1A1LA

Zif268 zinc finger-dna complex (gcac site)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
RPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*AP*C)-3')
total genus 28
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1lA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1lA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1lA03
2CT1A 2EN8A 2JPAA 1YSAC 2EQ1A 1UN6B 2RSIA 4R2PA 2EN3A 2R1FA 2EM2A 1TF3A 2BB8A 2EMBA 2YSPA 4R2CA 5KL5A 2ENHA 2LT7A 2EN7A 2EN1A 2EPXA 2EPZA 4X9JA 2DLQA 2DLKA 2DMIA 2EL6A 2EOOA 4WSGA 2EMZA 1KJKA 2EM3A 2YTFA 4R2DA 2HGHA 1Z1BA 2ENCA 4IS1C 3UK3C 4R2RA 1B69A 2EL5A 1NCSA 1A1JA 2EM8A 2EMLA 1X5WA 2LO3A 1BB8A 2EOXA 2M9AA 2EM0A 2ELYA 1P47A 2EOSA 3M99B 2EQ3A 2EOFA 5KL2A 2EOZA 2YTIA 4FK5C 4IJDA 2YTNA 1AAYA 2YRMA 3EPHA 2WBSA 2EOMA 2LCEA 2CTDA 2EMFA 2EOJA 5KL3A 3EPKA 2JP9A 2YSOA 1X6HA 5KL6A 2GHFA 2EOEA 2EJ4A 5KL4A 2WBUA 2EMIA 2EOYA 4F6MA 1ZR9A 1G2DC 2RPCA 1G2FC 1DGCA 2LVHA 1RMDA 2YTGA 1F2IG 2YTJA 1MEYC 2WBTA 2YRHA 2A25A 2ADRA 1X6EA 2D9HA 2EOHA 4R2EA 2EMGA 2YU8A 1YUIA 1LLMC 2EMYA 1A1IA 1TF6A 4R2AA 2EOQA 2WCC3 1UBDC 2EMWA 3MHHC 2EE8A 2EM9A 2EN6A 2PRTA 2EMAA 2VRDA 2EMHA 3EPLA 2GLIA 2E72A 2EP3A 2EORA 1ZU1A 2EMKA 2YTEA 3EPJA 1X6FA 1BBOA 2YTDA 2MKNA 2EM6A 2ENAA 1TN9A 2DRPA 4GZNC 2I13A 2EN2A 2EM7A 2EN4A 2MKDA 1A1HA 2EM4A 2YTQA 2EPCA 2EMXA 2LV2A 2MDGA 2EQ0A 1JK2A 3MHSC 5KL7A 2EMCA 4R2QA 2EL4A 2EM5A 1A1GA 2EPUA 2NABA 1A1KA 1A1FA 2DGCA 3VHTB 2CSHA 4R2SA 2YRKA 2ELZA 1YUJA 4M9VC 2YTOA 1JK1A 2EPAA 2J7JA 4F6NA 2YTPA 1A1LA 4F2JC 1ZAAC 2EPPA 1X3CA 2EPRA 2EOIA 2YU5A 1WJPA
chains in the Genus database with same CATH superfamily
1T38A 2JPAA 2L3JA 2EQ1A 3IWCA 3JTZA 2RSIA 4BCAA 3ADLA 3JAMC 4DV4E 2R1FA 2DIXA 5AC5A 5IXMB 4ZYEA 4OOGC 4R2CA 3J81C 1WHNA 4N4RB 1WXRA 2UUCE 2L6MA 2V85A 2LJHA 1QNTA 2DSYA 4X9JA 3K6QA 2DMIA 1T4NA 5T6JA 2HGHA 2UUBE 1XNQE 1PKPA 4R2RA 1B69A 2EL5A 1EKZA 1A1JA 4NXME 2JWOA 2EPNA 3ADJA 4X62E 1EH8A 4RH8A 2ELYA 3M99B 5ADZA 1XNRE 2YT4A 