1A2UA

Staphylococcal nuclease, v23c variant, complex with 1-n-butane thiol and 3',5'-thymidine diphosphate
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
135
structure length
134
Chain Sequence
LHKEPATLIKAIDGDTKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Mobile unnatural amino acid side chains in the core of staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Nuclease
total genus 34
structure length 134
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1998-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1a2uA00
3MXPA 2QDBA 4K5VA 3MVVA 4YIJA 2F0MA 5M9OA 2PW7A 5J22A 2NUCA 1A2UA 1SYBA 2PZWA 4I65A 5CC4A 5HGTA 4QF4A 3SR1A 4DGZA 1EYCA 3T16A 2F0NA 4LAAA 3OSOA 4ID6A 2KQ3A 2SNSA 2RDFA 4PNYA 4RKLA 2EY5A 1A3UA 3TMEA 4EVOA 2F0UA 1EYDA 3PMFA 4E6IA 1STNA 3ITPA 5JAVA 2F0FA 3ERQA 1EY4A 3D4DA 3OWFA 4KJNA 2EYLA 3QOJA 5CV9A 1JOKA 1STBA 1SYCA 2F0OA 3BDLA 4EQNA 3H6MA 5C3XA 4F7XA 1SNMA 2OEOA 5HURA 2WACA 2F0SA 5C4ZA 5I6YA 5CV8A 2ENBA 5CGKA 1A2TA 4KD4A 2F0IA 4KY6A 1A3VA 5EKKA 5KYLA 3C1FA 4KHVA 4IALA 4KD3A 1NSNS 1SNPA 4NMZA 4DFAA 4K8IA 1JOOA 4F8MA 5DEHA 5EGTA 1SNOA 2OF1A 3D8GA 1STHA 4K14A 4B9XA 1JOQA 4KY5A 5IGFA 1II3A 3LX0A 3QB3A 4EQPA 3OMGA 3TP5A 3C1EA 4QB4A 4WRDA 4NP5A 3P75A 4QMGA 5K5PA 2O4XA 3MHBA 3U9OA 2F0PA 2F0DA 2F0LA 4NKLA 3TP8A 2PZUA 1KAAA 5CV7A 1SYDA 4KJOA 4ODGA 2SNMA 2F0KA 1U9RA 4R8NA 4ZUJA 3T13A 2F3VA 1KDBA 2EXZA 3DMUA 1F2ZA 4KTAA 4NDXA 5I6WA 5IOCA 1JORA 1SNDA 5KGUA 4ZQ3A 5E3FA 1EY0A 3NHHA 5EKLA 2EYPA 4B9WA 2F0QA 2SOBA 3HEJA 1SNQA 5JOBA 1EQVA 3OMCA 1ENAA 5CV6A 1ENCA 2EY1A 1F2YA 3MZ5A 5C6AA 5I9OA 1IHZA 2RBMA 5IGCA 2F3WA 2OXPA 2F0EA 4K8JA 4N9TA 1F2MA 2F0GA 1SNCA 3S9WA 4J1MA 2EYMA 4K6DA 5C5LA 5CV4A 1AEXA 4DU9A 2EYOA 3MEHA 3NP8A 1TQOA 2PZTA 1KDAA 4HMIA 1STGA 3DHQA 1RKNA 4K5XA 2EYJA 4S3SA 5CR3A 2F0JA 3SK8A 2PQEA 3SK4A 5IGEA 3NXWA 5IIFA 3NUCA 4K2LA 3SK5A 2EY6A 3TP7A 4RKBA 3NQTA 5C5MA 1A3TA 3BDCA 2F0HA 2KHSA 4G57A 5E1FA 2EYFA 5ISRA 5J39A 2PW5A 3EVQA 1EY5A 2M00A 5F2DA 2EYHA 1NUCA 3D4WA 3NK9A 5DAUA 1STAA 3SXHA 5C3WA 5IGDA 5J1ZA 5IODA 4DF7A 5NUCA 4PMCA 4KV6A 5KIXA 1KABA 3E5SA 3QOLA 3R3OA 4K2KA 4ZUIA 4HTHA 5KYIA 3HZXA 5IGBA 4TRDA 1STYA 4MIUA 3SK6A 5KEEA 3RUZA 2PYKA 1EY9A 1EZ6A 1EZ8A 4N9PA 1EY6A 4J6HA 3V2TA 1EY7A 4PMBA 3EJIA 5CV5A 3P1HA 3SHLA 4WORA 1SYFA 1TR5A 5C4HA 4K5WA 1EY8A 2F0TA 4H7BA 1SYEA 4ME5A 5KRUA 1SYGA 4EQOA 4HMJA 4KY7A 3TP6A 3D6CA 3VA5A 5IGGA 2EY2A 2F0WA 2LKVA 1EYAA 2F0VA 3EROA 4IUNA 4OL7A 1KDCA 2HQEA 1TT2A 4IZ8A 2RKSA 5I9PA
chains in the Genus database with same CATH superfamily
1K8MA 4K5VA 2PW7A 1K8AC 4DR4L 3NWTA 5AJ3Q 4GN4B 1HNXL 2VQFQ 1PRTD 1PTOD 3WOFA 4LF9L 1YHAA 2RHQB 1RL2A 1TWHH 4JC0A 3SDZA 3GTPB 4BWGB 4DR4Q 4A3BB 3D4DA 4XYQA 2IX3A 2PQAA 3SVMA 4LF9Q 1S5CD 3TRZA 2NN6H 3UDFA 3PO2H 4ALPA 1ZKOA 4C3HH 4A3CH 4DK1A 1K3BC 4GLVB 4A3GB 2IL8A 2ATWA 3I91A 2H4OA 2Q8TA 2QA4A 3M4OB 1IKMA 1ZYRC 1UUPA 4KD3A 2DNEA 2TSSA 2SDFA 4F8MA 2VXWA 3U4VA 5EQ0A 3ZYYX 4A3MH 3ER0A 4A76A 1K9MC 2B63B 2OCEA 4X3SA 4B3MQ 1XMQL 4PQXA 4TVAB 1CSPA 3RZDB 2JSOA 2WKDA 3AQQA 3HOUH 4DV1L 1CHQD 2HQLA 1Z6HA 2KCMA 1ZEQX 1BF4A 1XPRA 1XMQQ 2K5NA 3UI2A 1EFID 5ELFA 4LFCL 1M4VA 2FJ2A 5LL6S 1LM0A 1XNQL 4L5TA 3K58A 3JAMi 2OWOA 1HZCA 2B29A 2RBMA 1G291 3RZOB 4LFCQ 1YVCA 4CGYB 5M5WH 4N8X1 3I4NG 1XNQQ 4S3SA 4HMIA 3UE1A 1Y1WB 5JJIA 1NAPA 1CQFA 2CWAA 5ELCA 1YITA 4HR7B 5IE8A 1HR0W 1V43A 3S2DB 1DM0B 3H0GH 2PW5A 5C0XJ 1Q81C 1QWYA 4RCNA 1K83H 2LS01 3CMAA 4XT3B 1ZYRD 3D4WA 1EEID 3FMCA 3NK9A 2EJFC 3KK7A 1IBML 2DJFC 4FDBA 2K52A 3E6ZX 1N9WA 4ZUIA 5FO7B 4LWCA 1XPOA 5KEEA 3OWEB 1U4RA 1AH9A 2G5DA 5CV5A 3G4SA 4X62L 2JA5B 3CCVA 5JVG3 3CRLC 2N88A 2Y0SE 1Q82C 3CXCA 2XRSD 4DV6L 4C3IH 4KKUA 1GUSA 4XT1B 3M7NA 5I9PA 5IYCH 1Y1VB 1SFOB 5EPKA 4R8IA 2K1BA 1L1OC 2F0NA 1T5XD 4RKLA 3I90A 4LF4L 2XNAC 1VQCA 1EY4A 3ERQA 3R8BA 4RHSA 4EQNA 5HURA 2F3IA 1CKOA 1MKHA 4AQYL 3PO2B 3A55A 2ZJPA 4C3HB 4LFAQ 5GADC 1YJ9A 1L2FA 5CGKA 4LF4Q 1FGUA 1B44D 1B70B 1EUJA 2EIFA 5IWAL 1K8GA 4AQYQ 3JAMc 4NMZA 1TS2A 5JEAH 4DXGA 3J80E 1DJRD 2E75C 1STHA 4A3MB 1V8QA 5IWAQ 3K5NA 4APVA 5K5PA 2AQ1B 3MHBA 1LUZA 2F0PA 1VQDA 3KFUA 5I6WA 4IOCA 2IX1A 2RF4A 1ICWA 1EY0A 1BBXC 4P73A 3SGIA 3VR4A 1D1KA 3NTIA 1Q8IA 1E2VA 4M1UB 3KJOA 2UUAQ 4BBSH 2I46A 1DCZA 1LTBD 5C4XH 1JJGA 4GLXA 1ICFB 3OYYA 1TQOA 1TXYA 4C1NK 1CFMA 2Y0SG 3X3NA 2UXDL 2EVBA 4C1NI 4YCVA 3GTGH 1JMCA 3NUCA 4R9WA 4C3JB 3E0EA 5M5YH 2UUBL 2JA6G 3BDCA 5FLMH 1G8ZD 3H0GB 2UXDQ 1K83B 3HOWH 1NUCA 1JWUD 2HD3A 1STAA 3H94A 2R7FA 3PUWA 5IGDA 2L11A 1EU3A 3LGJA 3PCOB 4KHZA 3R3OA 4IJLA 3L3OC 4AIMA 2EPBA 1E2ZA 5TSSA 1Y69U 2QGQA 2BOSA 4N9PA 3D31A 1X6OA 3ERSX 1YZ6A 3W5OA 2F0TA 2WINB 1Z7TA 3EROA 1KDCA 4C3IB 3CCSA 3HKZE 3MVVA 1D2BA 1KTKA 1N36L 1GHKA 2QILA 4CKBA 2EOTA 1H9SA 4HN7A 3HOVH 4UP7A 5IY0A 2HDMA 1N36Q 1PTOH 3F1ZA 4IN3A 5M3MG 4JI7L 2NVTB 3QOJA 2GVBA 3OIQA 2OEOA 1FJGL 4RA8A 1EU4A 4B3TL 3AYHB 1CZWA 3PSIA 3HKSA 4P72A 4POGA 2WFWA 2CQOA 1DYQA 1FJGQ 1QILA 4RAUC 2R3ZA 4B3TQ 3I8ZA 3S1NH 4HIDA 5IYDH 4P74A 2K5WA 4B9XA 4DV4L 1FD7D 4QQBX 3Q6SA 1ASZA 4FVMA 3C1EA 1VQAA 2G9DA 3P75A 2O4XA 1LV9A 2F0DA 1M8AA 1I4XA 1WTHA 1B3AA 5IODA 1GJXA 4DR2L 5C0XH 2FFKB 1ESFA 5GQOA 4B3SL 1GM5A 1JJCB 1VF7A 1VQ8A 4DR2Q 1AP0A 3HP3A 1TY0A 1SE4A 2B2TA 4IPDA 1LYLA 4A3IH 2Z6BA 4DNRB 5C4XB 4B3SQ 1IW7C 1K0RA 3FP9A 1PZJD 2KECA 2WAQG 3OIPA 1KDAA 2K6AA 1V9PA 1RKNA 2AQ2B 1WYDA 1EQQA 1VQNA 4LFBL 2QCPX 3OW7A 3S17B 4DV2L 3HOXB 3HKZG 2QDLA 5M5YB 4A3KH 2GVAA 1O7YA 3IFDA 4BY1G 3PIO3 1NTGA 3GDEA 2ES2A 3HFZB 1PFBA 3NBHA 3KJPA 2XWBB 3HOWB 1Z9FA 3B6YA 5KIXA 5CYUA 4IQZA 3S15B 1X55A 3QWNA 4LF8L 1KRSA 1KHIA 2FXQA 2KBNA 1BO0A 2B2VA 3FPPA 4KKSA 4YCWA 4N8FA 4H44C 3F2CA 3I4MB 1EY6A 4J15A 1O78A 1EFWA 1E2WA 3F2DA 2HT1A 4PZ7A 4OL7A 3MXUA 2IHFA 5I9OA 2Z1CA 4ZLTF 2K01A 1UE5A 2KHJA 2C9OA 4ILWA 1QE6A 3D6WA 1NR2A 2FHTA 3UDIA 1A3UA 1IW7D 1PRTB 4JBKA 1QNUA 3PMFA 1PTOB 3RNUA 1EQTA 4KJNA 2EYLA 2ZM6Q 1A0IA 4DNIA 4JK1C 2N55A 5FOBB 1XNRL 5CV8A 2TMPA 1GKHA 2MUYA 3KLWA 1YI2A 2HCCA 4IUQA 3WOEA 2A6ED 4IALA 4K8IA 1ONLA 1SNOA 2J7ZA 3I7FA 1I4HA 1O80A 1PDQA 1CZGA 4WRDA 4JVZA 2JE6I 3EBEA 1BR9A 3U58A 1I4PA 4NXML 1A15A 3E9HA 4BBRG 2PPBC 1ILPA 2A6HC 1LTRD 4LMQD 1V1OA 4AYBG 5LMUQ 3CD6A 2HHHL 1B7YB 1SN8A 2EYPA 4B9WA 3QO2A 4NXMQ 2N49A 4O1NA 2OXPA 1R9TH 3K7AB 3K0YA 1VQMA 3LWEA 1WCMG 2EYOA 3S1MH 1UE7A 5IGEA 3S14B 3TS2A 1D1IA 3HOZB 3OW2A 1I6HB 3NBIA 4JPBW 4G57A 1QCBD 2CQAA 2I07B 2E2JH 1H9MA 4YWMA 3M4QA 5JVH3 2OTJA 2LMCB 4GS3A 1TU2B 2MO0A 1KABA 1STYA 2I5MX 3UE0A 4RG1A 5K36G 3PO3H 3P20A 1ASYA 1EZ6A 1PVOA 1QUQA 4A3JB 1CKNA 1J9OA 1XWEA 1KC8C 2GA4B 3BZKA 3RR5A 2B2YA 4R4IA 1V1QA 4DR5L 3FKIH 3CPWA 2A6HD 2IJ0A 2JEAI 3V96A 3ND8A 1Q1EA 1VQFA 2N78A 2E74C 1P16A 4ME3A 5FLXE 1Q3LA 4I65A 3SR1A 1X3QA 3AFQA 2R61A 2KQ3A 2EY5A 3J81E 4KHPQ 4EVOA 3I4OA 3QG1A 4TQUS 5JAVA 3CC2A 3OWFA 1PYWD 4ZK9B 2A68C 2O2LD 1PZKD 4BY7B 1HZ9A 4MNOA 1JB7A 3IRBA 3BYTB 3CC4A 3DM1A 4A3LH 1HCZA 5A35A 1XMOL 1HPCA 5BN3A 3TZUA 3L9AX 2F0IA 5IT9L 1JE5A 3R2TA 3MWYW 1FNWA 5IYBH 1HR0L 3TBIB 1JOOA 1XMOQ 1D5ZC 1E1TA 1AE3A 4K14A 2BH8A 2Z6KA 5LMNL 1I4GA 2NN6G 1XTCD 4XYOA 3GTPH 3CCRA 1BOSA 1S5BD 3W1GA 2PZUA 1M90C 1WI5A 5CV7A 3Q23A 2O5JC 5LMNQ 2SNMA 3ICEA 3DMUA 5IOCA 1JB3A 1OTCA 3L0OA 5T1IA 1M1KC 3PIOA 3M4OH 2IWHA 2F0QA 2K4KA 1SE3A 1EQVA 3OMCA 3C2PA 4L6TB 3OOCA 2HIVA 4C56C 4IFDG 4GOPA 3MTSA 3S9WA 2B63H 1AEXA 5IT9c 3S1MB 1TWAB 2RCNA 4A3FH 2F0JA 2A68D 2AMCB 1C4QA 4X66Q 4L8JA 1CTMA 1HZAA 3T1HL 4X3UA 1VQLA 1K0SA 2UXCL 3DEOA 2YYZA 3T1HQ 3E5SA 1CHPD 4TRDA 2UXCQ 1I4RA 1D5XC 3PO3B 2B2UA 5LHY1 1EY7A 1Y1WH 4DV7L 5C4HA 3K81C 5T1GA 2R7ZG 4KY7A 3D6CA 2VQEL 1JWMD 1MJCA 3FVQA 4IZ8A 1IXRA 4WJ4A 4I7ZC 5IP9H 4XQJA 3BG3A 2VQEQ 1X3FA 2WB1E 5HGTA 2B2TC 3PV0A 5ELNA 2A69C 1GOZA 3HOYG 3A8IE 4PNYA 1EWCA 3VR2A 1F77A 4GNXA 3W3AA 4OIJA 1SROA 4DV3Q 5CV9A 3GTKB 5A2QE 1YHQA 2JA5H 1STBA 