1A2BA

Human rhoa complexed with gtp analogue
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
178
structure length
178
Chain Sequence
IRKKLVIVGDVACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human RhoA in a dominantly active form complexed with a GTP analogue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncogene protein
molecule keywords TRANSFORMING PROTEIN RHOA
total genus 54
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 1997-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1a2bA00
1CS4C 2DPXA 3NBXX 5E95A 1W7AA 4A0HA 4DT1A 3K70D 1FP7A 2VLIA 4L8GA 4Q4JB 1L7VC 1LS1A 1OHHA 1VHTA 4Q1BA 1CR4A 3RS3A 5AUPB 3B1ZA 2GZAA 4DEXA 5CDFA 2YVUA 4A2QA 3QSYA 2B21A 2I1VB 1W0JD 2IUTA 3WHLA 4YQFA 5JLJA 3H2YA 3EG5A 5CYOA 1OPXA 4DT1B 5CIWA 4KV9A 3U5ZB 1YHNA 2AXNA 1H65A 2BV3A 1QF9A 2GK6A 4LV5B 4ACBA 4B48A 3NDBB 5AR1A 2P65A 3QF4B 5HZKA 3CH5A 1B23P 1I4DD 4S2EA 1W5TA 4C9BA 3TH5A 421PA 3U3RA 1TPZA 2J0QA 4UXIA 3OFND 5FL7D 2AK2A 2QPTA 4A6PA 1US8B 3PXGA 3W5IA 4RD6A 4EQ6B 4AYTA 1OSNA 2G3YA 3TRFA 2W2TA 1SKYB 2DFTA 1Z0AA 4JSYA 4IW3B 4F38A 2OHFA 4YMSA 2NG1A 3CR8A 2EFEB 3BERA 1J90A 4IVQA 3A58B 4MUBA 4PHTA 3B5JA 5EE5B 1UAAA 2XAUA 3MMPA 1GOTA 4JVSB 4AIIA 2YHSA 2ZR0A 4C30A 1SVMA 2W83A 2CCKA 1Z2CA 3AVWA 2OM2A 3VAAA 4B44A 4Q02A 2Z4RA 1M7BA 1NVUQ 2HCBA 4IXNA 5L3RA 4OI1A 4JZKA 4L9SA 1G6HA 2ORIA 4LV8B 1G7TA 1Q57A 3K09C 4K81B 2H8KA 3LQRA 1NJFA 1WF3A 2LCFA 1RVDA 2B8TA 5EXXA 4EUNA 5J47A 5JWOA 1HQYE 4EAQA 3MD0A 5TV2A 2GZHA 4Q7MB 1YU9A 2V9PA 5TB5A 4BFVA 1P9WA 1X86B 1KO1A 1XTSA 4M9QA 4HAUA 4ZKEA 3V00A 1VG1A 3RRZA 3C16C 2R65A 3RS0A 2HYIC 1EFCA 1E6CA 1KMHB 2RHDA 5J5CA 1SQ5A 4UNPA 3WRYC 1CIPA 4KXFB 2BCGY 4PQYA 4LX0A 4M1MA 2FFBA 1M6NA 3BAFA 4C2UA 1MRNA 4ASUD 5DISB 2HV8A 3KTAB 3M1IA 1A1VA 2V6JA 2JJ2A 4ARZA 4XTCS 2FFHA 1AQYA 3L8ZA 5IDVA 3TSWA 1G5RA 1IJFA 2OFXA 4B6EA 4LBYA 3H84A 1ZC3A 3KQHA 4CYMA 1P2SA 4NCJA 4QJ3A 2ONKA 3CM0A 2FPKA 3A4NA 5LPNA 1W4RA 4MKGA 3DVLA 1NSFA 2W2VA 2VP4A 1JXMA 1HY3A 1WE2A 4XVUA 5BN4A 3FMIA 5J4KA 4E07A 1ZD1A 2HT6A 3LBIA 4NCHA 5G53C 3GLFA 1Z0FA 3SR0A 1NBME 3CH4B 4DLVA 4HATA 2YWFA 4MRSA 1FW6A 2DWOA 4NBSA 5AUQA 5KNDA 2X1VA 1D5CA 3Q7PA 1DG3A 1AA9A 1G16A 3VTKA 5EZ6B 3UWOA 1N6IA 3CLVA 2GEDA 4HI0E 1E1QD 2N42A 3TQCA 1Z28A 1L4YA 1T8TA 3VNUA 3THXB 3EPLA 3CWQA 4Z54A 5B30A 5EUMA 1UBCA 1TU4A 3Q5EA 1E96A 4EDHA 3JVUA 1CEEA 4DDVA 1TL7C 4LYHA 3B2EA 2EW1A 3CZPA 1U9IA 3CRMA 1GUAA 2RGDA 2ZSFA 3CNOA 4K8OA 4PFSA 1N6NA 3K0SA 1W0JA 3CRW1 1OXVA 2Q3HA 2ZQ5A 3OIVA 3RLFA 4ON9A 4ZO4A 1OXXK 3AVXA 5FR1A 1AN0A 1Q3TA 2ZETA 5DE3A 1W4BA 2OUKA 3LO5A 4RJLA 1NY6A 2GJKA 1G3QA 3HDTA 4CVNA 5L8VA 5HR5A 3CF6R 4NZYA 1NLZA 2TMKA 4AK9A 3C5CA 5EE3A 4A9AA 1JQLB 4JMPA 3BH0A 1GL6A 1LS6A 3VHXA 2GXSA 2AKAB 3HR7A 2AR7A 1BMFD 2QMEA 4Y0VA 2KE5A 521PA 4C0JA 1QBKC 1S8FA 1ZUHA 2HJGA 3J81k 1PUIA 1GITA 3U3MA 3QF4A 3TW4A 2QL6A 4M9ZA 5K8LA 2GF0A 3N2EA 4CEIA 2NO1A 2H17A 2ZRDA 4NPHA 4QGAA 3VQTA 4DCSA 1R8QA 5EP4A 4WXRA 1A2BA 1LB1B 2HCJB 4HLQB 1KO4A 1WA5A 3IILA 1VG9B 1NBMD 2D74A 2R44A 1HH4A 3FHTA 1EFRA 5JCPA 3LY5A 4UXHA 4XD7D 1ZW6A 3RS2A 2DB3A 4LJ4A 1Y3AA 4M1SA 4IDQA 2GBLC 3T12A 3U7EB 2J46A 4PSKA 1W2GA 1XXHA 2ZI4A 1DEKA 3W34A 3O8DA 3A1WA 1HYQA 4RZXA 4BFZA 5K8IA 1VIYA 2OILA 4EFNA 2ZVQX 2AX4A 4NYIQ 2O8DA 4FMCF 1RRFA 4GBMA 4PPFA 2YKGA 2A5DA 2NQ2C 3AKYA 4CGZA 2WJHA 3DZ8A 5FOWA 5FL3A 3TUIC 3QVUA 1W36D 4DZZA 2HXSA 4PHGA 3ZQ6A 5FOUA 1R4AA 3TQFA 3CRQA 3L8YA 4NL4H 3SNHA 1GIAA 2PZFA 3K0AB 4FN5A 4BLRA 1M8PA 3LVQE 3NH9A 1XNJA 2P6UA 2GJ9A 4DDUA 1EWQA 2CE2X 3A8TA 1IONA 3A4LA 2YC2C 5H70A 5DN6D 3WHKA 2PBRA 5FI0B 3M4YA 4ZI3A 2EYUA 2ATXA 2DR3A 2E9SA 4PC2A 3TR0A 4DB2A 4AKIA 1IAQA 3TUJC 3VHLB 4W5HA 2J45A 2V54A 4IHQA 4LZZA 1XPUA 1FOEB 2IWRA 2FJUA 3ZS9A 1XCPA 1NG1A 2R9VA 5JEDA 1EFUA 3QBVA 1ZM7A 4RCZA 5GJWC 4AKHA 3CNNA 2BHRA 5L3QB 5FUXA 3TLXA 1UF9A 1XB2A 1VIAA 2FFAA 3CB4A 3MWJA 3ZIAD 4E22A 2VF8A 1Q21A 1VTKA 3THYB 1VG0B 3GPLA 5CB8A 3MWYW 1HQCA 4C7OA 3B7GA 1YZGA 2C2HA 4KVAA 3C14C 5FOVA 1KSJA 2C8VA 2RMKA 1T6NA 1F5NA 5DO9A 3THYA 4IDNA 2O0KA 4Q7JB 2GXAA 3LQQA 1SXJE 4JLDA 2F9LA 1II8B 2R6CA 1E2FA 4BZPA 2CCJA 5AK0A 3CIOA 5HKKD 2CE7A 3KQUA 3RRNA 1OFTA 4TL7A 1R5OA 4JT4A 3LFUA 4YDHB 2J3EA 4AI6A 1XEWY 3CRRA 3D8BA 2XTZA 3EC1A 4KYIB 4TTQA 3WYGA 1G7SA 3K9GA 1NVXQ 3GLIB 4IKEA 2D7DA 2ZVPX 3B9PA 2I3BA 1VKJA 2IEZA 4YC7A 2AN9A 1G5TA 2ODEA 5AJVB 1LV7A 3KUDA 2G83A 1FQJA 3HP1A 4HZIA 2WJJA 1LY1A 1E79A 1F60A 4ACAA 2UZIR 1GVNB 3FMFA 1R2QA 4Q4LA 5AJZA 5H68A 4URUR 1OYYA 4B73A 1N0UA 5FPSA 4TYYA 2GNOA 1FZQA 1VYTA 2NMVA 1P3JA 3EWSA 2QP9X 3K8YA 1OB5A 2XZLA 2P6RA 2ZJ5A 3MWKA 4HEJA 4MUAA 1W4AA 2OG2A 3A4MA 1E9DA 2ZSAA 3U6BA 4DLSA 2EQBA 3EZ9A 1U99A 2O8BA 1ONBA 4GP7A 4F4CA 1XP8A 1CKEA 4BLPA 4TYPA 3SJCA 1T5LA 4IXMA 3UMFA 5C46F 5M04A 3IIJA 4Q1CA 3KL4A 1E1RA 1E94E 1KNXA 1X8LA 5FPKA 1PZNA 1DELA 1GSIA 5TXGA 3AEZA 1SXJB 2O8EB 2HF8A 2OXRA 1KK1A 4HSEA 1NN1A 3FE2A 3ZIAA 4LHYA 3ONWA 1TF2A 1YZNA 1CULC 5E3HA 2OFWA 1DAGA 5CIQA 4JLOA 3T06B 4F92B 3E2IA 2HYDA 1M2OB 3ASYA 3I73A 3LXXA 4BRWA 5HPYB 1MABA 2C9YA 4TL8A 2GDJA 2ZI7A 3D7MA 5DI3B 2REBA 1RZ3A 4D6PA 2ZAMA 2OESA 