1A1LA

Zif268 zinc finger-dna complex (gcac site)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
RPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*AP*C)-3')
publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 28
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1lA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1lA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1lA03
1X3CA 1DGCA 2EQ3A 1YSAC 2EQ0A 3VHTB 2EOZA 2YRKA 3UK3C 2JP9A 2DGCA 2EM7A 2EM5A 2HGHA 4R2AA 1NCSA 2EMKA 1KJKA 2ENHA 1RMDA 2LV2A 2E72A 2YTEA 2LO3A 2EN2A 1ZU1A 2A25A 2EM0A 2EOHA 3EPHA 2EOFA 2WBTA 1AAYA 2LVHA 2EPCA 4R2SA 1X6FA 3EPLA 1A1JA 2DLQA 2EMHA 2EPZA 4M9VC 1WJPA 1A1KA 1ZAAC 1JK2A 1G2DC 2EM8A 2EMFA 2EOSA 2EL5A 2YTNA 2MKDA 2EMYA 1TF6A 2EMAA 2EPRA 2EOQA 2MDGA 2LT7A 4X9JA 1ZR9A 1UBDC 2I13A 2WBUA 4IS1C 1X6EA 2JPAA 1A1HA 2ENAA 2EOYA 4R2EA 2DRPA 2DMIA 1YUJA 2EOEA 2EMBA 5KL6A 3MHSC 2EM4A 2YTOA 1BB8A 2EOMA 1F2IG 2EOXA 1MEYC 2ENCA 2EORA 4F2JC 1X5WA 2EQ1A 1LLMC 5KL4A 2EM3A 5KL2A 2YSPA 1TN9A 2EOOA 2EPXA 2YTIA 2EM6A 2EMCA 2YTPA 2EN4A 2EMXA 2EN7A 4WSGA 2EM9A 2EN1A 2EL6A 2EMZA 2YU5A 4R2PA 2RPCA 2EJ4A 2J7JA 1UN6B 2EL4A 2YRMA 4R2QA 4F6NA 2DLKA 2RSIA 5KL3A 1A1GA 2YTJA 1G2FC 2YTDA 2EOJA 2YRHA 2D9HA 2YTGA 2EN6A 5KL5A 1A1IA 2WBSA 4R2CA 2YTFA 2EM2A 2EMGA 2EMLA 2ELZA 2EN8A 2EPPA 1Z1BA 2EN3A 2M9AA 2EOIA 2GLIA 1TF3A 2EPAA 2GHFA 2CTDA 2YU8A 3EPJA 2ELYA 2NABA 1A1FA 3MHHC 2CT1A 5KL7A 3M99B 4R2RA 1P47A 2EMWA 2R1FA 1A1LA 2VRDA 2PRTA 2ADRA 1JK1A 1X6HA 1B69A 2MKNA 4GZNC 4F6MA 2EMIA 2EE8A 2EP3A 1YUIA 2WCC3 2LCEA 4R2DA 3EPKA 2YSOA 2CSHA 2EPUA 4FK5C 2BB8A 1BBOA 2YTQA 4IJDA
chains in the Genus database with same CATH superfamily
2JY9A 2EQ3A 4YHHE 2N3GA 3QG5C 4ZYDA 4DV7E 3UK3C 1KYQA 4JI8E 2L3JA 1QNTA 2EM5A 4R2AA 4F9BB 1NCSA 2HGHA 2EZ6A 3HXLA 4JV5E 2E72A 2FTXB 1ZU1A 1PKPA 2A25A 4O5GA 2LJUA 2EOHA 1AAYA 4R2SA 3IWDA 2FGGA 4B3SE 2LJHA 4M0VA 3HPSA 5AE1A 2LT7A 5ADZA 1AH5A 1FKAE 1UHZA 4BCAA 2I13A 4DUZE 1N36E 2YZTA 3HPZA 