1IBME 3EPHA 2LE2A 4DKKA 4L5NC 2RS7A 3HXLA 5A6AA 2YSOA 2NUGA 2MC5A 2EOEA 5KL4A 4DV3E 4F6MA 4DR7E 2H36X 4LF7E 2LVHA 5F3WA 4HEIA 3THOB 1MEYC 4KWYA 2LBSB 5FLXC 2A25A 2V88A 2KHXA 2L8TA 2KONA 1XMOE 1YUIA 4DR6E 1IMUA 2LRSA 4JI1E 2EOQA 3MHHC 2DB2A 2EN6A 3DF6A 2PRTA 4GKJE 2EP3A 4WPYA 1ZBTA 2YTEA 2JYAA 3EPJA 2EPMX 3L00A 1TN9A 2EN2A 2EM7A 2MKDA 1WRJA 1PJSA 2EPCA 2N3GA 2MDGA 4NHRA 1JK2A 3AV0A 3MHSC 5A6BA 2EPOA 3OTOE 1WHQA 2EL4A 4DV7E 1IQOA 1ZBQA 1A1GA 4Q35B 3THNA 1N36E 2MC6A 3F6HA 3FIGA 2JOBA 1JK1A 3JU0A 2L2KB 4JI4E 1X48A 2EPRA 1HNWE 4DR5E 3BF2A 1T4OA 2EN8A 2LTRA 2F4VE 3H09A 5IT9C 2V89A 2L33A 2BB8A 1RC7A 4O5GA 2EMBA 2CPNA 5KL5A 2ENHA 1QU6A 4DV5E 2EN7A 2MDRA 2UXDE 1N3GA 1SR9A 4B3TE 1YYWA 1IBLE 2DLKA 2EMZA 3C6MA 2UXBE 2ENCA 4DV1E 1PJQA 4MLVA 4R8OA 4JI8E 1X5WA 2LO3A 1BB8A 2EOXA 2FV4B 2RS6A 2JOXA 2K4VA 2EQ3A 3VYXA 1T4LB 1GZ6A 2FTXB 4FK5C 3DJWA 4F9BB 4X8WA 4WXDA 2LTSA 4TUIA 2CTDA 2EOJA 3EPKA 2JP9A 1J26A 4X65E 1KYQA 1X6HA 4JV5E 1ZR9A 1G2DC 1FKAE 2RPCA 4DUZE 3J7Yp 1RMDA 4L8NA 2YTJA 4DR4E 4R03A 4ZYHA 2D9HA 2EOHA 4R2EA 1YYOA 2UUAE 4JYAE 1N33E 4X64E 1A1IA 4R2AA 2WCC3 4BMJA 1UBDC 2EMWA 4JI5E 2EM9A 4DR1E 1RQ0A 2VRDA 2GLIA 4LTYA 3TQMA 3VYYA 1X6FA 2YTDA 2V83A 2EM6A 4JI2E 4GZNC 3F6GA 3C6KA 4P7DA 5A6KA 4O4KA 4JI7E 1AH5A 2NUFA 2BBGA 4B3ME 2KOUA 1HNXE 2ODRC 3VHTB 3LLHA 2ELZA 3HQ1A 5CFFE 1A1LA 1IBKE 1BBGA 2EPPA 2LJUA 2B7TA 1EH6A 2HC5A 2RQLA 2DMYA 3C4BA 5AASA 1UN6B 1TF3A 2JY9A 2ODRD 4F54A 2M4IA 2FGGA 2G7HA 4DMIA 4MLQA 1GTKA 2EN1A 3BGHA 1DI2A 2EPZA 2DLQA 1PDAA 3IWBA 1X47A 4WSGA 1YZ9A 2JVAA 2YTFA 4R2DA 2NA2A 1Z1BA 4BHCA 4O43A 4IS1C 3UK3C 1HR0E 1NCSA 1IQSA 3T1HE 2L3CA 2EM8A 4GEQB 2L2MA 1O0WA 3KZYA 2GPIA 2M9AA 2EM0A 1EH7A 2EOSA 2I9IA 2LUQA 4DV2E 4M2ZA 2EOFA 4ZYDA 2B9DA 2EOZA 3J80C 2YTIA 4IJDA 2YTNA 1AAYA 2YRMA 2WBSA 2EOMA 3LMLA 4KZSA 2EMFA 3HPZA 4LF4E 2GHFA 2K7IA 1PJTA 2EOYA 5AC4A 4F9CB 1G2FC 4X66E 2EZ6A 2VE7C 2WBTA 2B3TB 2Q8UA 2ADRA 2RSMA 5LLQA 2EMGA 3BBGA 2EPLX 2IHR1 4DR3E 1TF6A 2N3HA 4M0VA 4AQYE 