2VHQA 2OV2A 2XNDD 2QPAA 5KDOA 5JHHB 3HPRA 2WTUA 4KSBA 2J9RA 4XIGS 2OSBA 1VECA 1W36B 2VPPA 2ZYWX 4R7ZA 3QE0A 4URXR 2DBYA 1R5NA 5J4VA 3TAHA 4I1SA 2KI5A 1MOZA 5KNBA 1VYUA 4C3ZA 4Z8XA 4QM7A 1II9A 3GLHE 1CJKC 4PHHA 1IN8A 3U3KA 2QGZA 2WWWA 3PCRB 1NNEA 1EFTA 2ZIAA 2O8FA 3RRMA 1NLYA 2V6IA 4QBIA 3KFXA 4EPTA 2VA8A 3OEEA 4HLUC 2EWVA 1XTQA 1CR1A 4W5JA 4KBGA 1ZNXA 1G4AE 3B1VA 4IVPA 4RD0A 4D4LA 2QU8A 2P6NA 2X8AA 3WP0A 3EZ7A 5EUQB 4LJ5A 2GF9A 2Z6VA 1Z0JA 3AH8A 2OBLA 3VU9B 1EFRD 2XSZA 3SJAA 3KB1A 3TVDA 1W48A 3TBKA 1NBMA 5EP2A 2ZRJA 2ZRGA 3D31A 1VCMA 4E09A 3WBJA 3EASA 2BBOA 4KFSA 5K8TA 1E9AA 3ZVLA 2WWYA 4NP6A 5GADl 4RZ3A 2F1HA 2OAP1 1HT1E 4CEJB 1HTWA 2OLKA 1COWA 2G1KA 1XDBA 4OYHA 2FEMA 2Z83A 4AKGA 4XSHA 2GVZC 3N70A 3RHFA 2CCGA 4ABYA 3TUZC 3QPUA 2W0MA 1BMFA 721PA 3PUZA 1G17A 1BH2A 2GRJA 3U7HB 4I81A 1NI3A 2H7VA 3OHMA 2IHYA 4Q19A 3GFTA 4OK6A 1E9RA 2ZREA 3L2OB 3KQNA 2YOGA 2PEYA 1OLOA 4HAVA 4JS0A 4Q47A 4P31A 5UKDA 1XEWX 4GOKA 4RFVA 5EE0A 3F0TA 3T1VA 4NDZA 3K09A 4AWXA 1W0KD 4HAWA 3VR2A 2JLSA 4DLWA 1DG1G 2FF7A 3QKRA 5HZHA 1TTTA 4B35A 3CRVA 1G8FA 3U3OA 1R7RA 4M1KA 2C96A 3B13B 3PV0A 3SYNA 5JWRA 1WBDA 1P61B 1HEIA 1Q1QA 2OXCA 3BFKA 1N6PA 2P67A 1NJGA 5E7JA 1SVLA 4TQ9A 2QRZA 2G9NA 1J70A 4AG6A 1DPFA 2R2AA 2WMOB 3O8CA 2ZSEA 1TQ6A 3AQ4A 1JBKA 1UM8A 1H8EA 1XMSA 2CLSA 3CPHA 3E1SA 1KSFX 3QXSA 3THWA 4LGMA 3I5XA 3EIHA 1X6VA 3ADCA 2D3WA 1DARA 1P6XA 1QDEA 1U0JA 1GNRA 2H1LA 3IQXA 2O8CA 2O8BB 1ZAKA 1TX4B 1VPLA 2ZJ8A 1QHSA 5J40A 3A36A 5HCNA 4E5UA 1YJ5A 3B1WA 3P1JA 3EZ2A 3I61A 4OHZA 4ILEA 2O8CB 4LY6A 2QORA 8OHMA 1XXHE 5FPTA 3NH6A 4WZ6A 3AV0B 1G3RA 4OK3A 1CBUA 5E7MA 2JJ2D 3V9PA 2UKDA 3RS5A 2P3SA 4TZ6A 4CT4B 4US1R 4BRUA 4P4SB 3SEAA 5A4JA 3GJ7A 1HURA 3GLFB 3EARA 4O25A 2BJVA 2V55B 2ZRBA 4HDOB 4CRWB 3TSZA 2C04A 2IWHA 4OQXA 4MKFA 4MRRA 3TW8B 1ZIOA 4DCTA 2VHJA 4LHWA 3X1XA 5CK4A 3WMEA 3QENA 5G40A 3TGPA 3Q7QA 1DBSA 3UKDA 3MFYA 4NYJQ 1QG2A 1QHNA 5B64A 2WICA 2FMXA 2HUPA 2RGNC 3DM9B 2JDIA 2Q21A 5JHGB 4MRNA 4QNRA 1NIJA 5EE9A 3JZMA 3FFAA 4NMMA 2WKRA 2W0SA 1LVGA 2CBZA 3HWSA 3SE0A 2IX3A 3EPJA 2HF9A 3OAAA 1RIFA 4B74A 4L4UA 4PX9A 2O8FB 1JALA 1N6RA 3IPYA 4JVMA 3WRXC 4C0HA 4URYR 3ZLJA 4ESVA 1E0AA 1DE0A 2ZI6A 1QHGA 1N5JA 1CJVC 4GNKA 4V0MA 2ZS7A 2A2ZA 1N2CE 5DIFA 1IN6A 1SVIA 3CX7A 1T8UA 3I5YA 1CRPA 3ZD7A 2REOA 4A15A 4L16A 1W49A 4J0QA 4M9SA 4PO8A 3I32A 2OCBA 2ZJZA 1S1CA 2ZPTX 4P32A 1KOFA 3UG6A 5BW8A 1PVOA 2N46A 4FINA 1J8MF 2D4HA 3U6KA 3WMFA 4F93B 2BIFA 1AS3A 4GT1A 3W3ZB 1II0A 3DZDA 1P5ZB 1CR0A 5FL7A 4DUGD 1E4YA 4YMTA 1AJEA 4I1UA 2QSZA 3K9NA 5BQ5A 1OXUA 4HDCA 3E70C 1RFLA 5BXQC 1Q20A 4NCIA 3EA5A 3REFA 1YRBA 3AP2A 5D3QA 1EGAA 3LV8A 4BECA 2OBMA 1Q44A 1US8A 4BPBA 4R2HA 4PSAA 1HA3A 1M74A 3U2QA 2VHCA 3GEEA 1KKLA 3FYHA 2C78A 4R98A 4HB0A 1CU1A 3AKCA 3ND8A 1QHHA 3QEOA 1XXHB 3CPJB 4HAXA 1OHHD 5C18A 3BH7A 1G64A 4B3BA 3Q3JB 4DSTA 4RD2A 3R8CA 4Q9JA 3IEVA 2J87A 2VH5R 2Z5FA 3LX5A 4DDWA 5SZKB 4FI3C 1DAIA 2IBMA 1V43A 1QHIA 2GA8A 4PR0A 4M1OA 4A2PA 1E9CA 1DVRA 2J7PD 2QPOA 2MSDB 2RKOA 2VSFA 4M1WA 3GLGA 2NO6A 1E2LA 3L0IB 4FIDA 4Q01A 4DSOA 4M1YA 1XZPA 3TJZA 2IK8A 2ANBA 2FV8A 2OT3B 4CIDA 1LFDB 4X8HA 5ANRB 4PZZA 5KTYA 4IFBA 4GL2A 1OV4A 1X1SA 3F8TA 4RZ2A 2VSOA 4MYTA 1ZU4A 4KSCA 1U8ZA 4YXWD 2FPMA 5JZVA 5CITA 3Q72A 3QVVA 1J99A 2V1XA 5FPHA 3OEHA 4XSGA 1JI0A 1GTVA 5JI3E 3AVYA 5L3SB 1J8YF 2FN4A 3C4JA 1QHYA 2Q9BA 3NTUA 1UEJA 5AWFC 4DXAA 4DJTA 4HDQB 2GBLA 4A6XA 5CLLA 5L3SA 2FSFA 1YKSA 1XJQA 3A1VA 1KI1A 1G5PA 5HCIA 4HAYA 4D2IA 2YJTD 2PX0A 4MQBA 4C0AC 2Q6TA 4ITRC 4KU4A 2VL7A 4D4JA 4UJ5A 2QT0A 2OFOA 1GAJA 4QBFA 2JLVA 3KTAA 1G21E 1IN4A 3SYLA 3GEHA 5JI2E 3GP8A 1KYIA 1CR2A 1UBEA 3IQWA 4HLUA 4P4SA 2XXAA 2P5TB 1KZGB 4WVFA 3NVAA 3DM5A 1Z83A 4TLBA 3OE7D 1WRBA 5FBRB 1XD8A 3NEYA 1N0VC 2DWPA 1II8A 4GOXA 1G4UR 1P2UA 1KI8A 3L0OA 2ZE6A 2HXYA 2WZQA 4PXAA 3ZGXA 4JJKA 2XXAB 2IXEA 3D6TB 3MJHA 4P33A 1XRJA 3EX7C 1T0JB 4Q7LA 1TNDA 5A5GA 3LA6A 4B2IA 1T3SA 2ORWA 3MG9A 2D2EA 1NMYA 3K0EA 3LBHA 1E0SA 4PPQA 1EWRA 3UG7A 2D7CA 2XX3A 1Z6YA 2QE7A 4EPXA 4U5XA 3GLIA 1E3MA 3QXHA 4TSFA 1SVSA 3FGNA 3LH5A 5EXSA 1X8KA 3BGWA 3X1DA 5IHPA 2EYQA 1D8TA 3AF1A 1OIWA 3OIUA 3PUVA 4A1FA 1OH6A 1IXZA 1KSHA 2ZE5A 5LD2B 3CWZA 2ZS8A 3B8HA 5HE9A 5KU1A 2F7SA 3BD9A 5P21A 3X2SA 3QG1A 2GILA 2W6ID 2QAJA 3W8RA 2Q9CA 4G3XA 2XTNA 5DNYB 1VDZA 2AFIE 3FKSA 4RD3A 1JNYA 3U7FB 2XITA 3K0FB 4UXJA 2JLQA 5CLQA 1GRRA 1UKVY 2H57A 2NO7A 3RNLA 3JVVA 1DS6A 1U9IC 3PITA 2WPDD 4DEYA 1OB2A 4LYJA 1E2NA 5EJEA 4QXAA 3CNLA 5JS8A 1E9SA 4XTRA 5JS7A 2IYUA 4X8OA 2BCJQ 2C03A 3SDZA 1XF9A 2F9MA 4PAMA 1GZSA 1RKBA 2IW3A 1FNNA 1DO2A 1G8HA 4OBEA 2XB2A 5F9HA 1ODFA 2ZRCA 4RCYA 4AURA 1OW3B 1MRSA 3C5HA 2Q9AA 3SN6A 1D9XA 4EIWA 3U44B 2GAOA 2V8OA 4F7WA 3KXKA 1ZC4A 3FPAA 4TMTA 2ZRLA 4RKEA 2CHGA 2VBCA 2WHXA 4FXPA 1BO6A 3QOFA 4A8JA 3B1XA 2JLZA 2ZAOA 2XGJA 4QM6A 1N3BA 1S9DA 4CW7A 2VIIA 5J4LA 4IEEA 4LOAA 2D2FA 3UATA 4ZCIA 5D3MB 2P0EA 1MABB 4A8JB 5KSYA 4Z8YA 5C4MA 1P73A 1XEFA 2FA9A 2MMGA 3MGCA 1UKZA 4L15A 2V7QA 3FWYA 2VYFA 2FOLA 2WSSA 4JT2A 1NKSA 4QJ5A 3UXMA 4D25A 3QY0A 1C1YA 3UMRA 1FUUA 4AG5A 1G1MA 5KDLA 3B82A 1E2IA 2G1JA 3VKGA 2GCNA 