1A1MA

Mhc class i molecule b*5301 complexed with peptide tpydinqml from gag protein of hiv2
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
278
structure length
278
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRPPWIEQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, BW-53 B*5301 alpha c
publication title Bound water structure and polymorphic amino acids act together to allow the binding of different peptides to MHC class I HLA-B53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (antigen/peptide)
total genus 78
structure length 278
sequence length 278
ec nomenclature
pdb deposition date 1997-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a1mA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1a1mA01
4X9GA 3QQ4B 4Z7NF 1ZT4B 1Z2KA 4QRRA 1WEJH 2BCKB 2CDGB 3LSOA 3TF7A 2R56H 3S8WA 1N4XL 3REVA 4M5ZH 1D9KD 2M2DA 3B9KC 1UWEL 2CXKA 1GOGA 3BUYA 3L3HA 4G42B 4OFPA 2BVEA 4Q0XH 3RWJA 4GKZB 3G5YB 4FFVC 1JTPA 4J3OC 4P23C 1NDMA 3PWVA 3IFPA 4I0CC 4OCRL 2NXZD 4PJHF 5HHNA 2VLRB 1A14L 1HYSD 2AEQL 2VLJD 2VZ1A 5DYOB 5I1KL 2N4IA 4BFIB 4PLJC 4JM2F 5C8JA 1NFDE 5FF6B 4CGTA 2D9QB 2OBGA 4GUPA 3TCLB 4O2FA 1FH5L 1FO0A 5IMMB 4FQ1L 4Q9QL 3VWKC 2DOCA 3ARFC 5HYIA 4L8CA 3SKOA 4O2EA 5HDLA 3EGSB 3SJVA 1A9EA 2IH1A 5DJ8A 3BVNB 1KC5H 2V2XB 1XCQA 2C9AA 3BZEB 1JF1B 4CU7A 3BJLA 1DBKH 4MQXD 4RNRB 3SDXB 2MNUA 5C08B 2WK2A 2D03H 3HMXL 1INEL 3TZVD 3D69B 3D0LB 2PTTB 4PG9A 5GZOD 1DBBL 1RUPH 2IFGA 5F7MC 4Q2ZA 4HJ0C 5HVFB 5K9QI 1ND0A 4R7DB 2PETA 2J8HA 5BOZG 3HS0B 3RZCD 1R5IA 4LCWB 4HPOH 5I74C 3WIHL 3QIBC 4QT5A 4MXWL 3WFBH 3U30B 3KDMB 3MLZL 2FD6H 3AY4A 4Y1AA 3FQUA 2HLAA 1SYSA 5FHBL 1X5JA 4ODWB 3RWDA 4PJEE 2HYMA 4ZD3L 1XF5B 4QRQA 5CJOL 4KH2A 3AFLA 1LO5A 4XPTH 4ZTPL 3UBXI 4P2QA 2UVFA 3TJHA 5JW4Q 1GYAA 3HMWH 2F54D 1X5XA 1WZKA 3ZL4H 4Y5YC 4KKNA 5F7DA 1CFTA 1D5IL 1FN4B 4J1UA 3GMMB 4F9PA 3F65A 1IQWL 3DSNA 4JPIA 1CXKA 3UEZA 1JUFB 5AZ2L 4YDKH 4AMKH 4OCNC 2O61B 2PTVA 5I6XC 4NBXB 4L3CA 4XH2B 2XZZA 5K93A 2F5AH 3INUL 3BW9A 4WI6A 3SO3B 4ORGB 3V7AE 1A7RL 5DJXB 3U4EA 4GBXA 4UAOC 3QUZC 3MRRB 4MA8H 3MNVA 3TJEH 3FQWA 2DF3A 2NZ9C 2J1KA 4XTRD 5DTFB 1CXLA 1MRFL 3O6LL 4YK4B 4R6UA 4IJ3B 3FOLB 4P2YA 2YN5A 1F42A 2DQIH 3NABL 3LKPA 4P4KA 2EEDA 1JRHI 5E8NB 2VXTH 2ZSWA 5LVEA 3S35X 3DMMA 3NPZB 1ZE3C 5KS9A 1TZHA 1MHEB 3ZHDA 1WFNA 5HGAA 1N5AA 3MLWL 5L2JB 5IBLD 1T1WA 4YHZL 5GGVL 4N8PA 5D70H 2FDBP 1KJ2B 1N7MH 4MJ6B 4NYLA 5IKCB 4XXCA 1MQKH 2VAAA 2BY3A 3OSKA 4LFHD 1BF2A 2OR8A 1CLOH 2NY4C 2VISA 2BNRA 1W0WB 4LLDA 3TBYA 2VN4A 3N9GH 1I9EA 4MA3B 3KYKL 5B4MD 1U8JA 1KB5H 2DI8A 5KSBF 3BGMB 1LVEA 4Y2DC 1CFVL 3ZE2E 2G2RA 1SY6L 1DVFD 4HC1H 3QFDA 4Z6AT 3DO7B 4G7VH 3TNNB 1BJ8A 4JPKH 5IQ9A 5ESAA 5DMGC 2FJHB 4YFLI 4XP4L 3KS0J 5MHSE 3O0RH 1H8SA 1RU9L 2XG4A 3C60A 3IFOB 5FUZH 1T20A 2QSCH 3GO1L 1MCLA 3VGGA 2WZPD 1XF4B 5HDOA 4Z7UA 1MHHB 1P4BL 3DVNA 1CF8H 2AJXL 2X1PA 35C8H 5D72L 4CW1B 4FQJH 2AKRB 5ITBH 2NTFB 4FQXB 3WHE0 5F70A 2NW2B 3MV11 5HHOE 3QQ9C 1BIIB 1EJOH 3ZSSA 2DQJH 3TBVA 1Q94A 5F8QC 2C1PA 3WDJA 3MXVH 1LO4L 1BFOB 5D1QD 1OCWL 5FOBB 4GRMB 4OF7A 1U8LA 4HXAL 1YEJL 4GOSA 2CO7B 3HPLA 5DT1H 1ZLSL 4Z0XA 3V79C 1MY7A 5IFJB 3FONA 3E2HC 3IFLL 1M7IB 1T1XB 1QKZL 4U3HA 5ERWB 2APFA 2WINA 1VEOA 2L7UA 3SDDC 1TZGL 3KPQB 2X89A 2AK4B 1BVZA 5B3JF 3C08L 3MOQA 1KCRL 4NJAH 2BNQA 1INQA 3C5SA 3VXTB 1I85A 1SVCP 1HKLH 4PDCE 4YIQA 3S3PA 4PRHB 1OP3H 3MJ9H 3UPCA 2JCCF 3P4MA 2JIXD 2EDDA 3EJYD 5KAQF 3S5LG 2W9EH 1LP9F 4U6YA 4R4FH 3H9HB 2DLTA 4PJ5A 5DK2B 1KNOB 4C57C 4M1CC 3LAFA 2QADD 3GHEH 2F58H 3RIAK 4CMMA 5DUMH 4CU8A 4CJ1A 2HLFC 5IMLB 1BVLB 2ZUXA 2VITA 1JWSB 4HUXB 2EE9A 3B9KB 4S0UC 4WY7H 4G6MH 4X0KB 4WO4A 4WWKD 5F44A 3BZDA 3ULVL 3IS0X 3NACL 4NN7B 4P23B 5CMAA 2EIZB 5EC1A 2IQ9L 1AGBB 3MV7B 3CFJB 1XF3B 4P5TD 4PJIA 1XF2B 3FQTA 3IDXL 1ZOXA 4DK3A 4QRPE 1PKOA 4YDIH 5C0AB 4LHUG 3VWKB 4CL7A 5D1ZC 4OD1H 1QSEE 5J11B 2UZIL 1AGCB 4WW2C 5KVEH 1WFUA 4WDIA 1OP3K 1NCDL 4D9LL 4QXTB 2P5WA 1YDPB 1T1ZA 3WLBA 1AQKH 4M61B 2P24B 2XNAB 4KXZH 5E5MB 4DOHB 1W0VA 5AG8A 4KXZI 1S9VB 4HCRL 1NAKL 1AO7B 1OGAD 1HHKA 3EJJX 5FDWB 4OGYL 4Y4HD 5DGQA 4N68A 1MLCA 3BKML 2NR6C 2CGRL 5F9WB 4KRPB 4YXKH 4YJZL 3WIIH 1L6XA 1V7MH 4KMLB 4Q97A 3S5LA 4U2ZA 3MRLA 1E6JL 3EBAA 3MRCA 3W2DH 1NGPH 4I4WA 1OAZL 3QIBB 5K59F 1KIRA 4JHZA 1S7VA 3SCMA 4XMKL 4XWOC 3VFUA 3Q1SH 1OAXH 1NBVL 2C3VA 3G04B 3C6LA 1QRKA 4PRDA 1UXSA 1BD2A 4YO0B 5F8RC 2NXYC 1RZGA 2E8ZA 5CUSL 5D7JB 3RY6C 3WBDA 2J88H 1A3LL 3V95A 1TVBB 4F57H 2E5EA 1ETZB 4KPHL 2VUOA 4P2RA 4NQXA 3O9WD 4WFFD 5GGTH 4HX1A 1PBYA 1IAII 4LRNL 4A2MA 1T7ZA 3U6RA 3L3OA 3FB7B 4LHUA 2IMMA 1ZLUH 4JFHD 5SWQB 5JLZA 3HE6C 5EPMA 1L8JA 4RMRA 1JZ4A 1JP5A 1BAFL 4KVNL 1T6WA 3MBEA 4POYA 1X6LA 2OQJA 3KS0H 5JOFA 3DSFH 3JSSA 5EBLA 3NFPB 2Z92A 5JTWA 1J8HB 3H9SE 4I8DA 3BD5A 3ARGC 3EDDA 3D9AH 4TVPE 1T5WA 2RHEA 1OTSC 4FFVD 5DZNA 4IRSB 4XP6L 3IJSB 3P30H 4MAYC 4P23D 4UMGA 3G5ZA 1OPGL 1NEZB 3CK0H 4JY5H 4NO0A 4KQ4L 4X4ZA 4XPGH 3UTSA 1ZV5A 1CL7H 4PLJD 1BEYL 3OKLB 1PQZA 3V4UL 1FFOB 1HXYB 1XGPA 2AQ2A 2HWZL 4Z7QE 2Q1EA 1P2CA 3IRZA 4L8SB 3ARFD 3MODH 3GFUA 5J13C 1MCJA 4U1HA 1J9CT 1VSCA 4PYGA 4HUWA 