1A1LA

Zif268 zinc finger-dna complex (gcac site)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
RPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*AP*C)-3')
publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 28
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1lA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1lA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1lA03
2EM7A 2EN6A 1UN6B 2EM6A 2EL4A 1X3CA 1ZAAC 2EN2A 2EMLA 2EPUA 3EPJA 2A25A 2YU8A 2EN1A 2EMZA 4IJDA 1A1KA 4R2CA 2M9AA 2ELYA 4F6NA 2EP3A 2J7JA 5KL7A 2LO3A 2YSPA 2DGCA 1G2DC 2RSIA 2EOJA 1YUJA 4M9VC 4R2SA 2YRMA 2EPAA 2EMCA 1B69A 1A1HA 1UBDC 2EL5A 1P47A 4GZNC 1YUIA 2MDGA 2EORA 5KL2A 1X6FA 4R2AA 2EQ0A 2CT1A 2GHFA 2EOFA 2LT7A 2YTOA 4X9JA 4IS1C 2LVHA 2EOHA 2EPPA 1A1FA 2YTIA 2EOYA 4R2EA 2DMIA 2DLKA 2EOSA 5KL6A 2EQ3A 2EL6A 1LLMC 1ZU1A 1Z1BA 2LCEA 2ENCA 2YTDA 1BBOA 2YU5A 2EOEA 2EQ1A 2PRTA 2EM2A 1KJKA 2ELZA 1X6HA 2EM4A 2ENAA 2CTDA 2EOMA 2DLQA 2JPAA 2EMGA 1WJPA 2VRDA 4R2DA 3EPLA 1A1GA 1YSAC 2D9HA 3MHSC 1RMDA 2YTPA 2EPCA 1DGCA 2DRPA 2YSOA 2WBUA 1ZR9A 2EM0A 2EM9A 2YRHA 1F2IG 2EMAA 2EMFA 2EE8A 1TF3A 1BB8A 5KL5A 1A1IA 1G2FC 2WBTA 4FK5C 2YTEA 1TF6A 2R1FA 5KL3A 2EPXA 1NCSA 2EMWA 2MKNA 2WCC3 2EMKA 3EPHA 2EM5A 4R2PA 2GLIA 4R2RA 2CSHA 2EMBA 2YRKA 2EOIA 2RPCA 3VHTB 4WSGA 2EMIA 2EMYA 2HGHA 2EM8A 2EOQA 2EPRA 1X5WA 2EOZA 1JK2A 1JK1A 2EN3A 2ADRA 1AAYA 2EJ4A 2EMXA 2MKDA 4F2JC 2EM3A 2LV2A 2NABA 2YTNA 3MHHC 2EN4A 3M99B 2YTGA 1MEYC 2E72A 5KL4A 3UK3C 1X6EA 3EPKA 2EPZA 2EOXA 2I13A 2JP9A 4R2QA 2EN8A 2EOOA 1TN9A 2YTJA 4F6MA 1A1JA 1A1LA 2WBSA 2ENHA 2YTFA 2EN7A 2EMHA 2BB8A 2YTQA
chains in the Genus database with same CATH superfamily
1N3GA 3ADGA 2EN6A 2N8XA 1X3CA 2H36X 5LLQA 4DV7E 2EMLA 3J81C 4BBYA 2EPKX 4P78A 5IV8B 2L92A 5CFFE 1A1KA 1ZBQA 3J7Yp 1N33E 1YUJA 4DV4E 4R2SA 2LJUA 2YRMA 2EPAA 1A1HA 2LRSA 2EL5A 4YY3E 4GZNC 2L2NA 2MDGA 2BBGA 1IQSA 5KL2A 5A69A 4GEQB 4R2AA 4B3SE 2LT7A 2EOFA 1PJQA 4X9JA 4GKJE 1WRJA 3JU0A 4LF4E 