4P75A 4OWXB 4DV0Q 4ZAIA 4DK6C 1GO3E 3KLSX 5CBAE 2Q8IB 2ZJRA 3KLRA 1EWIA 1Y1VH 5KYLA 1SFOH 1B9NA 3C1FA 1NMFA 3RLOA 5GAEC 4GKKL 2YTYA 1EOVA 2K03A 2V4DA 2ZJQA 3QJYA 4LW1A 3CCJA 3D8GA 2B2VC 3I72A 1XJVA 1WVLA 4GKKQ 3F8TA 2QW7A 1NR4A 4A75A 3M9BA 1HNXQ 4RGOS 2BA0A 5COYA 2KHIA 3RD4A 4ULLA 5ELOA 4AH6A 3AU7A 2B39A 1Z47A 1SNDA 2BE5C 2IY5B 1HH2P 5JEAG 4O2DA 1TKWB 1X65A 3ONAB 1KIXA 1ENAA 1G2SA 2YU9H 5M3FB 4A3DB 2A69D 2AWNA 4TKOB 3WWVA 1F2MA 1TWCH 4K6DA 1UEBA 5C5LA 3NP8A 1L0YB 1VQ4A 4A3FB 2R92B 3NXWA 4EQ5A 1PYSB 4GLAC 3DM3A 4IPGA 3KF8B 4UPAA 1WTVA 1XTDA 2I5LX 3JAME 4JI2L 1EY5A 2WB1G 4DV1Q 4BBSG 4CDDC 1KXLA 1NCVA 5LL6X 4OONA 3CQZB 3G6JB 4DR7L 3H3VH 4JI2Q 1F9RA 3GV3A 2VUMG 4Y52H 3BJUA 3F2BA 4DR7Q 4DA2A 1C7YA 4K5WA 1S3OA 2RVLA 3V05A 2RQXA 1ENFA 1TY2A 2A73B 4C3JH 2EY2A 1I3QB 2F0VA 2BE5D 4NPSA 3BDOA 2RKSA 1DD2A 3MXPA 4FYDA 4YIJA 1YIJA 1QJOA 4JOIA 2CW0C 2PZWA 3TREA 4G7OC 1G6ZA 1GVPA 1EYCA 2IPKD 1DOLA 3OSOA 4UHVA 1ILQA 2NTSA 2VB3X 1IBMQ 4DXFA 1R4PB 4BA1I 2OQKA 1HNZL 4UY8C 2PCFB 2ZTCA 1N32L 2FINB 2PQAB 1MJEA 1PH2A 3CU7A 1HJPA 2BCOA 4X62Q 1HNZQ 1HA5A 1N34L 4JI3L 1HTLD 3HOVG 1AN8A 1KL9A 1SMYC 5DEHA 1I94L 1RCVD 4DV6Q 3N6RA 3GTLH 2CVRA 1VCIA 1N34Q 4IPHA 1AE2A 2K5QA 4A3EH 1X3PA 2IW3A 3IKJA 4M8AA 4DK3C 5I2XA 1I94Q 2NVTH 4HJ8A 1EYGA 1C48A 1GUOA 3J7ZC 3IAYA 3LNNA 3K57A 1B1ZA 1ET9A 2X6GA 5C3EH 5EPLA 5IYDG 1NBWA 5JOBA 2CW0D 1CA6A 2YU9B 1IHZA 2VY3A 4R1JA 1BBWA 1LTAD 4JBJA 1PLFA 2MO1A 1SNCA 4CJ1B 1A8VA 4DNTB 1TWCB 4K0KL 5CV4A 4YHHL 1D7QA 1NE3A 5CR3A 2K33A 1RJTA 3IL8A 2H1EA 3FEWX 4DUZL 1KLUD 4K0KQ 1Q7YC 3MC0B 2XRQD 5I4DA 2D0OA 2AUKA 1A3TA 2EYFA 4DAVA 1KNEA 1FNVA 2JA8G 2L1BA 4FF3A 4DUZQ 1G2TA 3NTKA 1DOKA 4A3IG 3L2PA 1CSQA 1SMYD 5FK9C 1Q8KA 3HZXA 5IGBA 1WOCA 5EKIA 2Z6KC 1RF2D 4OGQC 3S1RB 1E7ZA 1F9QA 2AWOA 4JBMA 3J80i 5ELDA 3P1HA 3SHLA 4RFBA 1B2TA 3CHBD 4A3KG 1TWGH 1SYGA 3S17H 3HOXH 5EAYA 2RSNA 4KI0A 3KBGA 2KEDA 5BN4A 3OHXC 1OO9B 1CUKA 1SLJA 2RCFA 1IL2A 2R93B 5I2YA 1RDPD 1SYBA 1J8IA 2UUBQ 3S15H 4GOPC 4HIKA 1DONA 2WV6D 1Y8PB 1OXUA 4JI1L 1FL0A 4E6IA 3I4MH 3E0JA 1BQQT 3KBXA 4GN5A 4ZKCB 5C44G 3TN2A 5M5XB 4U68A 3VYRA 2CKZB 4KMUC 4LF5L 4O0AA 1YNJC 2LXJA 3VR5A 4JI1Q 4Z9CB 2F4IA 1YBYA 1A2TA 1B3QA 3NE5B 3SEBA 2Q8RE 1H9KA 4KY6A 3J80L 1B50A 1LTGD 2I5HA 3CC7A 4XIGS 4KHVA 2MP1A 1LLRD 2K32A 5DLQE 4EGVA 2LY7A 3BZDB 1PTOF 1IZ6A 3GTLB 4MHEA 4DAPA 4A3EB 4EQPA 2KCNA 2EE1A 3R93A 1VQIA 2NN6I 2N8NA 3D0FA 4RMFA 1SYDA 2QEJC 1RTOA 4X64L 1BVSA 1KDBA 4NW2A 2QF7A 4HCEA 4ZQ3A 3K5OA 2D2CC 1J5EL 4JI7Q 4IOAA 5C3EB 3A5UA 2JA7B 3F2UA 1W3SA 4X64Q 2ZXOA 1WTRA 1I50B 1G91A 1B4OA 1Y8OB 3PF4A 4DAMA 4R4CA 3X3MA 4K8JA 1P8LA 1YEZA 1J5EQ 1TWFB 1EIFA 2VNUD 3RLNA 4GNXC 3MEHA 2HDLA 4QIWE 3J80c 3UDGA 3DHQA 3R2IA 4IFDI 2PQEA 2NVQH 4LUVA 1IBLL 4DV4Q 1YNJD 4NB3A 3CKIB 3TP7A 3VYUA 5J39A 4QUCA 2D5DA 5FJ8H 1IBLQ 4G7HC 4BXXG 4TSSA 4DF7A 2BH2A 3QOLA 3HRZC 1EIYB 1DOMA 2KJXA 3K7AH 3TSSA 1V1PB 2WIIB 4PMBA 4L5RC 2DY7A 3KUPA 1NNXA 1EY8A 1SYEA 1F9PA 1TWGB 4FO2A 2SEBD 3S14H 3HOZH 1I6HH 1E0BA 1O7LA 1Q12A 4HCSA 2DUDA 3BYYB 1X3EA 1HZBA 4LFBQ 1GD7A 4RWSC 1G6PA 1F9SA 4DV2Q 1PXUA 5CC4A 1HUNA 3K8AA 4FXKC 1KRTA 4QCLA 1BKBA 2I0QA 4CDEC 1BBUA 3GV6A 2BDOA 4CDFC 4A3JH 3I4NB 2NB0A 3EIVA 3FKIG 1EQRA 4A93G 2OQ0A 4LF8Q 1EEFD 2K04A 3MAQA 4YWKA 4LF6L 3DLLA 1Q46A 1EOTA 3ZJYC 1UWVA 3MXNA 3S24A 4LF6Q 3GTMB 1SR3A 3PF5A 2K75A 3T53B 3EA6A 1X54A 3KF6A 1PFSA 2JQOA 1OXVA 3K0XA 5FKAC 4QGUA 4CBVA 2JA9A 3TP8A 4FF4A 4LNQA 1MHWC 4BY7H 2HUGA 4IO9A 1KLGD 2F0KA 3T13A 1PMRA 2K50A 5EPJA 1ZXTA 2BA1A 4CDCC 3G48A 1KNAA 5GROA 4JOIC 2PNRC 1SNQA 2L55A 3NQIA 1XNRQ 5C6AA 3CF5A 2CCZA 2A74C 3GTJH 4A3BG 1FVIA 2EYMA 1X3GA 1HFNA 1RODA 1QVFA 5JPNC 4PMWA 4F87A 3MEFA 1TVXA 2EJMA 1MBYA 3NPPA 4A3GG 2NVQB 3BVZA 1OXXK 4K2LA 5IP7H 1KAWA 1LT6D 1BCPF 4JG2A 2UUCL 3VA7A 3DEPA 3UDXA 1Q86C 4MTKA 2KCCA 1JWSD 2IT1A 2CWPA 2LFNA 2B63G 3CCMA 3NBHB 2L5TA 4MIUA 3A56A 2HHHQ 1EZ8A 3TZDA 2IHEA 1KQSA 1TWAH 4WORA 4ZYSA 3BVMA 3Q22A 1VQ9A 4ME5A 5KRUA 2K7VA 1X9NA 1CK1A 2F0WA 3A8JE 1EYAA 3J81j 3H15A 1VF5C 3I56A 3PIP3 4HAEA 5M9OA 1LO5D 2NUCA 1ESRA 3BU2A 2XN9C 1Y1WG 2B3GA 2NWGA 4KLKA 4BA2I 1S40A 4JCVE 2A5HA 1K3RA 1JR0D 2ICIA 4POFA 3E9IA 2F0OA 4Y7NH 4KK7A 4A4IA 2C5CA 2WACA 2Y0SB 3I55A 4V190 5IP9G 1RD9D 3HG9A 3GQBA 5CBEE 2QEXA 2JA6B 4JV5L 3LWUA 1TIID 1NSNS 4DFAA 4DR5Q 1MGSA 4DR6L 2RA4A 2DN8A 5E7NA 4KY5A 1IKLA 3OTOL 2JA5G 2O5IC 4JV5Q 4IFDJ 1CI3M 3OMGA 4DAYA 1E22A 4QMGA 1S4ZA 3GTKH 3CCLA 3A54A 3HS0C 3O13A 4HEDA 4OO1G 3OTOQ 3T1YL 2EDGA 1Y1VG 4NDXA 2ZXPA 3NELA 3G71A 1A63A 1YHBA 3CW2C 3NWSA 4KN7C 3T1YQ 1J6QA 5CV6A 2EY1A 2Z4IA 4RH6A 1HUMA 1SE8A 3GTJB 2F0GA 2YV5A 2NZOA 4YCUA 1XYIA 2PZTA 3PO2G 4G4KA 1HR0Q 1PFNA 4GKJL 3J81i 4C3HG 4A3CG 5M3MB 3SE0A 3BZCA 3RLFA 3GD7A 4DR1L 2JN4A 2Z0SA 2KHSA 5E1FA 2A19A 1VQ6A 2ZT9C 4GKJQ 4B08A 2NVXH 4DR1Q 2LSSA 4A3MG 5J1ZA 1TS5A 4KV6A 4PMCA 3GTQH 1HFGA 4H02A 4K2KA 5M3FH 4A3DH 4C2MB 4IUPA 3W1BA 3HOUG 1L1OB 1PH3A 4UAIA 2Q2IA 3DWQA 1SYFA 1QUQB 1U4MA 3K5MA 1WD1A 2R92H 5FLXL 4JI8L 5BR8L 1PH6A 2NVYH 4IUNA 1TT2A 4BBRH 4Q0FA 3J81L 5ELEA 1A2UA 2FMCA 4JI8Q 3CQZH 1N33L 4ID6A 2RDFA 2MFIA 2F0UA 4KKTA 3VR6A 4FXDA 1FGBD 3I3CA 4C3JG 2WAQB 1B8AA 2R6GA 4Y7NB 1L0XB 3H0GG 2ENBA 1I3QH 1STEA 2Z4HA 4DV7Q 1VQHA 3HKZB 3KLSA 2E2HB 1R4QB 2MQHA 1SSOA 1Q1BA 4L63B 4BY1B 3CCUA 1C9OA 1PTOC 2PI2E 1A62A 5FLXc 2XSCA 4XQNA 1K73C 2X6LA 1QVGA 2F4VL 1S5FD 4JI0L 1OXSC 3J81c 3J7AF 5JJKA 3KF8A 1FNUA 1GUGA 1SJHD 4C3IG 1X32A 2F3VA 2EXZA 5G3LF 1F2ZA 1YNXA 2ZTDA 5IYCG 2F4VQ 4JI0Q 5E3FA 3NHHA 4YWLA 1CKMA 5EKLA 1E24A 3HEJA 4FP5D 3S16B 4ZRZA 2ASBA 2F3WA 1VQPA 1TS3A 3RMHA 4RGNA 1LT3D 4K5XA 2N3SA 3I4LA 5EBCA 5AJ3L 2NBFA 1VS0A 1EWHA 3NQTA 1PFMA 5ISRA 3TDQA 3CCEA 2JJQA 2EZVA 1SXTA 4O42A 1GUWA 2EYHA 3PIPA 2VB2X 3SXHA 2NVXB 2KENA 3GTQB 1IYVA 1QB5D 3RUZA 1EY9A 1O7ZA 4OHJA 3J7YW 4FF1A 3NEMA 4BS9A 4HMJA 3TP6A 5IGGA 1BXTA 2UXBL 4WJ3M 2NVYB 4OIKA 2DNCA 5ELBA 4BBRB 2QDBA 4CJ2C 3Q24A 4B3ML 1VQKA 2J4XA 4AYBB 2B8FA 4ZKBB 5C4XG 1U0LA 2UXBQ 4DGZA 5A2QL 3DWAA 3KDFB 4IFDH 3CCQA 3S1RH 3ITPA 3QIAA 4EX5A 3T4AC 3HOXG 4GNXB 1IL8A 1WCMB 3BDLA 3C46A 4X3KA 1IYJB 5FLMG 3DXJC 5FO9B 3ULPA 2F0SA 5GAGC 2UU9L 1BUVT 3HOWG 4KD4A 1LACA 1A3VA 4X65L 1C0AA 2UU9Q 4PZ8A 2R93H 1JCKB 1EIGA 4QL5A 2EXDA 3I4MG 2RHSB 2RDHA 4X65Q 1VQ5A 4JI6L 1WTOA 3LX0A 3S1QH 2EQSA 1AW7A 4QB4A 5M5XH 3NTHA 1QOHA 4DKAC 1K28A 2F1MA 4JI6Q 1U9RA 4JW0A 4RCOA 2R7ZH 1JORA 3MFGA 2PMZB 1EL0A 3N52A 5LMNW 3G6EA 1N32Q 2H5XA 4HIMA 2G9HD 4R4QA 1GXDC 5E4WC 1QZHA 4CHTB 1XXGA 3HOYH 4DU9A 4JI3Q 5JJLA 1D5MC 3JAML 1CA5A 3SK8A 5AFWA 3MA2B 1YJNA 1BCPC 2B2YC 2LXKA 5GAHC 5C4JH 3TQYA 1LTLA 3M7GA 1DXMA 5C5MA 1HQRD 4L5QA 3NENA 5F2DA 3GTOH 4OELB 1JE4A 4HJ5A 2JA7H 1NY4A 3CMEA 3K5LA 3AB9A 3DUZA 1I50H 3TEHB 1VMCA 1JT8A 4HTHA 2A1AA 1TWHB 1TWFH 3A74A 4LFAL 3K7UC 4J6HA 5HGQA 3J7A5 1TR5A 1VQGA 1VQ7A 5FJ8G 5C0XG 1UE1A 3BS1A 4PG3A 4YHHQ 1F2LA 4B3RL 3U50C 2F0MA 2EJGC 2KEEA 3I73A 1UEAB 5CORA 2B2WA 4B3RQ 2KCTA 3PUYA 1EYDA 2AHOB 1G51A 2L0CA 3HOUB 4KN4C 3HOZG 3PUZA 1T5EA 3H6MA 1XX8A 2OT2A 1BCPD 1I6VC 4F7XA 1PH4A 4RGTA 4R4TA 5I6YA 2UUAL 2VZAA 2R7DA 1B53A 4HJAA 2DY8A 2ID0A 2VL6A 3EQLC 2Q2UA 1AZQA 1MD2D 1B9MA 5EGTA 2L4NA 3M4YA 5M5WB 1L0WA 1MI2A 2HIXA 1II3A 4MTNA 4A3JG 2F52A 1E3PA 5H1SE 1PHJA 3S1QB 2VUMH 2IX0A 3D3RA 5KNDA 2J0TD 3I4NH 2NTTA 4KJOA 5EJWA 1PH7A 3URYA 3T51B 2R7ZB 2B8GA 4OO1I 1U5KA 5DM63 1S5ED 2PI2A 4LF5Q 1F2YA 4ABNA 1V1PA 3PUVA 4IPCA 1T9HA 1O7IA 3GTMH 3QR8A 2VS1A 2M9VA 1PRTF 1W2BA 4F88A 1HQMC 2D9UA 1S5DD 3HOYB 2B2UC 1WJJA 4BY7G 1AZPA 4HSVA 1VQJA 2WAQE 1PZID 5IIFA 2EY6A 5C4JB 2BDNA 3C3LA 2F0HA 2PNHA 2NYZD 1MIUA 3MFYA 4DUYL 2M00A 2JEBI 1SE2A 1IBKL 5D65A 1PA6A 3GTOB 5C3WA 1HNWL 4DK0A 4LF7L 3SK6A 4DUYQ 1QVCA 1IBKQ 1GUTA 2QKIC 2WP8J 3K59A 4K6LA 2MJ8A 1CQVA 5IP7G 4XDXA 4CJ0B 1HNWQ 1A6XA 4LF7Q 1YJWA 3VA5A 2D0PA 2HQEA 4UP9A 1ET6A 2L9HA 4OWWB 2Q2HA 2XGTA 4U673 