4US2R 1WMSA 3EA0A 1WP9A 4QNMA 1K6MA 4GMDA 1Z29A 4BFSA 2CK3A 4IFEA 3SI7A 3BS4A 1N5KA 2F55A 2A7QA 2ZRFA 3RABA 4DCVA 1NVWQ 4Y0AA 2ONJA 2ODWA 2BJWA 1BKDR 4LWZA 1ZM4A 2OO7A 2VHUA 5E4FA 2JLUA 1T3LA 1NP6A 4LJ7A 4BZQA 2R6FA 5DSZA 1DAEA 3BWDD 3KJHA 1KI7A 2ZJAA 3G0HA 1OYWA 1W47A 2QMHA 3AGQA 1E2PA 1TF5A 2QP4A 3KKMA 1RE0A 2GWHA 2OLJA 5C4GB 3VNVA 1NVVR 3EPKA 3CBQA 2BWJA 3MRSA 4JBWA 5EXTA 4Q1DA 5JJLA 4MRPA 4NU0A 2ERYA 3PR1A 1Q0UA 1F3OA 3K0CC 1IM2A 1S96A 4NYMR 4TQAA 3PENA 1M34E 3VU9A 3MUFA 3R20A 2QMOA 4IJMA 4GI7A 3IIMA 4MGIR 4CF7A 2CNWD 1OKKA 1Q12A 2BEKA 3RVBA 2CL6X 2RHMA 3H86A 3EZ6A 1E69A 1SVKA 4CEJA 1C9KA 3IPXA 3MJRA 3W6PA 4A4DA 4QRHA 4D0LB 3B1YA 3UIEA 1S9HA 2GESA 2IYLD 2WIBA 3X1ZA 3LAWA 1Z0KA 5IK2A 1XMJA 2FZLA 4EPRA 2GCOA 1L8QA 5KPJA 1E99A 3PEYA 2Q0HA 2EFGA 4G0NA 1Z6XA 4QBHA 2CJWB 3QXJA 5IT5A 2HLDD 1G41A 3FTQA 4G5GA 3SYKA 3DOFA 2G88A 2IYZA 2WIAA 5FBVB 5KOYA 3IBYA 3T1TA 4TYWA 1J2JA 1Z22A 1O3YA 2X77A 3UPUA 3OF5A 1XZQA 5EQTA 1ZVQA 2ZU0C 2IEYA 4B76A 3ZYCA 2CJWA 3AF0A 3HU3A 3A37A 4LJ8A 2FSGA 4JBXA 3BOSA 4QBGB 1NN5A 2FG5A 3CW2A 3RC3A 4DLZA 2KBEA 4O3MA 3AUYA 5LB4A 2W6JD 3LVRE 1YR9A 4NHOA 1UPTA 3T1OA 1SKYE 4BFUA 1XJ0A 1PLLA 3GMTA 4QGGA 2PJRA 2GZDA 1T5IA 2JLRA 3CF2A 4DVGA 4YLGA 3L82B 5CK5A 2K5UA 4DWJA 1N6KA 3DKPA 2FGKA 4C0SA 4DIEA 3LXRA 1KDRA 4BQSA 2HJVA 4G5RA 4LDJA 1ZM2A 2ZRMA 2YZ2A 5JMTA 3N2IA 3ADDA 1Q3HA 2OAQ1 2F3RA 1T4GA 4TMXA 4LRWA 3F3YA 3WNDA 1FPMA 3LLMA 2XOKD 3KJGA 3P4YA 4GRAA 4DRZA 1MO6A 2EWWA 4C0KA 1A5TA 3VKWA 4UQOA 4IVRA 4NYJR 1E4VA 4I4LA 1RRCA 1X1RA 2YC4C 2YWEA 3O47A 3SHWA 1SXJA 2E87A 3W8NA 4Q7KA 2O8EA 1KJWA 1MH1A 2IYTA 3BB1A 2ERXA 3PUXA 1GL7A 4QOSA 3E5HA 3PUYA 2W6JA 4WBSA 4B34A 2IYWA 5SZIA 1FNMA 1KKMA 1E2DA 2ORVA 1TQ2A 1CJTC 1ZD8A 3CO5A 5AJXA 3A6PC 2GKSA 5TVKA 1WB9A 3A1TA 4IDHA 3CR7A 4KVGA 1AKYA 5DI3A 1IY2A 1MV5A 1AZTA 2ODNA 2XJ9A 1BIFA 2BMFA 2GVDC 5DGXA 2MSCB 1CF4A 1XTJA 1EK0A 2VP5A 1NVVQ 2V1UA 5H8WA 3VFDA 5JECA 4Q00A 2WBLC 1E0KA 2HLDA 2WV9A 5FOTA 5G41A 1TQ4A 2JIZA 4D0NA 1D9ZA 3WXMA 2QZ4A 3FHOA 1I4LD 3BBPA 3LWNA 1VCOA 3LBNA 1K5DA 2QTFA 3BK7A 3T1QA 4KYUA 1W2HA 3RS4A 3SOPA 2CHQA 2PH1A 3BFXA 1ESNA 2IT1A 1WCV1 1P75A 1FFHA 2GEVA 3B85A 2EFCB 2ZI3A 2BMJA 5FOXA 4TYQA 5FUVA 3SC3A 5IF9A 4NCKA 1C4OA 2DFLA 2WMNB 4WA7A 3NG1A 3TE6A 1OKKD 1M1YE 1KHTA 3DO6A 4QGHA 4IOKA 1OH7A 4A0RA 2B7CA 2OCAA 1UKYA 4KI0A 5FTNA 3DEFA 5G3YA 4WAUA 1FQKA 1KDTA 5ELXA 5KUTA 1WBBA 1GG2A 5B57C 3DOEA 4B47A 3AVTA 4B43A 3EWAA 1EESA 1ESMA 1CLUA 2BKUA 3AVQA 4TN1A 4Z51A 1V5WA 4ZKDA 2IL1A 2YYZA 4UNNA 5B2ZA 2CLCX 1AS2A 3KXLA 4DDTA 2GCOB 2EVWX 3A1UA 5EXPA 4OI2A 2FE4A 1B0UA 1X3SA 2F1IA 3AB3A 3QXXA 4MYUA 4DC9A 4TLAA 1Z07A 3K70B 1CJMA 4ZDKA 2VQSA 1PJRA 4FMCB 1SVOA 1G3UA 2WAXA 3QG5A 4EKDA 5AUNB 1F2UB 4EPWA 2NPIA 2WJIA 3L43A 5FTMA 4JYBA 3BB4A 1CP2A 3VX4A 3ZDQA 4B75A 2CK3D 2AK3A 3KQLA 4V03A 1OXSC 4EPVA 1F2UA 1R6BX 2RB4A 3WMGA 1CRQA 2QQ0A 2C99A 4TQUS 1U0HC 3LLUA 3QKRB 1XCGB 4A8JC 3AVVA 4LJ9A 1YZKA 3VR5A 4HAZA 2PX3A 2YWGA 5KNCA 2REXB 4QKQA 4LBZA 4JLAA 2GJSA 3HJNA 4B2LA 2IUSA 1I4TD 1R0ZA 2BM1A 2QI9C 2IYXA 2IS1A 2FPLA 2RH5A 4YDSA 4PQRA 2ZJBA 1RRPA 1AQUA 2PMDA 3KKPA 1IJEA 2FSIA 4RD4A 5KO2A 4ZCMA 1OJLA 1QRAA 2XZPA 3C8UA 4GZMA 3U4QB 1E9EA 4LUCA 5C1BA 2QTVB 3EZFA 4TLEA 2JJ1D 1XTRA 3VR6A 4JL5A 1ETUA 1AKEA 2ZS9A 1SXJD 3M6AA 1OIVA 2ZJ2A 4G5OA 1ZD9A 1H8HD 2IC5A 1PLKA 4DKXA 1ZNZA 3EXAA 4IRUB 4U7DA 4H9GA 1NN0A 4B2PA 1P9RA 1FMJA 1Q22A 1W36C 5FBQB 4II7A 2ZI5A 4MITA 5FR2A 1ZUIA 1KI4A 1NN3A 4S35A 4Q9KA 3GD7A 2FWRA 3T61A 3R9IA 4Q03A 2DHRA 3ADKA 4ZCLA 1FTNA 1DAMA 4LJAA 3TAUA 4OQLA 1ZYUA 5AJWA 2X2EA 2ZJYA 3NHAA 5TMPA 3ZD6A 2KJQA 3GFOA 4EFLA 2OCPA 3AP1A 3FKSD 4A2WA 2VEDA 2BC9A 3NHBA 4XWOA 2CL7X 1BS1A 1LF0A 1UFQA 5BN3A 3AVPA 3R7WB 1ANKA 2G77B 3W9YA 3B9QA 1GDDA 1R10A 1XBTA 2CHVA 3PEUA 4MRVA 4W5WA 821PA 2ZM5A 3UMSA 2VF7A 2ZRAA 1NRJB 4V0LA 2XTMA 3KKQA 4JLVA 2LKDA 4KCGA 4TT3D 5C2JB 4O2LA 2IHBA 4XVQA 3GJXC 5JWHA 4HUTA 4HZUA 3MSXA 3K0FA 5LB2A 1WDTA 1F6BA 2ZEJA 2JGNA 2GXUA 4PQFA 2FSHA 3BC1A 1JR3A 4LV6A 2A30A 4BUJA 4JLKA 1X8JA 3O8BA 4M22A 3K70C 4XWAA 4HZUB 2A9KA 2EFHB 4AYWA 1G7RA 4Q4HB 2IS2A 3LW7A 3QPWA 2HT1A 4OJQA 4C4PA 5IK2D 1E0JA 5F3WB 4ESHA 2D06A 1NF3A 2JATA 2H5EA 2XEXA 3KQKA 3ICEA 3U44A 1JR3D 1N6HA 4AC9A 3PJRA 1ZM3A 3QIAA 1Q1ZA 4Q4HA 1PUJA 2ZRHA 1AS0A 3IHLA 4NKRA 3DHWC 2ANCA 4OQFA 4LPSA 2PMKA 3AF3A 2RGNA 2WAYA 3AF2A 4TTRA 3ZVRA 4YMVA 4HUQA 3ZJYA 4BEJA 2ZR9A 4IOMA 1JAIA 2AL7A 2CNWA 4TT3A 2C9OA 1ELOA 2JEOA 2H92A 2R6AA 1CJUC 3HR8A 3SBDA 2JAQA 4TWZA 3TMKA 3FHCB 1RC8A 4ZIRB 4EPYA 1P7CA 4MDFA 4IDOA 2DCUA 4PZLA 2EU8A 5JSZA 3KFVA 1RPZA 3OEHD 3QEJA 4TYNA 1G291 1YZTA 4DB4A 4F4IA 1Z5ZA 4HB4A 2QTHA 3QBTA 2ZRPA 4B3FX 1KK2A 1A4RA 3AM1A 2ZUDA 4PHFA 2J0UA 1FX0B 1BYUA 1KAOA 2P2LA 2IYQA 4V0NA 3ZQJA 1S1MA 1Z3IX 2CVFA 3BFVA 4POAA 4C0QC 4PSVA 5JSZB 1QHHB 5IRCD 1RJ9B 4Z1MA 5KSOA 1LW7A 1U90A 4V0KA 1IBRA 2OCYC 4W9MC 1UDWA 1FX0A 2J0UB 3RRYA 2DFKB 4KFUA 2YNMA 3BB3A 4D0GA 3QXCA 4Q9IA 1SULA 2Z43A 3PQCA 5HTKA 4FWTA 4WZAE 1EXMA 2QNRA 3GLGB 4A0FA 5GJVC 4H1UA 1H8HA 3KUCA 3L0PA 1HV8A 2AWNA 4URWR 1NL3A 221PA 2JLWA 3T5GA 2BBTA 4U02A 1KNQA 4V0ME 4C2TA 