1A1LA

Zif268 zinc finger-dna complex (gcac site)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
RPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*AP*C)-3')
total genus 28
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1lA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1lA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1lA03
1ZR9A 2WCC3 3M99B 2HGHA 2M9AA 1DGCA 4IS1C 4R2QA 2YTGA 2ELZA 1G2FC 4R2PA 2GHFA 1JK1A 2EM0A 2EORA 2WBSA 2EM6A 2CT1A 2ENHA 1MEYC 2EL4A 2ENCA 2EPRA 2EOXA 3VHTB 3UK3C 1A1LA 2R1FA 2MKNA 5KL5A 1BBOA 2EMYA 4F6MA 1UN6B 2EQ1A 1JK2A 4IJDA 1YSAC 2EPZA 2YTOA 2EOZA 2YSOA 2EM3A 2EOJA 2EMBA 4R2RA 2EN7A 2EMAA 5KL7A 2EPPA 1YUIA 2EOFA 1X5WA 2LVHA 2YTFA 2DLKA 2EOSA 2WBUA 4R2DA 3EPJA 1NCSA 5KL4A 4X9JA 4FK5C 2YRKA 2EOEA 2EPCA 2A25A 2LCEA 2YSPA 4R2EA 1F2IG 1X6EA 2EMGA 2EOIA 2YU5A 2RPCA 2EMHA 2EN8A 2EPXA 1X6HA 1B69A 2NABA 1TN9A 1BB8A 4F2JC 2DLQA 1TF3A 2EOOA 3MHHC 2EOQA 2MKDA 1UBDC 2JP9A 2YTQA 2DGCA 1A1IA 3EPHA 2EMZA 2EM4A 2EMLA 2EL6A 2ENAA 2ELYA 2EM5A 4R2AA 1LLMC 2EMCA 1YUJA 2JPAA 2EP3A 2WBTA 2CSHA 1ZU1A 2PRTA 2LV2A 2EN6A 2YTDA 5KL6A 2EPAA 1X3CA 1AAYA 2EMIA 2CTDA 2EOYA 2MDGA 1Z1BA 2GLIA 1RMDA 2EQ0A 2EPUA 1ZAAC 1G2DC 2D9HA 2EOHA 4R2SA 1A1HA 3EPLA 2EJ4A 2EM2A 2EMFA 3EPKA 2EM7A 2EN3A 4WSGA 2EN4A 2EE8A 4R2CA 1WJPA 5KL2A 2YU8A 4GZNC 2DRPA 5KL3A 2EOMA 2YTEA 3MHSC 2EN2A 2EMWA 2EL5A 2YTNA 2I13A 2RSIA 2LT7A 1A1FA 4M9VC 2VRDA 1X6FA 2EMKA 2YRHA 2BB8A 2EM9A 2YTJA 2YRMA 2EMXA 1KJKA 2ADRA 1P47A 2DMIA 2YTPA 2EQ3A 1TF6A 1A1GA 2J7JA 1A1JA 1A1KA 2EN1A 2EM8A 2YTIA 4F6NA 2E72A 2LO3A
chains in the Genus database with same CATH superfamily
3P1XA 2M9AA 4ZYEA 2ZM6E 4P7DA 2WZOA 2YTGA 4M2ZA 2RSMA 2CPNA 2LTRA 4JI3E 3AUZA 2EM6A 2MKNA 2EPRA 2K4VA 4DV3E 2V8QB 2R76A 5KL5A 1BBOA 1UN6B 4BC7A 2EQ1A 1JK2A 2EPZA 2YTOA 3JTZA 2L92A 2EM3A 3HQ1A 4LF8E 5KL7A 3VK6A 4I8OA 2KHXA 2LVHA 2YTFA 5AC5A 4KHPE 2DLKA 5TSEA 4DV5E 2VE7C 3K6QA 2L3JA 1PJQA 4K0KE 1YZ9A 4HTGA 4FK5C 2EPCA 4M30A 