3MUY1 2C3GA 5FGCE 3ZDYE 1S7RA 4RDQF 5IVXA 5BS0E 4QTHB 4Z76B 1DE4B 5DS8A 3UP1A 3TV3H 4UNVA 3PL6C 2V5MA 3ECBA 3L1OL 3L3GA 4LPVA 2W9DH 2FX8H 4WI8A 4JRWA 1G6VK 3KR3H 4HH9B 3RY4A 3MRIB 5IF0A 1ITBB 4W6YB 1AGFB 4HJ0D 3KXFD 3D0VA 1DANU 3A6CH 5HHQB 3RWFB 1LE9B 1MWAL 5FGBC 3EFFB 2XZAH 1IM9D 3LKRA 3ARDC 1LE5B 4WUKH 2CLZB 3DUUB 4YPGA 3HG1E 4O4YH 2R1XA 5ESVB 3T2NH 2LABA 3TNMA 3X12A 3FB8A 3BT2L 3UXFA 4JFFB 5CZKA 3U2SA 4FXGA 5J1AB 4HWEH 5IJVA 3T08A 2OTUB 3DYPA 4Z7OE 3UTZB 3MACH 5F1IA 2YD4A 1MF2L 3CVHL 3GI9L 3S6CA 1B88A 1QBLH 4P9MH 4OZHB 2G60H 1HEZA 1ZANH 4M6OL 2JTDA 2XN9E 4DVRH 4HWZA 4G8GA 2UWEE 4ZDHB 3SGEI 4AY0A 5I1JH 3QWQB 3QRGH 4OLZH 1LEGA 2DIJA 1ACYL 3MBXH 4DGYH 3TPUB 3QQ3B 2K1MA 5GGUA 5IESL 3PJSB 2DLEA 4LPXA 3REWA 3QUZD 3JBG7 4OZIE 4G6KH 4HS6A 4FTVD 4BQ8A 5FYKH 3QDGB 5DJ6A 2NZ9D 4POUB 3V5DA 3L5XL 2P47B 2AXGA 3SPVA 1TJIH 1M6OB 3MO1B 3BRDA 3LKQB 3RVWC 3OXSA 4JZJC 4X6BA 3OPZL 1P69B 4P3CH 3HNSL 1JGVL 3TH3T 1S5IL 5GS0L 3QR2A 2GSGA 3C2SA 1KCUH 1S7UA 3QUXA 4Y19A 1YMHA 1T3FA 2A9NH 4Z7VB 4PTTA 3G9VA 3JV5A 4Y8AA 3ME0A 5F3BA 3UJIL 5I19L 4KUCD 3T0DA 1QFUL 5C0JB 4JKPH 1VACB 3ULSA 1AXTH 3L3IB 2NY4D 1ZEAL 1E27A 1OWRM 3RVUC 1RJYA 2X5PA 4OZHE 5EOCH 3UTPE 2AVGA 3GKWH 3BJ91 3HAEG 2X42A 2EE2A 5ACMA 2YD3A 3SEPA 3MRNB 3TPKA 4XC3L 4Y2DD 4QTIH 3VDBA 2FECI 2ORBL 4RGMC 4D9RE 4R97C 5IHBA 3CFEA 1YNTB 4MA1B 4OIAA 5E9DD 5DMGD 4KI5D 5AAMA 3MV8B 5D93C 3MC0A 1I3RA 4WW2B 2C3XA 4GAGL 3RIFK 3DRQA 1O5DT 1ZT1A 4PV8B 2W0LA 5EA0L 5EWIL 5HD8C 4GW1B 5JORA 4QF1A 4NNXB 5J6HB 1HXMB 1ZKAA 5GGVY 1AFVH 1R3HA 3QQ9D 5ACZB 3H9ZA 3MGAA 1H0DB 4ORZC 5I30L 4ZUUA 2MWCA 4AIZB 2BSRB 3MMEB 3I84A 1FC1A 5IJKC 4OBSA 4PJXE 4CN1A 3ZTNL 4JRYA 2OM5A 1WJ3A 2AJVL 4H1LG 1Y0LA 2VZ3A 5I1IL 5CZVH 1WBYA 8FABB 5HYQB 2HRPL 1FLTX 3O3BA 2ZJSH 2E7LA 2APBA 1NLDH 1CIDA 4ODVH 4YFDB 3C5ZA 3CMOH 2NXYB 4XMPH 4J12A 3SDDD 4X98B 1FIGH 2FO4A 2PYEA 3V7MA 3EYSH 1QR4A 1QD0A 2DKUA 4JN1L 3VD3A 3CFBB 4U6VL 3U36B 3MLRH 1DUYA 3QDMA 3T1WA 4XZUA 2ZOKA 3F6IA 5D1XA 3O6ML 2XOTA 1N64H 2F5BH 3WNNA 2H26B 2HFEA 4MCZB 4WGWB 1RUKL 5C70A 3VWJC 5I1EL 1BZ7B 4F7CA 4OUUA 1F00I 3QEQB 2OMNA 1FNFA 1T80A 3EIFA 4M1CD 4DN4H 2ADFL 4HUMB 2W0FA 1IT9L 3FKUS 2A6JA 2HLFD 3K2UH 3CX5K 3PWPD 4PY8J 3HZMA 3WXVH 2VIRB 1KEGL 4FNLL 3JV6B 3ARGB 5E1AA 3L3KA 3DUHA 4O2CA 2X05A 4CMHC 2D9CA 4UT7H 3BKJL 3WFCH 4OTXH 4V1DA 4G8IB 4HLZH 2RIKA 4OT1L 4R4NC 1KACB 1LEIB 1HNGA 4U31A 1IAMA 3OR7A 3DX6A 4H1LA 4U1MA 4XI5C 1OSZA 3B8SA 1U92B 2YUVA 1MVUA 1WEJL 3QHTC 4HKXA 1DQML 5D1ZD 4JY4A 2R56L 4NRZB 4DZ8B 2MJWA 1R0AH 1DQDH 2J5LC 3KYMB 3LHPL 1MWAB 3M1BB 4LVNB 4Q0XL 5DVKA 5GS1A 1F2XK 4ZPTA 5JQHC 1QBMH 1HQRB 2R29H 2P44B 5J57B 2O93L 5IMKA 1I7ZA 1KUMA 4I9WD 1MJJA 4X5WB 4LDLB 3RL2A 5EZOL 1YPZF 2H9GB 3SE4A 1LO3H 5KS9F 4UQ2A 4M4RA 2NR6D 5KZCB 1MCQA 5E4EB 1JK8B 1HIML 4HJJH 4PJFB 5EDXA 1XR9A 2QSVA 5J4MA 1GZPA 1KLUA 4JVWA 4MGXA 2CLRA 2OR9H 5HYEA 4EVNB 1OL0A 3PNWB 1KC5L 1UCTA 4UDUA 2RQ8A 3DURB 4R90L 1CDBA 3LN9A 4FQCL 4HG4K 2D03L 2JB6B 3VXUA 1OB1A 4UDTB 1X5AA 3D85D 1YECH 3MV01 3GMNA 1WC7B 2ZKHH 3U0WL 1ZHLA 5D9SA 1TFHA 4ZO8A 3NAAL 2R4RH 2F74B 4JRXB 3ZTJH 2DKMA 3WFBL 5M94B 3GMOB 4Z7UF 1ZHBA 3HE6D 3T0ED 4RA0C 3GSOB 1BHGA 1V3KA 4U6XA 1UJ3C 2AJZA 2E7CA 3X11A 1U8KB 3QXTA 5C6TH 3SDAC 4XPTL 1U8HB 4R26L 1A7NL 2ADGA 4BSVA 5FYLE 1PX3A 4U1SB 3VXOA 3HI1B 1OTSD 3S97C 4MAYD 2VN7A 3OV6A 4NFBA 3PXHA 1IGTA 5C0RH 3SQBA 5DFVC 4X4XB 4YDKL 5DC9B 4AMKL 3FCTA 1HI6B 1G0YR 3G6DH 5DHXB 3M8OH 3CMGA 5EC2B 2XWBA 4PG2C 3GSXA 2F5AL 3RY5A 3T4YB 1C16B 5ENWB 1MIML 3BO8B 3DETC 3MLXL 4FOMA 2VDLL 4MA8L 5ALBL 5C9JB 1EFXB 4L3EB 3TJEL 5C09D 2CIKA 3B9VA 3V7AG 4EI5C 4NOFA 3IDNA 4LIQL 1KIPA 3BSZH 3SGKC 1FJ1B 4NQEE 3PL6D 1LK2B 5DHVB 5I8OL 4U0QB 1F2QA 3VFWA 1YEKH 1JRHL 3P73B 3CJJA 1IMHC 2A74B 3TIEA 4R97B 1ZT4A 3UJTH 4AIXA 1HSBB 2QHRL 4YHPB 2BCKA 2CDGA 3QIUC 3ARDD 3RX5A 2EDRA 1VPOH 5DD5H 4FFYH 4EN3B 3GEWB 3X3GL 1QBAA 1PYWB 4G42A 4HAFA 3Q6GH 4GKZA 3G5YA 4OB5H 3N9GL 4PJIF 1Q0XL 3BPLC 3O45B 1G0XA 4M48H 2VLRA 4R0LB 1KB5L 5KSVB 5DYOA 4BFIA 1RPQA 3V52L 4HC1L 3V5HB 5DQDH 3TCLA 4G7VL 3JWOC 4P5MB 1BFVH 2EDYA 4JPKL 2YSSB 5ADPH 2P5EE 2K3TA 5C0DB 2FJFB 3VFTB 1MFDH 5FUZL 5C0NC 3BVNA 4L3EE 1L7TH 2VYRE 5GGRY 3TEUA 4WUUD 2V2XA 4JCMA 3BZEA 1BBDH 1CF8L 1JF1A 35C8L 5HHME 3LQAH 3ELAT 3S4SB 2YKLL 4L9DA 3BYYA 3SDXA 5C08A 5TDNB 2FBJH 1PSKH 2CXGA 4X9IA 1UACL 1DTUA 3D69A 2E27H 2PTTA 3QUYC 3JWOL 3VGBA 1AGDB 1B3JA 4R7DA 4PRNB 1OWWA 3HS0A 5I1LB 4LCWA 4UV7H 2JKXA 1G9NH 1CDIA 4ZFZB 3KDMA 3RVWD 1E4WH 3SO5A 1ODAA 3MFGB 3HPJB 3WS3B 5TPWL 2Z93B 3E1F1 4KK8C 4YHKH 3PP4H 4ODWA 3FRPG 3B5GA 5GRZA 1XF5A 1CI5A 3VXMB 2VZVA 1NC2D 2QL1A 5GRXG 4HK0B 4NJAL 1KG0B 4MJIE 2I25N 3EOTL 4LCYB 4QXWA 4YUEH 2CD0A 3AM8A 4HFUL 3RVUD 1FN4A 2YC1B 3DHMA 3GMMA 5AZEL 2HVKB 4XVUC 3FQRB 2W9EL 1IL1B 3B5HA 2B1AH 4NZRH 1JUFA 1JV5A 5D1QA 3RJDA 2O61A 2GQHA 3RP1A 4NO2B 5JA8B 3GHEL 2F58L 2RJMA 4PJGE 4ORGA 5DJXA 5ILTH 5ANMB 5A16B 1EMTH 1EPFA 4ZSOB 3G6JB 4M7JH 3MRRA 4KKAC 4WY7L 5H35B 2H8PB 2IBBA 5HD8D 3QNYB 3ORJA 5ISZB 3MSPA 5DTFA 1KGCE 2PYFB 3V9FA 3C09B 3FOLA 1E4KC 1MJ8H 2ZUUA 3CCHB 3H42H 2JJTC 5GJSH 3VGHA 3OR6B 4I3RH 3CPLB 5LCVH 5DD3H 