1OH5A 5LD2C 1EG7A 1Z6AA 1ZNYA 1E2HA 2JJ1A 1JJVA 2WSSD 1TQDA 2IS6A 3UANA 1KMQA 3QF7A 1N25A 1YQTA 2QRNA 1ZBDA 2J1LA 4IOJA 4JVLA 1YZUA 3AUXA 1ZIPA 2VP6A 3I8SA 1OFUX 1T3HA 5FUYA 4MYHA 3SJBA 5CYPA 1KGDA 2NIPA 2FU5C 4HYYA 1F2TA 4NCNA 2C95A 1MO5A 4NH0A 4LYFA 4WIAA 2F43A 2WKPA 4P4UA 4IOLA 2LKCA 3CX8A 2PLRA 3NBZC 3VR4A 3W6OA 3QUSA 4ZDWA 1KJZA 3BRWD 1YR6A 2A3RA 1FTSA 2SHKA 5F98A 1M7HA 1A2KC 1PV4A 4DSUA 4XVRA 3ZVNA 1YRAA 2PCJA 2QN6A 3SU8A 2O5VA 3T15A 2E1RA 4BFWA 4EJSB 4DLTA 3LNCA 3LD9A 4KLZA 4H1VA 2JASA 2GAAA 1YE8A 2IXFA 1AM4D 3KJIA 4Z1MD 2IYVA 2QMUA 3OIWA 1ZNWA 2WOJA 5GVSA 1RYHA 3R7WA 1AIPA 3GLGE 2ZROA 3FKQA 4OI4A 4TMWA 4ERNA 2W6IA 4M1TA 1N0WA 1G6OA 2V3CC 2RGCA 3CF0A 4UJ3A 1KI3A 5A0FA 3ZZTA 1RRGA 1N5IA 3FB4A 4O2RA 2AD5A 1KK0A 3ZH9B 1KO7A 2QY9A 2W58A 4FD2A 4P0TA 4TSFD 1OH8A 2QE7D 2FZ4A 2ZRNA 1R8SA 4MGZR 2L0XA 4KLNA 2ZE8A 5SZJA 2B7BA 3W3AA 3ADBA 2QAGB 3R9WA 2A5JA 4BWYA 4QHTA 4XOIA 4QHSA 3X1YA 1BYIA 2H16A 1DADA 2P5SA 2V4ZA 5CM8B 3P32A 3THOA 2PLFA 4BFYA 2R6DA 2ASEA 2Z0MA 3WNCA 1Z2AA 2XZOA 1UKEA 2J0SA 1IXSB 1BOFA 4PPNA 3T5DA 3K9LA 1XPOA 4DLRA 2B8WA 3S1AB 3WY9A 5BYJA 4R71A 2ODBA 4GZLA 4TMZA 3ND9A 1N6LA 1GFIA 3TKLA 4D4KA 3RS7A 1OXTA 3NC0C 2QT1A 1FUKA 3V4RA 1TF7A 5DHFA 4IEIA 3QKTA 3AKDA 4PAQA 4ZIRA 3PEVA 4D4MA 2GTPA 4QHYA 1Q1BA 1LF5A 4TZ0A 1UDXA 4QG7A 2ATVA 2LWIA 3MWLA 1DAKA 1EFHA 4FWIB 2IF0A 4MKHA 2PJZA 1E2GA 5LDDC 3AF4A 2H18A 5D3MA 1MR3F 2ZRIA 4FCVA 1NY5A 3M0EA 3KKOA 4B3XA 3ZVMA 4LK2A 1RJ9A 1Z0IA 2OEPA 1AGRA 1KMHA 4LSGA 3FDIA 5FOSA 1KI2A 4MYCA 2JJ8A 2N1BA 3SS8A 3NWJA 4A82A 4KBFA 5GJBA 3IHWA 1W0KA 5H1YA 4KJZA 2XB4A 1GL9B 3I72A 4I1OA 2O0HA 2AFHE 2XOKA 1LNZA 2F1RA 2IYYA 3ETLA 3VR3A 4ZPXA 2A5YB 2J7PA 2YOFA 3FMOB 4JLNA 2KWIA 1OIXA 3GLHB 4AKEA 1G19A 2OE2A 4RSGA 1T9HA 1XTIA 3NKVA 4JYCA 4B71A 2WWXA 4TL9A 3NC1C 5GJCA 1GM5A 2VHTA 1KI6B 4JSTA 3W5JA 3GLHA 1Y63A 5J4YA 2CL0X 4B3CA 1JPJA 1XCMA 3LX8A 4N0DA 1UJ2A 2QM8A 2B6HA 3U61B 1XX6A 4GSYA 1ZRHA 4KITB 4FMDF 4Q18A 4KODA 1GILA 4MKIA 4DLYA 3UWKA 3DMNA 1KI6A 5JRJA 1XPRA 4JLMA 1F2TB 3THXA 1OT3A 2F43B 4QFMA 1OFHA 1VHLA 4MDEA 5DLQC 2FGJA 1QZXA 4PC1A 4G01B 4Q1EA 1SZPA 3G5UA 1OF1A 3D3QA 4A0GA 2XSZD 3AVOA 4MGKR 4QC2A 2BMEA 1HE1C 4D26A 4B3GA 1SHZA 1FP6A 2NGRA 4ZI2A 3KZ1E 1RW4A 2QUZA 2AWOA 1RYFA 5TDHA 2D62A 3DDCA 1P72A 4CT5A 3EIQA 2UVQA 3OEED 4ZDIA 5FFMA 1VG8A 4M53A 5B58C 2QA5A 1G9XA 2VP2A 2QSYA 2VP0A 4FW9A 4E03A 4Q66C 4FMBB 2JLYA 2ZJOA 2I1QA 2JA1A 4F4JA 3O8RA 3C7KA 4OQNA 1R0XA 2GCPA 1VCNA 1JR6A 1U8YA 2DYKA 5AUOB 2Q3MA 2VP9A 4Q4JA 2F6RA 1P62B 3WBKA 4UNQA 2J0VA 3JZAA 1K5GA 1P2VA 1JB1A 2OBNA 3QKUA 4V0OA 1ZINA 4YMWA 1WQ1R 4G5QA 2XNDA 4GDFA 2UZ3A 4OK5A 1YR7A 2DY1A 1T0HB 1YZQA 3DMDA 4TLDA 2BBSA 4OL0A 4Q5IA 4ZDJA 1JPNA 3B60A 1P2TA 2GJ8A 3U3JA 1U8AA 2J59A 3PIRA 2DWQA 3PVSA 3EC2A 2WWIA 2ZTSA 3WNBA 4QL3A 5DHAA 4BEBA 5E7IA 2RGXA 1WXQA 3GJ5A 2NO0A 2WKQA 5G3ZA 4PC6A 1E2MA 1KTVA 3KXIA 4L5BA 3AGPA 3DPUA 4Q21A 4KFRA 5FPYA 2FEOA 4M8NE 4BZXA 4JJZA 2ECKA 5J4HA 2NZJA 1TEVA 4LHVA 5JJKA 2ZI9A 3WP1B 4M4SA 3S1AA 4DBLC 5KSZA 3T34A 2O8DB 1FMLA 2BOVA 5LBIA 2O52A 1TAGA 3NXSA 4RKFA 1U94A 5CJ2A 3BH6A 1L4UA 3IO3A 1E9FA 4HB2A 1JJ7A 4WOPA 1CTQA 1ZCAA 4PZYA 1D2NA 2J41A 4NYIR 2JIZD 2FDCA 4GPTA 2FNAA 4XJXA 1R0WA 4KAXA 2AXPA 2ZXUA 4PANA 3VKHA 4B6FA 4M9XA 4L9WA 3BIFA 1JEDA 1EX6A 1K8RA 4I99A 1ZMXA 2NZ8A 2ZE7A 4JLJA 2WJGA 3LW8A 4BE7B 1H8ED 1E2EA 1S2MA 3Q5DA 121PA 2ZITA 3P27A 3SFVA 4UNRA 3ZZUA 4RFSB 1A7JA 5EP1A 2WSMA 4EFMA 1UEIA 1EX7A 4BASA 3EIEA 1G18A 1OE0A 3LRPA 1I2DA 5JCZA 2IXGA 5TARA 1LTQA 2IF2A 4JKYA 4LJ6A 4LJYA 1S3GA 4RFSA 3TK1A 3VMFA 1Z63A 2PT5A 4OJKA 2ZU6A 2GJAA 2ZUCA 3IDQA 1AK2A 4C7OB 1XTKA 2GHIA 3DL0A 2FFQA 4Q9HA 3CKLA 4ARZB 2MSEB 3QI2A 5HKKA 1MT0A 2QM7A 2WWFA 4X8LA 4CZ2A 3IBGA 3T35A 4GFDA 3IKJA 3WYFA 3OZXA 4V02A 1E2QA 2WJVA 3QJYA 2CDNA 1QVRA 2WVJA 1XEXA 2I4IA 2BVNA 3QPVA 3VX3A 2KSQA 3GLIE 1SGWA 1XMIA 1KSGA 1W4CA 2J5XA 3CUEF 3BE4A 1COWD 3K1JA 3IUYA 3G82C 2NTYC 2OZEA 4BFTA 4P4TA 3C41J 3OIYA 1XEXB 1GKYA 5FTJA 2QGNA 4HUQB 2QBYB 1D2EA 4HLCA 4WXPA 1Q1EA 1W5SA 2WWHA 2QAGC 2WOOA 4PO1A 3H1TA 1PLJA 1XWIA 4BLTA 1SKQA 4DLUA 4ZV4A 1JQJC 3TVTA 5GVRA 3RC8A 5JJIA 1U2RA 3V4FA 5F2EA 1J7KA 2BMDA 5L3VA 5EE1A 3NDPA 2QBYA 3H4MA 3P26A 3BJIC 2HDNB 3CONA 5TY0A 5DN6A 2WM9B 3NIBA 4OHVA 1OFIA 4CEHA 5KSPA 5KPDA 1KK3A 2O0JA 5FBLB 3KX2A 4TLCA 3F5FA 3PUWA 1G3MA 4UKDA 3VR1A 4O0MA 1SHKA 3FVQA 4US0R 2WWGA 3SHFA 4IDPA 5JFGA 3MAAC 5CB6A 1XU4A 4R9UC 3TIFA 2EFDB 1GKIA 1S4QA 2BEJA 4LPKA 5FBWB 1W44A 4DIDA 4HLDA 4AY2A 1DOAA 1E9BA 1YZLA 4I1VA 1G20E 4TMVA 4A92A 1F48A 1SVWA 3GJ4A 1ZM9A 3IEUA 2R6GA 3L0SA 3QNUA 3PFIA 4JLPA 2QQEA 5FTLA 3DKVA 2BKEA 3I1FA 5DYGA 4WW0A 1KO5A 1UBFA 621PA 3QQ5A 4XWKA 4JBYA 1W46A 2QEQA 1IY1A 4PO9A 5JRZA 3FMPB 4CEIB 3GEIA 2C77A 4DCNA 4GMXA 4JVNA 1R5BA 1NIPA 2G0TA 3A1SA 3PEWA 4XD7A 4OHWA 2RGAA 4N3NA 1NKTA 3QKSA 1R0YA 5HE8A 1O87A 2GEUA 4PC7A 1QHXA 3GJ6A 3I92A 4NONA 3AVUA 4FCWA 3ICQB 1KY3A 1ZJ6A 3RYTC 3U4QA 2CLDX 3RAPR 4BLQA 1E98A 1U81A 2ZUBA 3IIKA 3QKSB 4PAOA 4YXWA 2Y8EA 4N0EA 1IOZA 1DAFA 2IYSA 4C0LA 2RAPA 1TADA 2KBFA 3AP3A 3RANA 5JEEA 2IA5A 2PL3A 1Z08A 1NG9A 4JLBA 1NMZA 