1FYCA 3H3VI 1BDOA 2SNSA 5JPMC 3G7LA 5DM73 1X56A 5D14A 2KVMA 3W2DA 1JOKA 1LT5D 1SYCA 1SNMA 3ULLA 1SRUA 4PV1C 5C4ZA 1H9JA 1QG7A 1OXTA 5KNBA 2JA8H 4XQQA 4I7AA 2WB1B 3K6OA 4BBSB 5BN5A 5HY6A 3PO3G 1AFPA 5IGFA 4LK1C 1HTPA 1H9SB 3P7JA 5E4XA 2ZXRA 1SDFA 2VUMB 4NP5A 4RHRA 4NKLA 4LJZC 3GTGB 4CKEA 2MGSA 1TS4A 2CHBD 1E1OA 1SJED 4OXPA 1WTPA 4DN4M 2A6EC 4AYBE 2ZTEA 2P5ZX 2K5VA 4JI5L 2JA6H 2JXMB 1U4LA 3Q0AA 3RN5A 1QZGA 1H95A 4DR3L 1WD0A 3DWPA 2F03A 3U4ZA 3VYSA 4JI5Q 1DGSA 4DR3Q 2EYJA 1LT4D 3D4RA 4XTCS 1UE6A 2CH4A 4A3LG 3FRPB 5C44H 4WJWA 4JBWA 3A5ZB 1ML0D 1FR3A 1LTID 5IYBG 3EVQA 4UP8A 3A0JA 2NZ1D 2CH4W 4XXEA 2ZM6L 1MSGA 1HXYD 5KYIA 3HOVB 3K80C 3Q8DA 1XPUA 1C8CA 3EJIA 4IJHA 5G3LD 4HJ7A 1WTQA 5M3MH 4EQOA 2V1CC 1JC7A 1VQEA 1VDZA 3A7AB 1HRJA 1SBBB 2PMZE 1QNKA 4QJFA 4FNFA 3H3VC 5M3FG 4A3DG 2DGYA 3S1NB 4QF4A 3T16A 4LAAA 2YTXA 3TP5A 3U9SA 4C2MH 1H9RA 5L37A 2UUCQ 2ALYB 4H13C 2JYOA 4A3FG 2R92G 2F0FA 2AUJD 1WFQA 5LMUL 4RGMA 1PH5A 4OEMB 3ND9A 3CAMA 4GN3B 5C3XA 4JYAL 2Z8LA 2GN5A 3J7AV 3CPFA 4P2CB 1MSHA 2XIWA 2MNAA 4JYAQ 1S72A 1HA6A 3AMUA 2JP1A 1SNPA 1NJIC 2JA8B 1RHPA 1PH9A 2Z9HA 3CRKC 1NMGA 1HHVA 1UNSA 3A7LA 2OF1A 5J3BA 4Q5VA 4A3IB 3KOJA 2M2LA 5IT9E 4BXXH 3PGZA 3MXNB 1W6KA 5FO8B 1VQOA 1WTWA 2E2IH 3KF6B 3TS0A 3OPOA 2KA7A 4X6AH 1SEBD 4ZUJA 4LUOA 2PO4A 4A3KB 1Q90A 1W6JA 1JQYD 2DJGC 4IUUA 4LUZA 5DNFA 2E2HH 2SOBA 3FDTA 4QUFA 4BY1H 1DZ1A 5IGCA 1VQBA 2B2WC 2F0EA 1L1OA 2YTVA 2RSOA 4PZ6A 4HJ9A 4G7ZC 4R4OA 4DR6Q 5C44B 1CT1D 3SK5A 4IUVA 4A93H 4X3TA 1JICA 3RN2A 4KHPL 2X69A 3JC66 5DAUA 3EFXD 1K8OA 4DV5L 4OX9L 3S16H 4P71A 3EN2A 3M3YH 3VR3A 2PYKA 1RIPA 2XTIA 2VW9A 1Y14B 1D8LA 3V2TA 4DV5Q 4OX9Q 1LTSD 4YY3L 2RDGA 3VDYA 4V0BA 5D3DA 3S2HH 3KYHC 3MXGA 4OWTB 4FF2A 4HSPA 2LKVA 3VYTA 2K14A 4YY3Q 2K5DA 5C0XI 4ZCKA 2Q2TA 2WKCA 3H91A 5J22A 2E5LL 4J8QA 1SMXA 1VMPA 3I70A 5D3IB 4UDUC 2AKWB 3TMEA 4A3BH 2E5LQ 3BVGA 1STNA 3ULJA 3IFTA 4MZ9A 3HGBA 2E2DC 4FXGC 4A3GH 2K5HA 1CKNB 3M4PA 1PYBA 1BCPB 1PV4A 5EKKA 3I2ZA 3PQIA 5EBDA 2HCIA 2K05A 3L7ZC 5BR8Q 1R9TB 1U4PA 4X66L 4H0LC 1JOQA 2C35B 3E3XA 3QB3A 3RZDH 1LTTD 2E2IB 2XWJB 3U9OA 2F0LA 1D6EC 1WCMH 4DAYB 1N33Q 2A8VA 3GP7A 1KAAA 4ODGA 1YNNC 1JJ2A 1UAPA 4R8NA 1PH8A 4KTAA 4IUTA 3STBC 2E2JB 5KGUA 2L12A 4QY7A 2R93G 3PUXA 1IYUA 1ENCA 3MZ5A 3CP0A 1PRTC 3RZOH 3FPUB 5JEAJ 2FMMA 4N9TA 2OTLA 2AQ3B 2XVSA 4J1MA 4L5SA 1STGA 3WDNA 5K36H 2K28A 3AFPA 3SK4A 1WTXA 1GUNA 3GO5A 2KOLA 3FKIB 4RKBA 4A93B 4GZYC 3S2DH 1KD1C 3T56B 5JJZA 5KNCA 4HIOA 4DPGA 3H09A 4MN3A 4WFN3 1N8RC 2KUMA 3KDFA 4DV3L 2NZHA 3M85A 2L15A 5CMDA 5NUCA 1PH1A 4IURA 2MHVA 1SAPA 3NSWA 4A3EG 4DV0L 4CKCA 2CFMA 3A8KE 3M3YB 4JI4L 3FHWA 1I5FA 1LABA 2E76C 4NXNL 4QIWB 2ICEC 2JK8A 4GOPB 2MPMA 2E8GA 1Y8NB 3AEVA 4H7BA 4JI4Q 1YNND 3S2HB 1BNZA 4NXNQ 2VQFL 4OO1H 1GHJA 1CM9A 3STBD 1RTNA 5C3EG 2D62A 1EIHA 2JA7G 1I4QA
chains in the Genus database with same CATH topology
1K8MA 4K5VA 2PW7A 3NWTA 1PRTD 1PTOD 3WOFA 3SDZA 3GTPB 4BWGB 4A3BB 3D4DA 4XYQA 2IX3A 3SVMA 1S5CD 2NN6H 1ZKOA 4DK1A 4A3GB 2IL8A 3I91A 2H4OA 2Q8TA 3M4OB 1IKMA 1ZYRC 1UUPA 4KD3A 2DNEA 2TSSA 2SDFA 4F8MA 2VXWA 5EQ0A 3ZYYX 2B63B 4X3SA 4PQXA 3RZDB 2JSOA 2WKDA 1CHQD 1Z6HA 1ZEQX 1BF4A 3UI2A 1EFID 5ELFA 1M4VA 2FJ2A 5LL6S 3K58A 2RBMA 1G291 3RZOB 4CGYB 4S3SA 4HMIA 1Y1WB 1NAPA 1CQFA 5ELCA 4HR7B 1V43A 3S2DB 1DM0B 2PW5A 5C0XJ 1QWYA 4RCNA 2LS01 4XT3B 1ZYRD 3D4WA 1EEID 3FMCA 3NK9A 2EJFC 3KK7A 3E6ZX 5FO7B 4ZUIA 5KEEA 3OWEB 1U4RA 5CV5A 2JA5B 5JVG3 3CRLC 2N88A 2XRSD 4KKUA 1GUSA 4XT1B 3M7NA 5I9PA 1Y1VB 1SFOB 5EPKA 4R8IA 2K1BA 2F0NA 1T5XD 4RKLA 3I90A 2XNAC 3ERQA 1EY4A 3R8BA 4RHSA 4EQNA 5HURA 3PO2B 3A55A 4C3HB 5CGKA 1B44D 4NMZA 1TS2A 5JEAH 4DXGA 3J80E 1DJRD 2E75C 1STHA 4A3MB 1V8QA 3K5NA 5K5PA 2AQ1B 3MHBA 2F0PA 5I6WA 2IX1A 1ICWA 1EY0A 1BBXC 3VR4A 1D1KA 3NTIA 1Q8IA 1E2VA 4M1UB 2I46A 1DCZA 1LTBD 1TQOA 4C1NK 1CFMA 3X3NA 2EVBA 4C1NI 3NUCA 4R9WA 4C3JB 3BDCA 1G8ZD 3H0GB 1K83B 1NUCA 1JWUD 3PUWA 1STAA 3H94A 5IGDA 2L11A 1EU3A 4KHZA 3R3OA 3L3OC 2EPBA 1E2ZA 5TSSA 1Y69U 2BOSA 4N9PA 3D31A 2F0TA 2WINB 1Z7TA 3EROA 1KDCA 4C3IB 3MVVA 1D2BA 1KTKA 1GHKA 2QILA 4CKBA 2EOTA 1H9SA 4HN7A 2HDMA 1PTOH 4IN3A 2NVTB 3QOJA 3OIQA 2OEOA 4RA8A 1EU4A 1CZWA 1DYQA 1QILA 4RAUC 2R3ZA 3I8ZA 4B9XA 2K5WA 1FD7D 3Q6SA 4FVMA 3C1EA 2G9DA 3P75A 2O4XA 1LV9A 2F0DA 1M8AA 1I4XA 1B3AA 5IODA 1GJXA 5C0XH 2FFKB 1ESFA 1VF7A 1AP0A 3HP3A 1TY0A 1SE4A 2B2TA 4DNRB 5C4XB 1IW7C 1PZJD 2KECA 3OIPA 1KDAA 2K6AA 1RKNA 2AQ2B 2QCPX 3OW7A 3S17B 3HOXB 5M5YB 1O7YA 3IFDA 3PIO3 1PFBA 3NBHA 3HOWB 2XWBB 5KIXA 5CYUA 4IQZA 3S15B 3QWNA 3FPPA 1BO0A 2B2VA 4KKSA 4H44C 3I4MB 1EY6A 1O78A 1E2WA 4OL7A 3MXUA 5I9OA 2Z1CA 4ZLTF 2K01A 2C9OA 4ILWA 1QE6A 3D6WA 1NR2A 2FHTA 1A3UA 1IW7D 1PRTB 1QNUA 3PMFA 1PTOB 1EQTA 4KJNA 2EYLA 4JK1C 2N55A 5FOBB 5CV8A 2TMPA 2MUYA 2HCCA 4IUQA 3WOEA 2A6ED 4IALA 4K8IA 1ONLA 1SNOA 2J7ZA 1I4HA 1O80A 1PDQA 1CZGA 4WRDA 2JE6I 1BR9A 1I4PA 1A15A 2PPBC 1ILPA 2A6HC 1LTRD 4LMQD 1V1OA 2EYPA 4B9WA 3QO2A 4O1NA 2OXPA 3K7AB 3K0YA 3LWEA 2EYOA 5IGEA 3S14B 1D1IA 3HOZB 1I6HB 3NBIA 4G57A 1QCBD 2CQAA 2I07B 1H9MA 5JVH3 2LMCB 1TU2B 1KABA 1STYA 5K36G 3P20A 1EZ6A 4A3JB 1J9OA 1XWEA 2GA4B 2B2YA 2A6HD 2IJ0A 2JEAI 3V96A 3ND8A 1Q1EA 2E74C 5FLXE 1Q3LA 4I65A 3SR1A 1X3QA 2R61A 2KQ3A 2EY5A 3J81E 4EVOA 3QG1A 4TQUS 5JAVA 3OWFA 1PYWD 4ZK9B 2A68C 2O2LD 1PZKD 4BY7B 3BYTB 3DM1A 1HCZA 5A35A 1HPCA 5BN3A 3TZUA 3L9AX 2F0IA 5IT9L 3R2TA 3MWYW 1FNWA 3TBIB 1JOOA 1D5ZC 4K14A 1I4GA 2NN6G 1XTCD 4XYOA 1BOSA 1S5BD 2PZUA 5CV7A 3Q23A 2O5JC 2SNMA 3DMUA 5IOCA 1JB3A 5T1IA 2IWHA 2F0QA 1SE3A 1EQVA 3OMCA 3C2PA 4L6TB 3OOCA 4C56C 4IFDG 3MTSA 3S9WA 1AEXA 3S1MB 1TWAB 2F0JA 2A68D 1C4QA 4L8JA 1CTMA 4X3UA 3DEOA 2YYZA 3E5SA 1CHPD 4TRDA 1I4RA 1D5XC 3PO3B 2B2UA 5LHY1 1EY7A 5C4HA 5T1GA 4KY7A 3D6CA 1JWMD 3FVQA 4IZ8A 4I7ZC 4XQJA 3BG3A 5HGTA 2B2TC 3PV0A 2A69C 1GOZA 3A8IE 4PNYA 1EWCA 3VR2A 1F77A 3W3AA 4OIJA 5CV9A 3GTKB 5A2QE 1STBA 4ZAIA 3KLSX 5CBAE 2Q8IB 3KLRA 5KYLA 1B9NA 3C1FA 2V4DA 2K03A 3QJYA 3D8GA 2B2VC 3I72A 1WVLA 1NR4A 4RGOS 2BA0A 5COYA 3RD4A 4ULLA 3AU7A 2B39A 1Z47A 1SNDA 2BE5C 5JEAG 1TKWB 3ONAB 1ENAA 1G2SA 5M3FB 4A3DB 2A69D 2AWNA 4TKOB 1F2MA 4K6DA 5C5LA 3NP8A 1L0YB 4A3FB 2R92B 3NXWA 1WTVA 3JAME 1EY5A 1NCVA 5LL6X 3CQZB 3G6JB 1F9RA 3GV3A 4DA2A 4K5WA 2RVLA 3V05A 2RQXA 1ENFA 1TY2A 2A73B 2EY2A 1I3QB 2F0VA 2BE5D 3BDOA 2RKSA 1DD2A 3MXPA 4FYDA 4YIJA 1QJOA 2CW0C 2PZWA 1G6ZA 4G7OC 1EYCA 2IPKD 1DOLA 3OSOA 1ILQA 2NTSA 2VB3X 4DXFA 1R4PB 4BA1I 2PCFB 2FINB 3CU7A 2BCOA 1HA5A 1HTLD 1AN8A 1SMYC 5DEHA 1RCVD 3N6RA 2CVRA 1VCIA 2K5QA 1X3PA 2IW3A 3IKJA 4M8AA 5I2XA 1C48A 1GUOA 3IAYA 3LNNA 3K57A 1B1ZA 1ET9A 2X6GA 5EPLA 5JOBA 2CW0D 1CA6A 2YU9B 1IHZA 1LTAD 1PLFA 1SNCA 4CJ1B 4DNTB 1TWCB 5CV4A 5CR3A 2K33A 1RJTA 3IL8A 2H1EA 3FEWX 1KLUD 3MC0B 2XRQD 5I4DA 2AUKA 1A3TA 2EYFA 4DAVA 1KNEA 1FNVA 2L1BA 4FF3A 1G2TA 3NTKA 1DOKA 1SMYD 5FK9C 3HZXA 5IGBA 5EKIA 1RF2D 4OGQC 3S1RB 1F9QA 2AWOA 5ELDA 3P1HA 3SHLA 4RFBA 1B2TA 3CHBD 1SYGA 2RSNA 4KI0A 3KBGA 2KEDA 5BN4A 3OHXC 1OO9B 2R93B 5I2YA 1RDPD 1SYBA 1J8IA 1DONA 2WV6D 1Y8PB 1OXUA 4E6IA 3E0JA 1BQQT 3KBXA 4ZKCB 3TN2A 5M5XB 4U68A 3VYRA 4KMUC 1YNJC 3VR5A 4Z9CB 2F4IA 1A2TA 3NE5B 3SEBA 2Q8RE 1H9KA 4KY6A 3J80L 1B50A 1LTGD 4XIGS 4KHVA 2MP1A 1LLRD 2K32A 4EGVA 2LY7A 3BZDB 1PTOF 3GTLB 4MHEA 4DAPA 4A3EB 4EQPA 2KCNA 2EE1A 3R93A 2NN6I 1SYDA 2QEJC 1RTOA 1KDBA 4NW2A 2QF7A 4HCEA 4ZQ3A 3K5OA 2D2CC 5C3EB 2JA7B 3F2UA 2ZXOA 1WTRA 1I50B 1G91A 1B4OA 1Y8OB 3X3MA 4K8JA 2VNUD 1TWFB 3MEHA 2HDLA 4IFDI 3DHQA 3R2IA 2PQEA 1YNJD 3VYUA 3CKIB 3TP7A 5J39A 4QUCA 2D5DA 4G7HC 4TSSA 4DF7A 3QOLA 3HRZC 1DOMA 2KJXA 3TSSA 1V1PB 2WIIB 4PMBA 2DY7A 3KUPA 1EY8A 1SYEA 1F9PA 1TWGB 4FO2A 2SEBD 1E0BA 1O7LA 1Q12A 4HCSA 3BYYB 4RWSC 1F9SA 1PXUA 5CC4A 1HUNA 4FXKC 4QCLA 3GV6A 2BDOA 3I4NB 2NB0A 1EEFD 2K04A 3MAQA 1EOTA 3MXNA 3GTMB 3T53B 3EA6A 1OXVA 5FKAC 4CBVA 3TP8A 4FF4A 2HUGA 