4GKKE 2YTIA 2EOYA 5FLXC 2DMIA 2EOSA 2EL6A 2VQEE 2RS6A 1BBGA 5BR8E 2YU5A 4JI0E 4F9AB 2RS7A 4DV1E 2JYAA 2RTXA 4L5NC 4WPYA 2EM4A 2EOMA 4WXDA 1YYOA 2EMGA 3VK6A 1T4LB 3THOB 1I94E 2VRDA 1WHNA 4R2DA 1DI2A 2L6MA 1RMDA 2EPCA 5AE2A 2DRPA 2YT4A 3KZYA 1ZR9A 4JI2E 2YRHA 4N4RB 2EMAA 2MC5A 2EE8A 5KL5A 1A1IA 4LF8E 4FK5C 1TF6A 2R1FA 4AQYE 2EMWA 2WCC3 3F6GA 1QNTA 4R2PA 2E5LE 2VQFE 1YYKA 2UUCE 4K0KE 3VYXA 2YRKA 2EOIA 3VHTB 1XNQE 1HNXE 5A6AA 2HGHA 4KZSA 1X48A 4JI7E 4X62E 4TUIA 2KOUA 3LLHA 2YTGA 5KL4A 2YPNA 4DR1E 4JI4E 4JI5E 4Q35B 1HR0E 5LMNE 2I13A 4DV5E 2JP9A 2YZTA 4R2QA 2JOBA 3OTOE 5A6BA 2LJHA 1A1LA 2LUQA 1XNRE 2UU9E 4MLVA 2NUGA 1STUA 2EMHA 4M0VA 1PJSA 3BBGA 1GZ6A 4NHRA 1ZAAC 1FKAE 2EN2A 4F9BB 2EPUA 2MDRA 1YPNA 2EMZA 5F3WA 4F54A 1AH5A 2VE7C 2M9AA 2LTRA 1IMUA 2LBSB 2EWLA 2N3GA 2LO3A 5A6KA 4LFAE 2RSIA 2EOJA 1HNWE 3F6HA 4BMJA 1N36E 3C6KA 4DR7E 2EMCA 1B69A 3ZOQB 1UBDC 2M1SA 1P47A 2CPNA 2YWQA 2F4VE 1YUIA 4DUZE 1T39A 4WSPA 2YTOA 3HXLA 1O0WA 4ZYGA 2LVHA 3AV0A 4LF9E 3HPSA 2L2KB 2WZOA 2EZ6A 3C4BA 4BC9A 1LLMC 2EQ3A 3C4TA 5ADZA 4O5GA 3MSWA 4O24A 2ELZA 4O4KA 4F9CB 2B7TA 2ENAA 4JYAE 3T1YE 2JPAA 4O43A 1WJPA 2L33A 3J80C 3C6MA 3EPLA 1A1GA 4NXNE 3MHSC 1RQ0A 4L8NA 2NUEA 4B3TE 1PDAA 2EPNA 1IBLE 3LMLA 3P1XA 2EM9A 1EKZA 3K6QA 2LUPB 3FIGA 5IT9C 5KL3A 1N32E 1IQOA 1GTKA 2EMKA 5LL6R 2JVAA 2EM5A 3EQ1A 1PJTA 4X64E 1T4OA 4WSGA 2EMIA 4NZVA 4KHPE 1KYQA 2B9DA 2EOQA 2EPRA 2B3TB 1UILA 1X47A 3THNA 4JI8E 2EMXA 4F2JC 4DR4E 1PKPA 2NABA 1MEYC 4X65E 2ZM6E 1MGTA 2EPZA 4DR2E 2EN8A 1TN9A 2V8QB 2YTJA 4F6MA 1A1JA 1L4SA 3ADJA 2WBSA 2JOXA 2Q8UA 4WX9A 1SR9A 1IBME 2EL4A 4JI6E 2RQLA 1HNZE 2YU8A 4R03A 4ZYDA 3J7AG 5AE1A 2V83A 4IJDA 1EH6A 4HTGA 3KWRA 2R76A 4R2CA 5AASA 2ELYA 2L8TA 3HPZA 2J7JA 5KL7A 2V85A 2F8BA 4LFBE 5DNYA 2DGCA 3BGHA 2V86A 3IWDA 4YHHE 3HTXA 4RHBB 2JXPA 2EORA 1X6FA 2GHFA 4I8OA 2L2MA 2DB2A 2NA2A 4P7DA 4DV0E 1XMOE 4R2EA 2DLKA 5KL6A 1FJGE 1ZU1A 1Z1BA 3L00A 2DMYA 2ENCA 2LCEA 2YTDA 3JTZA 4WXCA 1YZ9A 2HC5A 2EM2A 1KJKA 1X6HA 