2JPAA 3JTZA 2EOYA 1YFHA 2N3HA 3KZZA 2DMIA 4P7DA 5DNYA 3J80C 1EH8A 2EMBA 2ODRC 1STUA 3T1HE 4LF5E 4F9AB 2EOXA 4KWYA 2V88A 1MGTA 4J8ZA 2LBSB 5KL4A 4ZYHA 1IQSA 4JI0E 1X47A 4LFAE 2EM6A 1J26A 2EMXA 4R03A 4WSGA 2KONA 4B3ME 2YU5A 3J7Yp 2YPNA 2DSYA 4BBYA 4F6NA 1A1GA 3LMLA 4NXNE 1SR9A 3EQ1A 4P78A 1X49A 2YRHA 2YTGA 3ADGA 2LE2A 2L6MA 2WBSA 1WHNA 4HEIA 1X48A 2EMGA 4WFTA 2I9IA 2EOIA 1XMQE 4TUIA 1TF3A 2CPNA 2V89A 2UXCE 5T6JA 3THNA 1HNWE 1NEIA 3ADIA 4GKKE 2JXPA 2CT1A 3M99B 5A69A 1T38A 1YPNA 2M1SA 3P1XA 2G7HA 2EE8A 2RSMA 4R2DA 3EPKA 5IV8B 3C4BA 1PJSA 2JR1A 2BB8A 4IJDA 1YSAC 3VHTB 5IT9C 1FJGE 2VE7C 2L92A 2EM7A 1XNQE 2EMKA 2ENHA 2LO3A 1IBLE 2UXDE 1WHQA 2EM0A 3EPHA 2EOFA 4X65E 2NUEA 1ZBQA 1X6FA 5F3WA 4JYAE 4M9VC 4O43A 2LUPB 1ZAAC 2UUBE 1WRJA 5AASA 1JK2A 2B9DA 2KOUA 4DV2E 2EMFA 2EL5A 4JI7E 2LUQA 1IQOA 1TF6A 2EPRA 2L3CA 4X9JA 5LL6R 4F9CB 2WBUA 2F8BA 1HR0E 2R76A 2L33A 1A1HA 1N33E 2RQLA 4DV1E 2EOEA 5AE3A 2DB2A 4JI2E 3L00A 4WYQB 2IHR1 2NUFA 1ZBTA 4F54A 5LMNE 3OMLA 4DR5E 1GTKA 2E1MA 2ENCA 2VQFE 1DI2A 3H09A 4JI3E 1EH7A 1LLMC 2EM3A 2YSPA 3VYYA 1TN9A 2B7TA 2H36X 2K4VA 2MDRA 2YTPA 4X8WA 4JI1E 1YZ9A 2EL6A 3THOB 2EJ4A 2J7JA 4MLQA 2EWLA 5AE2A 2EL4A 2DLKA 5CFFE 1EKZA 2YTJA 2EOJA 4LFCE 1UILA 5KL5A 4OOGC 1A1IA 2LTSA 1XNRE 2RS7A 4YY3E 2DIXA 2ELZA 2EN8A 1Z1BA 2EN3A 3BBGA 3C4TA 4LF4E 2EPAA 2GHFA 4DR1E 3AV0A 1T39A 3VYXA 2F4VE 2ZM6E 3EPJA 2DMYA 2ELYA 4JI5E 3MHHC 2B7VA 2JVAA 4MLVA 1YYOA 5KL7A 2RS6A 5IXMB 4DR6E 1SFEA 2UUAE 4LU9A 1EH6A 3DJWA 2LRSA 4LF9E 2VRDA 4DV6E 1JK1A 1B69A 4KZSA 2MC6A 2EP3A 3C6MA 3JU0A 1I94E 2EPUA 1GZ6A 1X3CA 2YWQA 3IWBA 3FIGA 1T4LB 2EOZA 2MC5A 1N32E 4DKKA 4DR2E 2DGCA 4DV5E 2E5LE 2UU9E 4WX9A 1KJKA 4JI6E 5IWAE 2YTEA 2GPIA 3HTXA 1T4OA 2WBTA 3JAMC 2EPKX 1QU6A 2JYAA 1A1JA 4WXCA 4BC7A 1IMUA 3RMPA 2EPNA 1G2DC 2FV4B 3DF6A 2YTNA 2Q8UA 1RC7A 2MKDA 2EMYA 4LF7E 2EMAA 2EOQA 3MSWA 1YYKA 1UBDC 2L2KB 3TQMA 3K6QA 4IS1C 4LF8E 1X6EA 1PJQA 4I8OA 3VK6A 5AC4A 4Q35B 1HNZE 2ENAA 3HQ1A 4R2EA 3BIDA 1YUJA 5KL6A 