1KLGD 2F0KA 3T13A 1PMRA 5EPJA 1ZXTA 2BA1A 1KNAA 2PNRC 1SNQA 2L55A 3NQIA 5C6AA 2A74C 2EYMA 1HFNA 1RODA 5JPNC 4PMWA 4F87A 1TVXA 2EJMA 1MBYA 3NPPA 2NVQB 3BVZA 1OXXK 4K2LA 1LT6D 1BCPF 3VA7A 3DEPA 2KCCA 1JWSD 2IT1A 2LFNA 2L5TA 4MIUA 3A56A 1EZ8A 3TZDA 4WORA 4ZYSA 3BVMA 3Q22A 4ME5A 5KRUA 2K7VA 1CK1A 2F0WA 3A8JE 1EYAA 1VF5C 3PIP3 4HAEA 5M9OA 1LO5D 2NUCA 1ESRA 2XN9C 2NWGA 4BA2I 2A5HA 1JR0D 2ICIA 2F0OA 4KK7A 2C5CA 2WACA 2Y0SB 4V190 1RD9D 3HG9A 3GQBA 5CBEE 2JA6B 3LWUA 1TIID 1NSNS 4DFAA 1MGSA 2RA4A 2DN8A 4KY5A 1IKLA 2O5IC 4IFDJ 1CI3M 3OMGA 4DAYA 4QMGA 1S4ZA 4OO1G 3A54A 3HS0C 3O13A 4HEDA 2EDGA 4NDXA 2ZXPA 3NWSA 4KN7C 5CV6A 2EY1A 2Z4IA 4RH6A 1HUMA 3GTJB 2F0GA 1XYIA 2PZTA 4G4KA 1PFNA 4C3HG 5M3MB 3SE0A 3RLFA 3GD7A 2KHSA 5E1FA 2ZT9C 4B08A 5J1ZA 1TS5A 4KV6A 4PMCA 1HFGA 4K2KA 4C2MB 4IUPA 4UAIA 3DWQA 1SYFA 1U4MA 3K5MA 1WD1A 5FLXL 4IUNA 1TT2A 4Q0FA 3J81L 5ELEA 1A2UA 2FMCA 4ID6A 2RDFA 2F0UA 4KKTA 3VR6A 4FXDA 1FGBD 3I3CA 4C3JG 2WAQB 2R6GA 4Y7NB 1L0XB 2ENBA 1STEA 2Z4HA 2E2HB 3HKZB 3KLSA 1R4QB 1SSOA 1Q1BA 4L63B 4BY1B 1PTOC 2XSCA 4XQNA 2X6LA 1S5FD 1OXSC 3J7AF 3KF8A 1FNUA 1GUGA 1SJHD 4C3IG 1X32A 2F3VA 2EXZA 5G3LF 1F2ZA 5E3FA 3NHHA 5EKLA 3HEJA 4FP5D 3S16B 4ZRZA 2F3WA 1TS3A 3RMHA 4RGNA 1LT3D 4K5XA 3I4LA 5EBCA 2NBFA 1EWHA 3NQTA 1PFMA 5ISRA 3TDQA 2EZVA 1SXTA 4O42A 1GUWA 2EYHA 2VB2X 3SXHA 2NVXB 3GTQB 1IYVA 1QB5D 3RUZA 1EY9A 1O7ZA 4OHJA 3J7YW 4FF1A 4BS9A 4HMJA 3TP6A 5IGGA 1BXTA 2NVYB 4OIKA 2DNCA 5ELBA 4BBRB 2QDBA 4CJ2C 3Q24A 2J4XA 4AYBB 2B8FA 4ZKBB 4DGZA 5A2QL 3DWAA 4IFDH 3ITPA 3QIAA 3T4AC 1IL8A 1WCMB 3BDLA 3C46A 4X3KA 3DXJC 5FO9B 2F0SA 1BUVT 4KD4A 1LACA 1A3VA 1JCKB 1EIGA 2RDHA 1WTOA 3LX0A 1AW7A 4QB4A 3NTHA 1QOHA 2F1MA 1U9RA 4RCOA 1JORA 3MFGA 2PMZB 1EL0A 3N52A 2G9HD 1GXDC 5E4WC 4CHTB 1XXGA 4DU9A 1D5MC 3JAML 1CA5A 3SK8A 5AFWA 3MA2B 1BCPC 2B2YC 3M7GA 1DXMA 5C5MA 1HQRD 5F2DA 1JE4A 3K5LA 3AB9A 3DUZA 1VMCA 4HTHA 1TWHB 4J6HA 1TR5A 5C0XG 3BS1A 1F2LA 2F0MA 2EJGC 2KEEA 3I73A 1UEAB 5CORA 2B2WA 3PUYA 1EYDA 2L0CA 3HOUB 4KN4C 3PUZA 1T5EA 3H6MA 1XX8A 2OT2A 1BCPD 1I6VC 4F7XA 4RGTA 5I6YA 1B53A 2DY8A 2ID0A 3EQLC 1AZQA 1MD2D 1B9MA 5EGTA 2L4NA 3M4YA 5M5WB 1MI2A 1II3A 3S1QB 2IX0A 3D3RA 5KNDA 2J0TD 2NTTA 4KJOA 5EJWA 3URYA 3T51B 2R7ZB 2B8GA 4OO1I 5DM63 1S5ED 1F2YA 4ABNA 1V1PA 3PUVA 2M9VA 1PRTF 4F88A 1HQMC 2D9UA 1S5DD 3HOYB 2B2UC 1AZPA 4HSVA 1PZID 5IIFA 2EY6A 5C4JB 2BDNA 3C3LA 2F0HA 2NYZD 3MFYA 2M00A 2JEBI 1SE2A 5D65A 3GTOB 5C3WA 4DK0A 3SK6A 1GUTA 2QKIC 2WP8J 3K59A 4K6LA 2MJ8A 1CQVA 4XDXA 4CJ0B 1A6XA 3VA5A 2HQEA 1ET6A 2L9HA 4U673 1FYCA 1BDOA 2SNSA 5JPMC 3G7LA 5DM73 5D14A 2KVMA 3W2DA 1JOKA 1LT5D 1SYCA 1SNMA 4PV1C 5C4ZA 1H9JA 1QG7A 1OXTA 5KNBA 4XQQA 2WB1B 3K6OA 4BBSB 5BN5A 1AFPA 5IGFA 4LK1C 1HTPA 1H9SB 3P7JA 5E4XA 2ZXRA 1SDFA 2VUMB 4NP5A 4RHRA 4NKLA 4LJZC 3GTGB 4CKEA 2MGSA 1TS4A 2CHBD 1SJED 1WTPA 4DN4M 2A6EC 2JXMB 1U4LA 3Q0AA 1WD0A 3DWPA 2F03A 3VYSA 2EYJA 1LT4D 3D4RA 4XTCS 3FRPB 4WJWA 4JBWA 1ML0D 1FR3A 1LTID 3EVQA 2NZ1D 4XXEA 1MSGA 1HXYD 5KYIA 3HOVB 1C8CA 3EJIA 5G3LD 1WTQA 4EQOA 1JC7A 1VDZA 3A7AB 1HRJA 1SBBB 1QNKA 4FNFA 3H3VC 3S1NB 4QF4A 3T16A 4LAAA 3TP5A 3U9SA 1H9RA 4H13C 2JYOA 2F0FA 2AUJD 4RGMA 3ND9A 5C3XA 2Z8LA 3J7AV 4P2CB 1MSHA 2XIWA 1HA6A 3AMUA 2JP1A 1SNPA 2JA8B 1RHPA 3CRKC 1HHVA 1UNSA 3A7LA 2OF1A 4Q5VA 4A3IB 5IT9E 2M2LA 1W6KA 5FO8B 1WTWA 3OPOA 2KA7A 1SEBD 4ZUJA 2PO4A 4A3KB 1Q90A 1W6JA 1JQYD 4IUUA 5DNFA 2SOBA 3FDTA 4QUFA 1DZ1A 5IGCA 2B2WC 2F0EA 2RSOA 4G7ZC 5C44B 1CT1D 3SK5A 4IUVA 4X3TA 1JICA 2X69A 5DAUA 3EFXD 1K8OA 3VR3A 2PYKA 3V2TA 1LTSD 2RDGA 4V0BA 5D3DA 3MXGA 4FF2A 4HSPA 2LKVA 3VYTA 2K5DA 5C0XI 2WKCA 3H91A 5J22A 4J8QA 1VMPA 3I70A 5D3IB 4UDUC 3TMEA 3BVGA 1STNA 3IFTA 3HGBA 2E2DC 4FXGC 1BCPB 5EKKA 5EBDA 2HCIA 2K05A 3L7ZC 1R9TB 1U4PA 4H0LC 1JOQA 3QB3A 1LTTD 2E2IB 2XWJB 3U9OA 2F0LA 1D6EC 3GP7A 1KAAA 4ODGA 1YNNC 1UAPA 4R8NA 4KTAA 4IUTA 2E2JB 5KGUA 2L12A 3PUXA 1IYUA 1ENCA 3MZ5A 1PRTC 3FPUB 5JEAJ 2FMMA 4N9TA 2AQ3B 2XVSA 4J1MA 1STGA 3WDNA 5K36H 2K28A 1WTXA 3SK4A 1GUNA 3GO5A 2KOLA 3FKIB 4RKBA 4A93B 4GZYC 3T56B 5JJZA 5KNCA 3H09A 4MN3A 4WFN3 2KUMA 3M85A 5CMDA 5NUCA 4IURA 2MHVA 1SAPA 3NSWA 4CKCA 3A8KE 3M3YB 1LABA 2E76C 4QIWB 2ICEC 2MPMA 1Y8NB 4H7BA 1YNND 3S2HB 1BNZA 4OO1H 1GHJA 1CM9A 1RTNA 1EIHA 2D62A 1I4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MXP A;  2QDB A;  4K5V A;  3MVV A;  4YIJ A;  2F0M A;  5M9O A;  2PW7 A;  5J22 A;  2NUC A;  1A2U A;  1SYB A;  2PZW A;  4I65 A;  5CC4 A;  5HGT A;  4QF4 A;  3SR1 A;  4DGZ A;  1EYC A;  3T16 A;  2F0N A;  4LAA A;  3OSO A;  4ID6 A;  2KQ3 A;  2SNS A;  2RDF A;  4PNY A;  4RKL A;  2EY5 A;  1A3U A;  3TME A;  4EVO A;  2F0U A;  1EYD A;  3PMF A;  4E6I A;  1STN A;  3ITP A;  5JAV A;  2F0F A;  3ERQ A;  1EY4 A;  3D4D A;  3OWF A;  4KJN A;  2EYL A;  3QOJ A;  5CV9 A;  1JOK A;  1STB A;  1SYC A;  2F0O A;  3BDL A;  4EQN A;  3H6M A;  5C3X A;  4F7X A;  1SNM A;  2OEO A;  5HUR A;  2WAC A;  2F0S A;  5C4Z A;  5I6Y A;  5CV8 A;  2ENB A;  5CGK A;  1A2T A;  4KD4 A;  2F0I A;  4KY6 A;  1A3V A;  5EKK A;  5KYL A;  3C1F A;  4KHV A;  4IAL A;  4KD3 A;  1NSN S;  1SNP A;  4NMZ A;  4DFA A;  4K8I A;  1JOO A;  4F8M A;  5DEH A;  5EGT A;  1SNO A;  2OF1 A;  3D8G A;  1STH A;  4K14 A;  4B9X A;  1JOQ A;  4KY5 A;  5IGF A;  1II3 A;  3LX0 A;  3QB3 A;  4EQP A;  3OMG A;  3TP5 A;  3C1E A;  4QB4 A;  4WRD A;  4NP5 A;  3P75 A;  4QMG A;  5K5P A;  2O4X A;  3MHB A;  3U9O A;  2F0P A;  2F0D A;  2F0L A;  4NKL A;  3TP8 A;  2PZU A;  1KAA A;  5CV7 A;  1SYD A;  4KJO A;  4ODG A;  2SNM A;  2F0K A;  1U9R A;  4R8N A;  4ZUJ A;  3T13 A;  2F3V A;  1KDB A;  2EXZ A;  3DMU A;  1F2Z A;  4KTA A;  4NDX A;  5I6W A;  5IOC A;  1JOR A;  1SND A;  5KGU A;  4ZQ3 A;  5E3F A;  1EY0 A;  3NHH A;  5EKL A;  2EYP A;  4B9W A;  2F0Q A;  2SOB A;  3HEJ A;  1SNQ A;  5JOB A;  1EQV A;  3OMC A;  1ENA A;  5CV6 A;  1ENC A;  2EY1 A;  1F2Y A;  3MZ5 A;  5C6A A;  5I9O A;  1IHZ A;  2RBM A;  5IGC A;  2F3W A;  2OXP A;  2F0E A;  4K8J A;  4N9T A;  1F2M A;  2F0G A;  1SNC A;  3S9W A;  4J1M A;  2EYM A;  4K6D A;  5C5L A;  5CV4 A;  1AEX A;  4DU9 A;  2EYO A;  3MEH A;  3NP8 A;  1TQO A;  2PZT A;  1KDA A;  4HMI A;  1STG A;  3DHQ A;  1RKN A;  4K5X A;  2EYJ A;  4S3S A;  5CR3 A;  2F0J A;  3SK8 A;  2PQE A;  3SK4 A;  5IGE A;  3NXW A;  5IIF A;  3NUC A;  4K2L A;  3SK5 A;  2EY6 A;  3TP7 A;  4RKB A;  3NQT A;  5C5M A;  1A3T A;  3BDC A;  2F0H A;  2KHS A;  4G57 A;  5E1F A;  2EYF A;  5ISR A;  5J39 A;  2PW5 A;  3EVQ A;  1EY5 A;  2M00 A;  5F2D A;  2EYH A;  1NUC A;  3D4W A;  3NK9 A;  5DAU A;  1STA A;  3SXH A;  5C3W A;  5IGD A;  5J1Z A;  5IOD A;  4DF7 A;  5NUC A;  4PMC A;  4KV6 A;  5KIX A;  1KAB A;  3E5S A;  3QOL A;  3R3O A;  4K2K A;  4ZUI A;  4HTH A;  5KYI A;  3HZX A;  5IGB A;  4TRD A;  1STY A;  4MIU A;  3SK6 A;  5KEE A;  3RUZ A;  2PYK A;  1EY9 A;  1EZ6 A;  1EZ8 A;  4N9P A;  1EY6 A;  4J6H A;  3V2T A;  1EY7 A;  4PMB A;  3EJI A;  5CV5 A;  3P1H A;  3SHL A;  4WOR A;  1SYF A;  1TR5 A;  5C4H A;  4K5W A;  1EY8 A;  2F0T A;  4H7B A;  1SYE A;  4ME5 A;  5KRU A;  1SYG A;  4EQO A;  4HMJ A;  4KY7 A;  3TP6 A;  3D6C A;  3VA5 A;  5IGG A;  2EY2 A;  2F0W A;  2LKV A;  1EYA A;  2F0V A;  3ERO A;  4IUN A;  4OL7 A;  1KDC A;  2HQE A;  1TT2 A;  4IZ8 A;  2RKS A;  5I9P A; 
#chains in the Genus database with same CATH topology
