1A1WA

Fadd death effector domain, f25y mutant, nmr minimized average structure
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
83
Chain Sequence
MDPFLVLLHSVSSSLSSSELTELKYLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure and mutagenesis of the FADD (Mort1) death-effector domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords FADD PROTEIN
total genus 23
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 1997-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 1a1wA00
1WMGA 2IB1A 2KN6A 4F44A 2YVIA 2N00A 4M9ZA 3J63A 1D2ZB 1ICHA 1NGRA 4EWIA 1UCPA 4N1KA 1D2ZA 2A5YB 4IZ7B 2BBRA 1WH4A 2N97A 2MPCA 4O7QA 2LWDA 4UZ0A 4F42A 1N3KA 2N80A 4N1LA 3CL3A 4DWNA 4IZ5E 4D8OA 4M9XA 2DBDA 1E41A 4JUPA 3J6JA 1FADA 3KATA 1DGNA 3CRDA 2DBGA 4E9MA 3T6PA 4P4HA 3EZQB 3MOPG 2MN4A 2YU0A 2OF5A 4I16A 3YGSP 2YQFA 1DDFA 2P1HA 2DO9A 4ZBWA 3QF2A 2G7RA 2OF5H 2DBHA 4O6XA 1CY5A 4NQKA 2VGQA 4A2QA 2DBFA 2GF5A 4M9SA 2B1WA 1A1ZA 2L6AA 2NZ7A 2A9IA 4RHWE 2HM2Q 1CWWA 3LQQA 4LWDA 2BBZA 2N1FA 2D96A 2MS7A 2N7ZA 2YGSA 3YGSC 1A1WA 4N1JA 1Z6TA 2LS7A 4IZAB 1WXPA 4A2WA 4P4HI 1PN5A 1C15A 4O9LA 2MB9A 4JQWA 2O71A 4FH0A 2M5VA 2NAQA 1YGOA 3MOPK 3LQRA 2N83A 2KM6A 1E3YA 3MOPA 3EZQA 2L9MA 2LWEA 4O9FA 4RHWA 2MS8A 2NSNA 4QOBA 2F1SA
chains in the Genus database with same CATH superfamily
1WMGA 2IB1A 2KN6A 4F44A 2YVIA 2N00A 4M9ZA 3J63A 1D2ZB 1ICHA 1NGRA 4EWIA 1UCPA 4N1KA 1D2ZA 2A5YB 4IZ7B 2BBRA 1WH4A 2N97A 2MPCA 4O7QA 2LWDA 2XV9A 4UZ0A 4F42A 1N3KA 2N80A 4N1LA 3CL3A 4DWNA 4IZ5E 4D8OA 4M9XA 2DBDA 1E41A 4JUPA 3J6JA 1FADA 3KATA 1DGNA 3CRDA 2DBGA 4E9MA 3T6PA 4P4HA 3EZQB 3MOPG 2MN4A 2YU0A 2OF5A 4I16A 3YGSP 2YQFA 1DDFA 2P1HA 2DO9A 4ZBWA 3QF2A 2G7RA 2OF5H 2DBHA 4O6XA 1CY5A 4NQKA 2VGQA 4A2QA 2DBFA 2GF5A 4M9SA 2B1WA 1A1ZA 2L6AA 2NZ7A 2A9IA 4RHWE 2HM2Q 1CWWA 3LQQA 4LWDA 2BBZA 2N1FA 2D96A 2MS7A 2N7ZA 2YGSA 3YGSC 1A1WA 4N1JA 1Z6TA 2LS7A 4IZAB 2MJMA 1WXPA 4A2WA 4P4HI 1PN5A 1C15A 4O9LA 2MB9A 4JQWA 2O71A 4FH0A 2M5VA 2NAQA 1YGOA 3MOPK 3LQRA 2N83A 2KM6A 1E3YA 3MOPA 3EZQA 2L9MA 2LWEA 4O9FA 4RHWA 2MS8A 2NSNA 4QOBA 2F1SA
chains in the Genus database with same CATH topology