5E8NA 5KVGH 3KPNB 5ICXB 1CU4H 2DWEB 5TH2B 1MHEA 1K8DB 5E08L 1BVKB 4X7TB 5L2JA 5JMOC 5KVEL 5IVXF 2DTMH 1NQBA 4X7SL 1KPRB 4JG0H 3VXME 3FRPA 1U3HD 4HAGA 1KJ2A 1RZ7L 4JO1H 4XGZB 1KIQB 4MJ6A 5IKCA 2BSTB 2VLJE 5DJ2B 4GH7B 4YXHH 1W0WA 3V6FB 4N0CA 4MA3A 1NUDA 2MOVA 3ZE0F 4JFPA 1CDYA 3NN8B 3UBXB 4U05A 3BGMA 4ZFGH 3DVGB 1V7ML 5F88A 2DB8A 4G6FB 3W2DL 3DO7A 5JO5B 3TNNA 3V6OE 4CVZB 2D2OA 5C92A 2FJHA 5F7FA 3ARBC 1OAQL 4JM4L 4AQ1B 2VABA 3IFOA 1P84J 3Q1SL 3VWJD 1OAXL 2K7QA 1XF4A 4CNIB 2J88L 1GGYA 4K7PH 2AKRA 3T3PE 2IPKB 2NTFA 1JZ7A 2ZCKH 4FQXA 2NW2A 4HDIB 3QO0B 2EIDA 1BIIA 1N0XL 2VJXA 1H3PH 1PKQB 1IAIL 3PQYB 1F45A 5GGTL 4W70A 4KK6D 3FRUB 2VZOA 3FN0H 1BFOA 4BH8B 4GRMA 1WIOA 3RGVC 1B4JH 5AG9A 3VXQB 2IBZX 5DVMA 3MV9B 4XI5D 1F11B 3GSQB 4XNZB 2JB5H 4OGZA 3DUSB 4RQQB 5IFJA 2BZDA 1NL0L 1KULA 3FB6B 4RGOH 1M7IA 1T1XA 2F54E 1J12A 5ERWA 3MOBH 2RFXB 2FNBA 1OM3H 4OQTL 3D9AL 3KPQA 2AK4A 5T3ZL 2DQTH 4HIHB 1GRWA 2AJSH 4QKXB 2C4FT 3P4LA 5FYJL 4XPGL 3S37X 2EYRB 2W38A 4PRHA 1CL7L 3STBA 1IC7H 4IEFB 2AQ3A 4RMVA 3W9EB 1EGJL 3U7WL 2F53B 4JR9H 1VGKB 1T7WA 3H9HA 4PGBB 1KB5B 5GRVK 2DDQH 3MODL 1KNOA 3ALPA 4K3EL 4DCQB 1L4IA 4I2XE 2Y4SA 1FP5A 4MVBA 5IMLA 1BVLA 3H3BC 4BUGA 1JWSA 4HUXA 3TV3L 2P45B 2X4UB 3B9KA 2H1PH 4X0KA 3V4VL 1PKQE 5BRZD 2X9YA 4B7LA 2I24N 2NY1C 4JZOB 3WO4B 2FX8L 1I8IB 2GTZB 1JPGB 3KR3L 3QULA 2BJMH 4P23A 3B83A 5FECB 3K46A 3MV7A 3H9YA 2MTPA 2EIBA 3CFJA 4KROC 2OI9C 4X9FA 4IMKC 3LVEA 1XF2A 2GEEA 4BZ1L 4G6FD 1JF5A 2IANB 1R3JB 3A6CL 4GMSH 2H2PC 5C0AA 3WDHA 3N85H 3HMXA 3MV9E 1A1MB 3X17A 3KJ4B 3RDTC 3VWKA 1Q72L 2XZAL 4PB0L 4WUKL 3R8BB 3SGDH 2H3NB 4LHJB 4QXTA 1YDPA 3GJFK 3WIHA 1AC6A 1N6QL 1VHPA 4K71B 1SJEB 4M61A 2P24A 2XNAA 3OQ3B 5E5MA 4EI6B 3SDAD 2DIBA 2LVCA 3SE3C 4M93B 1S9VA 1AO7A 2YD2A 5FDWA 4FFWD 4NHUE 1KT2A 1RIUH 4ZOEA 3MACL 3PQYD 4BFEA 5T1KB 1NEZG 3QUYB 5AEAA 1QBLL 4P9ML 2EDFA 4P4RB 2C1OB 1ZANL 2R69H 1UM5H 4GKOA 4X6DB 3EOBB 3KXFA 1X44A 3U4AA 4P3WA 5DFVD 5C07B 1QFWI 1Q8MA 4WEUD 3QIBA 4ZXBB 3WL9B 1JNNH 5I1JL 5CILL 3QRGL 4OLZL 1P1ZB 4OI8A 3MBXL 3EYQC 4Q9CA 3HZKA 4IDJH 3LEYH 3G04A 3DETD 4RIRB 2IAMC 4YO0A 3QDJB 2WBJB 5F7YC 5D7JA 1HSAB 4PJ8D 1YEGH 5IB3A 4MD5B 5FYKL 1TVBA 4EI5D 4FFZH 3VGEA 3IKKA 3VD5A 1OARH 3DRTA 1MCPL 3P11L 4OZFA 5I8CB 1SJVA 2X1WL 3BRGC 1FAIH 2PO6B 2NY2B 3FB7A 4P3CL 2FHBA 4KTEH 3TBTB 1MCEA 3D39B 4C55A 4WI4A 1TJHH 1IC4H 3LS5H 5FUCC 5GGQH 1CE1H 2A9NL 2NY0B 3PE9A 3DGCR 3DLQR 4F37K 4CVXB 3QIUD 2XQYG 4M02A 3MA9H 2NW3A 4HGMA 1J8HA 2J8UE 4JKPL 4L29A 4OLWH 1NCCH 4FTVA 4IRSA 3IJSA 2GITB 3MLYH 1BFSA 4LCCB 1NEZA 5EOCL 5E5UB 5BW7C 4LASL 2FECL 3OKLA 2AV1B 1FFOA 1HXYA 4NQCB 4ODBD 12E8H 1J10A 1UGNA 5CWSB 4F58L 3FN3A 5CKAA 5DSCB 1A3RH 1KCKA 1DBJL 4P59H 1TXKA 5DD0L 4M4PA 1SY6A 4TNWK 3GSNH 3I3DA 1S7QB 4QTHA 4KZDH 1DE4A 2WUBH 3RQ3A 1IEBB 5DZLA 1OW0C 1I9JL 4HH9A 3MRIA 4WHCA 1AGFA 2DKSA 3PWJB 3A0OA 2DM2A 4X4YB 5HHQA 1UA6L 3RWFA 1LE9A 1UQSB 3WN5B 3TT3H 4HW6A 4XB8A 1IAIM 4EXKA 3BHBB 5DHYB 1CXFA 3T1FB 1LE5A 3LV3B 1AI1H 3ARBB 2CLZA 3DUUA 5ESVA 4KK8D 1OGAE 4CJ0A 1NLDL 4ODVL 1JIBA 3VXSB 1KN2L 4JFFA 4XMPL 2QQLH 1FIGL 5J1AA 3EYSL 4XNUH 2OTUA 3EYUH 3DECA 3UTZA 4U6HB 4L4VD 3VA6A 2H32B 3B6SA 3MLRL 4RAHA 4NQCE 4H8WL 1G7LA 2ZOLB 4YDJB 4XVUD 2F5BL 2DN7A 1JGUH 3WXWH 1WSST 5IFAH 1X4YA 3EZ8A 3E3QA 5FCUL 4JM2D 1MFBH 3TPUA 3QQ3A 1CDUA 2UY6A 3PJSA 3LB6C 1T89A 3NBNA 1W72L 1G7QB 3PXJA 3AU1B 1I3UA 4KKAD 1MQ8A 1FYTB 3B3IB 3AGVA 4XBPB 3QDGA 3AB0C 1CLCA 5ID1B 4MXVF 3IAQA 1A02N 2BMKB 2VAJA 2ZP0T 2XKUA 3IRPX 3D5OF 4JFHE 4UT7L 2HAZA 1M6OA 3MO1A 4MMZC 4OM1H 4NQUA 3MCG1 2N1KA 3D2UB 1T6VN 5DJ0B 1MCDA 4OV5A 3JZ7A 5K9KB 3SDCC 5CD5C 1LILA 5I66B 4EBQL 1R0AL 4Z7VA 1DQDL 2IBGA 4ZQKB 1DSFL 1W2KT 1QBML 1IKNA 1VACA 4DTGL 1T4KA 3L3IA 3VJ6B 3NCCB 1MAMH 1LK3L 4XCCL 5C71A 3OHXB 4KJPC 4OGXH 3VXNA 5MENB 2OLDA 1FBIH 5IWLC 4JB9H 3MRBB 1FL3B 4HCRA 2HKHH 2XXMB 1MRDH 2FB4H 1YNTA 3I85A 1BLNA 2OR9L 5LXGH 4EQ2A 3RDTB 1ORQA 2FH6A 1OD7A 3MV8A 1MREL 5EU6B 3LPFA 4LVEA 4TNVF 4WW2A 5F72S 5BXFB 3OG4B 3SDYH 5C0BB 5CCKL 3UAJC 4PV8A 5IW1B 3WKNA 1FYTE 4GW1A 3K8KA 2AAVA 3QI9B 2Q3AA 4NUJB 1X5YA 4NNXA 2DMBA 2VDNH 5J6HA 2FX9H 5KSAB 1C8PA 1HXMA 4ZUTA 4XC1L 2O5YH 2ZNWA 5IBTL 3U7AA 1YECL 5ACZA 2ZKHL 1H0DA 1EBPA 2X1OA 2YUZA 3CAFA 3KPRB 3ZYJA 4Y16B 3WLWC 4AIZA 2BSRA 2R4RL 3MMEA 3NH7H 3ULUH 1G9MC 4JE4B 4CBPA 4M8VA 2V9QA 4D3CH 2P1YA 3RGVD 2X4NB 4F9LC 5F7NC 8FABA 1NGYA 1KCSL 3SDXF 5HYQA 4MA7H 2YA0A 2FWOB 4GAFB 5TE6L 1FE8H 3W11C 4LPWA 1CLYL 4ODSH 1VCAA 2IAMB 5MENE 3N1PC 4PJDB 1FL5B 4X98A 4PJCB 1CGYA 4PD4J 4GKSB 4WV1B 3I50H 3BQUB 4YH6A 2MSPA 1RULH 1K2DB 5DK0B 3CFBA 4JHWL 2VQ1B 3U36A 4GLRI 4XMLL 3IDGA 1J7VR 4JFYB 4Q6IC 3V0VB 3VI4F 1I8LA 4OCYH 1ZVSB 3G6DL 3M8OL 4NM8H 3O11B 1GAFL 4LGPB 4ZTOL 4MCZA 2ZWLT 4JY6B 4QO1A 1OSPL 3CXDL 5IHUL 5JHDD 1BZ7A 1QLRB 4RZCB 1A3QA 3QEQA 4OFYA 1HOCB 5JOPD 4PREB 2YXMA 1IAOB 4QWWC 1HCVA 3GM0A 4BA8A 4DK6A 3BSZL 4LKXB 3U46B 2PR4H 1B4RA 2VIRA 4XNYH 4WU5B 3RA7L 3JV6A 3ARGA 4XNQA 2NY1D 3OBAA 3O4OB 4LAQL 1C5BL 4UOJA 1T2XA 2XXCB 4KROD 3JTCA 4G8IA 4F8TA 1WWWX 1LEIA 3TYFB 2AW2A 2H2PD 1RURH 3VCLB 5D2NC 1U92A 2NY3B 4UTAL 3KGRA 1JPSH 3Q0HA 1F8TH 