 1K8M A;  4K5V A;  2PW7 A;  1K8A C;  4DR4 L;  3NWT A;  5AJ3 Q;  4GN4 B;  1HNX L;  2VQF Q;  1PRT D;  1PTO D;  3WOF A;  4LF9 L;  1YHA A;  2RHQ B;  1RL2 A;  1TWH H;  4JC0 A;  3SDZ A;  3GTP B;  4BWG B;  4DR4 Q;  4A3B B;  3D4D A;  4XYQ A;  2IX3 A;  2PQA A;  3SVM A;  4LF9 Q;  1S5C D;  3TRZ A;  2NN6 H;  3UDF A;  3PO2 H;  4ALP A;  1ZKO A;  4C3H H;  4A3C H;  4DK1 A;  1K3B C;  4GLV B;  4A3G B;  2IL8 A;  2ATW A;  3I91 A;  2H4O A;  2Q8T A;  2QA4 A;  3M4O B;  1IKM A;  1ZYR C;  1UUP A;  4KD3 A;  2DNE A;  2TSS A;  2SDF A;  4F8M A;  2VXW A;  3U4V A;  5EQ0 A;  3ZYY X;  4A3M H;  3ER0 A;  4A76 A;  1K9M C;  2B63 B;  2OCE A;  4X3S A;  4B3M Q;  1XMQ L;  4PQX A;  4TVA B;  1CSP A;  3RZD B;  2JSO A;  2WKD A;  3AQQ A;  3HOU H;  4DV1 L;  1CHQ D;  2HQL A;  1Z6H A;  2KCM A;  1ZEQ X;  1BF4 A;  1XPR A;  1XMQ Q;  2K5N A;  3UI2 A;  1EFI D;  5ELF A;  4LFC L;  1M4V A;  2FJ2 A;  5LL6 S;  1LM0 A;  1XNQ L;  4L5T A;  3K58 A;  3JAM i;  2OWO A;  1HZC A;  2B29 A;  2RBM A;  1G29 1;  3RZO B;  4LFC Q;  1YVC A;  4CGY B;  5M5W H;  4N8X 1;  3I4N G;  1XNQ Q;  4S3S A;  4HMI A;  3UE1 A;  1Y1W B;  5JJI A;  1NAP A;  1CQF A;  2CWA A;  5ELC A;  1YIT A;  4HR7 B;  5IE8 A;  1HR0 W;  1V43 A;  3S2D B;  1DM0 B;  3H0G H;  2PW5 A;  5C0X J;  1Q81 C;  1QWY A;  4RCN A;  1K83 H;  2LS0 1;  3CMA A;  4XT3 B;  1ZYR D;  3D4W A;  1EEI D;  3FMC A;  3NK9 A;  2EJF C;  3KK7 A;  1IBM L;  2DJF C;  4FDB A;  2K52 A;  3E6Z X;  1N9W A;  4ZUI A;  5FO7 B;  4LWC A;  1XPO A;  5KEE A;  3OWE B;  1U4R A;  1AH9 A;  2G5D A;  5CV5 A;  3G4S A;  4X62 L;  2JA5 B;  3CCV A;  5JVG 3;  3CRL C;  2N88 A;  2Y0S E;  1Q82 C;  3CXC A;  2XRS D;  4DV6 L;  4C3I H;  4KKU A;  1GUS A;  4XT1 B;  3M7N A;  5I9P A;  5IYC H;  1Y1V B;  1SFO B;  5EPK A;  4R8I A;  2K1B A;  1L1O C;  2F0N A;  1T5X D;  4RKL A;  3I90 A;  4LF4 L;  2XNA C;  1VQC A;  1EY4 A;  3ERQ A;  3R8B A;  4RHS A;  4EQN A;  5HUR A;  2F3I A;  1CKO A;  1MKH A;  4AQY L;  3PO2 B;  3A55 A;  2ZJP A;  4C3H B;  4LFA Q;  5GAD C;  1YJ9 A;  1L2F A;  5CGK A;  4LF4 Q;  1FGU A;  1B44 D;  1B70 B;  1EUJ A;  2EIF A;  5IWA L;  1K8G A;  4AQY Q;  3JAM c;  4NMZ A;  1TS2 A;  5JEA H;  4DXG A;  3J80 E;  1DJR D;  2E75 C;  1STH A;  4A3M B;  1V8Q A;  5IWA Q;  3K5N A;  4APV A;  5K5P A;  2AQ1 B;  3MHB A;  1LUZ A;  2F0P A;  1VQD A;  3KFU A;  5I6W A;  4IOC A;  2IX1 A;  2RF4 A;  1ICW A;  1EY0 A;  1BBX C;  4P73 A;  3SGI A;  3VR4 A;  1D1K A;  3NTI A;  1Q8I A;  1E2V A;  4M1U B;  3KJO A;  2UUA Q;  4BBS H;  2I46 A;  1DCZ A;  1LTB D;  5C4X H;  1JJG A;  4GLX A;  1ICF B;  3OYY A;  1TQO A;  1TXY A;  4C1N K;  1CFM A;  2Y0S G;  3X3N A;  2UXD L;  2EVB A;  4C1N I;  4YCV A;  3GTG H;  1JMC A;  3NUC A;  4R9W A;  4C3J B;  3E0E A;  5M5Y H;  2UUB L;  2JA6 G;  3BDC A;  5FLM H;  1G8Z D;  3H0G B;  2UXD Q;  1K83 B;  3HOW H;  1NUC A;  1JWU D;  2HD3 A;  1STA A;  3H94 A;  2R7F A;  3PUW A;  5IGD A;  2L11 A;  1EU3 A;  3LGJ A;  3PCO B;  4KHZ A;  3R3O A;  4IJL A;  3L3O C;  4AIM A;  2EPB A;  1E2Z A;  5TSS A;  1Y69 U;  2QGQ A;  2BOS A;  4N9P A;  3D31 A;  1X6O A;  3ERS X;  1YZ6 A;  3W5O A;  2F0T A;  2WIN B;  1Z7T A;  3ERO A;  1KDC A;  4C3I B;  3CCS A;  3HKZ E;  3MVV A;  1D2B A;  1KTK A;  1N36 L;  1GHK A;  2QIL A;  4CKB A;  2EOT A;  1H9S A;  4HN7 A;  3HOV H;  4UP7 A;  5IY0 A;  2HDM A;  1N36 Q;  1PTO H;  3F1Z A;  4IN3 A;  5M3M G;  4JI7 L;  2NVT B;  3QOJ A;  2GVB A;  3OIQ A;  2OEO A;  1FJG L;  4RA8 A;  1EU4 A;  4B3T L;  3AYH B;  1CZW A;  3PSI A;  3HKS A;  4P72 A;  4POG A;  2WFW A;  2CQO A;  1DYQ A;  1FJG Q;  1QIL A;  4RAU C;  2R3Z A;  4B3T Q;  3I8Z A;  3S1N H;  4HID A;  5IYD H;  4P74 A;  2K5W A;  4B9X A;  4DV4 L;  1FD7 D;  4QQB X;  3Q6S A;  1ASZ A;  4FVM A;  3C1E A;  1VQA A;  2G9D A;  3P75 A;  2O4X A;  1LV9 A;  2F0D A;  1M8A A;  1I4X A;  1WTH A;  1B3A A;  5IOD A;  1GJX A;  4DR2 L;  5C0X H;  2FFK B;  1ESF A;  5GQO A;  4B3S L;  1GM5 A;  1JJC B;  1VF7 A;  1VQ8 A;  4DR2 Q;  1AP0 A;  3HP3 A;  1TY0 A;  1SE4 A;  2B2T A;  4IPD A;  1LYL A;  4A3I H;  2Z6B A;  4DNR B;  5C4X B;  4B3S Q;  1IW7 C;  1K0R A;  3FP9 A;  1PZJ D;  2KEC A;  2WAQ G;  3OIP A;  1KDA A;  2K6A A;  1V9P A;  1RKN A;  2AQ2 B;  1WYD A;  1EQQ A;  1VQN A;  4LFB L;  2QCP X;  3OW7 A;  3S17 B;  4DV2 L;  3HOX B;  3HKZ G;  2QDL A;  5M5Y B;  4A3K H;  2GVA A;  1O7Y A;  3IFD A;  4BY1 G;  3PIO 3;  1NTG A;  3GDE A;  2ES2 A;  3HFZ B;  1PFB A;  3NBH A;  3KJP A;  2XWB B;  3HOW B;  1Z9F A;  3B6Y A;  5KIX A;  5CYU A;  4IQZ A;  3S15 B;  1X55 A;  3QWN A;  4LF8 L;  1KRS A;  1KHI A;  2FXQ A;  2KBN A;  1BO0 A;  2B2V A;  3FPP A;  4KKS A;  4YCW A;  4N8F A;  4H44 C;  3F2C A;  3I4M B;  1EY6 A;  4J15 A;  1O78 A;  1EFW A;  1E2W A;  3F2D A;  2HT1 A;  4PZ7 A;  4OL7 A;  3MXU A;  2IHF A;  5I9O A;  2Z1C A;  4ZLT F;  2K01 A;  1UE5 A;  2KHJ A;  2C9O A;  4ILW A;  1QE6 A;  3D6W A;  1NR2 A;  2FHT A;  3UDI A;  1A3U A;  1IW7 D;  1PRT B;  4JBK A;  1QNU A;  3PMF A;  1PTO B;  3RNU A;  1EQT A;  4KJN A;  2EYL A;  2ZM6 Q;  1A0I A;  4DNI A;  4JK1 C;  2N55 A;  5FOB B;  1XNR L;  5CV8 A;  2TMP A;  1GKH A;  2MUY A;  3KLW A;  1YI2 A;  2HCC A;  4IUQ A;  3WOE A;  2A6E D;  4IAL A;  4K8I A;  1ONL A;  1SNO A;  2J7Z A;  3I7F A;  1I4H A;  1O80 A;  1PDQ A;  1CZG A;  4WRD A;  4JVZ A;  2JE6 I;  3EBE A;  1BR9 A;  3U58 A;  1I4P A;  4NXM L;  1A15 A;  3E9H A;  4BBR G;  2PPB C;  1ILP A;  2A6H C;  1LTR D;  4LMQ D;  1V1O A;  4AYB G;  5LMU Q;  3CD6 A;  2HHH L;  1B7Y B;  1SN8 A;  2EYP A;  4B9W A;  3QO2 A;  4NXM Q;  2N49 A;  4O1N A;  2OXP A;  1R9T H;  3K7A B;  3K0Y A;  1VQM A;  3LWE A;  1WCM G;  2EYO A;  3S1M H;  1UE7 A;  5IGE A;  3S14 B;  3TS2 A;  1D1I A;  3HOZ B;  3OW2 A;  1I6H B;  3NBI A;  4JPB W;  4G57 A;  1QCB D;  2CQA A;  2I07 B;  2E2J H;  1H9M A;  4YWM A;  3M4Q A;  5JVH 3;  2OTJ A;  2LMC B;  4GS3 A;  1TU2 B;  2MO0 A;  1KAB A;  1STY A;  2I5M X;  3UE0 A;  4RG1 A;  5K36 G;  3PO3 H;  3P20 A;  1ASY A;  1EZ6 A;  1PVO A;  1QUQ A;  4A3J B;  1CKN A;  1J9O A;  1XWE A;  1KC8 C;  2GA4 B;  3BZK A;  3RR5 A;  2B2Y A;  4R4I A;  1V1Q A;  4DR5 L;  3FKI H;  3CPW A;  2A6H D;  2IJ0 A;  2JEA I;  3V96 A;  3ND8 A;  1Q1E A;  1VQF A;  2N78 A;  2E74 C;  1P16 A;  4ME3 A;  5FLX E;  1Q3L A;  4I65 A;  3SR1 A;  1X3Q A;  3AFQ A;  2R61 A;  2KQ3 A;  2EY5 A;  3J81 E;  4KHP Q;  4EVO A;  3I4O A;  3QG1 A;  4TQU S;  5JAV A;  3CC2 A;  3OWF A;  1PYW D;  4ZK9 B;  2A68 C;  2O2L D;  1PZK D;  4BY7 B;  1HZ9 A;  4MNO A;  1JB7 A;  3IRB A;  3BYT B;  3CC4 A;  3DM1 A;  4A3L H;  1HCZ A;  5A35 A;  1XMO L;  1HPC A;  5BN3 A;  3TZU A;  3L9A X;  2F0I A;  5IT9 L;  1JE5 A;  3R2T A;  3MWY W;  1FNW A;  5IYB H;  1HR0 L;  3TBI B;  1JOO A;  1XMO Q;  1D5Z C;  1E1T A;  1AE3 A;  4K14 A;  2BH8 A;  2Z6K A;  5LMN L;  1I4G A;  2NN6 G;  1XTC D;  4XYO A;  3GTP H;  3CCR A;  1BOS A;  1S5B D;  3W1G A;  2PZU A;  1M90 C;  1WI5 A;  5CV7 A;  3Q23 A;  2O5J C;  5LMN Q;  2SNM A;  3ICE A;  3DMU A;  5IOC A;  1JB3 A;  1OTC A;  3L0O A;  5T1I A;  1M1K C;  3PIO A;  3M4O H;  2IWH A;  2F0Q A;  2K4K A;  1SE3 A;  1EQV A;  3OMC A;  3C2P A;  4L6T B;  3OOC A;  2HIV A;  4C56 C;  4IFD G;  4GOP A;  3MTS A;  3S9W A;  2B63 H;  1AEX A;  5IT9 c;  3S1M B;  1TWA B;  2RCN A;  4A3F H;  2F0J A;  2A68 D;  2AMC B;  1C4Q A;  4X66 Q;  4L8J A;  1CTM A;  1HZA A;  3T1H L;  4X3U A;  1VQL A;  1K0S A;  2UXC L;  3DEO A;  2YYZ A;  3T1H Q;  3E5S A;  1CHP D;  4TRD A;  2UXC Q;  1I4R A;  1D5X C;  3PO3 B;  2B2U A;  5LHY 1;  1EY7 A;  1Y1W H;  4DV7 L;  5C4H A;  3K81 C;  5T1G A;  2R7Z G;  4KY7 A;  3D6C A;  2VQE L;  1JWM D;  1MJC A;  3FVQ A;  4IZ8 A;  1IXR A;  4WJ4 A;  4I7Z C;  5IP9 H;  4XQJ A;  3BG3 A;  2VQE Q;  1X3F A;  2WB1 E;  5HGT A;  2B2T C;  3PV0 A;  5ELN A;  2A69 C;  1GOZ A;  3HOY G;  3A8I E;  4PNY A;  1EWC A;  3VR2 A;  1F77 A;  4GNX A;  3W3A A;  4OIJ A;  1SRO A;  4DV3 Q;  5CV9 A;  3GTK B;  5A2Q E;  1YHQ A;  2JA5 H;  1STB A;  4P75 A;  4OWX B;  4DV0 Q;  4ZAI A;  4DK6 C;  1GO3 E;  3KLS X;  5CBA E;  2Q8I B;  2ZJR A;  3KLR A;  1EWI A;  1Y1V H;  5KYL A;  1SFO H;  1B9N A;  3C1F A;  1NMF A;  3RLO A;  5GAE C;  4GKK L;  2YTY A;  1EOV A;  2K03 A;  2V4D A;  2ZJQ A;  3QJY A;  4LW1 A;  3CCJ A;  3D8G A;  2B2V C;  3I72 A;  1XJV A;  1WVL A;  4GKK Q;  3F8T A;  2QW7 A;  1NR4 A;  4A75 A;  3M9B A;  1HNX Q;  4RGO S;  2BA0 A;  5COY A;  2KHI A;  3RD4 A;  4ULL A;  5ELO A;  4AH6 A;  3AU7 A;  2B39 A;  1Z47 A;  1SND A;  