4ZYGA 2B7VA 2EMAA 3EPLA 4WSPA 5A69A 2EORA 1ZU1A 2EMKA 1YPNA 2HHHE 1BBOA 2UXCE 2MKNA 4LF9E 2ENAA 2DRPA 2I13A 2JR1A 2V8QB 1HNZE 1A1HA 2RTXA 2EM4A 2YTQA 2EMXA 2LMZA 2LV2A 2EMCA 4R2QA 1YFHA 4K0KE 2EPUA 2NABA 1X49A 1A1KA 1A1FA 2UU9E 4DV0E 4R2SA 4LF5E 2EPAA 2J7JA 5BR8E 4F2JC 1ZAAC 1NEIA 3VK6A 4LFAE 3HPSA 3ECRA 2YU5A 2JXPA 4RHBB 1UHZA 2CT1A 1YSAC 1DQ3A 1UILA 1YYKA 4R2PA 2EN3A 2ZM6E 2EM2A 2N8XA 5A2QC 1J5EE 2YSPA 4YHHE 4OX9E 2F8BA 4Q28A 2LT7A 3ZOQB 2EPXA 4JI6E 4NZVA 1FJGE 1STUA 2EL6A 2EOOA 5A6BD 3J7AG 1KJKA 2EM3A 2NUEA 4P78A 2V86A 3RMPA 3MSWA 4DV6E 4WXCA 5DNYA 2VQEE 4B3RE 5IWAE 2EMLA 1T39A 4JI3E 4M30A 4LF8E 2LUPB 1P47A 4F9AB 4BC7A 5KL2A 2EWLA 2WZOA 2L2NA 4B3SE 2E1MA 2R76A 1I94E 4DR2E 2LCEA 5KL3A 4WFTA 2YPNA 3ADIA 2V87A 5KL6A 3C4TA 1GQEA 2EJ4A 4J8ZA 4LFCE 1SFEA 2WBUA 2EMIA 4LFBE 1DGCA 2M7QA 2YTGA 1F2IG 5A6JA 2YRHA 4BS9A 2E5LE 1X6EA 2YU8A 3IWDA 4I8OA 1LLMC 2EMYA 4KHPE 5TSEA 2EE8A 4HTGA 4NXNE 1N32E 2EMHA 2E72A 3BIDA 4WYQB 3T1YE 1N34E 4LU9A 4BC9A 4WX9A 2EPKX 5LMNE 3EQ1A 3KZZA 1MGTA 2EN4A 5IV8B 2M1SA 3P1XA 4O24A 4BHBA 5LMUE 4GKKE 4BBYA 1L4SA 3HTXA 2EQ0A 3ADGA 5KL7A 2YZTA 4YY3E 4LF6E 2EM5A 5LL6R 2VF1A 3AUZA 2VQFE 2DGCA 2CSHA 2YRKA 5AE2A 1YUJA 2YWQA 2HJJA 2YTOA 4JI0E 4M9VC 4F6NA 4TUGA 2YTPA 4DUYE 2L92A 3OMLA 1X3CA 5AE3A 3KWRA 5AE1A 2EOIA 1XMQE 1WJPA 3QG5C
chains in the Genus database with same CATH topology
2CT1A 2EN8A 2JPAA 1YSAC 2EQ1A 1UN6B 2RSIA 4R2PA 2EN3A 2R1FA 2EM2A 1TF3A 2BB8A 2EMBA 2YSPA 4R2CA 5KL5A 2ENHA 2LT7A 2EN7A 2EN1A 2EPXA 2EPZA 4X9JA 2DLQA 2DLKA 2DMIA 2EL6A 2EOOA 4WSGA 2EMZA 1KJKA 2EM3A 2YTFA 4R2DA 2HGHA 1Z1BA 2ENCA 4IS1C 3UK3C 4R2RA 1B69A 2EL5A 1NCSA 1A1JA 2EM8A 2EMLA 1X5WA 2LO3A 1BB8A 2EOXA 2M9AA 2EM0A 2ELYA 1P47A 2EOSA 3M99B 2EQ3A 2EOFA 5KL2A 2EOZA 2YTIA 4FK5C 4IJDA 2YTNA 1AAYA 2YRMA 3EPHA 2WBSA 2EOMA 2LCEA 2CTDA 2EMFA 2EOJA 5KL3A 3EPKA 2JP9A 2YSOA 1X6HA 5KL6A 2GHFA 2EOEA 2EJ4A 5KL4A 2WBUA 2EMIA 2EOYA 4F6MA 1ZR9A 1G2DC 2RPCA 1G2FC 1DGCA 2LVHA 1RMDA 2YTGA 1F2IG 