1WMGA 2IB1A 2KN6A 4F44A 2YVIA 2N00A 4M9ZA 3J63A 1D2ZB 1ICHA 1NGRA 4EWIA 1UCPA 4N1KA 1D2ZA 2A5YB 4IZ7B 2BBRA 1WH4A 2N97A 2MPCA 4O7QA 2LWDA 2XV9A 4UZ0A 4F42A 1N3KA 2N80A 4N1LA 3CL3A 4DWNA 4IZ5E 4D8OA 4M9XA 2DBDA 1E41A 4JUPA 3J6JA 1FADA 3KATA 1DGNA 3CRDA 2DBGA 4E9MA 3T6PA 4P4HA 3EZQB 3MOPG 2MN4A 2YU0A 2OF5A 4I16A 3YGSP 2YQFA 1DDFA 2P1HA 2DO9A 4ZBWA 3QF2A 2G7RA 2OF5H 2DBHA 4O6XA 1CY5A 4NQKA 2VGQA 4A2QA 2DBFA 2GF5A 4M9SA 2B1WA 1A1ZA 2L6AA 2NZ7A 2A9IA 4RHWE 2HM2Q 1CWWA 3LQQA 4LWDA 2BBZA 2N1FA 2D96A 2MS7A 2N7ZA 2YGSA 3YGSC 1A1WA 4N1JA 1Z6TA 2LS7A 4IZAB 2MJMA 1WXPA 4A2WA 4P4HI 1PN5A 1C15A 4O9LA 2MB9A 4JQWA 2O71A 4FH0A 2M5VA 2NAQA 1YGOA 3MOPK 3LQRA 2N83A 2KM6A 1E3YA 3MOPA 3EZQA 2L9MA 2LWEA 4O9FA 4RHWA 2MS8A 2NSNA 4QOBA 2F1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WMG A;  2IB1 A;  2KN6 A;  4F44 A;  2YVI A;  2N00 A;  4M9Z A;  3J63 A;  1D2Z B;  1ICH A;  1NGR A;  4EWI A;  1UCP A;  4N1K A;  1D2Z A;  2A5Y B;  4IZ7 B;  2BBR A;  1WH4 A;  2N97 A;  2MPC A;  4O7Q A;  2LWD A;  4UZ0 A;  4F42 A;  1N3K A;  2N80 A;  4N1L A;  3CL3 A;  4DWN A;  4IZ5 E;  4D8O A;  4M9X A;  2DBD A;  1E41 A;  4JUP A;  3J6J A;  1FAD A;  3KAT A;  1DGN A;  3CRD A;  2DBG A;  4E9M A;  3T6P A;  4P4H A;  3EZQ B;  3MOP G;  2MN4 A;  2YU0 A;  2OF5 A;  4I16 A;  3YGS P;  2YQF A;  1DDF A;  2P1H A;  2DO9 A;  4ZBW A;  3QF2 A;  2G7R A;  2OF5 H;  2DBH A;  4O6X A;  1CY5 A;  4NQK A;  2VGQ A;  4A2Q A;  2DBF A;  2GF5 A;  4M9S A;  2B1W A;  1A1Z A;  2L6A A;  2NZ7 A;  2A9I A;  4RHW E;  2HM2 Q;  1CWW A;  3LQQ A;  4LWD A;  2BBZ A;  2N1F A;  2D96 A;  2MS7 A;  2N7Z A;  2YGS A;  3YGS C;  1A1W A;  4N1J A;  1Z6T A;  2LS7 A;  4IZA B;  1WXP A;  4A2W A;  4P4H I;  1PN5 A;  1C15 A;  4O9L A;  2MB9 A;  4JQW A;  2O71 A;  4FH0 A;  2M5V A;  2NAQ A;  1YGO A;  3MOP K;  3LQR A;  2N83 A;  2KM6 A;  1E3Y A;  3MOP A;  3EZQ A;  2L9M A;  2LWE A;  4O9F A;  4RHW A;  2MS8 A;  2NSN A;  4QOB A;  2F1S A; 
#chains in the Genus database with same CATH topology