2BE5 C;  2IY5 B;  1HH2 P;  5JEA G;  4O2D A;  1TKW B;  1X65 A;  3ONA B;  1KIX A;  1ENA A;  1G2S A;  2YU9 H;  5M3F B;  4A3D B;  2A69 D;  2AWN A;  4TKO B;  3WWV A;  1F2M A;  1TWC H;  4K6D A;  1UEB A;  5C5L A;  3NP8 A;  1L0Y B;  1VQ4 A;  4A3F B;  2R92 B;  3NXW A;  4EQ5 A;  1PYS B;  4GLA C;  3DM3 A;  4IPG A;  3KF8 B;  4UPA A;  1WTV A;  1XTD A;  2I5L X;  3JAM E;  4JI2 L;  1EY5 A;  2WB1 G;  4DV1 Q;  4BBS G;  4CDD C;  1KXL A;  1NCV A;  5LL6 X;  4OON A;  3CQZ B;  3G6J B;  4DR7 L;  3H3V H;  4JI2 Q;  1F9R A;  3GV3 A;  2VUM G;  4Y52 H;  3BJU A;  3F2B A;  4DR7 Q;  4DA2 A;  1C7Y A;  4K5W A;  1S3O A;  2RVL A;  3V05 A;  2RQX A;  1ENF A;  1TY2 A;  2A73 B;  4C3J H;  2EY2 A;  1I3Q B;  2F0V A;  2BE5 D;  4NPS A;  3BDO A;  2RKS A;  1DD2 A;  3MXP A;  4FYD A;  4YIJ A;  1YIJ A;  1QJO A;  4JOI A;  2CW0 C;  2PZW A;  3TRE A;  4G7O C;  1G6Z A;  1GVP A;  1EYC A;  2IPK D;  1DOL A;  3OSO A;  4UHV A;  1ILQ A;  2NTS A;  2VB3 X;  1IBM Q;  4DXF A;  1R4P B;  4BA1 I;  2OQK A;  1HNZ L;  4UY8 C;  2PCF B;  2ZTC A;  1N32 L;  2FIN B;  2PQA B;  1MJE A;  1PH2 A;  3CU7 A;  1HJP A;  2BCO A;  4X62 Q;  1HNZ Q;  1HA5 A;  1N34 L;  4JI3 L;  1HTL D;  3HOV G;  1AN8 A;  1KL9 A;  1SMY C;  5DEH A;  1I94 L;  1RCV D;  4DV6 Q;  3N6R A;  3GTL H;  2CVR A;  1VCI A;  1N34 Q;  4IPH A;  1AE2 A;  2K5Q A;  4A3E H;  1X3P A;  2IW3 A;  3IKJ A;  4M8A A;  4DK3 C;  5I2X A;  1I94 Q;  2NVT H;  4HJ8 A;  1EYG A;  1C48 A;  1GUO A;  3J7Z C;  3IAY A;  3LNN A;  3K57 A;  1B1Z A;  1ET9 A;  2X6G A;  5C3E H;  5EPL A;  5IYD G;  1NBW A;  5JOB A;  2CW0 D;  1CA6 A;  2YU9 B;  1IHZ A;  2VY3 A;  4R1J A;  1BBW A;  1LTA D;  4JBJ A;  1PLF A;  2MO1 A;  1SNC A;  4CJ1 B;  1A8V A;  4DNT B;  1TWC B;  4K0K L;  5CV4 A;  4YHH L;  1D7Q A;  1NE3 A;  5CR3 A;  2K33 A;  1RJT A;  3IL8 A;  2H1E A;  3FEW X;  4DUZ L;  1KLU D;  4K0K Q;  1Q7Y C;  3MC0 B;  2XRQ D;  5I4D A;  2D0O A;  2AUK A;  1A3T A;  2EYF A;  4DAV A;  1KNE A;  1FNV A;  2JA8 G;  2L1B A;  4FF3 A;  4DUZ Q;  1G2T A;  3NTK A;  1DOK A;  4A3I G;  3L2P A;  1CSQ A;  1SMY D;  5FK9 C;  1Q8K A;  3HZX A;  5IGB A;  1WOC A;  5EKI A;  2Z6K C;  1RF2 D;  4OGQ C;  3S1R B;  1E7Z A;  1F9Q A;  2AWO A;  4JBM A;  3J80 i;  5ELD A;  3P1H A;  3SHL A;  4RFB A;  1B2T A;  3CHB D;  4A3K G;  1TWG H;  1SYG A;  3S17 H;  3HOX H;  5EAY A;  2RSN A;  4KI0 A;  3KBG A;  2KED A;  5BN4 A;  3OHX C;  1OO9 B;  1CUK A;  1SLJ A;  2RCF A;  1IL2 A;  2R93 B;  5I2Y A;  1RDP D;  1SYB A;  1J8I A;  2UUB Q;  3S15 H;  4GOP C;  4HIK A;  1DON A;  2WV6 D;  1Y8P B;  1OXU A;  4JI1 L;  1FL0 A;  4E6I A;  3I4M H;  3E0J A;  1BQQ T;  3KBX A;  4GN5 A;  4ZKC B;  5C44 G;  3TN2 A;  5M5X B;  4U68 A;  3VYR A;  2CKZ B;  4KMU C;  4LF5 L;  4O0A A;  1YNJ C;  2LXJ A;  3VR5 A;  4JI1 Q;  4Z9C B;  2F4I A;  1YBY A;  1A2T A;  1B3Q A;  3NE5 B;  3SEB A;  2Q8R E;  1H9K A;  4KY6 A;  3J80 L;  1B50 A;  1LTG D;  2I5H A;  3CC7 A;  4XIG S;  4KHV A;  2MP1 A;  1LLR D;  2K32 A;  5DLQ E;  4EGV A;  2LY7 A;  3BZD B;  1PTO F;  1IZ6 A;  3GTL B;  4MHE A;  4DAP A;  4A3E B;  4EQP A;  2KCN A;  2EE1 A;  3R93 A;  1VQI A;  2NN6 I;  2N8N A;  3D0F A;  4RMF A;  1SYD A;  2QEJ C;  1RTO A;  4X64 L;  1BVS A;  1KDB A;  4NW2 A;  2QF7 A;  4HCE A;  4ZQ3 A;  3K5O A;  2D2C C;  1J5E L;  4JI7 Q;  4IOA A;  5C3E B;  3A5U A;  2JA7 B;  3F2U A;  1W3S A;  4X64 Q;  2ZXO A;  1WTR A;  1I50 B;  1G91 A;  1B4O A;  1Y8O B;  3PF4 A;  4DAM A;  4R4C A;  3X3M A;  4K8J A;  1P8L A;  1YEZ A;  1J5E Q;  1TWF B;  1EIF A;  2VNU D;  3RLN A;  4GNX C;  3MEH A;  2HDL A;  4QIW E;  3J80 c;  3UDG A;  3DHQ A;  3R2I A;  4IFD I;  2PQE A;  2NVQ H;  4LUV A;  1IBL L;  4DV4 Q;  1YNJ D;  4NB3 A;  3CKI B;  3TP7 A;  3VYU A;  5J39 A;  4QUC A;  2D5D A;  5FJ8 H;  1IBL Q;  4G7H C;  4BXX G;  4TSS A;  4DF7 A;  2BH2 A;  3QOL A;  3HRZ C;  1EIY B;  1DOM A;  2KJX A;  3K7A H;  3TSS A;  1V1P B;  2WII B;  4PMB A;  4L5R C;  2DY7 A;  3KUP A;  1NNX A;  1EY8 A;  1SYE A;  1F9P A;  1TWG B;  4FO2 A;  2SEB D;  3S14 H;  3HOZ H;  1I6H H;  1E0B A;  1O7L A;  1Q12 A;  4HCS A;  2DUD A;  3BYY B;  1X3E A;  1HZB A;  4LFB Q;  1GD7 A;  4RWS C;  1G6P A;  1F9S A;  4DV2 Q;  1PXU A;  5CC4 A;  1HUN A;  3K8A A;  4FXK C;  1KRT A;  4QCL A;  1BKB A;  2I0Q A;  4CDE C;  1BBU A;  3GV6 A;  2BDO A;  4CDF C;  4A3J H;  3I4N B;  2NB0 A;  3EIV A;  3FKI G;  1EQR A;  4A93 G;  2OQ0 A;  4LF8 Q;  1EEF D;  2K04 A;  3MAQ A;  4YWK A;  4LF6 L;  3DLL A;  1Q46 A;  1EOT A;  3ZJY C;  1UWV A;  3MXN A;  3S24 A;  4LF6 Q;  3GTM B;  1SR3 A;  3PF5 A;  2K75 A;  3T53 B;  3EA6 A;  1X54 A;  3KF6 A;  1PFS A;  2JQO A;  1OXV A;  3K0X A;  5FKA C;  4QGU A;  4CBV A;  2JA9 A;  3TP8 A;  4FF4 A;  4LNQ A;  1MHW C;  4BY7 H;  2HUG A;  4IO9 A;  1KLG D;  2F0K A;  3T13 A;  1PMR A;  2K50 A;  5EPJ A;  1ZXT A;  2BA1 A;  4CDC C;  3G48 A;  1KNA A;  5GRO A;  4JOI C;  2PNR C;  1SNQ A;  2L55 A;  3NQI A;  1XNR Q;  5C6A A;  3CF5 A;  2CCZ A;  2A74 C;  3GTJ H;  4A3B G;  1FVI A;  2EYM A;  1X3G A;  1HFN A;  1ROD A;  1QVF A;  5JPN C;  4PMW A;  4F87 A;  3MEF A;  1TVX A;  2EJM A;  1MBY A;  3NPP A;  4A3G G;  2NVQ B;  3BVZ A;  1OXX K;  4K2L A;  5IP7 H;  1KAW A;  1LT6 D;  1BCP F;  4JG2 A;  2UUC L;  3VA7 A;  3DEP A;  3UDX A;  1Q86 C;  4MTK A;  2KCC A;  1JWS D;  2IT1 A;  2CWP A;  2LFN A;  2B63 G;  3CCM A;  3NBH B;  2L5T A;  4MIU A;  3A56 A;  2HHH Q;  1EZ8 A;  3TZD A;  2IHE A;  1KQS A;  1TWA H;  4WOR A;  4ZYS A;  3BVM A;  3Q22 A;  1VQ9 A;  4ME5 A;  5KRU A;  2K7V A;  1X9N A;  1CK1 A;  2F0W A;  3A8J E;  1EYA A;  3J81 j;  3H15 A;  1VF5 C;  3I56 A;  3PIP 3;  4HAE A;  5M9O A;  1LO5 D;  2NUC A;  1ESR A;  3BU2 A;  2XN9 C;  1Y1W G;  2B3G A;  2NWG A;  4KLK A;  4BA2 I;  1S40 A;  4JCV E;  2A5H A;  1K3R A;  1JR0 D;  2ICI A;  4POF A;  3E9I A;  2F0O A;  4Y7N H;  4KK7 A;  4A4I A;  2C5C A;  2WAC A;  2Y0S B;  3I55 A;  4V19 0;  5IP9 G;  1RD9 D;  3HG9 A;  3GQB A;  5CBE E;  2QEX A;  2JA6 B;  4JV5 L;  3LWU A;  1TII D;  1NSN S;  4DFA A;  4DR5 Q;  1MGS A;  4DR6 L;  2RA4 A;  2DN8 A;  5E7N A;  4KY5 A;  1IKL A;  3OTO L;  2JA5 G;  2O5I C;  4JV5 Q;  4IFD J;  1CI3 M;  3OMG A;  4DAY A;  1E22 A;  4QMG A;  1S4Z A;  3GTK H;  3CCL A;  3A54 A;  3HS0 C;  3O13 A;  4HED A;  4OO1 G;  3OTO Q;  3T1Y L;  2EDG A;  1Y1V G;  4NDX A;  2ZXP A;  3NEL A;  3G71 A;  1A63 A;  1YHB A;  3CW2 C;  3NWS A;  4KN7 C;  3T1Y Q;  1J6Q A;  5CV6 A;  2EY1 A;  2Z4I A;  4RH6 A;  1HUM A;  1SE8 A;  3GTJ B;  2F0G A;  2YV5 A;  2NZO A;  4YCU A;  1XYI A;  2PZT A;  3PO2 G;  4G4K A;  1HR0 Q;  1PFN A;  4GKJ L;  3J81 i;  4C3H G;  4A3C G;  5M3M B;  3SE0 A;  3BZC A;  3RLF A;  3GD7 A;  4DR1 L;  2JN4 A;  2Z0S A;  2KHS A;  5E1F A;  2A19 A;  1VQ6 A;  2ZT9 C;  4GKJ Q;  4B08 A;  2NVX H;  4DR1 Q;  2LSS A;  4A3M G;  5J1Z A;  1TS5 A;  4KV6 A;  4PMC A;  3GTQ H;  1HFG A;  4H02 A;  4K2K A;  5M3F H;  4A3D H;  4C2M B;  4IUP A;  3W1B A;  3HOU G;  1L1O B;  1PH3 A;  4UAI A;  2Q2I A;  3DWQ A;  1SYF A;  1QUQ B;  1U4M A;  3K5M A;  1WD1 A;  2R92 H;  5FLX L;  4JI8 L;  5BR8 L;  1PH6 A;  2NVY H;  4IUN A;  1TT2 A;  4BBR H;  4Q0F A;  3J81 L;  5ELE A;  1A2U A;  2FMC A;  4JI8 Q;  3CQZ H;  1N33 L;  4ID6 A;  2RDF A;  2MFI A;  2F0U A;  4KKT A;  3VR6 A;  4FXD A;  1FGB D;  3I3C A;  4C3J G;  2WAQ B;  1B8A A;  2R6G A;  4Y7N B;  1L0X B;  3H0G G;  2ENB A;  1I3Q H;  1STE A;  2Z4H A;  4DV7 Q;  1VQH A;  3HKZ B;  3KLS A;  2E2H B;  1R4Q B;  2MQH A;  1SSO A;  1Q1B A;  4L63 B;  4BY1 B;  3CCU A;  1C9O A;  1PTO C;  2PI2 E;  1A62 A;  5FLX c;  2XSC A;  4XQN A;  1K73 C;  2X6L A;  1QVG A;  2F4V L;  1S5F D;  4JI0 L;  1OXS C;  3J81 c;  3J7A F;  5JJK A;  3KF8 A;  1FNU A;  1GUG A;  1SJH D;  4C3I G;  1X32 A;  2F3V A;  2EXZ A;  5G3L F;  1F2Z A;  1YNX A;  2ZTD A;  5IYC G;  2F4V Q;  4JI0 Q;  5E3F A;  3NHH A;  4YWL A;  1CKM A;  5EKL A;  1E24 A;  3HEJ A;  4FP5 D;  3S16 B;  4ZRZ A;  2ASB A;  2F3W