2CTDA 2DLQA 4M30A 1GQEA 2JWOA 2LTSA 2V88A 2JR1A 1DGCA 4LF5E 2K7IA 1RC7A 2YSOA 2LMZA 4JI1E 2EM0A 1F2IG 1T4NA 1TF3A 1BB8A 5AE3A 3ADIA 2WBTA 2YTEA 1NEIA 2EPMX 1NCSA 4DMIA 3BIDA 3H09A 3EPHA 4R2RA 2KONA 2EMBA 4J8ZA 2RPCA 2FV4B 1IBKE 2UXCE 2EOZA 3RMPA 1JK2A 1JK1A 1WHQA 2ADRA 5T6JA 4JV5E 2EJ4A 2EM3A 2LV2A 2RSMA 2YTNA 3MHHC 5A6BD 3T1HE 2EN4A 4R8OA 3UK3C 4DR3E 3EPKA 4LF7E 3TQMA 2B7VA 4DV6E 2EOXA 4RH8A 4OOGC 3AUZA 5AC5A 4BHCA 1YFHA 3KZZA 2EN7A 4LFCE 2YTQA 2EM7A 2FTXB 1UN6B 2EM6A 4HEIA 4NXME 3JAMC 3EPJA 2ODRC 2A25A 2EN1A 2FGGA 1QU6A 5A2QC 5TSEA 3OMLA 4BCAA 4F6NA 2UUBE 1X49A 2EP3A 4DV3E 2ODRD 1T38A 1J26A 2YSPA 1G2DC 4M9VC 1WXRA 2VF1A 2HJJA 4X66E 3IWBA 3DJWA 1XMQE 3BF2A 4LU9A 4BS9A 2EQ0A 2CT1A 2L3JA 4BHBA 2G7HA 2HHHE 4IS1C 2EOHA 2EPPA 2IHR1 1A1FA 4TUGA 1EH7A 1BBOA 2EOEA 2V87A 4DKKA 2E1MA 2M7QA 2EQ1A 2PRTA 4JI3E 3IWCA 4LF6E 4ZYHA 2EPLX 4OX9E 4X8WA 4LTYA 4DR6E 2M4IA 2DSYA 1YSAC 3HQ1A 2D9HA 2YTPA 2K4VA 2NUFA 5LMUE 2WBUA 2MC6A 4Q28A 2EMFA 4KWYA 1G2FC 2L3CA 3VYYA 4DV2E 5IXMB 2EPXA 1YYWA 2MKNA 2N3HA 1ZBTA 2EPOA 1DQ3A 2UXBE 2GLIA 5IWAE 2V89A 3DF6A 4WYQB 2CSHA 2I9IA 1N34E 4WFTA 2EMYA 3ADLA 2EM8A 1J5EE 2DIXA 1X5WA 1UHZA 2EN3A 4B3ME 1AAYA 4M2ZA 2MKDA 1EH8A 2UXDE 3ECRA 3QG5C 3M99B 2E72A 1X6EA 2UUAE 4MLQA 1SFEA 4DUYE 4B3RE 4DR5E 2KHXA 2LE2A 5A6JA 4BC7A 4ZYEA 2EOOA 5AC4A 2ENHA 2YTFA 2BB8A 2GPIA 2JY9A
chains in the Genus database with same CATH topology
2EM7A 2EN6A 1UN6B 2EM6A 2EL4A 1X3CA 1ZAAC 2EN2A 2EMLA 2EPUA 3EPJA 2A25A 2YU8A 2EN1A 2EMZA 4IJDA 1A1KA 4R2CA 2M9AA 2ELYA 4F6NA 2EP3A 2J7JA 5KL7A 2LO3A 2YSPA 2DGCA 1G2DC 2RSIA 2EOJA 1YUJA 4M9VC 4R2SA 2YRMA 2EPAA 2EMCA 1B69A 1A1HA 1UBDC 2EL5A 1P47A 4GZNC 1YUIA 2MDGA 2EORA 5KL2A 1X6FA 4R2AA 2EQ0A 2CT1A 2GHFA 2EOFA 2LT7A 2YTOA 4X9JA 4IS1C 2LVHA 2EOHA 2EPPA 1A1FA 2YTIA 2EOYA 4R2EA 2DMIA 2DLKA 2EOSA 5KL6A 2EQ3A 2EL6A 1LLMC 1ZU1A 1Z1BA 2LCEA 2ENCA 2YTDA 1BBOA 2YU5A 2EOEA 2EQ1A 2PRTA 2EM2A 1KJKA 2ELZA 1X6HA 2EM4A 2ENAA 2CTDA 2EOMA 2DLQA 2JPAA 2EMGA 1WJPA 