 1WMG A;  2IB1 A;  2KN6 A;  4F44 A;  2YVI A;  2N00 A;  4M9Z A;  3J63 A;  1D2Z B;  1ICH A;  1NGR A;  4EWI A;  1UCP A;  4N1K A;  1D2Z A;  2A5Y B;  4IZ7 B;  2BBR A;  1WH4 A;  2N97 A;  2MPC A;  4O7Q A;  2LWD A;  2XV9 A;  4UZ0 A;  4F42 A;  1N3K A;  2N80 A;  4N1L A;  3CL3 A;  4DWN A;  4IZ5 E;  4D8O A;  4M9X A;  2DBD A;  1E41 A;  4JUP A;  3J6J A;  1FAD A;  3KAT A;  1DGN A;  3CRD A;  2DBG A;  4E9M A;  3T6P A;  4P4H A;  3EZQ B;  3MOP G;  2MN4 A;  2YU0 A;  2OF5 A;  4I16 A;  3YGS P;  2YQF A;  1DDF A;  2P1H A;  2DO9 A;  4ZBW A;  3QF2 A;  2G7R A;  2OF5 H;  2DBH A;  4O6X A;  1CY5 A;  4NQK A;  2VGQ A;  4A2Q A;  2DBF A;  2GF5 A;  4M9S A;  2B1W A;  1A1Z A;  2L6A A;  2NZ7 A;  2A9I A;  4RHW E;  2HM2 Q;  1CWW A;  3LQQ A;  4LWD A;  2BBZ A;  2N1F A;  2D96 A;  2MS7 A;  2N7Z A;  2YGS A;  3YGS C;  1A1W A;  4N1J A;  1Z6T A;  2LS7 A;  4IZA B;  2MJM A;  1WXP A;  4A2W A;  4P4H I;  1PN5 A;  1C15 A;  4O9L A;  2MB9 A;  4JQW A;  2O71 A;  4FH0 A;  2M5V A;  2NAQ A;  1YGO A;  3MOP K;  3LQR A;  2N83 A;  2KM6 A;  1E3Y A;  3MOP A;  3EZQ A;  2L9M A;  2LWE A;  4O9F A;  4RHW A;  2MS8 A;  2NSN A;  4QOB A;  2F1S A; 
#chains in the Genus database with same CATH homology
 1WMG A;  2IB1 A;  2KN6 A;  4F44 A;  2YVI A;  2N00 A;  4M9Z A;  3J63 A;  1D2Z B;  1ICH A;  1NGR A;  4EWI A;  1UCP A;  4N1K A;  1D2Z A;  2A5Y B;  4IZ7 B;  2BBR A;  1WH4 A;  2N97 A;  2MPC A;  4O7Q A;  2LWD A;  2XV9 A;  4UZ0 A;  4F42 A;  1N3K A;  2N80 A;  4N1L A;  3CL3 A;  4DWN A;  4IZ5 E;  4D8O A;  4M9X A;  2DBD A;  1E41 A;  4JUP A;  3J6J A;  1FAD A;  3KAT A;  1DGN A;  3CRD A;  2DBG A;  4E9M A;  3T6P A;  4P4H A;  3EZQ B;  3MOP G;  2MN4 A;  2YU0 A;  2OF5 A;  4I16 A;  3YGS P;  2YQF A;  1DDF A;  2P1H A;  2DO9 A;  4ZBW A;  3QF2 A;  2G7R A;  2OF5 H;  2DBH A;  4O6X A;  1CY5 A;  4NQK A;  2VGQ A;  4A2Q A;  2DBF A;  2GF5 A;  4M9S A;  2B1W A;  1A1Z A;  2L6A A;  2NZ7 A;  2A9I A;  4RHW E;  2HM2 Q;  1CWW A;  3LQQ A;  4LWD A;  2BBZ A;  2N1F A;  2D96 A;  2MS7 A;  2N7Z A;  2YGS A;  3YGS C;  1A1W A;  4N1J A;  1Z6T A;  2LS7 A;  4IZA B;  2MJM A;  1WXP A;  4A2W A;  4P4H I;  1PN5 A;  1C15 A;  4O9L A;  2MB9 A;  4JQW A;  2O71 A;  4FH0 A;  2M5V A;  2NAQ A;  1YGO A;  3MOP K;  3LQR A;  2N83 A;  2KM6 A;  1E3Y A;  3MOP A;  3EZQ A;  2L9M A;  2LWE A;  4O9F A;  4RHW A;  2MS8 A;  2NSN A;  4QOB A;  2F1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...