3J7AG 2EM4A 2YTOA 4L8NA 3IWCA 1DQ3A 2YT4A 4WPYA 2EPOA 4M30A 4BS9A 1MEYC 2VQEE 2KHXA 2EORA 2K7IA 4WXDA 4F2JC 2EQ1A 3ADLA 2EOOA 2EPXA 2EMCA 2V85A 2L2NA 1PDAA 1YYWA 4R2PA 2JOXA 1UN6B 2JOBA 2YRMA 5KL3A 3AUZA 5LLQA 2WZOA 4Q28A 1G2FC 2YTDA 2D9HA 4DR7E 2N8XA 4NHRA 5FLXC 4R2CA 2YTFA 2EM2A 2EPPA 1IBME 2NA2A 3ZOQB 3BGHA 4L5NC 2HC5A 2CTDA 5A2QC 4B3RE 4RH8A 2NABA 1A1FA 5A6BA 2R1FA 2V83A 4BHBA 3F6HA 2ODRD 2PRTA 2ADRA 2MKNA 1X6HA 4GZNC 2L8TA 1PJTA 2WCC3 2LCEA 2V87A 3ADJA 4B3TE 1YUIA 4LFBE 1DGCA 2EQ0A 4X62E 2UUCE 1IBKE 2YRKA 4GEQB 4AQYE 4TUGA 2UXBE 4DMIA 2JP9A 4JI4E 2LTRA 4ZYGA 1RMDA 2LV2A 2EN2A 5AC5A 3KZYA 4R8OA 4GKJE 4NZVA 4DV3E 2LVHA 2EPCA 4RHBB 3EPLA 1XMOE 2BBGA 2DLQA 2EMHA 4O24A 2EPZA 1J5EE 1WJPA 1A1KA 2V86A 3C6KA 2EM8A 4DR4E 2EOSA 2RTXA 4K0KE 4X64E 1N3GA 2MDGA 2VF1A 1ZR9A 2HJJA 1N34E 4OX9E 4BHCA 2DRPA 5A6AA 1WXRA 5TSEA 2HHHE 2V8QB 5A6JA 3MHSC 1BB8A 1L4SA 3KWRA 3ECRA 5BR8E 2JWOA 2EPMX 4WSPA 2EOMA 1F2IG 1X5WA 4DUYE 5KL2A 2LMZA 4NXME 2M4IA 4DV0E 2YTIA 2EN4A 4KHPE 2EN7A 2EM9A 2EN1A 2EMZA 2M7QA 2RPCA 4ZYEA 4M2ZA 1GQEA 4R2QA 1O0WA 2RSIA 4LF6E 3LLHA 3J81C 4X66E 2EN6A 3F6GA 1T4NA 4N4RB 4BC9A 2L2MA 2EMLA 2M9AA 2B3TB 3T1YE 2GLIA 5LMUE 4BMJA 4DR3E 4HTGA 2NUGA 2YU8A 2EPLX 3OTOE 4R2RA 1P47A 2EMWA 4O4KA 1BBGA 1A1LA 1RQ0A 3BF2A 4F6MA 2EMIA 1HNXE 5A6BD 5A6KA 4DV4E 4LTYA 2YSOA 2CSHA 4FK5C 1BBOA 2YTQA
chains in the Genus database with same CATH topology
1X3CA 1DGCA 2EQ3A 1YSAC 2EQ0A 3VHTB 2EOZA 2YRKA 3UK3C 2JP9A 2DGCA 2EM7A 2EM5A 2HGHA 4R2AA 1NCSA 2EMKA 1KJKA 2ENHA 1RMDA 2LV2A 2E72A 2YTEA 2LO3A 2EN2A 1ZU1A 2A25A 2EM0A 2EOHA 3EPHA 2EOFA 2WBTA 1AAYA 2LVHA 2EPCA 4R2SA 1X6FA 3EPLA 1A1JA 2DLQA 2EMHA 2EPZA 4M9VC 1WJPA 1A1KA 1ZAAC 1JK2A 1G2DC 2EM8A 2EMFA 2EOSA 2EL5A 2YTNA 2MKDA 2EMYA 1TF6A 2EMAA 2EPRA 2EOQA 2MDGA 2LT7A 4X9JA 1ZR9A 1UBDC 2I13A 2WBUA 4IS1C 1X6EA 2JPAA 1A1HA 2ENAA 2EOYA 4R2EA 2DRPA 2DMIA 1YUJA 2EOEA 2EMBA 5KL6A 3MHSC 2EM4A 2YTOA 1BB8A 2EOMA 1F2IG 2EOXA 1MEYC 2ENCA 2EORA 4F2JC 1X5WA 2EQ1A 