2YTJA 1MEYC 2WBTA 2YRHA 2A25A 2ADRA 1X6EA 2D9HA 2EOHA 4R2EA 2EMGA 2YU8A 1YUIA 1LLMC 2EMYA 1A1IA 1TF6A 4R2AA 2EOQA 2WCC3 1UBDC 2EMWA 3MHHC 2EE8A 2EM9A 2EN6A 2PRTA 2EMAA 2VRDA 2EMHA 3EPLA 2GLIA 2E72A 2EP3A 2EORA 1ZU1A 2EMKA 2YTEA 3EPJA 1X6FA 1BBOA 2YTDA 2MKNA 2EM6A 2ENAA 1TN9A 2DRPA 4GZNC 2I13A 2EN2A 2EM7A 2EN4A 2MKDA 1A1HA 2EM4A 2YTQA 2EPCA 2EMXA 2LV2A 2MDGA 2EQ0A 1JK2A 3MHSC 5KL7A 2EMCA 4R2QA 2EL4A 2EM5A 1A1GA 2EPUA 2NABA 1A1KA 1A1FA 2DGCA 3VHTB 2CSHA 4R2SA 2YRKA 2ELZA 1YUJA 4M9VC 2YTOA 1JK1A 2EPAA 2J7JA 4F6NA 2YTPA 1A1LA 4F2JC 1ZAAC 2EPPA 1X3CA 2EPRA 2EOIA 2YU5A 1WJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CT1 A;  2EN8 A;  2JPA A;  1YSA C;  2EQ1 A;  1UN6 B;  2RSI A;  4R2P A;  2EN3 A;  2R1F A;  2EM2 A;  1TF3 A;  2BB8 A;  2EMB A;  2YSP A;  4R2C A;  5KL5 A;  2ENH A;  2LT7 A;  2EN7 A;  2EN1 A;  2EPX A;  2EPZ A;  4X9J A;  2DLQ A;  2DLK A;  2DMI A;  2EL6 A;  2EOO A;  4WSG A;  2EMZ A;  1KJK A;  2EM3 A;  2YTF A;  4R2D A;  2HGH A;  1Z1B A;  2ENC A;  4IS1 C;  3UK3 C;  4R2R A;  1B69 A;  2EL5 A;  1NCS A;  1A1J A;  2EM8 A;  2EML A;  1X5W A;  2LO3 A;  1BB8 A;  2EOX A;  2M9A A;  2EM0 A;  2ELY A;  1P47 A;  2EOS A;  3M99 B;  2EQ3 A;  2EOF A;  5KL2 A;  2EOZ A;  2YTI A;  4FK5 C;  4IJD A;  2YTN A;  1AAY A;  2YRM A;  3EPH A;  2WBS A;  2EOM A;  2LCE A;  2CTD A;  2EMF A;  2EOJ A;  5KL3 A;  3EPK A;  2JP9 A;  2YSO A;  1X6H A;  5KL6 A;  2GHF A;  2EOE A;  2EJ4 A;  5KL4 A;  2WBU A;  2EMI A;  2EOY A;  4F6M A;  1ZR9 A;  1G2D C;  2RPC A;  1G2F C;  1DGC A;  2LVH A;  1RMD A;  2YTG A;  1F2I G;  2YTJ A;  1MEY C;  2WBT A;  2YRH A;  2A25 A;  2ADR A;  1X6E A;  2D9H A;  2EOH A;  4R2E A;  2EMG A;  2YU8 A;  1YUI A;  1LLM C;  2EMY A;  1A1I A;  1TF6 A;  4R2A A;  2EOQ A;  2WCC 3;  1UBD C;  2EMW A;  3MHH C;  2EE8 A;  2EM9 A;  2EN6 A;  2PRT A;  2EMA A;  2VRD A;  2EMH A;  3EPL A;  2GLI A;  2E72 A;  2EP3 A;  2EOR A;  1ZU1 A;  2EMK A;  2YTE A;  3EPJ A;  1X6F A;  1BBO A;  2YTD A;  2MKN A;  2EM6 A;  2ENA