1HE8B 2JLXA 1E1RD 3CZQA 4F91B 4UNSA 4LBWA 4CDGA 4N1AA 1HUQA 2JCSA 3N5CA 4AD8A 1P4SA 4M0LA 4MGYR 1XD9A 2G0NA 4EJSA 4LHXA 3PG5A 4X8MA 3CX6A 1UBGA 3LDAA 3SFZA 3Q9LA 3K0CA 5KHOC 4MA4A 4RD1A 2AKYA 2WJYA 3GJ3A 3GJ0A 3K0AA 4JIMA 4FCTA 1G3IA 3R9XA 4PTLA 1VCIA 1XJCA 3KB2A 4OHXA 4W7SA 2GK7A 4DCUA 3RSOA 5BYKA 2AD1A 2C9CA 2IYRA 5EZ5A 2W2XA 4A36A 3K9HA 1DAHA 4BFXA 3I8XA 2PZEA 1DTSA 3HYTA 4C0BA 3TSOA 4MH0R 1ZU5A 4JL8A 5EP3A 3HYRA 2X19A 4KHZA 1VYVA 2ZRKA 2V7QD 1E79D 1YR8A 1KZ7B 4NTZA 4FMDB 1KJYA 2CXXA 2KB0A 1IN5A 1D2MA 4B3DA 2YOHA 1D6JA 3U60B 2XNSA 3HPQA 4B32A 3CPEA 1KAGA 4DUGA 1E1QA 3P20A 1TU3A 5L3QA 1P60A 3EAQA 1JECA 1U98A 1XMVA 1Z8FA 4WZBE 1E32A 2GETA 4PC3A 1IN7A 1KDPA 2HEIA 2DFNA 3MCAA 5FH9A 4DHEA 4HB3A 3B78A 1FL9A 2QAGA 2NO9A 3P4XA 3R8FA 4RVCA 1KIMA 2X2FA 1IQPA 2PEZA 2YINC 3GJ8A 2CVHA 3TR5A 3NBYC 5BWMA 1GRNA 3ECCA 1HT2E 3FFBA 4G5SA 4B33A 3NEJA 4EQ6A 2G6BA 4LHZA 3I62A 1GWNA 4TMKA 2AHOA 2FH5B 3U7GA 1IXRC 4AYXA 2MMCA 2PZGA 1Z6TA 3I3SR 1G7CA 4RZUA 4M2LA 1NLFA 3RWMB 1Z6GA 2VO1A 3TNFA 5JBQA 3C15C 1DO0A 4GOJA 2XJ4A 2R62A 4YMUA 4Q1FA 3HU1A 3RDPA 4GP6A 4ASUA 5KYKA 2PCLA 3KDSE 3OAAD 4D82A 2ZYVX 1JXOA 3GLFE 2WPDA 1AZSC 2BDTA 1QG4A 3SJZA 1GP2A 2YV5A 4LC0A 3I4LA 3W90A 5CDFE 2F1JA 1G8PA 1KY2A 4D80A 4LYAA 1P9NA 1T91A 1ZCBA 2BBWA 2CMKA 4NE2A 4XH9B 5FI1B 2QG6A 3HU2A 2JDID 1TMKA 3MLEA 5K8UA 1UADA 2IS4A 4RY2A 5SZHB 4CEHB 3H0KA 3IO5A 2RGEA 1ZP6A 1U0LA 1JEEA 3X1WA 4M21A 2RGGA 3THWB 1XFAA 1Z06A 2GXQA 3GCGA 1YVDA 4DLXA 5DYIA 1IHUA 2NOAA 4QGFA 2W00A 4EJSC 2FX3A 1QVAA 4DSNA 3ZS8A 1MO3A 4KO8A 2J7KA 5DI9A 1MKYA 1XD2B 2A5GA 5FTKA 3OESA 3SBEA 4QJ4A 1GKUB 1A82A 3EW9A 4BLSA 5FUWA 4OI0A 4URVR 1KDOA 3GFPA 3IGFA 1G8GA 4JL6A 3AKEA 3OE7A 4D81A 1SXJC 1I2MA 1XD2A 1MO4A 1ZUNB 2QP3A 5CM9C 1AGPA 4LCBA 4NYMQ 4BLOA 1KI9A 1JR3E 4PPGA 3RWOA 4YONB 1E2KA 1S0UA 4URZR 4LBVA 1E2JA 2CEAA 1Z0DA 1VMAA 4OQMA 3GQBA 3UK6A 2R8RA 1GNPA 2IUUA 1Z47A 2C5LA 1N6OA 1TUIA 4K46A 2BM0A 4KFTA 2B92A 2F3TA 4Q48A 5AJYA 2RCNA 2ZYUX 3B6EA 4P3YA 3NBFA 3SZRA 2QENA 3Q8XB 4Q4AA 3REGA 1NSTA 1TEXA 1N5LA 2QROA 3SQXA 2VTKA 1M7GA 1NMXA 3OFNA 4JKIA 3KJEA 5CJPA 3KKNA 3ZZ0A 2ZSDA 4U00A 1GNQA 3SQWA 3EPHA 1CXZA 4LI0A 4Q4AB 2A5FA 4TTPA 3BORA 4G1UC 2RGBA 3Q85A 2ZSBA 1IY0A 6Q21A 4Q9LA 2NPFA 2PT7A 1S3SA 4BGDA 1G8YA 3ASZA 4OKSA 4Q1AA 1JAHA 3K53A 3BXZA 4R2IA 3FOZA 2C98A 2ZANA 1GRQA 2ZYTX 4OHYA 2Z4SA 3WYAA 5F9FA 4TL6A 5KDDA 2A78A 1L2TA 2ZR7A 4LC1A 2VSXA 3RSLA 1KO8A 2Q3FA 5BN5A 3W6NA 2YWHA 1W1WA 2VRWA 1TUEA 5DH9A
chains in the Genus database with same CATH superfamily
3HP4A 2WE8A 5E95A 2GM5A 5CBPA 4R1NA 1T2AA 4DT1A 4D45A 1T4CA 1EAYA 1V2HE 2NUTB 3A6ZA 1LS1A 3FUUA 1CR4A 5AUPB 3B1ZA 4WD3A 2L82A 4ZHQA 1TGVA 2IZ7A 2YVUA 3GDOA 3Q5GA 2CUZA 2I1VB 3K6JA 3FCOA 4JWKA 1U7WA 2FQWA 3LHSA 2RI6A 4IH9A 4P98A 1DXYA 4R8SA 3RTGA 4N3BA 1QF9A 3OE4A 1QCYA 5IEJA 1EKXA 1YGPA 2OWEA 2BFBA 2VSQA 5HZKA 3CH5A 4PYLA 5HM6A 4RKRA 2WHQA 1I4DD 4E5KA 1W5TA 1BZYA 4C9BA 4ZCQA 5I9MA 1MP0A 2CBXA 1V2GA 5J2TB 2QPTA 4CJXA 3PC7A 4A6PA 1US8B 4EKEA 1ZHOA 4RD6A 4AECA 1F4VA 1OSNA 1SKYB 4LKRA 1ZMRA 2P4UA 4ZOLA 5KMGA 5KNDD 4QULA 2RKBA 4WFKA 1RJDA 4J4TA 2EFEB 2Z9BA 3BERA 3RVQA 3BMOA 4BJ1A 2FQQA 3Q2OA 3FN4A 4MV5A 2XCQA 2DPMA 1B93A 1UPXA 4PHTA 3CBGA 5EE5B 2OXTA 3D6UA 1J20A 1GOTA 1X77A 2Z08A 4JVSB 2I6GA 5LVAA 4NPAA 1T9BA 1FP2A 1CLEA 1JU4A 2Q2OA 3AVWA 1NW5A 3FOFC 4FYMA 2OHIA 1W1IA 4WLUA 2C2XA 2Z4RA 3RODA 4JQOA 1U2GA 3FBTA 3Q6NA 4OP3A 4B3TB 3RFFA 5B3LA 1AGYA 2EEZA 1QH0A 1Y4AE 3VH2A 4IXNA 5L3RA 5I9LA 3DVAB 1E3SA 3OX4A 4S3MA 4HVLA 5B7PA 1QIDA 4LJLA 1Q57A 3RIXA 4FX2A 1B6SA 4KRYA 3LQRA 5EWJA 1WF3A 5IYZA 5ENDA 1RXIA 1KVRA 4DMCA 5CAEB 4EUNA 1GQSA 3K2EA 1RRVA 3TL3A 4CKEB 3MS4A 3TLKA 1AKMA 1HQYE 1UOOA 1PJCA 2FY8A 4Q05A 2VJMA 5DU2A 4FM9A 3JZFA 1O77A 3DNMA 1I6LA 2V9PA 3I6ZA 1P9WA 5TB5A 4CPDA 1K8QA 2OBBA 4E4RA 4BU1A 3FDFA 4M9QA 1YNSA 3EA4A 4ZKEA 1NXXA 1K63A 2FPPA 1L7NA 3GELA 3VR4H 4Q7QA 3AEYA 4FFNA 2R65A 3JD4A 4KTTE 3ZHXA 1E6CA 1KMHB 3N39C 3TB6A 5CG2A 5E0KB 2FEKA 3HXPA 1Y3CE 3EG9A 2BCGY 2EARA 4KXFB 4XGKA 4ZAVA 4ABTA 3AEQA 3UMYA 4L5AA 1ZUNA 4ZYYA 4EATA 3JAWA 1Z5WA 2GBFA 2RFLA 4ASUD 2OYCA 1A1VA 2HV8A 4XGIA 5IAAA 1E62A 5KNLA 1Y7HA 4GX1A 5BNZA 5LXTF 1V11B 2FFHA 2Q62A 3DKKA 1C30B 2BN4A 2H0QA 2OYSA 2OFXA 1XVVA 1M6HA 2QTLA 2PSJA 2XYPA 1ZC3A 2QRVA 4JELA 4LBYA 4KXVA 4EDFA 3SSNA 4NCJA 1XL0A 5ALWA 2PJUA 3A4NA 2QLLA 5JPCA 4OREX 1GU7A 5LZ8A 2ZUFA 2XRMA 3K4HA 3DLAA 1SELA 4KDFA 5BN4A 4W4TA 2FW7A 1R4MB 1NE2A 2HT6A 4H1HA 1RI4A 2PBLA 2DBRA 2YW2A 1Z0FA 4J03A 4NCHA 4Z86A 3AUKA 5G53C 2NAFA 3UJ8A 4HATA 4MRSA 3WZMA 2ZATA 4K9DA 4NBSA 4DLVA 4RULA 5DKFA 2X1VA 3SX0A 3LVFO 3MLBA 3VTKA 1BJRE 1YDHA 3CRZA 3Q3CA 4PSCA 1MN6A 5I9TA 3UWOA 3B48A 5JG7A 2GEDA 3KEQA 2H06A 2WP8J 3PU6A 1JFTA 4UHJA 5HIJA 3V80A 1CZNA 1P7ZA 2GSWA 2YWDA 3BWBA 4JP3A 1YR3A 2Q3LA 2BTQA 3N3BC 4HDKA 1J5XA 5EUMA 1KFKB 1BC5A 1V39A 4G65A 4NENA 5EKDA 3T8YA 4YQZA 3VH1A 4RA9B 1CEEA 1TL7C 1A69A 2HJSA 2SKEA 3B2EA 3GEGA 1NFQA 3CZPA 5K8VA 2IKQA 3T3OA 1DLIA 4MLZA 2ZSFA 1NLUA 2RGDA 4MS4A 4PFSA 4FGUA 3VPGA 2ZAYA 1MX5A 2HA6A 3OIVA 3RE1A 1TZMA 3QKIA 1OXXK 5B7GA 4RK5A 5EWLA 2AB0A 