A;  1VQP A;  1TS3 A;  3RMH A;  4RGN A;  1LT3 D;  4K5X A;  2N3S A;  3I4L A;  5EBC A;  5AJ3 L;  2NBF A;  1VS0 A;  1EWH A;  3NQT A;  1PFM A;  5ISR A;  3TDQ A;  3CCE A;  2JJQ A;  2EZV A;  1SXT A;  4O42 A;  1GUW A;  2EYH A;  3PIP A;  2VB2 X;  3SXH A;  2NVX B;  2KEN A;  3GTQ B;  1IYV A;  1QB5 D;  3RUZ A;  1EY9 A;  1O7Z A;  4OHJ A;  3J7Y W;  4FF1 A;  3NEM A;  4BS9 A;  4HMJ A;  3TP6 A;  5IGG A;  1BXT A;  2UXB L;  4WJ3 M;  2NVY B;  4OIK A;  2DNC A;  5ELB A;  4BBR B;  2QDB A;  4CJ2 C;  3Q24 A;  4B3M L;  1VQK A;  2J4X A;  4AYB B;  2B8F A;  4ZKB B;  5C4X G;  1U0L A;  2UXB Q;  4DGZ A;  5A2Q L;  3DWA A;  3KDF B;  4IFD H;  3CCQ A;  3S1R H;  3ITP A;  3QIA A;  4EX5 A;  3T4A C;  3HOX G;  4GNX B;  1IL8 A;  1WCM B;  3BDL A;  3C46 A;  4X3K A;  1IYJ B;  5FLM G;  3DXJ C;  5FO9 B;  3ULP A;  2F0S A;  5GAG C;  2UU9 L;  1BUV T;  3HOW G;  4KD4 A;  1LAC A;  1A3V A;  4X65 L;  1C0A A;  2UU9 Q;  4PZ8 A;  2R93 H;  1JCK B;  1EIG A;  4QL5 A;  2EXD A;  3I4M G;  2RHS B;  2RDH A;  4X65 Q;  1VQ5 A;  4JI6 L;  1WTO A;  3LX0 A;  3S1Q H;  2EQS A;  1AW7 A;  4QB4 A;  5M5X H;  3NTH A;  1QOH A;  4DKA C;  1K28 A;  2F1M A;  4JI6 Q;  1U9R A;  4JW0 A;  4RCO A;  2R7Z H;  1JOR A;  3MFG A;  2PMZ B;  1EL0 A;  3N52 A;  5LMN W;  3G6E A;  1N32 Q;  2H5X A;  4HIM A;  2G9H D;  4R4Q A;  1GXD C;  5E4W C;  1QZH A;  4CHT B;  1XXG A;  3HOY H;  4DU9 A;  4JI3 Q;  5JJL A;  1D5M C;  3JAM L;  1CA5 A;  3SK8 A;  5AFW A;  3MA2 B;  1YJN A;  1BCP C;  2B2Y C;  2LXK A;  5GAH C;  5C4J H;  3TQY A;  1LTL A;  3M7G A;  1DXM A;  5C5M A;  1HQR D;  4L5Q A;  3NEN A;  5F2D A;  3GTO H;  4OEL B;  1JE4 A;  4HJ5 A;  2JA7 H;  1NY4 A;  3CME A;  3K5L A;  3AB9 A;  3DUZ A;  1I50 H;  3TEH B;  1VMC A;  1JT8 A;  4HTH A;  2A1A A;  1TWH B;  1TWF H;  3A74 A;  4LFA L;  3K7U C;  4J6H A;  5HGQ A;  3J7A 5;  1TR5 A;  1VQG A;  1VQ7 A;  5FJ8 G;  5C0X G;  1UE1 A;  3BS1 A;  4PG3 A;  4YHH Q;  1F2L A;  4B3R L;  3U50 C;  2F0M A;  2EJG C;  2KEE A;  3I73 A;  1UEA B;  5COR A;  2B2W A;  4B3R Q;  2KCT A;  3PUY A;  1EYD A;  2AHO B;  1G51 A;  2L0C A;  3HOU B;  4KN4 C;  3HOZ G;  3PUZ A;  1T5E A;  3H6M A;  1XX8 A;  2OT2 A;  1BCP D;  1I6V C;  4F7X A;  1PH4 A;  4RGT A;  4R4T A;  5I6Y A;  2UUA L;  2VZA A;  2R7D A;  1B53 A;  4HJA A;  2DY8 A;  2ID0 A;  2VL6 A;  3EQL C;  2Q2U A;  1AZQ A;  1MD2 D;  1B9M A;  5EGT A;  2L4N A;  3M4Y A;  5M5W B;  1L0W A;  1MI2 A;  2HIX A;  1II3 A;  4MTN A;  4A3J G;  2F52 A;  1E3P A;  5H1S E;  1PHJ A;  3S1Q B;  2VUM H;  2IX0 A;  3D3R A;  5KND A;  2J0T D;  3I4N H;  2NTT A;  4KJO A;  5EJW A;  1PH7 A;  3URY A;  3T51 B;  2R7Z B;  2B8G A;  4OO1 I;  1U5K A;  5DM6 3;  1S5E D;  2PI2 A;  4LF5 Q;  1F2Y A;  4ABN A;  1V1P A;  3PUV A;  4IPC A;  1T9H A;  1O7I A;  3GTM H;  3QR8 A;  2VS1 A;  2M9V A;  1PRT F;  1W2B A;  4F88 A;  1HQM C;  2D9U A;  1S5D D;  3HOY B;  2B2U C;  1WJJ A;  4BY7 G;  1AZP A;  4HSV A;  1VQJ A;  2WAQ E;  1PZI D;  5IIF A;  2EY6 A;  5C4J B;  2BDN A;  3C3L A;  2F0H A;  2PNH A;  2NYZ D;  1MIU A;  3MFY A;  4DUY L;  2M00 A;  2JEB I;  1SE2 A;  1IBK L;  5D65 A;  1PA6 A;  3GTO B;  5C3W A;  1HNW L;  4DK0 A;  4LF7 L;  3SK6 A;  4DUY Q;  1QVC A;  1IBK Q;  1GUT A;  2QKI C;  2WP8 J;  3K59 A;  4K6L A;  2MJ8 A;  1CQV A;  5IP7 G;  4XDX A;  4CJ0 B;  1HNW Q;  1A6X A;  4LF7 Q;  1YJW A;  3VA5 A;  2D0P A;  2HQE A;  4UP9 A;  1ET6 A;  2L9H A;  4OWW B;  2Q2H A;  2XGT A;  4U67 3;  1FYC A;  3H3V I;  1BDO A;  2SNS A;  5JPM C;  3G7L A;  5DM7 3;  1X56 A;  5D14 A;  2KVM A;  3W2D A;  1JOK A;  1LT5 D;  1SYC A;  1SNM A;  3ULL A;  1SRU A;  4PV1 C;  5C4Z A;  1H9J A;  1QG7 A;  1OXT A;  5KNB A;  2JA8 H;  4XQQ A;  4I7A A;  2WB1 B;  3K6O A;  4BBS B;  5BN5 A;  5HY6 A;  3PO3 G;  1AFP A;  5IGF A;  4LK1 C;  1HTP A;  1H9S B;  3P7J A;  5E4X A;  2ZXR A;  1SDF A;  2VUM B;  4NP5 A;  4RHR A;  4NKL A;  4LJZ C;  3GTG B;  4CKE A;  2MGS A;  1TS4 A;  2CHB D;  1E1O A;  1SJE D;  4OXP A;  1WTP A;  4DN4 M;  2A6E C;  4AYB E;  2ZTE A;  2P5Z X;  2K5V A;  4JI5 L;  2JA6 H;  2JXM B;  1U4L A;  3Q0A A;  3RN5 A;  1QZG A;  1H95 A;  4DR3 L;  1WD0 A;  3DWP A;  2F03 A;  3U4Z A;  3VYS A;  4JI5 Q;  1DGS A;  4DR3 Q;  2EYJ A;  1LT4 D;  3D4R A;  4XTC S;  1UE6 A;  2CH4 A;  4A3L G;  3FRP B;  5C44 H;  4WJW A;  4JBW A;  3A5Z B;  1ML0 D;  1FR3 A;  1LTI D;  5IYB G;  3EVQ A;  4UP8 A;  3A0J A;  2NZ1 D;  2CH4 W;  4XXE A;  2ZM6 L;  1MSG A;  1HXY D;  5KYI A;  3HOV B;  3K80 C;  3Q8D A;  1XPU A;  1C8C A;  3EJI A;  4IJH A;  5G3L D;  4HJ7 A;  1WTQ A;  5M3M H;  4EQO A;  2V1C C;  1JC7 A;  1VQE A;  1VDZ A;  3A7A B;  1HRJ A;  1SBB B;  2PMZ E;  1QNK A;  4QJF A;  4FNF A;  3H3V C;  5M3F G;  4A3D G;  2DGY A;  3S1N B;  4QF4 A;  3T16 A;  4LAA A;  2YTX A;  3TP5 A;  3U9S A;  4C2M H;  1H9R A;  5L37 A;  2UUC Q;  2ALY B;  4H13 C;  2JYO A;  4A3F G;  2R92 G;  2F0F A;  2AUJ D;  1WFQ A;  5LMU L;  4RGM A;  1PH5 A;  4OEM B;  3ND9 A;  3CAM A;  4GN3 B;  5C3X A;  4JYA L;  2Z8L A;  2GN5 A;  3J7A V;  3CPF A;  4P2C B;  1MSH A;  2XIW A;  2MNA A;  4JYA Q;  1S72 A;  1HA6 A;  3AMU A;  2JP1 A;  1SNP A;  1NJI C;  2JA8 B;  1RHP A;  1PH9 A;  2Z9H A;  3CRK C;  1NMG A;  1HHV A;  1UNS A;  3A7L A;  2OF1 A;  5J3B A;  4Q5V A;  4A3I B;  3KOJ A;  2M2L A;  5IT9 E;  4BXX H;  3PGZ A;  3MXN B;  1W6K A;  5FO8 B;  1VQO A;  1WTW A;  2E2I H;  3KF6 B;  3TS0 A;  3OPO A;  2KA7 A;  4X6A H;  1SEB D;  4ZUJ A;  4LUO A;  2PO4 A;  4A3K B;  1Q90 A;  1W6J A;  1JQY D;  2DJG C;  4IUU A;  4LUZ A;  5DNF A;  2E2H H;  2SOB A;  3FDT A;  4QUF A;  4BY1 H;  1DZ1 A;  5IGC A;  1VQB A;  2B2W C;  2F0E A;  1L1O A;  2YTV A;  2RSO A;  4PZ6 A;  4HJ9 A;  4G7Z C;  4R4O A;  4DR6 Q;  5C44 B;  1CT1 D;  3SK5 A;  4IUV A;  4A93 H;  4X3T A;  1JIC A;  3RN2 A;  4KHP L;  2X69 A;  3JC6 6;  5DAU A;  3EFX D;  1K8O A;  4DV5 L;  4OX9 L;  3S16 H;  4P71 A;  3EN2 A;  3M3Y H;  3VR3 A;  2PYK A;  1RIP A;  2XTI A;  2VW9 A;  1Y14 B;  1D8L A;  3V2T A;  4DV5 Q;  4OX9 Q;  1LTS D;  4YY3 L;  2RDG A;  3VDY A;  4V0B A;  5D3D A;  3S2H H;  3KYH C;  3MXG A;  4OWT B;  4FF2 A;  4HSP A;  2LKV A;  3VYT A;  2K14 A;  4YY3 Q;  2K5D A;  5C0X I;  4ZCK A;  2Q2T A;  2WKC A;  3H91 A;  5J22 A;  2E5L L;  4J8Q A;  1SMX A;  1VMP A;  3I70 A;  5D3I B;  4UDU C;  2AKW B;  3TME A;  4A3B H;  2E5L Q;  3BVG A;  1STN A;  3ULJ A;  3IFT A;  4MZ9 A;  3HGB A;  2E2D C;  4FXG C;  4A3G H;  2K5H A;  1CKN B;  3M4P A;  1PYB A;  1BCP B;  1PV4 A;  5EKK A;  3I2Z A;  3PQI A;  5EBD A;  2HCI A;  2K05 A;  3L7Z C;  5BR8 Q;  1R9T B;  1U4P A;  4X66 L;  4H0L C;  1JOQ A;  2C35 B;  3E3X A;  3QB3 A;  3RZD H;  1LTT D;  2E2I B;  2XWJ B;  3U9O A;  2F0L A;  1D6E C;  1WCM H;  4DAY B;  1N33 Q;  2A8V A;  3GP7 A;  1KAA A;  4ODG A;  1YNN C;  1JJ2 A;  1UAP A;  4R8N A;  1PH8 A;  4KTA A;  4IUT A;  3STB C;  2E2J B;  5KGU A;  2L12 A;  4QY7 A;  2R93 G;  3PUX A;  1IYU A;  1ENC A;  3MZ5 A;  3CP0 A;  1PRT C;  3RZO H;  3FPU B;  5JEA J;  2FMM A;  4N9T A;  2OTL A;  2AQ3 B;  2XVS A;  4J1M A;  4L5S A;  1STG A;  3WDN A;  5K36 H;  2K28 A;  3AFP A;  3SK4 A;  1WTX A;  1GUN A;  3GO5 A;  2KOL A;  3FKI B;  4RKB A;  4A93 B;  4GZY C;  3S2D H;  1KD1 C;  3T56 B;  5JJZ A;  5KNC A;  4HIO A;  4DPG A;  3H09 A;  4MN3 A;  4WFN 3;  1N8R C;  2KUM A;  3KDF A;  4DV3 L;  2NZH A;  3M85 A;  2L15 A;  5CMD A;  5NUC A;  1PH1 A;  4IUR A;  2MHV A;  1SAP A;  3NSW A;  4A3E G;  4DV0 L;  4CKC A;  2CFM A;  3A8K E;  3M3Y B;  4JI4 L;  3FHW A;  1I5F A;  1LAB A;  2E76 C;  4NXN L;  4QIW B;  2ICE C;  2JK8 A;  4GOP B;  2MPM A;  2E8G A;  1Y8N B;  3AEV A;  4H7B A;  4JI4 Q;  1YNN D;  3S2H B;  1BNZ A;  4NXN Q;  2VQF L;  4OO1 H;  1GHJ A;  1CM9 A;  3STB D;  1RTN A;  5C3E G;  2D62 A;  1EIH A;  2JA7 G;  1I4Q A; 
#chains in the Genus database with same CATH homology