A;  1TN9 A;  2DRP A;  4GZN C;  2I13 A;  2EN2 A;  2EM7 A;  2EN4 A;  2MKD A;  1A1H A;  2EM4 A;  2YTQ A;  2EPC A;  2EMX A;  2LV2 A;  2MDG A;  2EQ0 A;  1JK2 A;  3MHS C;  5KL7 A;  2EMC A;  4R2Q A;  2EL4 A;  2EM5 A;  1A1G A;  2EPU A;  2NAB A;  1A1K A;  1A1F A;  2DGC A;  3VHT B;  2CSH A;  4R2S A;  2YRK A;  2ELZ A;  1YUJ A;  4M9V C;  2YTO A;  1JK1 A;  2EPA A;  2J7J A;  4F6N A;  2YTP A;  1A1L A;  4F2J C;  1ZAA C;  2EPP A;  1X3C A;  2EPR A;  2EOI A;  2YU5 A;  1WJP A; 
#chains in the Genus database with same CATH topology
 1T38 A;  2JPA A;  2L3J A;  2EQ1 A;  3IWC A;  3JTZ A;  2RSI A;  4BCA A;  3ADL A;  3JAM C;  4DV4 E;  2R1F A;  2DIX A;  5AC5 A;  5IXM B;  4ZYE A;  4OOG C;  4R2C A;  3J81 C;  1WHN A;  4N4R B;  1WXR A;  2UUC E;  2L6M A;  2V85 A;  2LJH A;  1QNT A;  2DSY A;  4X9J A;  3K6Q A;  2DMI A;  1T4N A;  5T6J A;  2HGH A;  2UUB E;  1XNQ E;  1PKP A;  4R2R A;  1B69 A;  2EL5 A;  1EKZ A;  1A1J A;  4NXM E;  2JWO A;  2EPN A;  3ADJ A;  4X62 E;  1EH8 A;  4RH8 A;  2ELY A;  3M99 B;  5ADZ A;  1XNR E;  2YT4 A;  1IBM E;  3EPH A;  2LE2 A;  4DKK A;  4L5N C;  2RS7 A;  3HXL A;  5A6A A;  2YSO A;  2NUG A;  2MC5 A;  2EOE A;  5KL4 A;  4DV3 E;  4F6M A;  4DR7 E;  2H36 X;  4LF7 E;  2LVH A;  5F3W A;  4HEI A;  3THO B;  1MEY C;  4KWY A;  2LBS B;  5FLX C;  2A25 A;  2V88 A;  2KHX A;  2L8T A;  2KON A;  1XMO E;  1YUI A;  4DR6 E;  1IMU A;  2LRS A;  4JI1 E;  2EOQ A;  3MHH C;  2DB2 A;  2EN6 A;  3DF6 A;  2PRT A;  4GKJ E;  2EP3 A;  4WPY A;  1ZBT A;  2YTE A;  2JYA A;  3EPJ A;  2EPM X;  3L00 A;  1TN9 A;  2EN2 A;  2EM7 A;  2MKD A;  1WRJ A;  1PJS A;  2EPC A;  2N3G A;  2MDG A;  4NHR A;  1JK2 A;  3AV0 A;  3MHS C;  5A6B A;  2EPO A;  3OTO E;  1WHQ A;  2EL4 A;  4DV7 E;  1IQO A;  1ZBQ A;  1A1G A;  4Q35 B;  3THN A;  1N36 E;  2MC6 A;  3F6H A;  3FIG A;  2JOB A;  1JK1 A;  3JU0 A;  2L2K B;  4JI4 E;  1X48 A;  2EPR A;  1HNW E;  4DR5 E;  3BF2 A;  1T4O A;  2EN8 A;  2LTR A;  2F4V E;  3H09 A;  5IT9 C;  2V89 A;  2L33 A;  2BB8 A;  