3EQ9A 4F2DA 1UOPA 2QL9A 2ZIFA 4GPIB 3NRJA 2OUKA 4RXUA 3WGJA 3L4BA 4MR8A 4ARZB 3G1UA 4CLRB 1FS4A 2FMIA 3U4IA 4NZYA 1IM8A 1JFVA 1HDXA 2TMKA 2X8JA 2OR3A 3SSOA 3HCWA 3UHFA 4B3RB 4L3VA 2P2DA 5EE3A 3H1BA 3O7MA 1JQLB 4JI1B 2ADOA 1N2EA 3BH0A 3E3MA 3G85A 5CT6A 1JG1A 4L73A 3ZDXB 3MIZA 2GPYA 3VHXA 4N0QA 3HR7A 4NU8X 4W99A 2Q3BA 5EIEA 3CW8X 1TD1A 1LI4A 4OB7A 2Q3EA 521PA 3JQGA 3DCNA 3JARB 1S8FA 2HJGA 4IV0A 4OXKA 1W76A 5CX1B 4ESOA 1GITA 2Q4BA 3U3MA 3ZX5A 3LF2A 4EW3A 3DC7A 3MTDA 2Y99A 3CH7A 3CXRA 4M9ZA 1P5RA 2OENG 3DOJA 4IGFA 5E7QA 3UMCA 3ZWQA 3N2EA 5IXJA 3ED1A 3HM9A 1JG7A 5HZGA 1ISIA 3CISA 2HA7A 3NHZA 2ONCA 5HFNA 2J32A 1ZSYA 1Y8AA 1PZFA 2XCLA 3PQFA 1R8QA 3LC7O 4D43A 5H5JA 1C7IA 1RAEA 3Q6MA 4CI9A 2IU3A 3OPYA 4UVEA 4ZOLB 3GCZA 3WQQA 4F86A 4PVCA 1NBMD 2PXXA 4UE3S 2C1ZA 1W85A 2R44A 4LISA 4NBWA 1IEWA 1EFRA 4UXHA 2FUG1 4WL0A 1WNFA 1AK1A 4BBJA 1IIBA 3EZYA 1JFFB 1FUEA 1QIGA 1T9CA 1Y3AA 3K71B 4EJ6A 3KYDB 4RGBA 2GBLC 1YFKA 2AI3A 3T12A 4PSKA 3W34A 2ZI4A 4O63O 1X9HA 1IOWA 4OVKA 2QR3A 7GPBA 2O50A 5ALVA 2IHTA 4YAEA 2X42A 4YN3A 2HLNA 2ZVQX 1DDOA 4HN2A 2QG9A 1SZCA 4NYIQ 3U26A 2O8DA 4LZAA 2C4UA 3UGKA 4CGZA 2NQ2C 1RBYA 1U0TA 1Y34E 2G5GX 2AZMA 3DVAA 4UPDA 3SKXA 4BB5A 4EHFA 2CFIA 4N5IX 3QVUA 1JYEA 3COJA 4J16C 1L5HB 3D1LA 3DMGA 3PT5A 5CB4B 3TQFA 3L0ZA 4WACA 3L8YA 2GCIA 5CEJA 2FN9A 3L6DA 5ESDA 2NTNA 2GZSA 1EWVA 3K0AB 4ND8B 4OJTA 5I7EA 2AQIA 5DX0A 3NH9A 1FSFA 1SFRA 4BZZA 4HKTA 2GJ9A 3VC3A 1EWQA 1CUXA 3A8TA 1IONA 4P5PA 5H70A 2BGWA 1SUBA 4FSDA 3GV0A 4MPPA 3HA2A 1T13A 2E9SA 4PC2A 3UB3A 3TR0A 4EYOA 4DB2A 3ELBA 3HEBA 5THQA 3OLXA 3HXTA 3OZBA 4BNWA 1CD5A 1A9PA 4IHQA 1Z4JA 3USCS 3M5CA 1O4WA 4LZZA 1L7XA 2LPMA 1FOEB 2NX2A 2FJUA 4L7QA 1XCPA 4P92A 3UCFA 3UFBA 3W1VA 5J23A 2R9VA 2PYZA 3QBVA 1ZM7A 5GJWC 4ZZ0A 2AFIA 3FCEA 3VA7A 1QIMA 1VIAA 3ZIAD 4ER5A 3AEKB 3OTOB 4U9IS 1Q21A 4ZRDA 2OK8A 2DBZA 2PSHA 3UEOA 5BQFA 2B7LA 4XM0A 4EUHA 4PNPA 2HFJA 4GHWA 4XYMA 2UU9B 3G2PA 4C7OA 3C8HA 4EZIA 4ZYLA 2DM6A 5FOVA 5E1OA 2C8VA 2RMKA 3JATB 3NP9A 4H7DA 1T6NA 5IANA 5F1KA 1NNSA 4IDNA 5TGZA 3FTPA 4DBZA 2F9LA 5JU6A 1IXKA 3PNBA 2R6CA 4RUKA 3KL2A 4XDYA 5DWDA 5IASA 1P0CA 2H65A 2EBUA 3RADC 2CCJA 2Q4TA 3R3XA 5HKKD 4P53A 4RANA 4C2AA 4IRXA 4DQXA 3QVWA 1BN6A 5ICSA 4WCFB 1JWLA 4YDHB 5K51A 3WB0A 4FKMA 4LQCA 4L0DA 1K06A 3D8BA 5IJWA 3I23A 4QPCA 4NENB 3TQHA 1G7SA 1PK9A 3KOMA 4YLYA 5HX7A 5EHGA 1NPYA 2O8NA 3UICA 1P31A 1JB9A 2WTBA 3FFXA 2P6OA 3B9PA 4X20A 5A9SA 4HXYA 4ZJYA 4KAFA 1HT3A 3MOGA 3NIWA 3C74A 2Q5EA 4CHTA 5AJVB 4IS2A 1O0SA 1LV7A 3GWGA 3V7UA 4HZIA 3MCVA 1K3UB 1HMYA 4FHZA 1LY1A 1E79A 4AUNA 4K9LA 5JQGF 4I4TF 3GB9A 3MTGA 1MJGA 2QN8A 3FMFA 4MR8B 5AK3A 5H68A 3RJMA 3G17A 1KH1A 1KHHA 1PSZA 3R2JA 2GNOA 3EQ8A 1CX9B 3VTFA 3KU4A 4AF8A 4BB6A 2X3FA 2GO1A 3VZSA 3DOOA 3E81A 1ZIXA 3P0HA 4KPFC 1HLPA 3VHXB 3G2LA 2GERA 2B34A 1VRVA 3M2PA 3MAJA 4I50B 1T2FA 5HBGA 3SQNA 4TS4A 2JEZA 1YFZA 2XXJA 1E9DA 1FRFS 4H3VA 3OQNA 1I7QB 1M5RA 2RJNA 2OY0A 2ZSAA 3TXYA 3U6BA 3EZ9A 4BMNA 1G0OA 3UCXA 3K9FC 3K6SA 3RM3A 2SECE 4XJVA 1XHEA 4AW9A 3A27A 3ITNA 3HSSA 4OSEA 4AP9A 4F4CA 3QPBA 2R00A 4TYPA 2NVUA 4IPTA 2F1OA 4QD3A 4EG4A 1CZOA 1GV0A 3OCCA 3IIJA 2V4MA 3IIEA 4Q1CA 4FR2A 1KNXA 1ZD2P 1DZIA 2V7GA 4PE5B 2R97A 3ZTTA 5IDXA 2GLXA 1R15A 2OXRA 2NZVG 1SD1A 3VDXA 2Q6KA 1DWPA 5ER9A 4V2IA 3AK4A 3KR0A 3D3NA 3B6MA 3ONWA 1Y48E 2H2WA 4Q16A 1CULC 5E3HA 4F5WA 3T06B 4JLOA 4F92B 4EJMA 1M34A 1PX0A 2Y6UA 3QV1A 3T7RA 4ARBA 2DTXA 2OSVA 3KYDA 3WE7A 2O3TA 1EBBA 1UXOA 2D5IA 2HH9A 3B9BA 2G08A 1WR8A 1NONA 4MW4A 3EGEA 1M9NA 4TPKA 4MMYB 4TXJA 3JQPA 2V7VA 2PKQP 3UYKA 4OUKX 4UHHA 4ALKA 4ZYXA 4QXMA 4MIEA 2OORC 3OQMA 3L40A 3RU7A 3II6X 2C3PA 2XNDD 4HS9A 3ZV6A 1E1KA 2FK7A 3GLVA 1F20A 2ZWMA 3JQ6A 1M3SA 3ILYA 4KSBA 1C9DB 4RLFA 4XDZA 2WF8A 1EK1A 4R7ZA 2KW5A 3FDZA 1YQDA 3HKCA 4NARA 5AK5A 1RM4A 1R5NA 5CXQA 1E3WB 2Q5FA 4MI6A 2HBZA 3OQJA 2LRHA 3KR2A 2RC6A 4QOFA 2HREA 4CM9D 1CG6A 4OHOA 5A9TA 1II9A 2GAIA 1R6TA 4W8HA 4DJ5X 3GW8A 5TGTA 3KOXA 2J8ZA 3U3KA 2YR0A 4HQOA 4AQDA 1AQNA 2F64A 1U3TA 1EFTA 1XLUA 3BWCA 2G82A 1PT7A 3OFKA 1GCIA 1SRQA 3OEEA 2AS0A 2EWVA 1QFYA 2G9RA 1KZHA 2G5CA 2WU1A 1VSUA 3QLVC 2FWJA 3KZVA 1M1UA 4JJ8A 4KBGA 1AKTA 2XBLA 4MW5A 4RQBA 4RZIA 4S1NA 3HCPA 4TROA 1G4AE 1L1QA 2GCEA 4AZTA 4BN0A 3P0IA 4UZSA 1JTVA 5EUQB 3Q8LA 2NU6B 2VDUE 2Z6VA 4GMHA 3H2GA 5J2UB 3ZKAA 3QJGA 1Z0JA 4CL8A 3DV0A 1N8TA 3GZNB 1LPAB 3Q7RA 4RLQA 4E46A 2I71A 2ALJA 3SJAA 1Z8NA 2P2CA 3I39X 5EP2A 5EKTA 2CW5A 2E5FA 3DZBA 3TE7A 4DAEA 3D31A 1Z5NA 5JR3A 5IEBA 1B6TA 1XQ1A 4AY4A 4KHPB 4KFSA 2JPDA 3N8GA 1UJ6A 1YK0A 3PD0A 3K1AA 4NJOA 5CCBA 3K9QO 1X2BA 3VH3A 3ZVLA 4NP6A 5L45A 3C24A 2OVBA 3FIJA 1VKRA 3PDJA 4I3FA 1I3OA 4CLDA 1VL5A 3GN2A 1QHFA 1QGED 3GAFA 4RM3A 3A7DA 3GN1A 4ZQCB 3T54A 8LDHA 1IDN1 1BXZA 1TM2A 2FFJA 2FK8A 2C61A 2FEMA 2G1KA 4QU0A 3SBOA 2GVZC 4MI3A 3UQZA 1C3EA 3DEZA 3PS9A 3HV2A 2W0MA 1BMFA 721PA 4MSUA 3WRXA 4H7HA 4AKHA 1A7AA 2EZTA 2XT9A 2HPVA 2VUSA 1GA6A 5GWXA 4WQMA 1AV7A 3C3WA 3JQ7B 1N7GA 4HK4A 4MQMA 2FUG6 4LZLA 2ZBQA 1OWMA 4OKNA 3KQNA 2YN4A 1WSAA 4L6AA 2PEYA 3K1TA 4HAVA 1ONOA 3VR3D 3AY0A 1USUA 2P4QA 5UKDA 3UAVA 5FWDA 5HKLA 