4NRZA 4DZ8A 5DD5L 1MI5D 1FNSH 3D3VD 4J3UA 3KYMA 3M1BA 1MWAA 3ESUF 3Q6GL 2R2BA 2OP4H 3D87B 3BGAA 5IHLB 2V7HB 4M48L 1UZ6F 1HQRA 1DUZB 1T0MB 4X5WA 4D8PB 3BPOB 2QQKL 2H9GA 1A6VH 4LSTL 5DMKB 1LD9B 4M62L 1B6UA 1XZ0B 5E9DE 1JK8A 3RI5K 2DTSA 3IKCA 4KI5E 1QTYT 4PJFA 2P42B 1JZ2A 5ADPL 2P7TA 2VZTA 1M05B 1AGEB 2MPAL 1MIEL 3OJDB 3CVHA 3HI6L 5FGBA 4X6CE 1PDKA 4EVNA 2B39A 5FKAB 3PNWA 5SWZD 3QCVL 3AY4C 3LH2L 3U9PH 3EYQD 4ZFFB 3DURA 3FFCB 4M43H 1ZS8B 1UKQA 2JB6A 4P49A 2CMRH 2JLLA 2E27L 1NFKA 4UDTA 3GIZH 1RK0B 1PG7H 1WC7A 1A7PL 4NCDA 3MRKA 5F7UA 3UTQB 2WP3O 1W72B 3LIZH 4DKEL 4TULH 4UV7L 2F74A 4JRXA 4NKIH 5KVDH 1GGCL 1X5ZA 1KJMB 1IGYA 4TTDC 2DM3A 1E4WL 5AWNH 3SKJH 1H3UA 4OF5A 3GMOA 4C4KT 3GSOA 3X14B 1LO2H 5CAYB 4X7CC 4M6NL 4G9FB 4HZAA 3AS0A 3WFEH 4K8RH 4PGDA 4HS8H 2E6QA 5J6GB 1FGVL 4FP8H 1U8HA 4GBXC 4RMSA 4LU5H 1Y18B 4LSVH 1MJUL 4MX7B 4K3JH 4OZGE 4U1SA 3IXTB 5L8LB 3BXNB 3HI1A 4S1SH 1A4KB 3ISWA 1JL8A 1PAMA 1X5GA 1FAKT 1KLGB 2VR5A 4NWUL 1D5MB 2R9HC 2V9TA 5EUOE 4X4XA 1GGUA 3VGAC 3QA3A 2CKBH 2O5XH 1HI6A 4OFDA 4P4KC 1NMAL 5EC2A 3S96A 3T4YA 4QCIB 1A6ZB 3UYRL 4J2XA 3PWPE 2VDKH 5ENWA 3TP4A 2R2HB 1SHMA 3BO8A 3FB5B 4BK4A 4LEOB 1EMTL 4DGVL 3CH8A 3LZFH 4M7JL 5C9JA 1EFXA 3WFHB 4M9PA 2O5ZH 3EKCA 4F3FB 1UCBL 3S4SG 5SWSD 4XXCC 3T8XB 2ICWJ 3TWCH 4EKXA 1FJ1A 1KYOK 4I1NB 4R3SB 1LK2A 1MJ8L 5DHVA 3HZVB 1XEDA 4LDOB 1UB5B 2EDEA 3KLDA 2YA2A 3P73A 5BVPL 3EYOB 3DARA 5LCVL 2X1XR 5DD3L 5JNYB 3EAKA 5KVGL 2EYSB 5HHXH 2YK1H 3P2TA 1IM3A 2A74A 1Z0MA 5JDSA 4PLOB 5L6YL 3KPSD 1VKXB 5EOQH 2BRQA 3LKSB 1ZWIB 1HSBA 1J1OH 5KW9L 2R0LL 4YHPA 2EIEA 4JFXB 2WBWB 3MCLH 1G9EA 1CDJA 4I9WE 5EUKB 3C60C 1PYWA 5E2UL 5CEXB 4EIGB 1C12B 2LU3A 5DC4B 3GSVB 3O45A 4PIRF 5L2KB 4NQSB 1OAYH 4ERSH 1HH9B 4R0LA 5KSVA 2PKDA 4AT6B 3L5IA 2ZUQC 3ARPA 3KPMB 4ETYA 4LLYB 1DL7H 3WNKA 3K74B 5LQBH 1W8OA 3FT3B 3V5HA 3VFRB 1EVTC 5E00B 4L9LB 4P5MA 4C59B 2YSSA 5JIPA 4QHUA 1YUHB 2OJEB 3GRWH 3TN0C 2FJFA 4KDTC 1NKOA 3QAZC 4PD4K 4GT7A 2VWEC 1RUAL 3FZUC 1RSFA 4N0UE 2Z8SA 1NCWH 5FM5O 4K7PL 1CK0L 4GG6E 5HY9A 3LDBC 4ZOAA 3S4SA 2CPCA 3OKEB 4RFOH 1T7VA 4YHIB 5TDNA 5CGYC 5IEHB 2OTWB 2LV4A 1U36A 1GIGL 5DZOA 5DGRA 4G80B 1YMMD 1AGDA 1I85C 1H8NA 3RGHA 3A67H 1JGLL 3FN0L 3G5XB 3T0EE 1H5BB 2FATL 1IKFL 4LQ1A 4TUKH 3GMLB 5IB2B 5JIHA 1B4JL 1CZ8H 2ZUVA 4PRID 4WHYG 4ZFZA 4HULB 2XA3A 4PGEB 3WS3A 3BD4A 3CZFA 3SDCD 2Z93A 5CD5D 5MI0B 1H9VA 4XT1C 1YC7A 1E0OB 5HGGS 4NBZB 1FCGA 3RKDC 4GQ9H 4K3HA 5L2KE 1BJ1J 3EDKA 3VMOA 4HK0A 2AJSL 2IG2H 1KG0A 4LCYA 1H3WM 4OCSL 3HR6A 2BSSB 1EEQA 4PJAE 4WTZG 1IC7L 4GXUN 5F7KC 4KJPD 3RBSA 3TESA 1REIA 3UBXG 2YC1A 1CS6A 4JR9L 2HVKA 4NZUH 3FQRA 4ZUWB 4NQDD 5I18H 1IL1A 3TVMB 3IFNH 4HUKB 5T1DL 1T04B 3CUPB 2XZQH 5GRUL 1N8ZB 4NO2A 2DL9A 5I15L 2VLKD 1IJ9A 2WQRA 5C09E 3V4PH 2EDNA 2CJUH 2B5IC 2FRGP 1GJIA 5ANMA 4M7ZB 2GJ6D 4U1NB 5GS2H 4ZSOA 4F33B 3G6JA 3UAJD 1JZ3A 2H1PL 5J1SC 2H8PA 3O2DL 3QNYA 5ISZA 2W60B 1MSPA 3E8UH 4MJ5B 3LQZB 1OF2B 3VFOB 5J12C 1J0KA 3CCHA 5L0QC 1C08B 4TSCH 3OR6A 2KQNA 2G75B 3WLWD 1EDQA 3CPLA 3NPSC 1QLFA 4GMSL 4K9EH 3N85L 5HHPB 2MCPH 3DX7B 3KPNA 4ELME 5ICXA 4EUPH 3TO4C 1SBBA 2DWEA 3VG9B 2LAGB 1K8DA 1BVKA 4X7TA 5DJCB 3F7QA 1RV6X 3HUJE 5ETUB 1KPRA 3NIGE 2G5RA 3MREB 3P9MB 3CSPA 1EH9A 1A6TB 4XGZA 1KIQA 4P2OB 2BSTA 4IOFC 2VXSH 1ES0B 2FYYB 2VDOH 2XG5A 1D5XB 4FXKB 4PBWD 5DJ2A 3C6LC 3V6FA 3AMKA 1RIUL 4WTZA 1JFQH 5DA4A 2W92A 3NN8A 5D96B 1S7TB 4MNQD 3UBXA 3DVGA 3MGTB 1UM5L 2WMPA 1ZT7A 2CRMA 4MQ7A 4FABH 4GRWE 1QFWL 4R4BB 4YBLC 4HLJA 5JO5A 2EC9U 4NN5C 3OF6D 4WUUE 4CVZA 5KVFH 2QQNH 1KCGC 3N06B 2ARJB 1NMBL 3NIDF 3I9GH 5LG1A 5JXEA 4O58H 3LEYL 4KMQA 4HKZB 1A7OH 1A6AB 1S5HB 4QRRD 4CNIA 4XP1L 5BCAA 2IPKA 4QWWD 3SDAA 3QEHA 3RAJH 4DZBB 2JELH 3OTTA 1UVQB 3KYNB 3QO0A 1I3VA 3PQYA 4WGVB 1JHTB 4QHKI 1OARL 1FO0H 3FRUA 4WFED 1FAIL 5EOTB 2ITCB 3HNVH 1RMFL 4JFQB 5C0IB 4BH8A 5BMFL 4KTEL 5HDBF 2BVPB 2B1HH 3F12B 1G7IB 3BRFA 4L4JA 1J0ZA 1TJHL 3LS5L 5GGQL 1CE1L 1F4YL 2V2WB 1F11A 3GSQA 4OF3A 3DUSA 4RQQA 3NFNA 3BKCH 3FB6A 3VXPB 2X4QB 2EEBA 4ZG1A 1UENA 2RFXA 4X6EB 3SJVD 2VE6B 1A4JB 2X41A 4HBCH 4HIHA 5JUEH 2ZSVB 1ZA3B 1F02I 4OLVH 1HKFA 5C1MB 3SGKA 3ULVF 2H45A 43CAB 3GIVB 1P7QB 3JWNC 3W9EA 2F53A 1CICB 2EDTA 1VGKA 1Z0NA 1A64A 3AXLB 4AYFA 4Z7VF 4TOYL 2ZPKH 4LPYA 4YPJA 5I75B 1KB5A 4E41B 4Z78B 1A7BA 4OBRA 4P59L 2Z91B 4DCQA 4HC1A 5TGBB 4OCLC 3LPGA 2EDLA 4HEPG 5ELIA 3GBML 3DOSA 3GUTB 3GSNL 4E9LA 1YQ2A 4Y1AD 4KZDL 1TETH 1QACA 2DLHA 2X4UA 3DVFA 2WUBL 1BJ1H 1FORH 1I8IA 5HHVL 2GTZA 3G6AB 1JPGA 5FECA 4HUVB 4BFBD 4M00A 4QLRA 3TJHD 5GHWL 5EO9B 2Q8AH 2EECA 5D5MB 1MHCA 3U82B 2IANA 1R3JA 3A6BH 4KKBC 1UWXH 4O02L 1HQ4B 3BAEL 4WW2F 5EIIB 2Q76B 4TTDD 4KTDH 3MOAL 2CRIA 2OJZL 1AI1L 1KELH 3QHZH 3TN0B 2H3NA 2NX5B 4HK3J 4CN6A 5F9JA 1KLFA 1T22B 4M5YH 4OFKA 1SJEA 2ITDB 2IALB 2QQLL 4PJ9C 1CVRA 4EI6A 5E8OB 2EKSB 3EYUL 4GBXD 4BQBA 5I71C 1I7RB 4F7PB 4O5LH 5T1KA 2Y36H 4KDVA 2AXFB 1LDPL 3BH9A 2AEWA 3QUYA 1BZ9B 1CG9A 4P4RA 2C1OA 1R3KB 5HYSA 4RISH 4X6DA 3EOBA 1NC4B 1PX4A 5DMJB 2R9HD 1AD0B 1JGUL 1NH6A 5F1NB 5C07A 2MCG1 3L7FB 3WJLC 2BY2A 1WAAA 1WCQA 3HKFA 5EZIH 4P4KD 5FB8B 4ZXBA 3RTQB 3WL9A 2YEZB 6CGTA 2YPVL 