1ZBQA 4R2EA 2LRSA 3ADLA 2LE2A 1WHNA 5LLQA 2EOIA 2UXBE 1GTKA 3THOB 2JY9A 2UUCE 1FJGE 2DLQA 1TF3A 2EOOA 2UU9E 5A69A 2L8TA 2MKDA 4NXNE 1UBDC 2F8BA 3C4BA 2YTQA 1STUA 4JI1E 2FGGA 4J8ZA 3TQMA 2EM4A 2EL6A 2ENAA 2ELYA 1O0WA 1L4SA 4BHCA 4R2AA 3T1YE 2JPAA 2EP3A 4TUIA 1I94E 4BS9A 2DSYA 2LBSB 4JI4E 5A6BD 1Z1BA 2GLIA 1GZ6A 2EQ0A 2EOHA 2BBGA 1FKAE 4Q35B 4R03A 2EN3A 3AV0A 2EN4A 2EE8A 2MC6A 4RHBB 2N8XA 4YY3E 1T39A 5KL2A 4AQYE 1PKPA 4GZNC 1IBKE 4BHBA 2EPKX 1EKZA 2NA2A 5A2QC 4JYAE 2YZTA 4DKKA 4DV1E 1X6FA 4DV6E 2YRHA 1EH7A 2YTJA 2YRMA 3L00A 2LMZA 4GEQB 2JVAA 2DMIA 1XMQE 2YTPA 4DV7E 1A1JA 4LF6E 4DR4E 2HGHA 2ELZA 3ECRA 3F6GA 3F6HA 2JOBA 2L2NA 2EM0A 2EORA 2EPMX 2WBSA 2CT1A 1T4OA 4DR2E 1PJSA 2EL4A 2ENCA 1XNRE 3H09A 5LL6R 4KWYA 2YT4A 4ZYHA 4F6MA 3THNA 1YSAC 4IJDA 5ADZA 2EOZA 1X48A 5AASA 1IBLE 4KZSA 1J26A 2EN7A 4NHRA 2EMAA 1RQ0A 2EPPA 1T38A 1X5WA 1YUIA 2L3CA 2NUEA 4JV5E 2Q8UA 4R2DA 5F3WA 2M1SA 2YWQA 3KWRA 1EH8A 2EMGA 2EPOA 3ADGA 2RPCA 2VQEE 2EMHA 1B69A 3LMLA 1AH5A 4OOGC 1GQEA 4F2JC 1BBGA 3MHHC 2RS6A 1ZBTA 2FTXB 2DGCA 1A1IA 3EPHA 2EPLX 2JXPA 2V87A 2MC5A 1LLMC 1YUJA 3HPSA 2PRTA 2EN6A 2YTDA 4BCAA 4LFAE 2CTDA 1QU6A 3HPZA 4DUYE 1IBME 4YHHE 2EPUA 2DIXA 1G2DC 2B3TB 3DF6A 5AE2A 4F6NA 1SR9A 3IWBA 4R2SA 4B3SE 4JI8E 3EPLA 2EM2A 2DB2A 3BBGA 4WXCA 2EPNA 2LTSA 1DI2A 3MHSC 1KYQA 5IWAE 4L8NA 4GKJE 2YTNA 4F9BB 2HHHE 2LT7A 2JOXA 3KZZA 4X8WA 1N36E 4ZYGA 4JI7E 1KJKA 2ADRA 1EH6A 4NXME 4WSPA 3J7Yp 2GPIA 1YYKA 4LFBE 1ZR9A 2WCC3 3M99B 1NEIA 4JI5E 1N34E 2LJUA 4R2QA 1G2FC 4WXDA 2GHFA 1IQSA 2UXDE 1JK1A 4O5GA 2L2KB 2ENHA 2B9DA 3MSWA 1YFHA 4R8OA 1MEYC 2KONA 2I9IA 1HR0E 3KZYA 4DR6E 3RMPA 2V86A 2UXCE 3VYXA 2HC5A 4LF7E 2EOJA 2ODRC 1N33E 2EOFA 1IMUA 3JU0A 2EOSA 2WBUA 1T4LB 1NCSA 5KL4A 4X9JA 5AE1A 3JAMC 3IWDA 2YSPA 2EZ6A 1F2IG 4HEIA 1X6EA 2UUAE 2EN8A 5LMNE 1X6HA 4B3ME 1HNZE 2E1MA 2MDRA 2JP9A 1UHZA 2HJJA 4F54A 2F4VE 2EMLA 3J80C 1X49A 4DV0E 2EMCA 1RC7A 2E5LE 3J81C 1PJTA 2LV2A 5KL6A 4P78A 2EOYA 4RH8A 5IV8B 2MDGA 2M7QA 3T1HE 