1RC7 A;  4O5G A;  2EMB A;  2CPN A;  5KL5 A;  2ENH A;  1QU6 A;  4DV5 E;  2EN7 A;  2MDR A;  2UXD E;  1N3G A;  1SR9 A;  4B3T E;  1YYW A;  1IBL E;  2DLK A;  2EMZ A;  3C6M A;  2UXB E;  2ENC A;  4DV1 E;  1PJQ A;  4MLV A;  4R8O A;  4JI8 E;  1X5W A;  2LO3 A;  1BB8 A;  2EOX A;  2FV4 B;  2RS6 A;  2JOX A;  2K4V A;  2EQ3 A;  3VYX A;  1T4L B;  1GZ6 A;  2FTX B;  4FK5 C;  3DJW A;  4F9B B;  4X8W A;  4WXD A;  2LTS A;  4TUI A;  2CTD A;  2EOJ A;  3EPK A;  2JP9 A;  1J26 A;  4X65 E;  1KYQ A;  1X6H A;  4JV5 E;  1ZR9 A;  1G2D C;  1FKA E;  2RPC A;  4DUZ E;  3J7Y p;  1RMD A;  4L8N A;  2YTJ A;  4DR4 E;  4R03 A;  4ZYH A;  2D9H A;  2EOH A;  4R2E A;  1YYO A;  2UUA E;  4JYA E;  1N33 E;  4X64 E;  1A1I A;  4R2A A;  2WCC 3;  4BMJ A;  1UBD C;  2EMW A;  4JI5 E;  2EM9 A;  4DR1 E;  1RQ0 A;  2VRD A;  2GLI A;  4LTY A;  3TQM A;  3VYY A;  1X6F A;  2YTD A;  2V83 A;  2EM6 A;  4JI2 E;  4GZN C;  3F6G A;  3C6K A;  4P7D A;  5A6K A;  4O4K A;  4JI7 E;  1AH5 A;  2NUF A;  2BBG A;  4B3M E;  2KOU A;  1HNX E;  2ODR C;  3VHT B;  3LLH A;  2ELZ A;  3HQ1 A;  5CFF E;  1A1L A;  1IBK E;  1BBG A;  2EPP A;  2LJU A;  2B7T A;  1EH6 A;  2HC5 A;  2RQL A;  2DMY A;  3C4B A;  5AAS A;  1UN6 B;  1TF3 A;  2JY9 A;  2ODR D;  4F54 A;  2M4I A;  2FGG A;  2G7H A;  4DMI A;  4MLQ A;  1GTK A;  2EN1 A;  3BGH A;  1DI2 A;  2EPZ A;  2DLQ A;  1PDA A;  3IWB A;  1X47 A;  4WSG A;  1YZ9 A;  2JVA A;  2YTF A;  4R2D A;  2NA2 A;  1Z1B A;  4BHC A;  4O43 A;  4IS1 C;  3UK3 C;  1HR0 E;  1NCS A;  1IQS A;  3T1H E;  2L3C A;  2EM8 A;  4GEQ B;  2L2M A;  1O0W A;  3KZY A;  2GPI A;  2M9A A;  2EM0 A;  1EH7 A;  2EOS A;  2I9I A;  2LUQ A;  4DV2 E;  4M2Z A;  2EOF A;  4ZYD A;  2B9D A;  2EOZ A;  3J80 C;  2YTI A;  4IJD A;  2YTN A;  1AAY A;  2YRM A;  2WBS A;  2EOM A;  3LML A;  4KZS A;  2EMF A;  3HPZ A;  4LF4 E;  2GHF A;  2K7I A;  1PJT A;  2EOY A;  5AC4 A;  4F9C B;  1G2F C;  4X66 E;  2EZ6 A;  2VE7 C;  2WBT A;  2B3T B;  2Q8U A;  2ADR A;  2RSM A;  5LLQ A;  2EMG A;  3BBG A;  2EPL