1RZJH 3GJFB 3L5HA 3FN9A 1P1ZA 3DMMD 2UYLB 2VL4A 1MFBL 4M8QB 1NGWB 2HN7B 4NIKB 4RIRA 3QDJA 2WBJA 2D0HA 3W0WD 2PXYB 1HSAA 2ENYA 4M3JA 1HHGA 2DQDH 3IDJB 4MD5A 3HI5H 4LRIA 2OZ4L 1T2JA 2AI0H 1P7HL 4JDTL 4MD4B 5K9OB 4POZC 3UTTB 2BNRD 3T65B 4HIEB 4JHAH 5I8CA 4OM1L 4BSWB 2YUWA 3RWGB 3H3PH 5CEZH 4C54A 4DW2H 2PO6A 1BREA 1KJVA 5F71A 3D39A 1U8QA 1LDSA 3RNKB 1L0YA 2NX5E 1FRGH 1MCIA 4PJBE 3F58H 5C3TA 5CEZD 4CVXA 3KPPB 4N5EC 4YR6B 3I6LE 3C60D 2XY1A 1MAML 4WCYL 4PJ7E 1OT1A 4AK1A 4OGXL 2GITA 1VENA 1FBIL 2R0KL 4LCCA 1A5FL 4ODHH 5I0ZA 4JB9L 4KUZL 1KV3A 4A6YH 1E4KA 1EO8L 5DUBB 3VW3H 2AV1A 1MRDL 1GVIA 2R1WB 4HQQH 5CWSA 3KYOB 5IV2B 1IFHH 1AC0A 5LXGL 3TO4B 4BSJA 2NY5H 1RUQH 1F6FB 4FMFA 1F90H 5BRZE 2ESVB 1YY8A 4NPYB 1QRNB 3V0AC 3FZUD 1I8KB 3PWUB 1INDH 2E7LC 4LSQH 4F2MB 4X7DC 2O5YL 1DBAH 1F4HA 3IAGC 1IEBA 4BELD 4PJFF 3C5ZC 3HE7B 5CGYD 4UILH 1MLBB 1XGRB 3QFJB 3LRSB 3ULUL 2BNQD 1P9MA 3PWJA 4YC2B 2FX7L 4X4YA 4Z0BH 2DJUA 4D3CL 4N1EA 4YBLB 5GGTA 5F89B 5D1XC 4C83B 5F6IB 1JPTL 2B4CC 3OL2A 3BHBA 5DHYA 4LMQE 4XBGB 4JREC 3T1FA 1I9IH 2V5YA 3LV3A 3ARBA 2VQUA 4KHXH 4MA7L 5SX5H 3MYZA 3K0WA 3QPXL 4PJ5D 3PIQB 1FE8L 3B8YA 5IFHH 3VDAA 1IBGH 2CLVB 3VXSA 1XGYH 4NT6A 3CLEH 3RKDD 5J89A 3C6SB 2YR3A 3S36H 1F4XH 5C6WH 2DBJA 1WWCA 1YNLL 4X4MA 2QQQA 3VE0B 4U6HA 2QLVB 3BP6A 2H32A 4ZFOL 4G59A 4PUBH 4OQTA 1IQDB 3GBNH 3HC4H 5TE4H 2ZOLA 5DMYA 4YDJA 1H3TA 2R2EB 2UUDH 1YJDH 1D7FA 1EUTA 1QRNE 1A1NB 2FIRT 1EGJA 5I1GL 4IRZH 4KDWA 1AR1C 2YUXA 4MAUH 4MCYB 1MCOH 2Y72A 2ZG3A 5E8EB 5T1LB 5TDPA 4AEIL 4B41A 1G7QA 2PR4L 4XNYL 3AU1A 2P5WD 2FCBA 4LVHC 3B3IA 2CUHA 4XBPA 3RWIA 1UB6B 1P5VA 4X7EC 3GSNB 5ID1A 1XGQB 5SX5K 3VFVB 2BMKA 5EO1B 3F5WB 3PWNB 2EO9A 3R1GH 2K9UA 1ZGLB 1YN6B 4PTUB 5TQ2L 3QXAB 3SE4C 3D2UA 3B2VL 1KTDB 3LMJH 3W5NA 2X4PB 3CXHJ 3IDMB 5DJ0A 1Y6NR 1RURL 4GXUM 1RFDH 4FQQA 4HGKC 5K9KA 5EU5B 4X9HA 3BP4B 1JPSL 4D0DB 1CGSH 2C4FU 1F8TL 2A6KB 5I66A 1RZKC 1FC2D 3I02B 5IG7B 3L95B 2XQBH 4H88H 2P49B 3QP3A 4ZQKA 5CKGA 4U1GB 5ITFB 4IOFD 3IDIA 2ATPB 2UUDK 3VJ6A 4WJ5B 3C6LD 1BD2D 4YGAB 3ZDZF 1A6VL 3EDFA 4AQOA 1G7HB 1K4DB 1Q9KB 1PW3A 3IDYB 2XA8H 3U1SL 3CC5B 4P2RD 4MB3A 2VKWA 4IMKA 1CQYA 4D9QE 4V3DB 1GGIH 3RHWF 2R1YB 3FAXA 1O7VA 4LHUD 3RDTA 5EU6A 1YEHH 5GRYA 2C4XA 1CCZA 3U9PL 5ALCH 3BPCB 5C0BA 3C8KB 5T1MB 3MBED 4Z9KB 3QI9A 2HJKB 3OKNB 4NUJA 5BV7C 3QUML 3GIZL 3T09A 3BFOA 3O8XC 3SE3A 3TGXA 2VH5H 1PG7L 1PZ5B 1IZKA 4YZFF 3KPRA 3BPNB 3IVKB 3LIZL 5E6YA 2HTKC 1Z3GH 4TULL 4V2BA 4NKIL 5KVDL 4JGUA 5F21B 4NO0D 5AWNL 3FFDB 1EUUA 3ARWA 3UTSD 4XBEH 2CDFB 2ZG2A 4R8WH 3MCKB 4K55A 2X4NA 2D7MA 4RRPA 3B2UC 2K7PA 5DR5H 4HS8L 2FWOA 2Q7NA 4Z7NE 2GCYB 3MR9B 2IAMA 4LSVL 1MCCA 4YHLL 4K3JL 1EHNA 1BX2B 4PJDA 4K94H 4S1SL 4PJCA 3IJHB 4WV1A 4GKSA 4C58B 4JAMB 3BQUA 2RCSH 1K2DA 5DK0A 2CUIA 5IW3A 2VQ1A 4EZMA 1R5VB 4KWUA 1VA9A 3ZDXF 4PJHE 1IC5L 3V0VA 4JFYA 5TF1H 4B7IA 4ODTL 2CKBL 5SV4A 1HZHH 3S3SA 1ZVSA 3ZE1F 3O11A 4JY6A 2VXVL 3BZFB 4KY1L 4KJWD 1QLRA 2VDKL 3CFKA 1DZBA 1FZKA 1CBVL 1HOCA 2CRZA 3C2AH 3LZFL 5DO2C 5FUOH 4I0PB 4JG1H 3U4BH 3PABB 3FQXB 1IAOA 3CZJA 1JNHB 4WRLA 2H6PB 3TWCL 4LKXA 2FEDC 3HLAB 3U46A 1AIFB 4WU5A 1DQQB 3PGFH 4MD0B 2AEIT 2APWA 4EDWL 3BEWB 3QNZA 2PCPB 1CLZH 3MJ7B 5BW7A 5HHXL 4C56B 2MQCA 2YK1L 4PRPB 4R2GB 4YWGL 1CGTA 4M3KB 3PGDB 2VL5B 4KKBD 1XH3B 3DHJA 4BZ2H 1CE6B 3G6JF 4FQIL 4KMTL 4HLZG 3BWAB 3ARSA 3SGJA 1NBZB 4G8GD 4N0RA 4Y5XB 1OTTC 4PV9B 2FL5A 1FLRL 3UCRA 2Z9TA 2V7HA 1MOEA 4D0BB 2VNCA 5SWSA 1OAYL 4PJ9D 2VRAA 3VI3F 4NUGH 3ZKXC 4ERSL 1T0MA 4D8PA 2BVTA 3W39B 3P4NA 4Z5RB 2X10A 4JO2H 5I73B 4LNRA 1DL7L 5DMKA 1LD9A 2I5YH 3HNTL 1XZ0A 1BM3L 5DDHA 3TT1L 3O2VL 5I76A 1AKJD 1VFBB 1K6QL 3RUGA 1M05A 1XIWB 3U48A 3DXAB 1AGEA 3BEVB 3GRWL 3HN3A 5C0CB 3TH4T 5BQ7B 1WIUA 4JQXA 3OJDA 2EICA 1DCLA 4G6JL 4ZFOB 2ZCHL 2YPLB 5FKAA 1QSFB 5C0FB 1YEIH 5JHLH 1WUNT 1KIUA 4M6MH 4P5KB 1YNKH 1A7QL 1NCWL 4E0RA 3IS1X 5D71H 4GS7B 4ZFFA 3STZB 4O9HH 4LSPL 3QUXD 4Y19D 3FFCA 4RFOL 4Z95L 3WHXB 4UV4H 1ZS8A 2GAZA 4P3DB 3DJ9A 1S9XB 4M7LL 1RZIB 4NGHH 3SHSA 4PGCB 1RK0A 1ZTXH 4LF3B 4C56E 3V6ZB 4PRPE 1ACZA 4POZD 1CDCA 4YAQB 1W72A 2IFFL 3AM8C 3UDWA 4Y4KB 2VERN 3ZHKA 4TUKL 3RVVC 1NBYB 1KJMA 5D7IB 1H15B 1C5CH 1L7IH 1UM6H 3X14A 5L8JB 3O4LB 4JQVC 4G9FA 4M1GH 4QYOB 3AREC 3ZTJG 5HYJB 2V17L 2VZUA 4GQ9L 4UTBH 5J6GA 4JPVH 1IARB 1SEQL 3ALWA 4P57B 2IG2L 5CS7A 2XRAH 4YHOL 1Y18A 1T2QL 1IEAB 4NOBA 4GSDH 4MX7A 1VEMA 2BHUA 3K8MA 3PHQB 5D6CB 3IXTA 5IB5B 2J4WH 5EZLB 5DA0B 1KLGA 1D5MA 1B90A 4NZUL 3DO3A 3RU8L 4YK4C 4ESKA 1MFAH 2JJUA 5I18L 4IRJB 4JFEB 3IFNL 4YDVA 5JHDE 5BO1H 5J8OA 2YPLE 5KSBE 1S3KL 1QSFE 4ODUB 5F7EH 3FO0H 5C0GB 5CJQH 3BIAX 3SDCA 3V4PL 3QJHA 4DEPB 5HYFA 2R2HA 4JRYD 4LEOA 5T3XH 4E5XB 5DVOA 4EOWL 15C8H 1ZHNB 3BP7A 4F3FA 3T8XA 1ED3B 3E8UL 4G8EB 3HZVA 4N0CC 3C5ZD 1UB5A 4WW1B 5T3XD 2NTSP 2XTJB 4TSCL 3E0GA 2LU7A 3EYOA 1BOYA 2PYED 5IWLA 4K9EL 1QR1B 5JNYA 2EYSA 4ONGL 5D4QA 1TJGL 5B39B 1Q0YH 4LPUA 5EIQA 4YXLH 1MI5E 4YFLF 1VFOA 2MKWA 3D3VE 2IH3A 3KHOA 1VKXA 3MRMB 1ZWIA 2CQVA 5D1XD 1KPUB 4Z7WB 4JFXA 3VDCA 2XPGB 3AROA 1DN0B 3GSUB 5EUKA 2VDOL 4I3SL 1C12A 1J11A 1HE7A 3GSVA 1MH5B 5L2KA 4NQSA 4MWFB 4LKCB 