2VRDA 4R2DA 3EPLA 1A1GA 1YSAC 2D9HA 3MHSC 1RMDA 2YTPA 2EPCA 1DGCA 2DRPA 2YSOA 2WBUA 1ZR9A 2EM0A 2EM9A 2YRHA 1F2IG 2EMAA 2EMFA 2EE8A 1TF3A 1BB8A 5KL5A 1A1IA 1G2FC 2WBTA 4FK5C 2YTEA 1TF6A 2R1FA 5KL3A 2EPXA 1NCSA 2EMWA 2MKNA 2WCC3 2EMKA 3EPHA 2EM5A 4R2PA 2GLIA 4R2RA 2CSHA 2EMBA 2YRKA 2EOIA 2RPCA 3VHTB 4WSGA 2EMIA 2EMYA 2HGHA 2EM8A 2EOQA 2EPRA 1X5WA 2EOZA 1JK2A 1JK1A 2EN3A 2ADRA 1AAYA 2EJ4A 2EMXA 2MKDA 4F2JC 2EM3A 2LV2A 2NABA 2YTNA 3MHHC 2EN4A 3M99B 2YTGA 1MEYC 2E72A 5KL4A 3UK3C 1X6EA 3EPKA 2EPZA 2EOXA 2I13A 2JP9A 4R2QA 2EN8A 2EOOA 1TN9A 2YTJA 4F6MA 1A1JA 1A1LA 2WBSA 2ENHA 2YTFA 2EN7A 2EMHA 2BB8A 2YTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM7 A;  2EN6 A;  1UN6 B;  2EM6 A;  2EL4 A;  1X3C A;  1ZAA C;  2EN2 A;  2EML A;  2EPU A;  3EPJ A;  2A25 A;  2YU8 A;  2EN1 A;  2EMZ A;  4IJD A;  1A1K A;  4R2C A;  2M9A A;  2ELY A;  4F6N A;  2EP3 A;  2J7J A;  5KL7 A;  2LO3 A;  2YSP A;  2DGC A;  1G2D C;  2RSI A;  2EOJ A;  1YUJ A;  4M9V C;  4R2S A;  2YRM A;  2EPA A;  2EMC A;  1B69 A;  1A1H A;  1UBD C;  2EL5 A;  1P47 A;  4GZN C;  1YUI A;  2MDG A;  2EOR A;  5KL2 A;  1X6F A;  4R2A A;  2EQ0 A;  2CT1 A;  2GHF A;  2EOF A;  2LT7 A;  2YTO A;  4X9J A;  4IS1 C;  2LVH A;  2EOH A;  2EPP A;  1A1F A;  2YTI A;  2EOY A;  4R2E A;  2DMI A;  2DLK A;  2EOS A;  5KL6 A;  2EQ3 A;  2EL6 A;  1LLM C;  1ZU1 A;  1Z1B A;  2LCE A;  2ENC A;  2YTD A;  1BBO A;  2YU5 A;  2EOE A;  2EQ1 A;  2PRT A;  2EM2 A;  1KJK A;  2ELZ A;  1X6H A;  2EM4 A;  2ENA A;  2CTD A;  2EOM A;  2DLQ A;  2JPA A;  2EMG A;  1WJP A;  2VRD A;  4R2D A;  3EPL A;  1A1G A;  1YSA C;  2D9H A;  3MHS C;  1RMD A;  2YTP A;  2EPC A;  1DGC A;  2DRP A;  2YSO A;  2WBU A;  1ZR9 A;  2EM0 A;  2EM9 A;  2YRH A;  1F2I G;  2EMA A;  2EMF A;  2EE8 A;  1TF3 A;  1BB8 A;  5KL5 A;  1A1I A;  1G2F C;  2WBT A;  4FK5 C;  2YTE A;  1TF6 A;  2R1F A;  5KL3 A;  2EPX A;  1NCS A;  2EMW A;  2MKN A;  2WCC 3;  2EMK A;  3EPH A;  2EM5 A;  4R2P A;  2GLI A;  4R2R A;  2CSH A;  2EMB A;  2YRK A;  