4Y2HA 2P2YA 3A4VA 5BVHB 1PEDA 4CLOA 4RFVA 3T1VA 2BGJA 4D3DA 3ENKA 2B1GA 4BMYA 1SA0A 3ZWBA 2JA2A 2FF7A 3D7LA 4IINA 4IY1A 3U3OA 1R7RA 2PUBA 2C96A 4X7RA 2EL7A 4CG0A 2AEFA 4BQFA 1KP2A 4BNXA 1WBDA 2XRYA 1YS6A 3RSHA 2R5WA 1IB0A 1Q1QA 2OXCA 2YDYA 3BFKA 1RWQA 1NJGA 4F8YA 2G07A 2DHCA 2QL5A 4HY3A 4MO2A 3C8ZA 1J70A 4K6GA 4PYNA 2G8NA 3IIIA 4KAJA 4D8UA 4ZO9A 4EVRA 2R2AA 2VZ9A 4EWLA 3O8CA 5JXIA 1F3LA 2SICE 1XMSA 3CPHA 1H9AA 3THWA 1OT5A 4MPJA 4BB9A 2WD7A 3I5XA 4PG6A 1GD1O 2X8WA 3EIHA 3G7NA 3I9OA 1BCRB 1TYDE 2ENUA 4YCBA 3H18A 1QDEA 1KP9A 1LSOA 1UODA 1VLJA 5FNVF 1Y7IA 5BQXA 1X7WB 3WI7A 2DUJA 1E2BA 4D98A 4M0MA 1GQQA 2ZJ8A 5BR8B 3KEFA 1QHSA 3I9JA 5HCNA 1YJ5A 3OQIA 3LYUA 3OPVA 2B8JA 1YS4A 4ILEA 3SNKA 1I30A 4LY6A 4X0EA 1M73E 3QU7A 3W5SA 8OHMA 2O8CB 9ATCA 5ALSA 1G3RA 3QM1A 2C07A 1Y6FA 3ENZA 4C7XA 2WYHA 1YDEA 3GRPA 3UJBA 6REQB 3TTXA 1B42A 3MAGA 4CT4B 4P4SB 5ESXA 4LSWA 4D9FA 1Z5GA 4BN5A 2OPBA 2W2KB 3OOJA 3AVYA 3EARA 1BGVA 2IOQA 1RBQA 4G0QA 2ZRBA 5IXSA 4NEGA 1MD9A 2ZIEA 3WLQA 3VJLA 5J2TA 5C1IA 5LNK1 3H4VA 1C0PA 1Y3HA 4RPKA 5CK4A 1CF2O 2OBXA 3DG9A 4YMHA 2HHAA 1Q6ZA 5G40A 1ZL2A 4DJJA 2AV6A 3OCYA 3UKDA 3MFYA 4FBMA 1SZDA 2GDZA 1QG2A 5DXAA 1DKLA 2VYVD 3BIOA 3RIYA 4E5NA 2E6KA 4U7JA 3AUSA 2FMXA 2RGNC 2XB6A 2OZPA 4DIOA 1WSWA 1BXKA 4WFQA 2QLMA 2Q21A 4FC6A 4Y98A 3NZEA 3JTEA 3Q87B 1F8FA 2XOXA 4KGDA 1NMEA 5EE9A 3KJNA 3TZCA 4YCCA 4IJKA 4CKWA 1VL2A 3HWSA 3TAXA 2IX3A 5C34B 1JG6A 3C5WP 3OAAA 5AI9A 1VE1A 3EDYA 2RHCA 3BM5A 4IQ8A 3V9AA 1QDUA 4PX9A 2GAJA 5A3RA 3IPYA 1N6RA 3D0KA 4UEKA 1GDHA 2O3JA 4FZRA 4QGSA 1XRNA 1CJVC 4CE6A 1IHPA 4V0MA 3CTMA 5TQJA 3WLKX 4HADA 4RV5A 2JGRA 1IN6A 4EG3A 1JKMA 3WLEA 1T8UA 3I5YA 5F12A 3TR6A 2Q5CA 5I7UA 3ZD7A 1HFWA 4C88A 1W49A 4FKBA 4A8HA 4UZFA 4PO8A 1G8JA 1YDFA 1SHLA 1CNFA 2GSDA 2NLOA 2ZJZA 3O94A 3ZJ5A 2CDAA 2F67A 2Z30A 3A7EA 5BW8A 1PVOA 2N46A 3AL2A 2D4HA 2VXCA 3IVRA 3NRBA 3RTCA 1YCFA 5D5PA 3IBCA 4NICA 3SQMA 1ZOSA 2DFVA 4G8BA 2E4YA 4H7KA 1II0A 2FSSA 3R41A 4HOYA 3W3ZB 3DZDA 1P5ZB 1CR0A 3P45A 5F33A 5IJXA 5KWSA 3U4MA 2CXRA 1E4YA 2R1ZA 4YMTA 4I1UA 2BHSA 3GHYA 2AW5A 1EM8A 4MGHA 1OXUA 4HDCA 3DDOA 1TT5A 1P7YA 1LW6E 3IP9A 1Q20A 3H99A 4NCIA 3IMFA 4MV7A 2PKEA 3BE8A 5B1YA 1V8BA 3LV8A 2OBMA 1Z12A 3NJ4A 4DAOA 5E9WA 4BPBA 5EXEA 5CEFA 1ZMOA 1M74A 2VHCA 1KKLA 2C78A 4J94A 5I47A 3QEOA 3T3GA 4D74A 4B3BA 4DSTA 2PGOA 3Q3JB 3GIDA 4GXNA 4KXYA 4MS3A 1GCUA 2A0XA 5C8DA 1ULAA 3R8CA 3Q9UA 4CLOB 5BVHA 2Z5FA 5SZKB 5C8YF 1BA3A 1LZLA 3OSUA 4G1CA 3I30X 4P7BA 2R8YA 4F1KA 3TW0A 2VSFA 1JIKA 4IKPA 5I9BA 4YI3A 3DZKA 1G5IA 4FIDA 4KMOA 1M0SA 2COEA 4IWNA 4BO0A 2Q2VA 1XZPA 4M1YA 1T2NA 1SVUA 3HCRA 1IL0A 1LFDB 3IP7A 3KOZA 1Y1SA 3DXZA 3M9WA 4HJXA 4UASA 4X8HA 5CUQA 1I1NA 3AB7A 2C9ZA 2GN4A 4L8VA 1T9AA 3CEPB 4CLXA 1SCUA 4B6OA 4YXWD 4EECA 4HXEB 4I6GA 4R2MA 5AKJA 5LOVA 3QVVA 4PGAA 1XGKA 2Q9UA 3K96A 1PQUA 2QM0A 2V1XA 1U2DA 3OEHA 3AEUA 4NPCA 1JI0A 1E7RA 3ELYA 4XSGA 5DIZA 4B6GA 5K0CA 3GLUA 3JD0A 4YJ3F 1X42A 5CT8A 5D3ZA 2AJDA 3WX0A 4EI8A 5L3SB 1VL0A 4RESA 3DZJA 2D3TA 3FJYA 4K9PA 4QLOA 5DASA 2FN4A 5GOZA 4KREA 3C4JA 1TI7A 1CC1S 2P9EA 2WHPB 4P3NA 3CSDA 5AW9A 5AWFC 2MSKA 3IQHX 3QPDA 3QWHA 4DXAA 2VT7A 3K16A 4DJTA 4J1SA 5JH7A 4TV8A 2C7PA 4A6XA 4AF7A 4HWOA 1RR6A 2FSFA 4OKIA 2P0YA 2Z2IA 1Q1GA 2X0RA 4BMXA 3DMTC 4HAYA 2TMDA 3AHJA 3PNPA 4MIKA 3M2TA 4MQBA 4XFDA 5JY6A 4ITRC 3RK4A 5IFLA 4J07A 3GLSA 4HGOA 2QZ9A 3BTUA 1KJIA 3KTAA 1YH3A 2C54A 4J1TA 4UHEA 5CVUA 3VYWA 1BJKA 1KYIA 1UBEA 3H9JA 3IQWA 4P4SA 3TGLA 2P5TB 5HF6A 2XXAA 3NVAA 3SVLA 2W2KA 3DAPA 3W04A 3T1HB 4UBOA 4TLBA 1WRBA 3LUCA 3K0HA 5TT1A 1GKLA 2DWPA 1TK9A 5SYMA 2D2VA 4C4TA 2W37A 5AP9A 4B7ZA 5I7FA 5K7SA 1HZJA 1B1CA 1M2VB 4MGEA 3ZIDA 2M6RA 5IVKA 3D6TB 1JDTA 1TVMA 4Q7LA 3T3HA 3T99A 3SIRA 3LA6A 1JHYA 2B1JA 5COAA 1HYHA 1TE2A 2J4DA 1NMYA 1E1LA 4LF4B 4DY4A 4ID3A 3GCXA 3LL4A 1FSPA 3O2QB 4KMMA 3UG7A 2W48A 3VPHA 3GLIA 4U5XA 1GFWA 2NP6A 2GGSA 4RJIA 1XU9A 1PTKA 2R6JA 2ZCVA 3KKLA 3CUKA 2FW0A 4LECA 3V7YA 3OIUA 3ANSA 1OIWA 2F3PA 1E20A 2C97A 2QJOA 2EV9A 2R79A 2XWPA 3NNSA 4O4IA 5K03A 3QEMA 3CWZA 1T5BA 4XYEA 5HE9A 2H1RA 1I9GA 2W8BA 2WAOA 5BURA 1P8JA 3KSAC 3UA3A 5P21A 3X2SA 5BNTA 4WK2B 2BFFB 3TQIA 1E4EB 3LBFA 2XITA 3ZWMA 1JU3A 5CLQA 3VSCA 4BRZA 1FSGA 4E33A 1GXSA 2C31A 3TRJA 4Z1OA 2Q5QA 1P19A 2HU7A 2P2NA 4LYJA 1E2NA 3TJMA 5EJEA 3CNLA 3LECA 1EDOA 3NTVA 4F96A 1FLNA 4Q34A 4CQJA 1TJYA 3P2IA 2F9MA 2BMVA 1GZSA 3MQ4A 3VM6A 2J31A 4HFJA 4C04A 4F9FA 1Z74A 1DO2A 4CL3A 4OBEA 1HEYA 1E1DA 3JQBA 3PC6A 4LI3X 3M81A 3AFMA 4RQAA 4WCFC 3OZ7A 2A6PA 1KH3A 2BFAA 4H4EA 4K86A 1P1HA 1PQYA 4AURA 1VP9A 4EIWA 4GRDA 1J07A 3U44B 5L7WA 3PGA1 4NBVA 2Z57A 5HS6A 9ABPA 1IQRA 2UXBB 1ZC4A 1Y33E 2JFHA 3DO5A 3L8CA 3UA4A 3BZWA 3M3DA 4TMTA 4F71A 5C53B 5B7NA 2ZRLA 4X84A 5A02A 2CHGA 1K0UA 2ID7A 2VBCA 3IOYA 2ZXEA 1BO6A 1IZYA 1NOIA 1QYVA 4A8JA 4AMBA 2CMGA 3SXPA 4E94A 2XGJA 4EF6A 1NXVA 4QM6A 1N3BA 2XHZA 3PT9A 1HM5A 2AEEA 3VGJA 3VAZA 1NQTA 4Z0PA 5EJ9A 1DJQA 4GG1A 1U5BA 5KKAA 1CIJA 1YL5A 4J0KA 4QDJA 4F04A 2HEGA 3H2KA 4BMVA 2ZK7A 3G8DA 4K0RA 1Y3FE 5KSYA 1BQEA 1IZZA 1IBSA 2E48A 3M33A 3OCUA 4L15A 4O3FA 1FDUA 3DW1X 1U2SA 4LMRA 