3ADIA 4WYQB 2D9HA 4LTYA 4M0VA 2L6MA 2EJ4A 3EPKA 2EM7A 4TUGA 3HXLA 4Q28A 4BMJA 2V89A 2EWLA 2YU8A 1N3GA 3C4TA 2LUPB 5KL3A 2EN2A 2EMWA 3ADJA 2EL5A 5DNYA 2RSIA 3QG5C 4M9VC 4B3TE 1WHQA 2BB8A 2EM9A 3J7AG 5BR8E 2RQLA 3BGHA 2V85A 4X65E 2EMXA 4BBYA 1YYWA 1UILA 2V88A 3ZOQB 2NUFA 4OX9E 2J7JA 1A1KA 2YPNA 2EN1A 5A6KA 2NUGA 2LO3A 3DJWA 1DGCA 4IS1C 4R2PA 5A6BA 4LU9A 2H36X 5LMUE 4WFTA 4O43A 1DQ3A 3VHTB 1A1LA 2EOXA 3UK3C 2R1FA 4F9CB 3OTOE 5IXMB 2EMYA 3OMLA 4GKKE 5FLXC 2YSOA 2EMBA 4R2RA 4DV4E 1XNQE 1QNTA 4JI6E 2JWOA 4L5NC 3FIGA 3EPJA 2LUQA 3LLHA 4WPYA 2YRKA 2EOEA 2RS7A 2A25A 2LCEA 5A6AA 2G7HA 5AC4A 1IQOA 4O24A 2VF1A 2YU5A 4LFCE 2B7VA 4BC9A 2EPXA 4ZYDA 4DR7E 2NABA 1TN9A 2LJHA 1BB8A 4X66E 2EOQA 2N3GA 5A6JA 4LF4E 1PDAA 3IWCA 1N32E 2EMZA 3EQ1A 4MLQA 1WRJA 4DUZE 4DV2E 1J5EE 3HTXA 2VQFE 2EM5A 4N4RB 3VYYA 3BF2A 2WBTA 2CSHA 1ZU1A 4F9AB 1XMOE 2EPAA 1X3CA 1AAYA 2EMIA 2L33A 4NZVA 4LF5E 2KOUA 1RMDA 5CFFE 1ZAAC 3C6KA 2M4IA 1A1HA 2EMFA 5T6JA 2JR1A 4WSGA 2L2MA 4R2CA 2DMYA 1WJPA 1MGTA 2V83A 4WX9A 4DMIA 2UUBE 1YYOA 2IHR1 2DRPA 4JI0E 2EOMA 2YTEA 3BIDA 2ODRD 4LF9E 2N3HA 4B3RE 3C6MA 1T4NA 2FV4B 4JI2E 2K7IA 5IT9C 2I13A 2B7TA 4X62E 1A1FA 2VRDA 2EMKA 1HNWE 4O4KA 4DR1E 2RTXA 4MLVA 5AE3A 1P47A 4X64E 1SFEA 2EQ3A 1X47A 1WXRA 2JYAA 4DR3E 1A1GA 1TF6A 2EM8A 2YTIA 4DR5E 1HNXE 2E72A 1YPNA
chains in the Genus database with same CATH topology
1ZR9A 2WCC3 3M99B 2HGHA 2M9AA 1DGCA 4IS1C 4R2QA 2YTGA 2ELZA 1G2FC 4R2PA 2GHFA 1JK1A 2EM0A 2EORA 2WBSA 2EM6A 2CT1A 2ENHA 1MEYC 2EL4A 2ENCA 2EPRA 2EOXA 3VHTB 3UK3C 1A1LA 2R1FA 2MKNA 5KL5A 1BBOA 2EMYA 4F6MA 1UN6B 2EQ1A 1JK2A 4IJDA 1YSAC 2EPZA 2YTOA 2EOZA 2YSOA 2EM3A 2EOJA 2EMBA 4R2RA 2EN7A 2EMAA 5KL7A 2EPPA 1YUIA 2EOFA 1X5WA 2LVHA 2YTFA 2DLKA 2EOSA 2WBUA 4R2DA 3EPJA 1NCSA 5KL4A 4X9JA 4FK5C 2YRKA 2EOEA 2EPCA 2A25A 2LCEA 2YSPA 4R2EA 1F2IG 1X6EA 2EMGA 2EOIA 2YU5A 2RPCA 2EMHA 2EN8A 2EPXA 1X6HA 1B69A 2NABA 1TN9A 1BB8A 4F2JC 2DLQA 1TF3A 2EOOA 3MHHC 2EOQA 2MKDA 1UBDC 2JP9A 2YTQA 2DGCA 