2EOI A;  2RPC A;  3VHT B;  4WSG A;  2EMI A;  2EMY A;  2HGH A;  2EM8 A;  2EOQ A;  2EPR A;  1X5W A;  2EOZ A;  1JK2 A;  1JK1 A;  2EN3 A;  2ADR A;  1AAY A;  2EJ4 A;  2EMX A;  2MKD A;  4F2J C;  2EM3 A;  2LV2 A;  2NAB A;  2YTN A;  3MHH C;  2EN4 A;  3M99 B;  2YTG A;  1MEY C;  2E72 A;  5KL4 A;  3UK3 C;  1X6E A;  3EPK A;  2EPZ A;  2EOX A;  2I13 A;  2JP9 A;  4R2Q A;  2EN8 A;  2EOO A;  1TN9 A;  2YTJ A;  4F6M A;  1A1J A;  1A1L A;  2WBS A;  2ENH A;  2YTF A;  2EN7 A;  2EMH A;  2BB8 A;  2YTQ A; 
#chains in the Genus database with same CATH topology
 1N3G A;  3ADG A;  2EN6 A;  2N8X A;  1X3C A;  2H36 X;  5LLQ A;  4DV7 E;  2EML A;  3J81 C;  4BBY A;  2EPK X;  4P78 A;  5IV8 B;  2L92 A;  5CFF E;  1A1K A;  1ZBQ A;  3J7Y p;  1N33 E;  1YUJ A;  4DV4 E;  4R2S A;  2LJU A;  2YRM A;  2EPA A;  1A1H A;  2LRS A;  2EL5 A;  4YY3 E;  4GZN C;  2L2N A;  2MDG A;  2BBG A;  1IQS A;  5KL2 A;  5A69 A;  4GEQ B;  4R2A A;  4B3S E;  2LT7 A;  2EOF A;  1PJQ A;  4X9J A;  4GKJ E;  1WRJ A;  3JU0 A;  4LF4 E;  4GKK E;  2YTI A;  2EOY A;  5FLX C;  2DMI A;  2EOS A;  2EL6 A;  2VQE E;  2RS6 A;  1BBG A;  5BR8 E;  2YU5 A;  4JI0 E;  4F9A B;  2RS7 A;  4DV1 E;  2JYA A;  2RTX A;  4L5N C;  4WPY A;  2EM4 A;  2EOM A;  4WXD A;  1YYO A;  2EMG A;  3VK6 A;  1T4L B;  3THO B;  1I94 E;  2VRD A;  1WHN A;  4R2D A;  1DI2 A;  2L6M A;  1RMD A;  2EPC A;  5AE2 A;  2DRP A;  2YT4 A;  3KZY A;  1ZR9 A;  4JI2 E;  2YRH A;  4N4R B;  2EMA A;  2MC5 A;  2EE8 A;  5KL5 A;  1A1I A;  4LF8 E;  4FK5 C;  1TF6 A;  2R1F A;  4AQY E;  2EMW A;  2WCC 3;  3F6G A;  1QNT A;  4R2P A;  2E5L E;  2VQF E;  1YYK A;  2UUC E;  4K0K E;  3VYX A;  2YRK A;  2EOI A;  3VHT B;  1XNQ E;  1HNX E;  5A6A A;  2HGH A;  4KZS A;  1X48 A;  4JI7 E;  4X62 E;  4TUI A;  2KOU A;  3LLH A;  2YTG A;  5KL4 A;  2YPN A;  4DR1 E;  4JI4 E;  4JI5 E;  4Q35 B;  1HR0 E;  5LMN E;  2I13 A;  4DV5 E;  2JP9 A;  2YZT A;  4R2Q A;  2JOB A;  3OTO E;  5A6B A;  2LJH A;  1A1L A;  2LUQ A;  1XNR E;  2UU9 E;  4MLV A;  2NUG A;  