3O3AB 1HH9A 4FQXC 1S78C 1QSVA 3O8XB 4JFEE 4XNXL 4AT6A 4LLYA 5B3JE 4XHJC 4FABL 3FT3A 1Y6KR 3VFRA 1AJ7L 3NCJH 5E00A 5MP6L 1KCVH 4JO4H 4L9LA 4N8CH 5SWZE 3QCUH 4IM8A 3D48R 4HHAB 4YHMH 1RVFL 3TIDB 2OJEA 4FQLH 2JCCE 4PLNC 4V1DD 3I9GL 2DMCA 1GH7A 1LP9E 1NFDB 1BOGB 3K81A 4KRNA 4F9LA 2CKBB 2DJSA 3IYLW 2FEEL 2XYCA 3V6BR 4GAYB 2JELL 1AR1D 3GJEB 4LLMB 1DLFH 1NJ9B 2YPKB 3OKEA 4YHIA 2QHLA 5GGSB 2XTJE 4X6DF 3NCBB 2OTWA 2VXQH 5INDB 1KENH 1WAAF 3HNVL 2KZ1B 4QRTB 4AG4H 3G5XA 1EBAA 1H5BA 5F96H 4UINH 1RQ5A 3K3QA 2BVYA 4L5FH 5FOJA 1KTLB 3GMLA 5FUCE 4Q6IA 5IB2A 2F9BT 5D7LB 5IR1B 3OG6B 4K2UH 4ELKB 4P9HC 5DRWB 3GDBA 4PGEA 2EDOA 5FKPA 5FIEA 3BKCL 3G08B 5FO9A 1J1XL 3OKOA 5L8KB 5E4IA 4YHNB 1MCBA 4MVBC 2Y7QB 5JUEL 4QOKD 3WSQL 4OLVL 1NKRA 2BSSA 1LNUA 4PJEB 2F19L 5TJWK 1KEML 4NN7C 3IU3B 3FO9B 2A1WH 2QV2A 2V9RA 4P9HL 3VXUD 4JQIH 3PHOB 1U8NB 3N0PB 3U9UB 4QXGL 3B9EA 1CFNB 1KF9B 3TVMA 2E9BA 1CXEA 2ZPKL 1RJLB 2WWMC 5AYQA 1KB9K 1T04A 2ED7A 3CUPA 3WJJC 5E99L 3NCFB 2DBLL 5D2NA 5DLMH 4L4TB 3S35H 4F7TB 1E4JA 1HYRC 1JPFA 1Q1JH 5J11C 2YHGA 2XT1B 3HA0A 5K59E 2GK0B 4CRPA 4U1NA 4F33A 3IGAB 4ZS7H 3P9LB 4MNGE 5HVWA 3NCEB 1D6VL 3CH1B 1FORL 2W60A 4U1KB 1KTKE 3BE1L 1MJ7L 4MJ5A 3LQZA 1OF2A 3ZKXB 2NY6C 2IQAB 3O8XD 5KANG 1S7WB 4UIKL 1C08A 2B20A 2X70B 2G75A 3KPSE 5D7LE 4LARH 2HTKD 5DRNB 4K3DH 5AYUL 5F9WC 4CVWA 4QRUB 4KRPC 4X9BA 5FK9B 2D31B 1C7TA 4KTDL 4LBEB 1I9RH 2BERA 2Z31B 3QHZL 2AJYH 5ETUA 5DK3A 5C0EB 5C2BH 3MREA 5IIEB 1QYGL 3P9MA 4XXDB 2ZZUT 3VFGL 3LOWA 1A6TA 1HINH 3PDOB 3B2UD 3SE9L 3EDJA 1RD6A 3P3YA 3TCXA 4FXKA 3DROB 1E6OH 1D5XA 4JHBA 3RWCB 2BOBB 4TVPL 5D7JC 4DUXA 2B8OT 5T33H 4H25B 2Y36L 1OTUD 1FNHA 5JW3H 3LKOA 1ULVA 4FQHB 3O3EB 1UH2A 3MGTA 4AZ8A 4GAJL 4RISL 5EB9A 1NCTA 1JNLH 2I60H 4R4BA 5EZIL 4L4TE 2BDNH 2ARJA 4JPWH 1RZJL 5DJAA 3WD5L 4NNPL 1HCFX 3SKUD 4NJ9H 4HKZA 3WEXB 3IDUA 3ESVF 1A6AA 4RX4D 1S5HA 5KTEH 4JDVB 1J1PH 3AREB 5DO2D 2FZ3B 2A77L 4QHKJ 2BX5A 2DQHH 4DZBA 1YMME 1MCKA 1UVQA 3KYNA 1B0GB 2FEDD 5CINH 1YYMH 3WNOA 3CSBA 4U0RC 1JHTA 4IRSC 4TTGA 4PRIE 4H0GA 3H3PL 4CVUA 5EOTA 2ITCA 3X13B 2XWTB 2VLRD 4JFQA 5C0IA 1U42A 3MUZ1 1VB9A 1Q9WB 3U83A 5HHOB 4ONHB 4S1QH 2WIIB 2BVPA 1NCBL 5FHAL 3F12A 4QNPF 1QNZH 2LTQB 3FT4B 4U3XA 1QQDB 4DUVA 5CBEB 3NCMA 1CFQB 2WV3A 3VG0H 1J86A 2BY1A 4L8SC 5GJTH 2X4QA 3HCVB 4XX1E 4CDHA 4X6EA 3CSGA 3W0WA 2VE6A 4LQFL 1OTTD 4LPCA 4G3YH 1OAKL 2ZSVA 5GGSY 1ZA3A 3LEXA 4NKDB 4NQDE 4Q74A 4ODHL 1WFOA 3O6KL 4H0HB 2YA1A 1DEEB 4A6YL 43CAA 2XTLA 5C08D 3GIVA 2W91A 1P7QA 3VW3L 4DQOH 4PPTA 2AERT 3AXLA 2VLKE 3RBGA 1QEWA 1IFHL 3MUGB 3JWDC 4HIIB 2L4OA 3X3FH 4E41A 2GJ6E 2NY5L 4Z78A 1RUQL 2FBOJ 1F90L 4WNQB 2Z91A 4LCWD 5DUPH 5TGBA 1FZJB 3GUTA 3N1MC 4XRCB 1XMWA 3WS6A 1IGMH 3F7YB 4LSQL 3MRGB 4GQPH 1FG2B 2Y07L 3G6AA 1VESA 4HUVA 2F8VA 2H2SC 3PWVB 5I1AB 3HFMH 3JWDL 1MCFA 2DM7A 4PS4L 5EO9A 5D5MA 4XCEB 1V05A 2P8PA 3C8DA 4OAWA 3BDYH 1HQ4A 5EIIA 1UM4L 4GUPB 3RVVD 4KC3B 3MNZB 1G0DA 2DLFH 2Q76A 3LRGA 3UO1H 5HI5C 3R06A 1I9IL 1URLA 1OLLA 3TN0A 4J3VA 4KDTA 4QRPB 3E3QC 4X80H 1IBGL 2IH1B 1T22A 2A9MH 1XGYL 2ITDA 3CLEL 4ALAH 1FSKB 2Y06H 1IC1A 3OXRA 3S36L 1CFBA 4MNQE 3GI8H 1D5BB 5D7SL 1QSEB 2EKSA 5E8OA 5EU3B 1SM3L 1T89C 1UWGH 1I7RA 4F7PA 3T3MF 1IRAY 3PDDA 2AXFA 4QXUL 1XCTB 2L0DA 1DFBL 1JGDB 1BZ9A 5GRJH 3HC4L 1MRCH 4PG9B 2HJFA 1R3KA 2EDHA 5LGHL 3EOAA 2WIMA 1AD0A 5J0BA 4HV8B 1OY3B 3L7FA 1YJDL 3T2QA 5FB8A 1B0WA 4QRRE 3RTQA 3ULVC 1KJ2H 4XPHH 3F7VB 3GJFA 2P4AB 3LS4H 2UYLA 4PJDF 1X5LA 1NGWA 2HLAB 2A38A 2HN7A 4PJCF 1M7DB 1S9YB 1MCOL 5HXMA 5DRZB 1I8MA 4AL8L 2PXYA 4OFIA 4Z77B 2R8SL 1IKNC 4JVPA 4P2QB 1NFIA 4MD4A 1BQLH 5K9OA 3UTTA 4UUJB 3H7LA 1KBGL 4HIEA 4ISVB 4N0CD 2ED9A 3BH8B 4TYUA 1CFTB 4BSWA 3OGCB 3O2DA 2BVOB 3LMJL 5AUMB 3RWGA 2HH0H 4F7EB 3CLFH 1VGEL 1A6WH 3BWUC 4C4KO 4R96B 4K7FB 3CU1A 2HT2C 5E2VH 3GZKA 3VMPA 5I9QB 2R0ZH 3RNKA 4UQ3B 2VLLB 3SJVE 1J5OL 3NZHH 4IIQC 4PGJA 4MA1C 2B7DT 4P2CG 2RGSA 2WP3T 5IK3B 3QIWB 5GPRA 2XQBL 4H88L 4AEEA 3KPPA 2ERJB 2J6EH 4YR6A 1F3DJ 2CRYA 1CR9H 4BJLA 5DJZB 3TC9A 2J2ZA 4FQXD 2XA8L 2IC2A 4OJFL 4LLUA 5MEOB 2NY6B 1S78D 4Y4FC 4DN3L 3H9SB 5DUBA 5CSBA 4XHJD 3O6FC 3LKPB 4WI9A 4ZNEA 3KYOA 5IV2A 2XACC 4LPTA 4Y1AE 1YPZB 3TO4A 1PEWA 4MHHI 4X83A 1OP5H 1YEHL 5ALCL 5B21A 2ESVA 2CSPA 4QRPD 4NPYA 1GCFA 1I8KA 1BQHB 2BOCA 1ORSB 3SOBH 4P2QE 3MLSL 3PWUA 1DANT 1U95B 1UT9A 4G5ZH 4OLUL 3RWEA 1OD9A 4F2MA 5JW4R 1N59B 3WCYA 3HE7A 4LLDB 1N3NB 1MLBA 3RUGF 2PF6A 1D5ZB 1XGRA 2AK4D 3QFJA 3LRSA 5F9DC 3QNXB 4LVOC 5FGCB 4XCNA 4X6FB 1ITCA 5BS0B 2FHCA 1B2WL 2AEQH 1FIEA 4YHYB 5I1KH 1AD9B 5D2LF 4PRHD 1S9WB 3R4DA 4XBEL 4R8WL 4UB0H 2AJ3B 1I8LC 3M45A 4DJMA 4C83A 4FQ1H 4Q9QH 4P0DA 4XBGA 3P0VH 5DR5L 3VFSB 3PIQA 3K80A 2CLVA 3SKMA 2DQEH 1TQCB 3C6SA 4OKVB 1KFAH 1OP9A 4K94L 1ADQL 4MVBD 1U2HA 1NLBL 3S7GA 2W65B 3HG1B 2RCSL 4YBQC 3VE0A 3B9KD 1NCAH 1FL6B 2J7LA 4U0RB 3TBVB 1MVFA 3HMXH 4TSAL 1T1YB 1HZHL 1YPZE 3MV7D 2R2EA 2VTFA 5KS9E 5L9DL 3MLVL 2WWMD 1CL7I 4A6YB 4MJ2A 1U8LB 4NHCL 4LLQB 1A1NA 5C0AD 3OKMA 2CUMA 3HPLB 3T04D 4DKDC 4PP2A 3VWKD 1MCWM 3U4BL 2Q87A 3FONB 5FHBH 2XN9B 2ZUTA 1ZAGA 4KRMB 4MCYA 2UWEB 2BNRE 5T1LA 4LVNC 3V2AR 2YRLA 3PGFL 5HPMB 