1LLMC 5KL4A 2EM3A 5KL2A 2YSPA 1TN9A 2EOOA 2EPXA 2YTIA 2EM6A 2EMCA 2YTPA 2EN4A 2EMXA 2EN7A 4WSGA 2EM9A 2EN1A 2EL6A 2EMZA 2YU5A 4R2PA 2RPCA 2EJ4A 2J7JA 1UN6B 2EL4A 2YRMA 4R2QA 4F6NA 2DLKA 2RSIA 5KL3A 1A1GA 2YTJA 1G2FC 2YTDA 2EOJA 2YRHA 2D9HA 2YTGA 2EN6A 5KL5A 1A1IA 2WBSA 4R2CA 2YTFA 2EM2A 2EMGA 2EMLA 2ELZA 2EN8A 2EPPA 1Z1BA 2EN3A 2M9AA 2EOIA 2GLIA 1TF3A 2EPAA 2GHFA 2CTDA 2YU8A 3EPJA 2ELYA 2NABA 1A1FA 3MHHC 2CT1A 5KL7A 3M99B 4R2RA 1P47A 2EMWA 2R1FA 1A1LA 2VRDA 2PRTA 2ADRA 1JK1A 1X6HA 1B69A 2MKNA 4GZNC 4F6MA 2EMIA 2EE8A 2EP3A 1YUIA 2WCC3 2LCEA 4R2DA 3EPKA 2YSOA 2CSHA 2EPUA 4FK5C 2BB8A 1BBOA 2YTQA 4IJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3C A;  1DGC A;  2EQ3 A;  1YSA C;  2EQ0 A;  3VHT B;  2EOZ A;  2YRK A;  3UK3 C;  2JP9 A;  2DGC A;  2EM7 A;  2EM5 A;  2HGH A;  4R2A A;  1NCS A;  2EMK A;  1KJK A;  2ENH A;  1RMD A;  2LV2 A;  2E72 A;  2YTE A;  2LO3 A;  2EN2 A;  1ZU1 A;  2A25 A;  2EM0 A;  2EOH A;  3EPH A;  2EOF A;  2WBT A;  1AAY A;  2LVH A;  2EPC A;  4R2S A;  1X6F A;  3EPL A;  1A1J A;  2DLQ A;  2EMH A;  2EPZ A;  4M9V C;  1WJP A;  1A1K A;  1ZAA C;  1JK2 A;  1G2D C;  2EM8 A;  2EMF A;  2EOS A;  2EL5 A;  2YTN A;  2MKD A;  2EMY A;  1TF6 A;  2EMA A;  2EPR A;  2EOQ A;  2MDG A;  2LT7 A;  4X9J A;  1ZR9 A;  1UBD C;  2I13 A;  2WBU A;  4IS1 C;  1X6E A;  2JPA A;  1A1H A;  2ENA A;  2EOY A;  4R2E A;  2DRP A;  2DMI A;  1YUJ A;  2EOE A;  2EMB A;  5KL6 A;  3MHS C;  2EM4 A;  2YTO A;  1BB8 A;  2EOM A;  1F2I G;  2EOX A;  1MEY C;  2ENC A;  2EOR A;  4F2J C;  1X5W A;  2EQ1 A;  1LLM C;  5KL4 A;  2EM3 A;  5KL2 A;  2YSP A;  1TN9 A;  2EOO A;  2EPX A;  2YTI A;  2EM6 A;  2EMC A;  2YTP A;  2EN4 A;  2EMX A;  2EN7 A;  4WSG A;  2EM9 A;  2EN1 A;  2EL6 A;  2EMZ A;  2YU5 A;  4R2P A;  2RPC A;  2EJ4 A;  2J7J A;  1UN6 B;  2EL4 A;  2YRM A;  4R2Q A;  4F6N A;  2DLK A;  2RSI A;  5KL3 A;  1A1G A;  2YTJ A;  1G2F C;  2YTD A;  2EOJ A;  2YRH A;  2D9H A;  2YTG A;  2EN6 A;  5KL5 A;  1A1I A;  2WBS A;  4R2C A;  2YTF A;  