1STU A;  2EMH A;  4M0V A;  1PJS A;  3BBG A;  1GZ6 A;  4NHR A;  1ZAA C;  1FKA E;  2EN2 A;  4F9B B;  2EPU A;  2MDR A;  1YPN A;  2EMZ A;  5F3W A;  4F54 A;  1AH5 A;  2VE7 C;  2M9A A;  2LTR A;  1IMU A;  2LBS B;  2EWL A;  2N3G A;  2LO3 A;  5A6K A;  4LFA E;  2RSI A;  2EOJ A;  1HNW E;  3F6H A;  4BMJ A;  1N36 E;  3C6K A;  4DR7 E;  2EMC A;  1B69 A;  3ZOQ B;  1UBD C;  2M1S A;  1P47 A;  2CPN A;  2YWQ A;  2F4V E;  1YUI A;  4DUZ E;  1T39 A;  4WSP A;  2YTO A;  3HXL A;  1O0W A;  4ZYG A;  2LVH A;  3AV0 A;  4LF9 E;  3HPS A;  2L2K B;  2WZO A;  2EZ6 A;  3C4B A;  4BC9 A;  1LLM C;  2EQ3 A;  3C4T A;  5ADZ A;  4O5G A;  3MSW A;  4O24 A;  2ELZ A;  4O4K A;  4F9C B;  2B7T A;  2ENA A;  4JYA E;  3T1Y E;  2JPA A;  4O43 A;  1WJP A;  2L33 A;  3J80 C;  3C6M A;  3EPL A;  1A1G A;  4NXN E;  3MHS C;  1RQ0 A;  4L8N A;  2NUE A;  4B3T E;  1PDA A;  2EPN A;  1IBL E;  3LML A;  3P1X A;  2EM9 A;  1EKZ A;  3K6Q A;  2LUP B;  3FIG A;  5IT9 C;  5KL3 A;  1N32 E;  1IQO A;  1GTK A;  2EMK A;  5LL6 R;  2JVA A;  2EM5 A;  3EQ1 A;  1PJT A;  4X64 E;  1T4O A;  4WSG A;  2EMI A;  4NZV A;  4KHP E;  1KYQ A;  2B9D A;  2EOQ A;  2EPR A;  2B3T B;  1UIL A;  1X47 A;  3THN A;  4JI8 E;  2EMX A;  4F2J C;  4DR4 E;  1PKP A;  2NAB A;  1MEY C;  4X65 E;  2ZM6 E;  1MGT A;  2EPZ A;  4DR2 E;  2EN8 A;  1TN9 A;  2V8Q B;  2YTJ A;  4F6M A;  1A1J A;  1L4S A;  3ADJ A;  2WBS A;  2JOX A;  2Q8U A;  4WX9 A;  1SR9 A;  1IBM E;  2EL4 A;  4JI6 E;  2RQL A;  1HNZ E;  2YU8 A;  4R03 A;  4ZYD A;  3J7A G;  5AE1 A;  2V83 A;  4IJD A;  1EH6 A;  4HTG A;  3KWR A;  2R76 A;  4R2C A;  5AAS A;  2ELY A;  2L8T A;  3HPZ A;  2J7J A;  5KL7 A;  2V85 A;  2F8B A;  4LFB E;  5DNY A;  2DGC A;  3BGH A;  2V86 A;  3IWD A;  4YHH E;  3HTX A;  4RHB B;  2JXP A;  2EOR A;  1X6F A;  2GHF A;  4I8O A;  2L2M A;  2DB2 A;  2NA2 A;  4P7D A;  4DV0 E;  1XMO E;  4R2E A;  2DLK A;  5KL6 A;  1FJG E;  1ZU1 A;  1Z1B A;  3L00 A;  2DMY A;  2ENC A;  2LCE A;  2YTD A;  3JTZ A;  4WXC A;  1YZ9 A;  2HC5 A;  2EM2 A;  