1P53A 1UB6A 4ZTPH 3GSNA 3TA3B 1ZLUK 5EO1A 3F5WA 5E0QA 3PWNA 1B9ZA 1VFMA 2E3VA 1AO7D 2CKNA 1ZGLA 1DDHA 1YN6A 3VH8B 3QXAA 1KPVB 3EO1B 4JDZB 4OZIB 1CGVA 4TVPD 1HHJB 1KTDA 25C8L 2X4PA 1GOFA 5DEZA 1T03L 5E4EC 3IDMA 3QO1B 2DQUH 1HN1A 3AUVA 4KRPD 5CEZE 1B0RB 1EZVY 2BRRL 5EU5A 1X9QA 4D0DA 5AZ2H 4RAVB 2A6KA 4ZMAT 3QIBD 3I02A 4Z7UE 5IG7A 3INUH 5H2BB 3L95A 4OD3H 5IB1B 1WZ1L 1A7RH 5ITFA 1HDMB 1PJ9A 2ATPA 4FXLA 4OLXH 5K33A 4NUGL 5IMOB 2X4OA 4WJ5A 5FYLL 4OZFH 4HZLB 4FS0A 4JO2L 2NYYC 4WO4B 1EZVX 5D7JD 1G7HA 4KVCL 1K4DA 1Q9KA 1KXVC 5CMAB 5E56A 3CC5A 4KRLB 1EXUB 3O6LH 1CN4A 1BMGA 4KJQC 2YRPA 3GSWB 3FQTB 1G7JB 2NNAA 2AQ1A 2R1YA 2VWEE 4P46B 2AK1L 4MMXC 5JHLL 3D18B 1G1YA 4JANA 4M6ML 1YNKL 1TDQA 5D71L 3BPCA 4YHZH 4O9HL 1GPOH 3C8KA 5T1MA 4G9DB 3U7YH 1OGTB 1T1ZB 3CFCL 2HJKA 4APQB 3OKNA 4B5EA 5E2WH 5IHZB 4HPYH 2BNQE 4PJ9A 4NGHL 1ZTXL 5GS0C 1J8HD 2BC4B 1PZ5A 2Q8BH 5JW5B 5KN5A 5EBWB 4WFGD 5EBMB 4NWTL 1MLCB 3IVKA 3KYKH 1MHPL 4IRSD 3DGGB 5F3HB 2D4FA 1AKJA 2BP3A 2OZ4A 1C5CL 1L7IL 4PJ5E 1S7XB 2CDFA 3MRLB 1FVDB 2AXJA 1UM6L 3WJLA 4M1GL 5F9OL 4W4OA 2XZCH 4NN6B 4XP4H 2GSIB 4JPVL 3ARVA 5IQ7L 1RU9H 4PJXB 5TE7H 3VFUB 2GCYA 3MGOB 3WDIA 3MR9A 3K1KC 2C3VB 1RZGB 1BX2A 2X4TB 4ZPVB 5DRXB 1P4BH 3GSRB 1VFUA 3JXAA 3IJHA 5D72H 2J4WL 1Y6MR 4JLRB 4PJIE 1CTNA 1MFAL 5FA3B 1R5VA 3HR5B 1NCUA 5BO1L 1D3CA 5IT2L 3BZFA 3IF1A 4YEFA 3QXDB 4TVSa 2P5WE 4IIQB 4HS3A 1ZLSH 4I0PA 3UPRA 15C8L 3DX9B 3FQXA 1X6NA 4N5EA 3IFLH 2H6PA 1QHPA 4EN3C 3HLAA 1GC1C 1DQQA 5F6HJ 1MAJA 4MD0A 4ZOBA 4JFFD 1QUNA 5JPMB 5A2KH 3C08H 1KCRH 2G5BB 1BIHA 2H2SD 1UXWB 3BEWA 4R0LC 5SV3A 2PCPA 4U1LB 1YYLH 4C56A 5KSUB 1UYWH 4Y4FB 3VXRB 1Q0YL 5ESQB 5E8DH 4YXLL 3PGDA 3O6FB 2UVEA 1XH3A 3DWTA 4JFOA 1CE6A 5HI5D 4RMWA 3HTLX 1NAML 2Z8RA 3BWAA 1NBZA 1NCNA 2GJZB 1GC1L 1BD2E 4D9RD 4Y5XA 3UTOA 4XHQA 4H26A 1ZMYA 4PV9A 2IWGA 5FGSA 3S3JA 4D0BA 1S7RB 5CP7B 5DS8B 4P2RE 5JIIA 2XICA 1RJZB 3W39A 3ECBB 4JZNB 4KKCC 4HWNA 2OL3H 2DD8L 3QDGD 3NCJL 2M8XA 3MYJB 4LVOB 1KCVL 2OCFD 2IQ9H 1VFBA 1PLGL 4YHML 1I1YA 3Q6FA 1FFNB 1XIWA 5DI8A 3DXAA 3HAEA 4FQLL 3BEVA 5C0CA 5BQ7A 1V7NH 4ZFOA 5JXAH 3VMNA 4FZEH 3Q3GB 1QSFA 3ULVD 5DURB 3BGFB 1M7XA 4P5KA 1WWBX 3QBTB 1CDGA 4ZAKB 3X12B 5FA4B 4D9LH 3BZ4B 1FDLL 5A2IH 1D6EB 1EHAA 5HVHB 4P3DA 2X1QA 1S9XA 1RZIA 1AQDB 4AH2B 4PGCA 4LF3A 4OIIL 1KENL 3V6ZA 4AG4L 3VXRE 4OGYH 4XVTH 2BSED 4YAQA 1PEZA 3BKMH 4Y4KA 4RWYH 2CGRH 5D7IA 5B39G 5TQ0H 4LK4A 1H15A 4HIXH 2M1KA 4GG8A 2KPNA 4HWZB 1E6JH 2HT2D 2HFGH 4I5BB 1NSNL 5DVLA 3O4LA 1N2RA 4OQ1A 1OAZH 1WFTA 5TDOB 3SQOH 5HYJA 4DKFH 5IVXE 3MV8D 4P57A 5E7BA 5GGUB 4M5ZL 4MQXC 4Q9BA 5FO7B 5CUSH 3PHQA 1CD8A 5D6CA 5IB5A 4HS6B 5DEGA 1FHGA 5IOPA 5EZLA 5LKNA 4JQIL 4DKAA 4RA3A 2LFGA 3BP5B 3C09C 3ZYOA 4YBHA 4IRJA 5KG9B 4JFEA 5ADOH 3ZE0E 4UZGA 2XKSA 3SPVB 4O51B 3O6FD 2OK0H 5DLML 3S35L 5C0GA 1CD0A 5I8EA 1Q1JL 2AJUH 3PHSA 1BAFH 1S7UB 2VKXA 5LAXA 4E5XA 2MMXA 4OZ4B 4ZS7L 1KN4H 1BJMA 1LQSR 4QOKA 5CIPH 1ED3A 1K5NB 2PTUA 4XWOD 1BF8A 1KOAA 1DBKL 4WW1A 2NXYD 4XPFH 1EEYB 4XP6H 1X5FA 1OPGH 4K3DL 1QR1A 1SQ2N 3QUMA 2GY7B 1RUPL 4AENB 2COQA 4G7YH 4G8GE 4NQEB 1BEYH 3V4UH 2AJYL 2HG5B 2HWZH 3MRMA 5C2BL 5DFWH 4HPOL 3ZT6A 1KPUA 4Z7WA 2D4DA 2FD6L 1DN0A 3GSUA 1Z9MA 2D7PA 5E6IB 5JXEC 1T21B 3QEQD 1UFUA 4OFYD 1EO7A 4N90E 5D5MF 1MH5A 2DYPB 5T33L 3MRPA 5I8KH 5CFHA 4MWFA 4QF1B 1QFOA 4XTRC 1TENA 3O3AA 4LKCA 5JW3L 2BNUB 3O8XA 4YBQD 3L1OH 2ICCA 2CH8A 3HMWL 3ZL4L 3ARGD 3QWRD 2I60L 3O3UN 3CDFA 5E70A 3QEGH 2FR4B 4HHAA 5HVGB 3TIDA 3THMH 1I1AB 2NLJB 4WU7A 4Y19E 4NJ9L 1NFDA 4BQ9A 1BOGA 3S98A 3SBWC 2CKBA 4S10A 2MKLC 4XNZC 3V0WH 4GAYA 4YGVB 1X4ZA 2P5EB 2DQHL 4LLMA 1WICA 4UT6H 1NJ9A 2YPKA 5GGSA 5CINL 3BT2H 1EO5A 2GUOB 4N9GB 5B4MC 4ENEC 2C7UB 2I07A 4PY7B 4QRTA 5HHMB 4N0YH 4RDQG 4NKMB 1MF2H 3CVHH 4S1QL 2GTWB 3QDMB 3GI9H 2DQIL 1KTLA 3UYPA 5D7LA 4GFTB 1QNZL 5KZCD 3HHRB 4ELKA 1AP2B 5DRWA 1FNEB 2VXTL 3VG0L 1IVLA 5IW6B 3F62A 3G08A 4GMTH 3TH2T 1UEYA 4Q7DA 3QQ4A 3EO9H 4RX4A 3DV6B 1H3GA 4YHNA 5CSZB 1XR8B 5D70L 4M1DH 2Y7QA 1N7ML 4OI9A 2I9LB 3IETB 1MQKL 1NAMB 1CLOL 3HZMB 3ES6B 4PJEA 1JTTA 2NYYD 5D8JH 3WO4C 4DQOL 3IU3A 2HT3C 2JF1A 3PHOA 2DI7A 4PY8I 4MJIB 4KJQD 4JFDB 1RJLA 4GRWH 3GMQB 4JRYE 1EAPB 3X3FL 1TCMA 5FF6A 3VRLF 4JRXD 5IMMA 5DUPL 2JJSC 3KJ4C 1SBSH 1NGZB 4L4TA 4WVRA 1MVUB 3HNSH 4J3TA 4B0MM 1JGVH 1S5IH 2E7LE 1IGML 2GK0A 3O0RL 3GRWA 3KJ6H 3IGAA 3EGSA 3P9LA 2QSCL 5T3XE 4GRLB 4RGNE 4K71C 1FZOB 5GS1B 4OLYH 3CH1A 4U1KA 3UJIH 5I19H 4PJGB 2XWJB 4UT9H 5ITBL 1QFUH 4KGLA 5FM8A 4FQJL 3HFML 4M93C 1EV2E 4OKDA 5GS0D 4F15B 2PW2B 1EJOL 1JF6A 3MX0A 4OUOA 1S7WA 1CQKA 4RNRA 3QDME 3VFNB 1WBZB 2X70A 3BDYL 2DQJL 4F37F 5DRNA 3D0LA 2J3SA 4QRUA 3ZYZA 3MXVL 1FV1B 1ZGLP 4LBEA 4QHMB 4XC3H 2ORBH 5C0EA 4N1HB 1K4CB 3FOMB 5IIEA 3QXUA 4ZXBC 2CLRB 1MPAH 5DT1L 4EUPG 1JN6B 2A9ML 4GKNB 1BECA 3PDOA 4ALAL 3CSYB 2Y06L 2A2QT 3DROA 3GI8L 5DHVH 4GAGH 1D9KB 2D7TH 4UDUB 3QG6B 4OF6A 3RWCA 2WBJC 2GT9B 5EA0H 2BOBA 3RX7A 5EWIH 2FHFA 1EFXD 2R15A 4L3ED 4ZODA 5E03A 4LRIC 2NXZB 5GRJL 4PP1C 4FQHA 3O3EA 4JFDE 2VLJB 4TNWF 4V1DE 1HKLL 5JQ6H 3MJ9L 1NDGB 2GK2A 2PUQT 2PO6C 2NY2C 1P4IH 2X4SB 2X9XA 4Y2OA 4R4FL 3ZTNH 4UNUA 