X;  2IHR 1;  4DR3 E;  1TF6 A;  2N3H A;  4M0V A;  4AQY E;  4ZYG A;  2B7V A;  2EMA A;  3EPL A;  4WSP A;  5A69 A;  2EOR A;  1ZU1 A;  2EMK A;  1YPN A;  2HHH E;  1BBO A;  2UXC E;  2MKN A;  4LF9 E;  2ENA A;  2DRP A;  2I13 A;  2JR1 A;  2V8Q B;  1HNZ E;  1A1H A;  2RTX A;  2EM4 A;  2YTQ A;  2EMX A;  2LMZ A;  2LV2 A;  2EMC A;  4R2Q A;  1YFH A;  4K0K E;  2EPU A;  2NAB A;  1X49 A;  1A1K A;  1A1F A;  2UU9 E;  4DV0 E;  4R2S A;  4LF5 E;  2EPA A;  2J7J A;  5BR8 E;  4F2J C;  1ZAA C;  1NEI A;  3VK6 A;  4LFA E;  3HPS A;  3ECR A;  2YU5 A;  2JXP A;  4RHB B;  1UHZ A;  2CT1 A;  1YSA C;  1DQ3 A;  1UIL A;  1YYK A;  4R2P A;  2EN3 A;  2ZM6 E;  2EM2 A;  2N8X A;  5A2Q C;  1J5E E;  2YSP A;  4YHH E;  4OX9 E;  2F8B A;  4Q28 A;  2LT7 A;  3ZOQ B;  2EPX A;  4JI6 E;  4NZV A;  1FJG E;  1STU A;  2EL6 A;  2EOO A;  5A6B D;  3J7A G;  1KJK A;  2EM3 A;  2NUE A;  4P78 A;  2V86 A;  3RMP A;  3MSW A;  4DV6 E;  4WXC A;  5DNY A;  2VQE E;  4B3R E;  5IWA E;  2EML A;  1T39 A;  4JI3 E;  4M30 A;  4LF8 E;  2LUP B;  1P47 A;  4F9A B;  4BC7 A;  5KL2 A;  2EWL A;  2WZO A;  2L2N A;  4B3S E;  2E1M A;  2R76 A;  1I94 E;  4DR2 E;  2LCE A;  5KL3 A;  4WFT A;  2YPN A;  3ADI A;  2V87 A;  5KL6 A;  3C4T A;  1GQE A;  2EJ4 A;  4J8Z A;  4LFC E;  1SFE A;  2WBU A;  2EMI A;  4LFB E;  1DGC A;  2M7Q A;  2YTG A;  1F2I G;  5A6J A;  2YRH A;  4BS9 A;  2E5L E;  1X6E A;  2YU8 A;  3IWD A;  4I8O A;  1LLM C;  2EMY A;  4KHP E;  5TSE A;  2EE8 A;  4HTG A;  4NXN E;  1N32 E;  2EMH A;  2E72 A;  3BID A;  4WYQ B;  3T1Y E;  1N34 E;  4LU9 A;  4BC9 A;  4WX9 A;  2EPK X;  5LMN E;  3EQ1 A;  3KZZ A;  1MGT A;  2EN4 A;  5IV8 B;  2M1S A;  3P1X A;  4O24 A;  4BHB A;  5LMU E;  4GKK E;  4BBY A;  1L4S A;  3HTX A;  2EQ0 A;  3ADG A;  5KL7 A;  2YZT A;  4YY3 E;  4LF6 E;  2EM5 A;  5LL6 R;  2VF1 A;  3AUZ A;  2VQF E;  2DGC A;  2CSH A;  2YRK A;  5AE2 A;  1YUJ A;  2YWQ A;  2HJJ A;  2YTO A;  4JI0 E;  4M9V C;  4F6N A;  4TUG A;  2YTP A;  4DUY E;  2L92 A;  3OML A;  1X3C A;  5AE3 A;  3KWR A;  5AE1 A;  2EOI A;  1XMQ E;  1WJP A;  3QG5 C; 