2EM2 A;  2EMG A;  2EML A;  2ELZ A;  2EN8 A;  2EPP A;  1Z1B A;  2EN3 A;  2M9A A;  2EOI A;  2GLI A;  1TF3 A;  2EPA A;  2GHF A;  2CTD A;  2YU8 A;  3EPJ A;  2ELY A;  2NAB A;  1A1F A;  3MHH C;  2CT1 A;  5KL7 A;  3M99 B;  4R2R A;  1P47 A;  2EMW A;  2R1F A;  1A1L A;  2VRD A;  2PRT A;  2ADR A;  1JK1 A;  1X6H A;  1B69 A;  2MKN A;  4GZN C;  4F6M A;  2EMI A;  2EE8 A;  2EP3 A;  1YUI A;  2WCC 3;  2LCE A;  4R2D A;  3EPK A;  2YSO A;  2CSH A;  2EPU A;  4FK5 C;  2BB8 A;  1BBO A;  2YTQ A;  4IJD A; 
#chains in the Genus database with same CATH topology
 2JY9 A;  2EQ3 A;  4YHH E;  2N3G A;  3QG5 C;  4ZYD A;  4DV7 E;  3UK3 C;  1KYQ A;  4JI8 E;  2L3J A;  1QNT A;  2EM5 A;  4R2A A;  4F9B B;  1NCS A;  2HGH A;  2EZ6 A;  3HXL A;  4JV5 E;  2E72 A;  2FTX B;  1ZU1 A;  1PKP A;  2A25 A;  4O5G A;  2LJU A;  2EOH A;  1AAY A;  4R2S A;  3IWD A;  2FGG A;  4B3S E;  2LJH A;  4M0V A;  3HPS A;  5AE1 A;  2LT7 A;  5ADZ A;  1AH5 A;  1FKA E;  1UHZ A;  4BCA A;  2I13 A;  4DUZ E;  1N36 E;  2YZT A;  3HPZ A;  2JPA A;  3JTZ A;  2EOY A;  1YFH A;  2N3H A;  3KZZ A;  2DMI A;  4P7D A;  5DNY A;  3J80 C;  1EH8 A;  2EMB A;  2ODR C;  1STU A;  3T1H E;  4LF5 E;  4F9A B;  2EOX A;  4KWY A;  2V88 A;  1MGT A;  4J8Z A;  2LBS B;  5KL4 A;  4ZYH A;  1IQS A;  4JI0 E;  1X47 A;  4LFA E;  2EM6 A;  1J26 A;  2EMX A;  4R03 A;  4WSG A;  2KON A;  4B3M E;  2YU5 A;  3J7Y p;  2YPN A;  2DSY A;  4BBY A;  4F6N A;  1A1G A;  3LML A;  4NXN E;  1SR9 A;  3EQ1 A;  4P78 A;  1X49 A;  2YRH A;  2YTG A;  3ADG A;  2LE2 A;  2L6M A;  2WBS A;  1WHN A;  4HEI A;  1X48 A;  2EMG A;  4WFT A;  2I9I A;  2EOI A;  1XMQ E;  4TUI A;  1TF3 A;  2CPN A;  2V89 A;  2UXC E;  5T6J A;  3THN A;  1HNW E;  1NEI A;  3ADI A;  4GKK E;  2JXP A;  2CT1 A;  3M99 B;  5A69 A;  1T38 A;  1YPN A;  2M1S A;  3P1X A;  2G7H A;  2EE8 A;  2RSM A;  4R2D A;  3EPK A;  5IV8 B;  3C4B A;  1PJS A;  2JR1 A;  2BB8 A;  4IJD A;  1YSA C;  3VHT B;  5IT9 C;  1FJG E;  2VE7 C;  2L92 A;  2EM7 A;  1XNQ E;  2EMK A;  2ENH A;  