4RZSA 3IRVA 1SO8A 2FOLA 2XODA 4JT2A 1NKSA 1JQEA 1QFSA 4MS3B 3N6XA 4D56A 3MB8A 1C1YA 2DBVO 4DN6A 5KI6A 2Y0PA 4AM8A 4LY3A 4NK4A 1XR3A 2PS0A 2V8BA 1R74A 2Z2JA 5AKHA 1Z2PX 2BLLA 2R6HA 2G1JA 4MVJE 2A33A 3FR7A 4US2R 2ZVJA 3RCBA 2I91A 3VKGA 1YL6A 4QNMA 2ZZKA 5LZ2A 2Y0DA 4BFSA 2Z3WA 4IFEA 3TD6A 1F8XA 1WZEA 1SBNE 1SQSA 2ZRFA 1DKRA 3BJEA 4R5MA 2I67A 4V0RA 3RABA 2DKNA 2ONJA 1QPBA 4WEQA 2ODWA 2B4TO 1BKDR 1CW2B 1RYDA 2BJWA 2OO7A 3A6JA 3G8YA 4HUJA 4J2TA 4LJ7A 1L4GA 3A6FA 3C2QA 3CSUA 2C8KA 4LFCB 1JJFA 1DAEA 4BNVA 5DRTA 1UBTS 1AKRA 3BWDD 1QF6A 1KI7A 2ZJAA 2B82A 3L6BA 1OOEA 3D4LA 1W47A 2Q0QA 3WFZA 2OV6A 3MA0A 2EKDA 3H5RA 1RBMA 1KEUA 2QN9A 3NHJA 4G86A 3SXUB 2B30A 2X1LA 1WPXA 3DT6A 3X2EA 1DDIA 1LRJA 5A3QA 5EZYB 5HG0A 3WFJA 4YRBA 2BWJA 3IVGA 1YCHA 5EXTA 2XOEA 4KW7A 3CO0S 1X80B 2ERYA 3NEPX 4WNAB 4EB8A 4KFCA 4P0QB 3ZCRA 1DAPA 2YFKA 3GAMA 1W6RA 2UZ1A 3IQEA 3OHPA 4XEUA 1S96A 4L57A 5CYGA 3PENA 3DPIA 3TS1A 1NDUA 4TV8B 5CVTA 1Z3CA 8ADHA 3R20A 5FBHA 4NG4A 2X6RA 4ZCRA 4Q93A 3EPPA 4EF4A 1NVKA 1GSAA 4NECA 1KDZA 4DV6B 1B43A 3F8WA 4MGIR 4CF7A 1WKBA 2BEKA 3HWRA 4RPGA 4YJFB 3DE5X 4UHKA 2H6EA 4NV1A 2CL6X 3LIPA 3RARA 1YAHA 4IH4A 4CEJA 3IQDB 1ZQ1A 3C3CA 1C9KA 2VDNB 2Y1KA 1NAHA 3GA7A 3MJRA 4K6OA 4Q4DA 2CF5A 2HK7A 3DTVD 2ZYAA 2IV7A 4QRHA 1RWWA 3CG0A 2JH9A 3PSAA 4CLEA 1S9HA 1EK2A 1PG2A 3I9LA 5F51A 2WIBA 1UPBA 3X1ZA 2C4MA 2HHLA 1WUTA 1BFUA 2OQIA 2JHFA 2P9TA 5IK2A 1MJ5A 4EPRA 1L8AA 2ORYA 2GCOA 1JIVA 2C5FA 3RQSA 3WLPA 4DNFA 1V37A 3CCBA 3I8OA 1IZ0A 3SZOA 3QMMA 1EYZA 4AU1A 1E99A 3FI0A 5CXSA 4K6MA 2PLNA 4Q3AA 1TTQB 3EGCA 4DA7A 2QLNA 1Z6XA 1Z5VA 4KN9S 4QBHA 3Q3HA 3FBGA 4G5GA 3MTJA 4F3KA 4X60A 4YJGA 4C5AA 2QNIA 3UPUA 4R2JA 2HB6A 3OZRA 4L8YA 4Z9AA 2JGEA 1E2UA 1J09A 1SUFA 1U28A 4B76A 4CQLA 3IL2A 3H1AA 3HU3A 4MS1B 3F1KA 4UVDA 2O4UX 1PFQA 4MVJF 1G5QA 2FDXA 2FSGA 1NHWA 3E9MA 4JBXA 2DLDA 4F0JA 4EL0A 2PLAA 5ITZA 5AXDA 1TM7E 1IRIA 4F8JA 3NUZA 1YDGA 3UAOA 4NOMA 1LPSA 1E5XA 1TUBA 4DCGA 4O3MA 4C5CA 4BVEA 2RB5A 2JCBA 4CDRA 2YIVX 2Z1DA 3ZC3A 3LUBA 4WESB 4UPEA 2WVAA 3OZUA 3T1OA 1SKYE 4BFUA 4P6VF 5JXWA 1PLLA 3BHJA 1LTKA 1XK7A 2GZDA 3GMTA 4IF4A 3WV5A 3U09A 2GLTA 1NVAA 2R8ZA 1XMOB 1U7HA 3L82B 4E2XA 5CK5A 1SD2A 2K5UA 2VTDA 1N6KA 4DWJA 2W71A 3K70C 1XZDA 1G21A 4TKUA 4BQSA 1WD7A 2P9YA 4XIYA 4HMPA 3KETA 3QLUC 2JGKA 2I4TA 1WXDA 2FP3A 4H6XA 3CLSC 1WAMA 3N2IA 4FYIA 2F3RA 1T4GA 4O4HB 4U7TB 3T5CA 4MNTA 4OAOA 1MZVA 5CFRA 3ORFA 4XX0B 4LK3A 2PTHA 1MO6A 2VKTA 5AI8A 4C0KA 3LYHA 2P41A 1OLXA 3NTLA 3UJ3X 3AHCA 4IVRA 2O5EA 4UHBA 4NYJR 1V96A 1E4VA 1JDBB 2B3TA 2ZXFA 3BKXA 3I53A 2J30A 1RRCA 1KA9H 3T3EA 1NT2A 2VAXA 4ND1A 3KAQA 5C8YA 1X1RA 4PTZA 3GFRA 3O47A 4GGPA 1MAWA 1SXJA 4V38A 4QTUB 2O8EA 4LWPA 4U2BA 1Q7TA 1KJWA 3SC4A 2CXPA 2IYTA 5G1OA 2AN4A 2ERXA 2PTGA 3VR6D 4EB6B 4NOLA 1EM6A 3WYNA 1JLRA 1XKXA 3VV3A 3T52A 4RIIA 1YASA 3CVOA 3EVFA 1E1CB 1QE3A 1PJ4A 2JFWA 3DE7X 1FNMA 4H4CA 4ILKA 4J3JA 4B34A 4BP3A 4HT3B 2NACA 4LF7B 5A06A 1Z7EA 1H0KA 2BE7A 3A6PC 3LRXA 4YP7A 5TVKA 2ZYGA 4Z3DA 2UZ4A 3TKAA 5BSMA 4OP1A 1ARZA 5IH3A 5KDLA 5IJ0B 2BGKA 2XJ9A 1E0DA 5BN3B 3NHUA 2BMFA 3G02A 5AVTA 5DGXA 4TTSA 3O8OB 1B41A 5IDQA 4L5CA 3SP1A 4YUAA 1XTJA 3VAYA 1NVVQ 5FJIA 5JECA 3D6AA 1XZGA 1H69A 2CB9A 2WBLC 3EFHA 3Q7SA 3G7SA 2JHCA 4QARA 2FAXA 2JIZA 5KTSA 4IV8A 2QZ4A 4RK6A 5IS2A 5JO9A 3LBNA 5BMVA 2QTFA 1U0FA 3DL2A 3IPCA 1V4NA 4IJVA 5AVJA 3NASA 3RS4A 1FX1A 1JKJB 3GGPA 4Q15A 1AUOA 1JQDA 3CH6A 4LZNA 3SOPA 3ND7A 5KJ6A 2RHRA 4EYSA 3UKOA 3ZY5A 1WCV1 1FFHA 3B85A 3EQZA 2YWRA 5FOXA 3OQVA 2BMJA 3ZHSA 5FUVA 3SC3A 3GVCA 1CERA 1JA1A 1QQ7A 5IKPA 4HNAB 3DZIA 3KP1A 3UXYA 3A2MA 3A2KA 2IS1A 2JZOA 3RVSA 3TE6A 5K0LA 1EVJA 4HJRA 5FO1A 3A1DA 4P83A 1M1YE 3MYYA 3KXPA 1P81A 4I2VA 3GDWA 3NANA 4IOKA 4JP1A 3KUKA 2RE8A 4BQPA 1UKYA 3DEFA 4IXDA 3U0VA 1L5RA 1FQKA 2XDYA 5KUTA 1UC8A 2DPGA 1GG2A 3GCWA 3LFTA 1YI0A 3DOEA 3M4ZA 5HIIA 5B57C 3F49S 1SK9A 4L4SA 3EC7A 3FUWA 3IKVA 4FMPA 2UAGA 1QO7A 1YT5A 5KOHB 5F35A 4XWGA 3RAFC 2GLUA 5ECWA 1VMEA 1AS2A 5FUQA 4M89A 2VJYA 3ETHA 2GCOB 2EVWX 2IOHA 3M8KA 2G1PA 5AFSA 1L9KA 3RSFA 1B0UA 1X3SA 4MYUA 1ISRA 1JYSA 2V0CA 3QXXA 4NV0A 4XCQA 1KETA 1Q84A 4Y3UA 4BP8A 1CJMA 4EY5A 3GRRA 4Y0NA 2VQSA 3R4CA 3ZWVA 3N5KA 5LA6A 1QFXA 1FP4B 1G3UA 1SVOA 1ZWLA 4KO4S 5HMLA 1F2UB 2X5NA 4DQLA 5FB3A 4EPWA 3UV3A 4WEOA 1XRMA 4F21A 1A9XB 4CKYA 2EP5A 2OBFA 2OCDA 2VUIB 1N2CA 4RHXA 3VX4A 3QFFA 2OCKA 2XMZA 3TW6A 5C8ZA 4HZGA 1O9HA 5LZ5A 2PA3A 4PBSA 1M1YA 2D00A 3O4VA 1OXSC 4V03A 4EPVA 1R6BX 5EC8A 2ODAA 2C99A 5ITZB 1P45A 3C6KA 3WISA 4BGEA 2K87A 1XP5A 3DFFA 4FJ0A 3IXQA 3LM8A 4HAZA 2PX3A 3QEAZ 3F71A 1SXPA 1Y6GA 2REXB 3GUVA 4QUIA 4E12A 1BXGB 1Y7TA 4X24A 3ZV4A 4LBZA 1AKVA 2GJSA 3LUHA 1FDVA 1GUBA 2BM1A 3WK7A 2FYTA 4CIYA 2CNBA 5HM8A 1JEYA 4PQRA 4BPRA 4YRMA 2XUKA 5GM2A 3FYCA 4XQEA 3ICCA 4RD4A 3CVVA 1PR6A 5LMUB 5JROA 1QRAA 4RTKA 3OY7A 1NJSA 2AX3A 3MINA 4GZMA 1TCAA 3VISA 1QK5A 3KM0A 2G25A 3EZFA 1L5YA 2IXTA 3D8NA 5KYVA 1ETUA 1ECJA 1AKEA 4TV9F 1PNVA 4H6VA 1LX7A 3I83A 3M6AA 1K7FB 3DVSX 4L8FA 3RSCA 4HL6A 2P1ZA 4FTWA 1FTYA 4XQCA 3RIMA 3TEFA 3VO9A 1H8HD 4IGIA 1FCJA 3ZE1B 5G0UA 3RVOA 3EXAA 4IRUB 5G1PA