1A1IA 3EPHA 2EMZA 2EM4A 2EMLA 2EL6A 2ENAA 2ELYA 2EM5A 4R2AA 1LLMC 2EMCA 1YUJA 2JPAA 2EP3A 2WBTA 2CSHA 1ZU1A 2PRTA 2LV2A 2EN6A 2YTDA 5KL6A 2EPAA 1X3CA 1AAYA 2EMIA 2CTDA 2EOYA 2MDGA 1Z1BA 2GLIA 1RMDA 2EQ0A 2EPUA 1ZAAC 1G2DC 2D9HA 2EOHA 4R2SA 1A1HA 3EPLA 2EJ4A 2EM2A 2EMFA 3EPKA 2EM7A 2EN3A 4WSGA 2EN4A 2EE8A 4R2CA 1WJPA 5KL2A 2YU8A 4GZNC 2DRPA 5KL3A 2EOMA 2YTEA 3MHSC 2EN2A 2EMWA 2EL5A 2YTNA 2I13A 2RSIA 2LT7A 1A1FA 4M9VC 2VRDA 1X6FA 2EMKA 2YRHA 2BB8A 2EM9A 2YTJA 2YRMA 2EMXA 1KJKA 2ADRA 1P47A 2DMIA 2YTPA 2EQ3A 1TF6A 1A1GA 2J7JA 1A1JA 1A1KA 2EN1A 2EM8A 2YTIA 4F6NA 2E72A 2LO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZR9 A;  2WCC 3;  3M99 B;  2HGH A;  2M9A A;  1DGC A;  4IS1 C;  4R2Q A;  2YTG A;  2ELZ A;  1G2F C;  4R2P A;  2GHF A;  1JK1 A;  2EM0 A;  2EOR A;  2WBS A;  2EM6 A;  2CT1 A;  2ENH A;  1MEY C;  2EL4 A;  2ENC A;  2EPR A;  2EOX A;  3VHT B;  3UK3 C;  1A1L A;  2R1F A;  2MKN A;  5KL5 A;  1BBO A;  2EMY A;  4F6M A;  1UN6 B;  2EQ1 A;  1JK2 A;  4IJD A;  1YSA C;  2EPZ A;  2YTO A;  2EOZ A;  2YSO A;  2EM3 A;  2EOJ A;  2EMB A;  4R2R A;  2EN7 A;  2EMA A;  5KL7 A;  2EPP A;  1YUI A;  2EOF A;  1X5W A;  2LVH A;  2YTF A;  2DLK A;  2EOS A;  2WBU A;  4R2D A;  3EPJ A;  1NCS A;  5KL4 A;  4X9J A;  4FK5 C;  2YRK A;  2EOE A;  2EPC A;  2A25 A;  2LCE A;  2YSP A;  4R2E A;  1F2I G;  1X6E A;  2EMG A;  2EOI A;  2YU5 A;  2RPC A;  2EMH A;  2EN8 A;  2EPX A;  1X6H A;  1B69 A;  2NAB A;  1TN9 A;  1BB8 A;  4F2J C;  2DLQ A;  1TF3 A;  2EOO A;  3MHH C;  2EOQ A;  2MKD A;  1UBD C;  2JP9 A;  2YTQ A;  2DGC A;  1A1I A;  3EPH A;  2EMZ A;  2EM4 A;  2EML A;  2EL6 A;  2ENA A;  2ELY A;  2EM5 A;  4R2A A;  1LLM C;  2EMC A;  1YUJ A;  2JPA A;  2EP3 A;  2WBT A;  2CSH A;  1ZU1 A;  2PRT A;  2LV2 A;  2EN6 A;  2YTD A;  5KL6 A;  2EPA A;  1X3C A;  1AAY A;  2EMI A;  2CTD A;  2EOY A;  2MDG A;  1Z1B A;  2GLI A;  1RMD A;  2EQ0 A;  2EPU A;  1ZAA C;  1G2D C;  2D9H A;  2EOH A;  4R2S A;  1A1H A;  3EPL A;  2EJ4 A;  2EM2 A;  2EMF