2BB8 A;  1MEY C;  2YU8 A;  2YTI A;  2YTP A;  2EOQ A;  2LT7 A;  2EMB A;  1TF6 A;  1RMD A;  2EOF A;  2EPR A;  2ENC A;  1P47 A;  2DMI A;  4FK5 C;  1TN9 A;  1LLM C;  2NAB A;  4IS1 C;  4R2R A;  2EJ4 A;  2M9A A;  2DLQ A;  2RPC A;  2EMC A;  2YTF A;  2EM6 A;  4R2E A;  5KL6 A;  2EPU A;  2EMX A;  2EMI A;  2EM7 A;  2EOR A;  2YRH A;  2WBU A;  2YTE A;  4WSG A;  4F2J C;  1X6E A;  3EPH A;  2EM0 A;  2YTJ A;  2YSP A;  2EM9 A;  2E72 A;  2J7J A;  2EOJ A;  2DRP A;  2YTO A;  1UBD C;  2YTD A;  2YTN A;  2EQ1 A;  2MKN A;  1A1I A;  2EOY A;  2EPX A;  1AAY A;  1G2F C;  2WCC 3;  2EPZ A;  1A1F A;  1UN6 B;  1X3C A;  1B69 A;  2EMY A;  1NCS A;  2EOH A;  1WJP A;  2YSO A;  5KL4 A;  2EML A;  2EOM A;  2EOZ A;  4GZN C;  1BBO A;  5KL5 A;  2EN6 A;  2YU5 A;  2D9H A;  2GHF A;  2EPA A;  1ZR9 A;  2WBS A;  2A25 A;  1X5W A;  2R1F A;  1A1J A;  2EN1 A;  1Z1B A;  3EPK A;  2YRM A;  2DLK A;  2EN7 A;  2LVH A;  3EPL A;  2EM4 A;  1DGC A;  4R2C A;  2CT1 A;  4F6N A;  2EE8 A;  2RSI A;  2EPC A;  2LV2 A;  5KL3 A;  1YUI A;  2DGC A;  1KJK A;  1G2D C;  2YTG A;  2HGH A;  4R2D A;  1X6F A;  2EL6 A;  2LO3 A;  3MHH C;  2GLI A;  1F2I G;  2EOE A;  2I13 A;  2EL5 A;  3EPJ A;  5KL7 A;  2EM3 A;  2EQ3 A;  2EM8 A;  1BB8 A;  5KL2 A;  2EN8 A;  1ZU1 A;  3M99 B;  2YTQ A;  2MKD A;  2EM2 A;  3UK3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...