1KJK A;  1X6H A;  2CTD A;  2DLQ A;  4M30 A;  1GQE A;  2JWO A;  2LTS A;  2V88 A;  2JR1 A;  1DGC A;  4LF5 E;  2K7I A;  1RC7 A;  2YSO A;  2LMZ A;  4JI1 E;  2EM0 A;  1F2I G;  1T4N A;  1TF3 A;  1BB8 A;  5AE3 A;  3ADI A;  2WBT A;  2YTE A;  1NEI A;  2EPM X;  1NCS A;  4DMI A;  3BID A;  3H09 A;  3EPH A;  4R2R A;  2KON A;  2EMB A;  4J8Z A;  2RPC A;  2FV4 B;  1IBK E;  2UXC E;  2EOZ A;  3RMP A;  1JK2 A;  1JK1 A;  1WHQ A;  2ADR A;  5T6J A;  4JV5 E;  2EJ4 A;  2EM3 A;  2LV2 A;  2RSM A;  2YTN A;  3MHH C;  5A6B D;  3T1H E;  2EN4 A;  4R8O A;  3UK3 C;  4DR3 E;  3EPK A;  4LF7 E;  3TQM A;  2B7V A;  4DV6 E;  2EOX A;  4RH8 A;  4OOG C;  3AUZ A;  5AC5 A;  4BHC A;  1YFH A;  3KZZ A;  2EN7 A;  4LFC E;  2YTQ A;  2EM7 A;  2FTX B;  1UN6 B;  2EM6 A;  4HEI A;  4NXM E;  3JAM C;  3EPJ A;  2ODR C;  2A25 A;  2EN1 A;  2FGG A;  1QU6 A;  5A2Q C;  5TSE A;  3OML A;  4BCA A;  4F6N A;  2UUB E;  1X49 A;  2EP3 A;  4DV3 E;  2ODR D;  1T38 A;  1J26 A;  2YSP A;  1G2D C;  4M9V C;  1WXR A;  2VF1 A;  2HJJ A;  4X66 E;  3IWB A;  3DJW A;  1XMQ E;  3BF2 A;  4LU9 A;  4BS9 A;  2EQ0 A;  2CT1 A;  2L3J A;  4BHB A;  2G7H A;  2HHH E;  4IS1 C;  2EOH A;  2EPP A;  2IHR 1;  1A1F A;  4TUG A;  1EH7 A;  1BBO A;  2EOE A;  2V87 A;  4DKK A;  2E1M A;  2M7Q A;  2EQ1 A;  2PRT A;  4JI3 E;  3IWC A;  4LF6 E;  4ZYH A;  2EPL X;  4OX9 E;  4X8W A;  4LTY A;  4DR6 E;  2M4I A;  2DSY A;  1YSA C;  3HQ1 A;  2D9H A;  2YTP A;  2K4V A;  2NUF A;  5LMU E;  2WBU A;  2MC6 A;  4Q28 A;  2EMF A;  4KWY A;  1G2F C;  2L3C A;  3VYY A;  4DV2 E;  5IXM B;  2EPX A;  1YYW A;  2MKN A;  2N3H A;  1ZBT A;  2EPO A;  1DQ3 A;  2UXB E;  2GLI A;  5IWA E;  2V89 A;  3DF6 A;  4WYQ B;  2CSH A;  2I9I A;  1N34 E;  4WFT A;  2EMY A;  3ADL A;  2EM8 A;  1J5E E;  2DIX A;  1X5W A;  1UHZ A;  2EN3 A;  4B3M E;  1AAY A;  4M2Z A;  2MKD A;  1EH8 A;  2UXD E;  3ECR A;  3QG5 C;  3M99 B;  2E72 A;  1X6E A;  2UUA E;  4MLQ A;  1SFE A;  4DUY E;  4B3R E;  4DR5 E;  2KHX A;  2LE2 A;  5A6J A;  4BC7 A;  4ZYE A;  2EOO A;  5AC4 A;  2ENH A;  2YTF A;  2BB8 A;  2GPI A;  2JY9 A; 