A;  3EPK A;  2EM7 A;  2EN3 A;  4WSG A;  2EN4 A;  2EE8 A;  4R2C A;  1WJP A;  5KL2 A;  2YU8 A;  4GZN C;  2DRP A;  5KL3 A;  2EOM A;  2YTE A;  3MHS C;  2EN2 A;  2EMW A;  2EL5 A;  2YTN A;  2I13 A;  2RSI A;  2LT7 A;  1A1F A;  4M9V C;  2VRD A;  1X6F A;  2EMK A;  2YRH A;  2BB8 A;  2EM9 A;  2YTJ A;  2YRM A;  2EMX A;  1KJK A;  2ADR A;  1P47 A;  2DMI A;  2YTP A;  2EQ3 A;  1TF6 A;  1A1G A;  2J7J A;  1A1J A;  1A1K A;  2EN1 A;  2EM8 A;  2YTI A;  4F6N A;  2E72 A;  2LO3 A; 
#chains in the Genus database with same CATH topology
 3P1X A;  2M9A A;  4ZYE A;  2ZM6 E;  4P7D A;  2WZO A;  2YTG A;  4M2Z A;  2RSM A;  2CPN A;  2LTR A;  4JI3 E;  3AUZ A;  2EM6 A;  2MKN A;  2EPR A;  2K4V A;  4DV3 E;  2V8Q B;  2R76 A;  5KL5 A;  1BBO A;  1UN6 B;  4BC7 A;  2EQ1 A;  1JK2 A;  2EPZ A;  2YTO A;  3JTZ A;  2L92 A;  2EM3 A;  3HQ1 A;  4LF8 E;  5KL7 A;  3VK6 A;  4I8O A;  2KHX A;  2LVH A;  2YTF A;  5AC5 A;  4KHP E;  2DLK A;  5TSE A;  4DV5 E;  2VE7 C;  3K6Q A;  2L3J A;  1PJQ A;  4K0K E;  1YZ9 A;  4HTG A;  4FK5 C;  2EPC A;  4M30 A;  1ZBQ A;  4R2E A;  2LRS A;  3ADL A;  2LE2 A;  1WHN A;  5LLQ A;  2EOI A;  2UXB E;  1GTK A;  3THO B;  2JY9 A;  2UUC E;  1FJG E;  2DLQ A;  1TF3 A;  2EOO A;  2UU9 E;  5A69 A;  2L8T A;  2MKD A;  4NXN E;  1UBD C;  2F8B A;  3C4B A;  2YTQ A;  1STU A;  4JI1 E;  2FGG A;  4J8Z A;  3TQM A;  2EM4 A;  2EL6 A;  2ENA A;  2ELY A;  1O0W A;  1L4S A;  4BHC A;  4R2A A;  3T1Y E;  2JPA A;  2EP3 A;  4TUI A;  1I94 E;  4BS9 A;  2DSY A;  2LBS B;  4JI4 E;  5A6B D;  1Z1B A;  2GLI A;  1GZ6 A;  2EQ0 A;  2EOH A;  2BBG A;  1FKA E;  4Q35 B;  4R03 A;  2EN3 A;  3AV0 A;  2EN4 A;  2EE8 A;  2MC6 A;  4RHB B;  2N8X A;  4YY3 E;  1T39 A;  5KL2 A;  4AQY E;  1PKP A;  4GZN C;  1IBK E;  4BHB A;  2EPK X;  1EKZ A;  2NA2 A;  5A2Q C;  4JYA E;  2YZT A;  4DKK A;  4DV1 E;  1X6F A;  4DV6 E;  2YRH A;  1EH7 A;  2YTJ A;  2YRM A;  3L00 A;  2LMZ A;  4GEQ B;  2JVA A;  2DMI A;  1XMQ E;  2YTP A;  4DV7 E;  1A1J A;  4LF6 E;  4DR4 E;  2HGH A;  