2LO3 A;  1IBL E;  2UXD E;  1WHQ A;  2EM0 A;  3EPH A;  2EOF A;  4X65 E;  2NUE A;  1ZBQ A;  1X6F A;  5F3W A;  4JYA E;  4M9V C;  4O43 A;  2LUP B;  1ZAA C;  2UUB E;  1WRJ A;  5AAS A;  1JK2 A;  2B9D A;  2KOU A;  4DV2 E;  2EMF A;  2EL5 A;  4JI7 E;  2LUQ A;  1IQO A;  1TF6 A;  2EPR A;  2L3C A;  4X9J A;  5LL6 R;  4F9C B;  2WBU A;  2F8B A;  1HR0 E;  2R76 A;  2L33 A;  1A1H A;  1N33 E;  2RQL A;  4DV1 E;  2EOE A;  5AE3 A;  2DB2 A;  4JI2 E;  3L00 A;  4WYQ B;  2IHR 1;  2NUF A;  1ZBT A;  4F54 A;  5LMN E;  3OML A;  4DR5 E;  1GTK A;  2E1M A;  2ENC A;  2VQF E;  1DI2 A;  3H09 A;  4JI3 E;  1EH7 A;  1LLM C;  2EM3 A;  2YSP A;  3VYY A;  1TN9 A;  2B7T A;  2H36 X;  2K4V A;  2MDR A;  2YTP A;  4X8W A;  4JI1 E;  1YZ9 A;  2EL6 A;  3THO B;  2EJ4 A;  2J7J A;  4MLQ A;  2EWL A;  5AE2 A;  2EL4 A;  2DLK A;  5CFF E;  1EKZ A;  2YTJ A;  2EOJ A;  4LFC E;  1UIL A;  5KL5 A;  4OOG C;  1A1I A;  2LTS A;  1XNR E;  2RS7 A;  4YY3 E;  2DIX A;  2ELZ A;  2EN8 A;  1Z1B A;  2EN3 A;  3BBG A;  3C4T A;  4LF4 E;  2EPA A;  2GHF A;  4DR1 E;  3AV0 A;  1T39 A;  3VYX A;  2F4V E;  2ZM6 E;  3EPJ A;  2DMY A;  2ELY A;  4JI5 E;  3MHH C;  2B7V A;  2JVA A;  4MLV A;  1YYO A;  5KL7 A;  2RS6 A;  5IXM B;  4DR6 E;  1SFE A;  2UUA E;  4LU9 A;  1EH6 A;  3DJW A;  2LRS A;  4LF9 E;  2VRD A;  4DV6 E;  1JK1 A;  1B69 A;  4KZS A;  2MC6 A;  2EP3 A;  3C6M A;  3JU0 A;  1I94 E;  2EPU A;  1GZ6 A;  1X3C A;  2YWQ A;  3IWB A;  3FIG A;  1T4L B;  2EOZ A;  2MC5 A;  1N32 E;  4DKK A;  4DR2 E;  2DGC A;  4DV5 E;  2E5L E;  2UU9 E;  4WX9 A;  1KJK A;  4JI6 E;  5IWA E;  2YTE A;  2GPI A;  3HTX A;  1T4O A;  2WBT A;  3JAM C;  2EPK X;  1QU6 A;  2JYA A;  1A1J A;  4WXC A;  4BC7 A;  1IMU A;  3RMP A;  2EPN A;  1G2D C;  2FV4 B;  3DF6 A;  2YTN A;  2Q8U A;  1RC7 A;  2MKD A;  2EMY A;  4LF7 E;  2EMA A;  2EOQ A;  3MSW A;  1YYK A;  1UBD C;  2L2K B;  3TQM A;  3K6Q A;  4IS1 C;  4LF8 E;  1X6E A;  1PJQ A;  4I8O A;  3VK6 A;  5AC4 A;  4Q35 B;  1HNZ E;  2ENA A;  3HQ1 A;  4R2E A;  3BID A;  