1HHHB 4LSUH 3WEXA 4LLVB 4JQVA 3BUTA 2X6MA 4XH2A 2NY0C 2PN5A 4U6XB 4JDVA 3AREA 4R9HA 2FZ3A 5EN2B 3X11B 5DUML 2A0LC 1B0GA 3RVXC 4EN3D 2X44D 1BQLL 4KAQH 4G6ML 2APVA 5KANI 3JUZA 1M4KA 3TZVB 4LCCC 3X13A 4I18B 2HH0L 3CLFL 1FCCA 3S37H 4MXQA 3AAZB 5GSVB 1GGTA 1A6WL 1Q9WA 4R7NB 5HHOA 1WK0A 4ONHA 2WIIA 3U0TB 3RZCB 2R0ZL 1FNGB 4YDIL 3FT4A 3O6MH 1QQDA 1TNNA 5CBEA 3GSXB 1CFQA 3OKYA 1RUKH 4OD1L 2J6EL 5I1EH 2I26N 4OI7A 3NA4A 1WIPA 3BYTA 3AMLA 3FHAA 4KV5F 4MS8A 3VXUE 1IT9H 3MFFB 1AQKL 4NKDA 1KIPB 3RHWK 4UNTA 1JWUB 4NQVB 4Y5VB 4FNLH 2F54B 2EDJA 3FJTA 4KFZC 3MUGA 2LVEA 1P9MC 4HIIA 4YXKL 1EEUA 3WIIL 1H8OA 1LO0H 4L8DB 4OT1H 1J88A 1JMZA 3WN5C 3TIEB 1NGPL 1FZJA 4F8QA 1PD6A 4XRCA 4HJGB 1DQMH 1GL4B 3SOBL 3F7YA 1LHZA 5F1KC 4G5ZL 4I13B 3MRGA 4KHTH 5IVNA 5B38B 1FG2A 3LHPH 1C1EH 3L3DB 1R24B 2P43B 4N9OB 1ERNA 1MHHA 3VXMD 1V3LA 4I2XB 4CW1A 4ODXB 5I1AA 1U91B 4F57L 3F7RA 3RJQB 5JZ7C 4AM0B 3S34H 4XCEA 5EZOH 4EQ3A 4MXVE 5FGRA 4UB0L 4PB9H 1TIUA 3MNZA 1QSZA 1HIMH 4WFHD 2EH8H 3P0VL 4MB4A 5HGBB 4PP8C 5FOBA 4R4ND 4QRPA 3MQIA 3VRIB 5H94B 2DQEL 1KFAL 2MQ0A 1NMCB 3SN6N 4BKLB 1D5BA 3DSFL 1QSEA 5EU3A 5ICZB 5JPNB 4OD2B 4R90H 3GK8H 4HKJB 1FPTH 3E6HB 4FQCH 1NCAL 1XCTA 2RAMA 5ISZD 1JGDA 4WHYH 1N5YH 3P30L 2Q3ZA 3TFKC 3CK0L 3VXTA 4JY5L 3U0WH 4HD9A 4HV8A 4NHUB 4J8RB 2WBKA 3FO2B 1DVFB 3NAAH 2YMXH 2VSDA 4LGRB 1MEXH 3F7VA 3MZTA 4G6AC 3T2PA 2EYTB 4NO5B 5ACLA 1M7DA 5DK2A 1S9YA 5DRZA 4HMCA 1BQHG 3EW3B 3GMRB 5I17B 3J7HA 5B3NA 4Z77A 4FFEX 2VLRE 3CDYA 1W0YT 4R26H 1A7NH 1ONQB 4E42B 4UUJA 4ISVA 3BH8A 3OGCA 2W9DL 1JWMB 2BVOA 3DX8B 5AUMA 3P40A 1N6UA 2EIZA 4F7EA 2KH2B 2DQUL 1AGBA 3LD8B 4X8JB 4R96A 1XF3A 3PWLB 3NIFF 3Q5OA 1DN2A 4K7FA 1WWAX 1JV5B 5D1QB 5CBAB 1OLZA 1ZK9A 4UQ3A 1WVZA 2VLLA 4EDXB 3WJJA 5IK3A 4LMQI 3QIWA 3ABZA 4OD3L 3VD4A 1ZVYA 1AGCA 1U8MB 1MIMH 5BJTB 4O4YL 4OLXL 3MLXH 3EFDH 5F9AC 3T2NL 3SDXE 5C08E 5JXED 1K9TA 3MA7B 2CK0H 2VDLH 5ALBH 2F8XC 3SGDI 3QI9C 5DJZA 2GI7A 2IMNA 4LIQH 4YDLB 5KSAC 4HWEL 2BY0A 5MEOA 3KWWB 2J8UB 3H9SA 4JVUA 5I8OH 1JYNA 2BVUA 4IS6B 4Y16C 3ULUF 4LCWE 1TZIB 1JRHH 2JIXB 4NRXB 1F58H 4JGJA 5DEFB 2G60L 2W9LA 1YPZA 1XF1A 2D7QA 3VI4E 4DVRL 1UC6A 5IVZB 3OAYH 1GPOL 1DLHB 1Z9OA 3U7YL 2QADB 3MRFB 2QHRH 3MV9D 1BQHA 1ORSA 4LHQB 5E2WL 3G5VB 5T5FH 1U95A 4HPYL 4DGYL 2IEPA 3X3GH 1N59A 2ZNXA 2Q8BL 4WWKB 1N3NA 1QVOB 4G6KL 1Q0XH 1D5ZA 2DQGH 3QNXA 4HWUA 4WV1C 4X6FA 3BQUC 1ETZA 4JFPB 5BS0A 4ENED 3VH8G 1I7UB 4P5TB 1AD9A 5F88B 1S9WA 4GW4B 3V52H 2AJ3A 1TJIL 1U3YA 3H7BB 2F53D 3K1DA 4KI5C 2IPUG 1QA9B 2XZCL 3VFSA 2W1NA 5SWQA 5D6DA 2VABB 5TE7L 5LWYH 1KCUL 1L0QA 3GKZA 1X5IA 3RI5F 3AS1A 5IB4B 2DLGA 4OKVA 4JJ5B 2GFBB 5HBBA 2W65A 3HZYB 3NFPA 3HG1A 2YKLH 1TVDA 5D7IF 1FZMB 1OGAB 1AXTL 1FL6A 1UZ6E 3OAYK 4Y4HB 4KZEH 3MROB 1UACH 3O4OC 2WLYA 1T1YA 3JWOH 5F1SA 5GIRB 5MERB 2HT3D 1LGVA 3W9DB 3GKWL 3C9NB 2HA1A 4HT1H 3BI9X 2IAND 4QTIL 4A6YA 3QRFM 5H37G 4LLQA 1KTRL 4IBLT 1CT8B 2NY3C 3GB7B 1WBXB 2D7OA 1NBQA 3FMGH 5TPWH 4L8SA 2XN9A 3SGJC 5FM4A 2JJVA 2UWEA 3IU4H 5C0ND 1I7TB 5HPMA 2QTEA 3TA3A 2FSEB 2WUCH 4Z76A 5J9PB 3EOTH 4OSUH 1JMXA 1AFVL 3O9WB 1YYLL 2DQFB 3BPOC 3VH8A 1UYWL 1KPVA 1C5DB 3EO1A 3IJYB 4JDZA 3DYMA 3TYGH 4OZIA 4HFUH 5E8DL 5T1KD 1HHJA 5A3IC 1RK1B 5AZEH 3QO1A 1JE6A 1P84K 3PV7A 3QUYD 1B0RA 4FG6C 3WUWB 5ICYB 3P0GB 4RAVA 4JQXC 2ADJB 4MJ4A 5C07D 4EXPX 1R5WB 3MRJB 3EFFA 4ZXBD 4H8WC 5H2BA 5CZVL 5IB1A 2QSTA 5CJ8A 1HDMA 5IMOA 2ZJSL 2AXHA 3OMZA 4HZLA 3QDJD 2WBJD 3CMOL 2DMKA 1H3VA 2OL3L 3WKMH 3QULB 1EXUA 4PP1D 3QG7H 4KKLC 4LCIH 4Z7WF 1P6FA 5HPOA 3GSWA 1G7JA 5MEQB 3UDWC 1IAKB 1V7NL 4RSVA 5JXAL 3U79A 4F7MB 4P46A 2PO6D 4FZEL 4OZHA 1WZLA 2NY2D 1N64L 3D18A 3L5WB 5E08H 3B4NA 1V3MA 1TPXC 3ARFB 4IMLB 3D39D 4X7SH 4ZDHA 2A6IB 4G9DA 1OGTA 2NY0D 2BVQB 2AK4E 4APQA 4DN4L 1RZ7H 4WENB 5IHZA 1FFPB 4X7FC 5DXWA 5K9JH 2A0LD 3K2UL 2BC4A 3RVXD 4WFFE 5DQ9B 5JW5A 4PRHE 4XVTL 1KT2B 5EBWA 3WXVL 5EBMA 3I6KB 1FFQA 4RWYL 3DGGA 3ZKQD 5F3HA 2GY5A 1NFDF 5TQ0L 3B43A 3KXFB 1S7XA 4HIXL 3WFCL 3VA2C 4OTXL 3R0NA 1FVDA 2HFGL 3T0BA 1CD1B 4NQCD 4MSWB 5I74B 3LKQA 2XV6B 3SQOL 3LQMA 4DKFL 2FO1A 1IM9B 1OAQH 3IT8D 4FRWA 4JM4H 4XAWH 2GSIA 5GISH 5A1AA 4PJXA 5J56B 3MGOA 3HZKB 3T77B 2VDRH 4FQPA 4ZPVA 2X4TA 5DRXA 4MQTB 3GSRA 3QEUB 5A2JH 5IB3B 5FV2A 2FGZA 1BBJB 2R29L 3MV7E 4JLRA 2V2TB 5C0JA 1I3GH 1F97A 1N0XH 3ROLB 5FA3A 5EOCJ 3ILPB 5AAWA 5ADOL 1IAIH 1S7SB 3HR5A 3DRTB 4Y5YB 4OZFB 1LO3L 1TITA 5C0AE 1NUNB 4ZO7A 4KI1A 2FJGB 3G9AB 3BN9C 3WYRA 2ZUSA 2OK0L 1AHWC 3MRNA 4HJJL 5EZJB 4EEEA 1T66C 2WY3A 1OQOA 2AJUL 3T0EC 4MLIA 3QXDA 3O2WH 5I6XB 4IIQA 2ARWA 1LQVA 1T7YA 2R0WH 3DX9A 1KN4L 5GQBA 2GW5A 1OAUH 4PJEF 4DOHE 3ARBD 1NL0H 3EUUA 3MLUH 3JTSB 5I2IB 2NW3B 4PGZA 1AO7E 4L29B 4UAOB 2H32H 1MCWW 3QUZB 1A8JH 4OQTH 3DI3B 2AS5M 3VXSD 5T3ZH 4FTVB 4XPFL 5JPMA 4UIMB 2G5BA 1UXWA 5FYJH 4NFCA 2EZ0C 4U1LA 3VGFA 5JZ7D 5KSUA 3KXFE 4HWBH 4Y4FA 3VXRA 5ESQA 3WV0A 4G7YL 5I0DA 3O6FA 1EGJH 3U7WH 4NO3B 3CX5J 3ET9F 4L9LC 5T3ZD 1ZVHA 5FYJD 5E1HB 4NSKB 2GJZA 4K3EH 5HTSA 4RFNC 1F3JB 3H0TB 4U1JB 5HI3C 2HT4C 5I8KL 3B9AA 4RFEB 5CP7A 5C6TL 2YS4A 3ARZA 1RJZA 3V4VH 2VZSA 4JZNA 2NY4B 2VUYA 3NGBC 1FYTD 3LCYA 2C3WA 1L6ZA 3MYJA