2ELZ A;  3ECR A;  3F6G A;  3F6H A;  2JOB A;  2L2N A;  2EM0 A;  2EOR A;  2EPM X;  2WBS A;  2CT1 A;  1T4O A;  4DR2 E;  1PJS A;  2EL4 A;  2ENC A;  1XNR E;  3H09 A;  5LL6 R;  4KWY A;  2YT4 A;  4ZYH A;  4F6M A;  3THN A;  1YSA C;  4IJD A;  5ADZ A;  2EOZ A;  1X48 A;  5AAS A;  1IBL E;  4KZS A;  1J26 A;  2EN7 A;  4NHR A;  2EMA A;  1RQ0 A;  2EPP A;  1T38 A;  1X5W A;  1YUI A;  2L3C A;  2NUE A;  4JV5 E;  2Q8U A;  4R2D A;  5F3W A;  2M1S A;  2YWQ A;  3KWR A;  1EH8 A;  2EMG A;  2EPO A;  3ADG A;  2RPC A;  2VQE E;  2EMH A;  1B69 A;  3LML A;  1AH5 A;  4OOG C;  1GQE A;  4F2J C;  1BBG A;  3MHH C;  2RS6 A;  1ZBT A;  2FTX B;  2DGC A;  1A1I A;  3EPH A;  2EPL X;  2JXP A;  2V87 A;  2MC5 A;  1LLM C;  1YUJ A;  3HPS A;  2PRT A;  2EN6 A;  2YTD A;  4BCA A;  4LFA E;  2CTD A;  1QU6 A;  3HPZ A;  4DUY E;  1IBM E;  4YHH E;  2EPU A;  2DIX A;  1G2D C;  2B3T B;  3DF6 A;  5AE2 A;  4F6N A;  1SR9 A;  3IWB A;  4R2S A;  4B3S E;  4JI8 E;  3EPL A;  2EM2 A;  2DB2 A;  3BBG A;  4WXC A;  2EPN A;  2LTS A;  1DI2 A;  3MHS C;  1KYQ A;  5IWA E;  4L8N A;  4GKJ E;  2YTN A;  4F9B B;  2HHH E;  2LT7 A;  2JOX A;  3KZZ A;  4X8W A;  1N36 E;  4ZYG A;  4JI7 E;  1KJK A;  2ADR A;  1EH6 A;  4NXM E;  4WSP A;  3J7Y p;  2GPI A;  1YYK A;  4LFB E;  1ZR9 A;  2WCC 3;  3M99 B;  1NEI A;  4JI5 E;  1N34 E;  2LJU A;  4R2Q A;  1G2F C;  4WXD A;  2GHF A;  1IQS A;  2UXD E;  1JK1 A;  4O5G A;  2L2K B;  2ENH A;  2B9D A;  3MSW A;  1YFH A;  4R8O A;  1MEY C;  2KON A;  2I9I A;  1HR0 E;  3KZY A;  4DR6 E;  3RMP A;  2V86 A;  2UXC E;  3VYX A;  2HC5 A;  4LF7 E;  2EOJ A;  2ODR C;  1N33 E;  2EOF A;  1IMU A;  3JU0 A;  2EOS A;  2WBU A;  1T4L B;  1NCS A;  5KL4 A;  4X9J A;  5AE1 A;  3JAM C;  3IWD A;  2YSP A;  2EZ6 A;  1F2I G;  4HEI A;  1X6E A;  2UUA E;  2EN8 A;  5LMN E;  1X6H A;  4B3M E;  1HNZ E;  2E1M A;  2MDR A;  2JP9 A;  1UHZ A;  2HJJ A;  4F54 A;  2F4V E;  2EML A;  3J80 C;  1X49 A;  4DV0 E;  2EMC A;  1RC7 A;  2E5L E;  3J81 C;  1PJT A;  2LV2 A;  5KL6 A;  4P78 