#chains in the Genus database with same CATH homology
 2CT1 A;  2EN8 A;  2JPA A;  1YSA C;  2EQ1 A;  1UN6 B;  2RSI A;  4R2P A;  2EN3 A;  2R1F A;  2EM2 A;  1TF3 A;  2BB8 A;  2EMB A;  2YSP A;  4R2C A;  5KL5 A;  2ENH A;  2LT7 A;  2EN7 A;  2EN1 A;  2EPX A;  2EPZ A;  4X9J A;  2DLQ A;  2DLK A;  2DMI A;  2EL6 A;  2EOO A;  4WSG A;  2EMZ A;  1KJK A;  2EM3 A;  2YTF A;  4R2D A;  2HGH A;  1Z1B A;  2ENC A;  4IS1 C;  3UK3 C;  4R2R A;  1B69 A;  2EL5 A;  1NCS A;  1A1J A;  2EM8 A;  2EML A;  1X5W A;  2LO3 A;  1BB8 A;  2EOX A;  2M9A A;  2EM0 A;  2ELY A;  1P47 A;  2EOS A;  3M99 B;  2EQ3 A;  2EOF A;  5KL2 A;  2EOZ A;  2YTI A;  4FK5 C;  4IJD A;  2YTN A;  1AAY A;  2YRM A;  3EPH A;  2WBS A;  2EOM A;  2LCE A;  2CTD A;  2EMF A;  2EOJ A;  5KL3 A;  3EPK A;  2JP9 A;  2YSO A;  1X6H A;  5KL6 A;  2GHF A;  2EOE A;  2EJ4 A;  5KL4 A;  2WBU A;  2EMI A;  2EOY A;  4F6M A;  1ZR9 A;  1G2D C;  2RPC A;  1G2F C;  1DGC A;  2LVH A;  1RMD A;  2YTG A;  1F2I G;  2YTJ A;  1MEY C;  2WBT A;  2YRH A;  2A25 A;  2ADR A;  1X6E A;  2D9H A;  2EOH A;  4R2E A;  2EMG A;  2YU8 A;  1YUI A;  1LLM C;  2EMY A;  1A1I A;  1TF6 A;  4R2A A;  2EOQ A;  2WCC 3;  1UBD C;  2EMW A;  3MHH C;  2EE8 A;  2EM9 A;  2EN6 A;  2PRT A;  2EMA A;  2VRD A;  2EMH A;  3EPL A;  2GLI A;  2E72 A;  2EP3 A;  2EOR A;  1ZU1 A;  2EMK A;  2YTE A;  3EPJ A;  1X6F A;  1BBO A;  2YTD A;  2MKN A;  2EM6 A;  2ENA A;  1TN9 A;  2DRP A;  4GZN C;  2I13 A;  2EN2 A;  2EM7 A;  2EN4 A;  2MKD A;  1A1H A;  2EM4 A;  2YTQ A;  2EPC A;  2EMX A;  2LV2 A;  2MDG A;  2EQ0 A;  1JK2 A;  3MHS C;  5KL7 A;  2EMC A;  4R2Q A;  2EL4 A;  2EM5 A;  1A1G A;  2EPU A;  2NAB A;  1A1K A;  1A1F A;  2DGC A;  3VHT B;  2CSH A;  4R2S A;  2YRK A;  2ELZ A;  1YUJ A;  4M9V C;  2YTO A;  1JK1 A;  2EPA A;  2J7J A;  4F6N A;  2YTP A;  1A1L A;  4F2J C;  1ZAA C;  2EPP A;  1X3C A;  2EPR A;  2EOI A;  2YU5 A;  1WJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...