1YUJ A;  5KL6 A;  3J7A G;  2EM4 A;  2YTO A;  4L8N A;  3IWC A;  1DQ3 A;  2YT4 A;  4WPY A;  2EPO A;  4M30 A;  4BS9 A;  1MEY C;  2VQE E;  2KHX A;  2EOR A;  2K7I A;  4WXD A;  4F2J C;  2EQ1 A;  3ADL A;  2EOO A;  2EPX A;  2EMC A;  2V85 A;  2L2N A;  1PDA A;  1YYW A;  4R2P A;  2JOX A;  1UN6 B;  2JOB A;  2YRM A;  5KL3 A;  3AUZ A;  5LLQ A;  2WZO A;  4Q28 A;  1G2F C;  2YTD A;  2D9H A;  4DR7 E;  2N8X A;  4NHR A;  5FLX C;  4R2C A;  2YTF A;  2EM2 A;  2EPP A;  1IBM E;  2NA2 A;  3ZOQ B;  3BGH A;  4L5N C;  2HC5 A;  2CTD A;  5A2Q C;  4B3R E;  4RH8 A;  2NAB A;  1A1F A;  5A6B A;  2R1F A;  2V83 A;  4BHB A;  3F6H A;  2ODR D;  2PRT A;  2ADR A;  2MKN A;  1X6H A;  4GZN C;  2L8T A;  1PJT A;  2WCC 3;  2LCE A;  2V87 A;  3ADJ A;  4B3T E;  1YUI A;  4LFB E;  1DGC A;  2EQ0 A;  4X62 E;  2UUC E;  1IBK E;  2YRK A;  4GEQ B;  4AQY E;  4TUG A;  2UXB E;  4DMI A;  2JP9 A;  4JI4 E;  2LTR A;  4ZYG A;  1RMD A;  2LV2 A;  2EN2 A;  5AC5 A;  3KZY A;  4R8O A;  4GKJ E;  4NZV A;  4DV3 E;  2LVH A;  2EPC A;  4RHB B;  3EPL A;  1XMO E;  2BBG A;  2DLQ A;  2EMH A;  4O24 A;  2EPZ A;  1J5E E;  1WJP A;  1A1K A;  2V86 A;  3C6K A;  2EM8 A;  4DR4 E;  2EOS A;  2RTX A;  4K0K E;  4X64 E;  1N3G A;  2MDG A;  2VF1 A;  1ZR9 A;  2HJJ A;  1N34 E;  4OX9 E;  4BHC A;  2DRP A;  5A6A A;  1WXR A;  5TSE A;  2HHH E;  2V8Q B;  5A6J A;  3MHS C;  1BB8 A;  1L4S A;  3KWR A;  3ECR A;  5BR8 E;  2JWO A;  2EPM X;  4WSP A;  2EOM A;  1F2I G;  1X5W A;  4DUY E;  5KL2 A;  2LMZ A;  4NXM E;  2M4I A;  4DV0 E;  2YTI A;  2EN4 A;  4KHP E;  2EN7 A;  2EM9 A;  2EN1 A;  2EMZ A;  2M7Q A;  2RPC A;  4ZYE A;  4M2Z A;  1GQE A;  4R2Q A;  1O0W A;  2RSI A;  4LF6 E;  3LLH A;  3J81 C;  4X66 E;  2EN6 A;  3F6G A;  1T4N A;  4N4R B;  4BC9 A;  2L2M A;  2EML A;  2M9A A;  2B3T B;  3T1Y E;  2GLI A;  5LMU E;  4BMJ A;  4DR3 E;  4HTG A;  2NUG A;  2YU8 A;  2EPL X;  3OTO E;  4R2R A;  1P47 A;  2EMW A;  4O4K A;  1BBG A;  1A1L A;  1RQ0 A;  3BF2 A;  4F6M A;  2EMI A;  1HNX E;  5A6B D;  5A6K A;  4DV4 E;  4LTY A;  2YSO A;  2CSH A;  4FK5 C;  1BBO A;  2YTQ A; 