A;  2EOY A;  4RH8 A;  5IV8 B;  2MDG A;  2M7Q A;  3T1H E;  3ADI A;  4WYQ B;  2D9H A;  4LTY A;  4M0V A;  2L6M A;  2EJ4 A;  3EPK A;  2EM7 A;  4TUG A;  3HXL A;  4Q28 A;  4BMJ A;  2V89 A;  2EWL A;  2YU8 A;  1N3G A;  3C4T A;  2LUP B;  5KL3 A;  2EN2 A;  2EMW A;  3ADJ A;  2EL5 A;  5DNY A;  2RSI A;  3QG5 C;  4M9V C;  4B3T E;  1WHQ A;  2BB8 A;  2EM9 A;  3J7A G;  5BR8 E;  2RQL A;  3BGH A;  2V85 A;  4X65 E;  2EMX A;  4BBY A;  1YYW A;  1UIL A;  2V88 A;  3ZOQ B;  2NUF A;  4OX9 E;  2J7J A;  1A1K A;  2YPN A;  2EN1 A;  5A6K A;  2NUG A;  2LO3 A;  3DJW A;  1DGC A;  4IS1 C;  4R2P A;  5A6B A;  4LU9 A;  2H36 X;  5LMU E;  4WFT A;  4O43 A;  1DQ3 A;  3VHT B;  1A1L A;  2EOX A;  3UK3 C;  2R1F A;  4F9C B;  3OTO E;  5IXM B;  2EMY A;  3OML A;  4GKK E;  5FLX C;  2YSO A;  2EMB A;  4R2R A;  4DV4 E;  1XNQ E;  1QNT A;  4JI6 E;  2JWO A;  4L5N C;  3FIG A;  3EPJ A;  2LUQ A;  3LLH A;  4WPY A;  2YRK A;  2EOE A;  2RS7 A;  2A25 A;  2LCE A;  5A6A A;  2G7H A;  5AC4 A;  1IQO A;  4O24 A;  2VF1 A;  2YU5 A;  4LFC E;  2B7V A;  4BC9 A;  2EPX A;  4ZYD A;  4DR7 E;  2NAB A;  1TN9 A;  2LJH A;  1BB8 A;  4X66 E;  2EOQ A;  2N3G A;  5A6J A;  4LF4 E;  1PDA A;  3IWC A;  1N32 E;  2EMZ A;  3EQ1 A;  4MLQ A;  1WRJ A;  4DUZ E;  4DV2 E;  1J5E E;  3HTX A;  2VQF E;  2EM5 A;  4N4R B;  3VYY A;  3BF2 A;  2WBT A;  2CSH A;  1ZU1 A;  4F9A B;  1XMO E;  2EPA A;  1X3C A;  1AAY A;  2EMI A;  2L33 A;  4NZV A;  4LF5 E;  2KOU A;  1RMD A;  5CFF E;  1ZAA C;  3C6K A;  2M4I A;  1A1H A;  2EMF A;  5T6J A;  2JR1 A;  4WSG A;  2L2M A;  4R2C A;  2DMY A;  1WJP A;  1MGT A;  2V83 A;  4WX9 A;  4DMI A;  2UUB E;  1YYO A;  2IHR 1;  2DRP A;  4JI0 E;  2EOM A;  2YTE A;  3BID A;  2ODR D;  4LF9 E;  2N3H A;  4B3R E;  3C6M A;  1T4N A;  2FV4 B;  4JI2 E;  2K7I A;  5IT9 C;  2I13 A;  2B7T A;  4X62 E;  1A1F A;  2VRD A;  2EMK A;  1HNW E;  4O4K A;  4DR1 E;  2RTX A;  4MLV A;  5AE3 A;  1P47 A;  4X64 E;  1SFE A;  2EQ3 A;  1X47 A;  1WXR A;  2JYA A;  4DR3 E;  1A1G A;  1TF6 A;  2EM8 A;  2YTI A;  4DR5 E;  1HNX E;  2E72 A;  1YPN A; 