#chains in the Genus database with same CATH homology
 2EM7 A;  2EN6 A;  1UN6 B;  2EM6 A;  2EL4 A;  1X3C A;  1ZAA C;  2EN2 A;  2EML A;  2EPU A;  3EPJ A;  2A25 A;  2YU8 A;  2EN1 A;  2EMZ A;  4IJD A;  1A1K A;  4R2C A;  2M9A A;  2ELY A;  4F6N A;  2EP3 A;  2J7J A;  5KL7 A;  2LO3 A;  2YSP A;  2DGC A;  1G2D C;  2RSI A;  2EOJ A;  1YUJ A;  4M9V C;  4R2S A;  2YRM A;  2EPA A;  2EMC A;  1B69 A;  1A1H A;  1UBD C;  2EL5 A;  1P47 A;  4GZN C;  1YUI A;  2MDG A;  2EOR A;  5KL2 A;  1X6F A;  4R2A A;  2EQ0 A;  2CT1 A;  2GHF A;  2EOF A;  2LT7 A;  2YTO A;  4X9J A;  4IS1 C;  2LVH A;  2EOH A;  2EPP A;  1A1F A;  2YTI A;  2EOY A;  4R2E A;  2DMI A;  2DLK A;  2EOS A;  5KL6 A;  2EQ3 A;  2EL6 A;  1LLM C;  1ZU1 A;  1Z1B A;  2LCE A;  2ENC A;  2YTD A;  1BBO A;  2YU5 A;  2EOE A;  2EQ1 A;  2PRT A;  2EM2 A;  1KJK A;  2ELZ A;  1X6H A;  2EM4 A;  2ENA A;  2CTD A;  2EOM A;  2DLQ A;  2JPA A;  2EMG A;  1WJP A;  2VRD A;  4R2D A;  3EPL A;  1A1G A;  1YSA C;  2D9H A;  3MHS C;  1RMD A;  2YTP A;  2EPC A;  1DGC A;  2DRP A;  2YSO A;  2WBU A;  1ZR9 A;  2EM0 A;  2EM9 A;  2YRH A;  1F2I G;  2EMA A;  2EMF A;  2EE8 A;  1TF3 A;  1BB8 A;  5KL5 A;  1A1I A;  1G2F C;  2WBT A;  4FK5 C;  2YTE A;  1TF6 A;  2R1F A;  5KL3 A;  2EPX A;  1NCS A;  2EMW A;  2MKN A;  2WCC 3;  2EMK A;  3EPH A;  2EM5 A;  4R2P A;  2GLI A;  4R2R A;  2CSH A;  2EMB A;  2YRK A;  2EOI A;  2RPC A;  3VHT B;  4WSG A;  2EMI A;  2EMY A;  2HGH A;  2EM8 A;  2EOQ A;  2EPR A;  1X5W A;  2EOZ A;  1JK2 A;  1JK1 A;  2EN3 A;  2ADR A;  1AAY A;  2EJ4 A;  2EMX A;  2MKD A;  4F2J C;  2EM3 A;  2LV2 A;  2NAB A;  2YTN A;  3MHH C;  2EN4 A;  3M99 B;  2YTG A;  1MEY C;  2E72 A;  5KL4 A;  3UK3 C;  1X6E A;  3EPK A;  2EPZ A;  2EOX A;  2I13 A;  2JP9 A;  4R2Q A;  2EN8 A;  2EOO A;  1TN9 A;  2YTJ A;  4F6M A;  1A1J A;  1A1L A;  2WBS A;  2ENH A;  2YTF A;  2EN7 A;  2EMH A;  2BB8 A;  2YTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...