#chains in the Genus database with same CATH homology
 1X3C A;  1DGC A;  2EQ3 A;  1YSA C;  2EQ0 A;  3VHT B;  2EOZ A;  2YRK A;  3UK3 C;  2JP9 A;  2DGC A;  2EM7 A;  2EM5 A;  2HGH A;  4R2A A;  1NCS A;  2EMK A;  1KJK A;  2ENH A;  1RMD A;  2LV2 A;  2E72 A;  2YTE A;  2LO3 A;  2EN2 A;  1ZU1 A;  2A25 A;  2EM0 A;  2EOH A;  3EPH A;  2EOF A;  2WBT A;  1AAY A;  2LVH A;  2EPC A;  4R2S A;  1X6F A;  3EPL A;  1A1J A;  2DLQ A;  2EMH A;  2EPZ A;  4M9V C;  1WJP A;  1A1K A;  1ZAA C;  1JK2 A;  1G2D C;  2EM8 A;  2EMF A;  2EOS A;  2EL5 A;  2YTN A;  2MKD A;  2EMY A;  1TF6 A;  2EMA A;  2EPR A;  2EOQ A;  2MDG A;  2LT7 A;  4X9J A;  1ZR9 A;  1UBD C;  2I13 A;  2WBU A;  4IS1 C;  1X6E A;  2JPA A;  1A1H A;  2ENA A;  2EOY A;  4R2E A;  2DRP A;  2DMI A;  1YUJ A;  2EOE A;  2EMB A;  5KL6 A;  3MHS C;  2EM4 A;  2YTO A;  1BB8 A;  2EOM A;  1F2I G;  2EOX A;  1MEY C;  2ENC A;  2EOR A;  4F2J C;  1X5W A;  2EQ1 A;  1LLM C;  5KL4 A;  2EM3 A;  5KL2 A;  2YSP A;  1TN9 A;  2EOO A;  2EPX A;  2YTI A;  2EM6 A;  2EMC A;  2YTP A;  2EN4 A;  2EMX A;  2EN7 A;  4WSG A;  2EM9 A;  2EN1 A;  2EL6 A;  2EMZ A;  2YU5 A;  4R2P A;  2RPC A;  2EJ4 A;  2J7J A;  1UN6 B;  2EL4 A;  2YRM A;  4R2Q A;  4F6N A;  2DLK A;  2RSI A;  5KL3 A;  1A1G A;  2YTJ A;  1G2F C;  2YTD A;  2EOJ A;  2YRH A;  2D9H A;  2YTG A;  2EN6 A;  5KL5 A;  1A1I A;  2WBS A;  4R2C A;  2YTF A;  2EM2 A;  2EMG A;  2EML A;  2ELZ A;  2EN8 A;  2EPP A;  1Z1B A;  2EN3 A;  2M9A A;  2EOI A;  2GLI A;  1TF3 A;  2EPA A;  2GHF A;  2CTD A;  2YU8 A;  3EPJ A;  2ELY A;  2NAB A;  1A1F A;  3MHH C;  2CT1 A;  5KL7 A;  3M99 B;  4R2R A;  1P47 A;  2EMW A;  2R1F A;  1A1L A;  2VRD A;  2PRT A;  2ADR A;  1JK1 A;  1X6H A;  1B69 A;  2MKN A;  4GZN C;  4F6M A;  2EMI A;  2EE8 A;  2EP3 A;  1YUI A;  2WCC 3;  2LCE A;  4R2D A;  3EPK A;  2YSO A;  2CSH A;  2EPU A;  4FK5 C;  2BB8 A;  1BBO A;  2YTQ A;  4IJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...