#chains in the Genus database with same CATH homology
 1ZR9 A;  2WCC 3;  3M99 B;  2HGH A;  2M9A A;  1DGC A;  4IS1 C;  4R2Q A;  2YTG A;  2ELZ A;  1G2F C;  4R2P A;  2GHF A;  1JK1 A;  2EM0 A;  2EOR A;  2WBS A;  2EM6 A;  2CT1 A;  2ENH A;  1MEY C;  2EL4 A;  2ENC A;  2EPR A;  2EOX A;  3VHT B;  3UK3 C;  1A1L A;  2R1F A;  2MKN A;  5KL5 A;  1BBO A;  2EMY A;  4F6M A;  1UN6 B;  2EQ1 A;  1JK2 A;  4IJD A;  1YSA C;  2EPZ A;  2YTO A;  2EOZ A;  2YSO A;  2EM3 A;  2EOJ A;  2EMB A;  4R2R A;  2EN7 A;  2EMA A;  5KL7 A;  2EPP A;  1YUI A;  2EOF A;  1X5W A;  2LVH A;  2YTF A;  2DLK A;  2EOS A;  2WBU A;  4R2D A;  3EPJ A;  1NCS A;  5KL4 A;  4X9J A;  4FK5 C;  2YRK A;  2EOE A;  2EPC A;  2A25 A;  2LCE A;  2YSP A;  4R2E A;  1F2I G;  1X6E A;  2EMG A;  2EOI A;  2YU5 A;  2RPC A;  2EMH A;  2EN8 A;  2EPX A;  1X6H A;  1B69 A;  2NAB A;  1TN9 A;  1BB8 A;  4F2J C;  2DLQ A;  1TF3 A;  2EOO A;  3MHH C;  2EOQ A;  2MKD A;  1UBD C;  2JP9 A;  2YTQ A;  2DGC A;  1A1I A;  3EPH A;  2EMZ A;  2EM4 A;  2EML A;  2EL6 A;  2ENA A;  2ELY A;  2EM5 A;  4R2A A;  1LLM C;  2EMC A;  1YUJ A;  2JPA A;  2EP3 A;  2WBT A;  2CSH A;  1ZU1 A;  2PRT A;  2LV2 A;  2EN6 A;  2YTD A;  5KL6 A;  2EPA A;  1X3C A;  1AAY A;  2EMI A;  2CTD A;  2EOY A;  2MDG A;  1Z1B A;  2GLI A;  1RMD A;  2EQ0 A;  2EPU A;  1ZAA C;  1G2D C;  2D9H A;  2EOH A;  4R2S A;  1A1H A;  3EPL A;  2EJ4 A;  2EM2 A;  2EMF A;  3EPK A;  2EM7 A;  2EN3 A;  4WSG A;  2EN4 A;  2EE8 A;  4R2C A;  1WJP A;  5KL2 A;  2YU8 A;  4GZN C;  2DRP A;  5KL3 A;  2EOM A;  2YTE A;  3MHS C;  2EN2 A;  2EMW A;  2EL5 A;  2YTN A;  2I13 A;  2RSI A;  2LT7 A;  1A1F A;  4M9V C;  2VRD A;  1X6F A;  2EMK A;  2YRH A;  2BB8 A;  2EM9 A;  2YTJ A;  2YRM A;  2EMX A;  1KJK A;  2ADR A;  1P47 A;  2DMI A;  2YTP A;  2EQ3 A;  1TF6 A;  1A1G A;  2J7J A;  1A1J A;  1A1K A;  2EN1 A;  2EM8 A;  2YTI A;  4F6N A;  2E72 A;  2LO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...