 1K8M A;  4K5V A;  2PW7 A;  3NWT A;  1PRT D;  1PTO D;  3WOF A;  3SDZ A;  3GTP B;  4BWG B;  4A3B B;  3D4D A;  4XYQ A;  2IX3 A;  3SVM A;  1S5C D;  2NN6 H;  1ZKO A;  4DK1 A;  4A3G B;  2IL8 A;  3I91 A;  2H4O A;  2Q8T A;  3M4O B;  1IKM A;  1ZYR C;  1UUP A;  4KD3 A;  2DNE A;  2TSS A;  2SDF A;  4F8M A;  2VXW A;  5EQ0 A;  3ZYY X;  2B63 B;  4X3S A;  4PQX A;  3RZD B;  2JSO A;  2WKD A;  1CHQ D;  1Z6H A;  1ZEQ X;  1BF4 A;  3UI2 A;  1EFI D;  5ELF A;  1M4V A;  2FJ2 A;  5LL6 S;  3K58 A;  2RBM A;  1G29 1;  3RZO B;  4CGY B;  4S3S A;  4HMI A;  1Y1W B;  1NAP A;  1CQF A;  5ELC A;  4HR7 B;  1V43 A;  3S2D B;  1DM0 B;  2PW5 A;  5C0X J;  1QWY A;  4RCN A;  2LS0 1;  4XT3 B;  1ZYR D;  3D4W A;  1EEI D;  3FMC A;  3NK9 A;  2EJF C;  3KK7 A;  3E6Z X;  5FO7 B;  4ZUI A;  5KEE A;  3OWE B;  1U4R A;  5CV5 A;  2JA5 B;  5JVG 3;  3CRL C;  2N88 A;  2XRS D;  4KKU A;  1GUS A;  4XT1 B;  3M7N A;  5I9P A;  1Y1V B;  1SFO B;  5EPK A;  4R8I A;  2K1B A;  2F0N A;  1T5X D;  4RKL A;  3I90 A;  2XNA C;  3ERQ A;  1EY4 A;  3R8B A;  4RHS A;  4EQN A;  5HUR A;  3PO2 B;  3A55 A;  4C3H B;  5CGK A;  1B44 D;  4NMZ A;  1TS2 A;  5JEA H;  4DXG A;  3J80 E;  1DJR D;  2E75 C;  1STH A;  4A3M B;  1V8Q A;  3K5N A;  5K5P A;  2AQ1 B;  3MHB A;  2F0P A;  5I6W A;  2IX1 A;  1ICW A;  1EY0 A;  1BBX C;  3VR4 A;  1D1K A;  3NTI A;  1Q8I A;  1E2V A;  4M1U B;  2I46 A;  1DCZ A;  1LTB D;  1TQO A;  4C1N K;  1CFM A;  3X3N A;  2EVB A;  4C1N I;  3NUC A;  4R9W A;  4C3J B;  3BDC A;  1G8Z D;  3H0G B;  1K83 B;  1NUC A;  1JWU D;  3PUW A;  1STA A;  3H94 A;  5IGD A;  2L11 A;  1EU3 A;  4KHZ A;  3R3O A;  3L3O C;  2EPB A;  1E2Z A;  5TSS A;  1Y69 U;  2BOS A;  4N9P A;  3D31 A;  2F0T A;  2WIN B;  1Z7T A;  3ERO A;  1KDC A;  4C3I B;  3MVV A;  1D2B A;  1KTK A;  1GHK A;  2QIL A;  4CKB A;  2EOT A;  1H9S A;  4HN7 A;  2HDM A;  1PTO H;  4IN3 A;  2NVT B;  3QOJ A;  3OIQ A;  2OEO A;  4RA8 A;  1EU4 A;  1CZW A;  1DYQ A;  1QIL A;  4RAU C;  2R3Z A;  3I8Z A;  4B9X A;  2K5W A;  1FD7 D;  3Q6S A;  4FVM A;  3C1E A;  2G9D A;  3P75 A;  2O4X A;  1LV9 A;  2F0D A;  1M8A A;  1I4X A;  1B3A A;  5IOD A;  1GJX A;  5C0X H;  2FFK B;  1ESF A;  1VF7 A;  1AP0 A;  3HP3 A;  1TY0 A;  1SE4 A;  2B2T A;  4DNR B;  5C4X B;  1IW7 C;  1PZJ D;  2KEC A;  3OIP A;  1KDA A;  2K6A A;  1RKN A;  2AQ2 B;  2QCP X;  3OW7 A;  3S17 B;  3HOX B;  5M5Y B;  1O7Y A;  3IFD A;  3PIO 3;  1PFB A;  3NBH A;  3HOW B;  2XWB B;  5KIX A;  5CYU A;  4IQZ A;  3S15 B;  3QWN A;  3FPP A;  1BO0 A;  2B2V A;  4KKS A;  4H44 C;  3I4M B;  1EY6 A;  1O78 A;  1E2W A;  4OL7 A;  3MXU A;  5I9O A;  2Z1C A;  4ZLT F;  2K01 A;  2C9O A;  4ILW A;  1QE6 A;  3D6W A;  1NR2 A;  2FHT A;  1A3U A;  1IW7 D;  1PRT B;  1QNU A;  3PMF A;  1PTO B;  1EQT A;  4KJN A;  2EYL A;  4JK1 C;  2N55 A;  5FOB B;  5CV8 A;  2TMP A;  2MUY A;  2HCC A;  4IUQ A;  3WOE A;  2A6E D;  4IAL A;  4K8I A;  1ONL A;  1SNO A;  2J7Z A;  1I4H A;  1O80 A;  1PDQ A;  1CZG A;  4WRD A;  2JE6 I;  1BR9 A;  1I4P A;  1A15 A;  2PPB C;  1ILP A;  2A6H C;  1LTR D;  4LMQ D;  1V1O A;  2EYP A;  4B9W A;  3QO2 A;  4O1N A;  2OXP A;  3K7A B;  3K0Y A;  3LWE A;  2EYO A;  5IGE A;  3S14 B;  1D1I A;  3HOZ B;  1I6H B;  3NBI A;  4G57 A;  1QCB D;  2CQA A;  2I07 B;  1H9M A;  5JVH 3;  2LMC B;  1TU2 B;  1KAB A;  1STY A;  5K36 G;  3P20 A;  1EZ6 A;  4A3J B;  1J9O A;  1XWE A;  2GA4 B;  2B2Y A;  2A6H D;  2IJ0 A;  2JEA I;  3V96 A;  3ND8 A;  1Q1E A;  2E74 C;  5FLX E;  1Q3L A;  4I65 A;  3SR1 A;  1X3Q A;  2R61 A;  2KQ3 A;  2EY5 A;  3J81 E;  4EVO A;  3QG1 A;  4TQU S;  5JAV A;  3OWF A;  1PYW D;  4ZK9 B;  2A68 C;  2O2L D;  1PZK D;  4BY7 B;  3BYT B;  3DM1 A;  1HCZ A;  5A35 A;  1HPC A;  5BN3 A;  3TZU A;  3L9A X;  2F0I A;  5IT9 L;  3R2T A;  3MWY W;  1FNW A;  3TBI B;  1JOO A;  1D5Z C;  4K14 A;  1I4G A;  2NN6 G;  1XTC D;  4XYO A;  1BOS A;  1S5B D;  2PZU A;  5CV7 A;  3Q23 A;  2O5J C;  2SNM A;  3DMU A;  5IOC A;  1JB3 A;  5T1I A;  2IWH A;  2F0Q A;  1SE3 A;  1EQV A;  3OMC A;  3C2P A;  4L6T B;  3OOC A;  4C56 C;  4IFD G;  3MTS A;  3S9W A;  1AEX A;  3S1M B;  1TWA B;  2F0J A;  2A68 D;  1C4Q A;  4L8J A;  1CTM A;  4X3U A;  3DEO A;  2YYZ A;  3E5S A;  1CHP D;  4TRD A;  1I4R A;  1D5X C;  3PO3 B;  2B2U A;  5LHY 1;  1EY7 A;  5C4H A;  5T1G A;  4KY7 A;  3D6C A;  1JWM D;  3FVQ A;  4IZ8 A;  4I7Z C;  4XQJ A;  3BG3 A;  5HGT A;  2B2T C;  3PV0 A;  2A69 C;  1GOZ A;  3A8I E;  4PNY A;  1EWC A;  3VR2 A;  1F77 A;  3W3A A;  4OIJ A;  5CV9 A;  3GTK B;  5A2Q E;  1STB A;  4ZAI A;  3KLS X;  5CBA E;  2Q8I B;  3KLR A;  5KYL A;  1B9N A;  3C1F A;  2V4D A;  2K03 A;  3QJY A;  3D8G A;  2B2V C;  3I72 A;  1WVL A;  1NR4 A;  4RGO S;  2BA0 A;  5COY A;  3RD4 A;  4ULL A;  3AU7 A;  2B39 A;  1Z47 A;  1SND A;  2BE5 C;  5JEA G;  1TKW B;  3ONA B;  1ENA A;  1G2S A;  5M3F B;  4A3D B;  2A69 D;  2AWN A;  4TKO B;  1F2M A;  4K6D A;  5C5L A;  3NP8 A;  1L0Y B;  4A3F B;  2R92 B;  3NXW A;  1WTV A;  3JAM E;  1EY5 A;  1NCV A;  5LL6 X;  3CQZ B;  3G6J B;  1F9R A;  3GV3 A;  4DA2 A;  4K5W A;  2RVL A;  3V05 A;  2RQX A;  1ENF A;  1TY2 A;  2A73 B;  2EY2 A;  1I3Q B;  2F0V A;  2BE5 D;  3BDO A;  2RKS A;  1DD2 A;  3MXP A;  4FYD A;  4YIJ A;  1QJO A;  2CW0 C;  2PZW A;  1G6Z A;  4G7O C;  1EYC A;  2IPK D;  1DOL A;  3OSO A;  1ILQ A;  2NTS A;  2VB3 X;  4DXF A;  1R4P B;  4BA1 I;  2PCF B;  2FIN B;  3CU7 A;  2BCO A;  1HA5 A;  1HTL D;  1AN8 A;  1SMY C;  5DEH A;  1RCV D;  3N6R A;  2CVR A;  1VCI A;  2K5Q A;  1X3P A;  2IW3 A;  3IKJ A;  4M8A A;  5I2X A;  1C48 A;  1GUO A;  3IAY A;  3LNN A;  3K57 A;  1B1Z A;  1ET9 A;  2X6G A;  5EPL A;  5JOB A;  2CW0 D;  1CA6 A;  2YU9 B;  1IHZ A;  1LTA D;  1PLF A;  1SNC A;  4CJ1 B;  4DNT B;  1TWC B;  5CV4 A;  5CR3 A;  2K33 A;  1RJT A;  3IL8 A;  2H1E A;  3FEW X;  1KLU D;  3MC0 B;  2XRQ D;  5I4D A;  2AUK A;  1A3T A;  2EYF A;  4DAV A;  1KNE A;  1FNV A;  2L1B A;  4FF3 A;  1G2T A;  3NTK A;  1DOK A;  1SMY D;  5FK9 C;  3HZX A;  5IGB A;  5EKI A;  1RF2 D;  4OGQ C;  3S1R B;  1F9Q A;  2AWO A;  5ELD A;  3P1H A;  3SHL A;  4RFB A;  1B2T A;  3CHB D;  1SYG A;  2RSN A;  4KI0 A;  3KBG A;  2KED A;  5BN4 A;  3OHX C;  1OO9 B;  2R93 B;  5I2Y A;  1RDP D;  1SYB A;  1J8I A;  1DON A;  2WV6 D;  1Y8P B;  1OXU A;  4E6I A;  3E0J A;  1BQQ T;  3KBX A;  4ZKC B;  3TN2 A;  5M5X B;  4U68 A;  3VYR A;  4KMU C;  1YNJ C;  3VR5 A;  4Z9C B;  2F4I A;  1A2T A;  3NE5 B;  3SEB A;  2Q8R E;  1H9K A;  4KY6 A;  3J80 L;  1B50 A;  1LTG D;  4XIG S;  4KHV A;  2MP1 A;  1LLR D;  2K32 A;  4EGV A;  2LY7 A;  3BZD B;  1PTO F;  3GTL B;  4MHE A;  4DAP A;  4A3E B;  4EQP A;  2KCN A;  2EE1 A;  3R93 A;  2NN6 I;  1SYD A;  2QEJ C;  1RTO A;  1KDB A;  4NW2 A;  2QF7 A;  4HCE A;  4ZQ3 A;  3K5O A;  2D2C C;  5C3E B;  2JA7 B;  3F2U A;  2ZXO A;  1WTR A;  1I50 B;  1G91 A;  1B4O A;  1Y8O B;  3X3M A;  4K8J A;  2VNU D;  1TWF B;  3MEH A;  2HDL A;  4IFD I;  3DHQ A;  3R2I A;  2PQE A;  1YNJ D;  3VYU A;  3CKI B;  3TP7 A;  5J39 A;  4QUC A;  2D5D A;  4G7H C;  4TSS A;  4DF7 A;  3QOL A;  3HRZ C;  1DOM A;  2KJX A;  3TSS A;  1V1P B;  2WII B;  4PMB A;  2DY7 A;  3KUP A;  1EY8 A;  1SYE A;  1F9P A;  1TWG B;  4FO2 A;  2SEB D;  1E0B A;  1O7L A;  1Q12 A;  4HCS A;  3BYY B;  4RWS C;  1F9S A;  1PXU A;  5CC4 A;  1HUN A;  4FXK C;  4QCL A;  3GV6 A;  2BDO A;  3I4N B;  2NB0 A;  1EEF D;  2K04 A;  3MAQ A;  1EOT A;  3MXN A;  3GTM B;  3T53 B;  3EA6 A;  1OXV A;  5FKA C;  4CBV A;  3TP8 A;  4FF4 A;  2HUG A;  1KLG D;  2F0K A;  3T13 A;  1PMR A;  5EPJ A;  1ZXT A;  2BA1 A;  1KNA A;  2PNR C;  1SNQ A;  2L55 A;  3NQI A;  5C6A A;  2A74 C;  2EYM A;  1HFN A;  1ROD A;  5JPN C;  4PMW A;  4F87 A;  1TVX A;  2EJM A;  1MBY A;  3NPP A;  2NVQ B;  3BVZ A;  1OXX K;  4K2L A;  1LT6 D;  1BCP F;  3VA7 A;  3DEP A;  2KCC A;  1JWS D;  2IT1 A;  2LFN A;  2L5T A;  4MIU A;  3A56 A;  1EZ8 A;  3TZD A;  4WOR A;  4ZYS A;  3BVM A;  3Q22 A;  4ME5 A;  5KRU A;  2K7V A;  1CK1 A;  2F0W A;  3A8J E;  1EYA A;  1VF5 C;  3PIP 3;  4HAE A;  5M9O A;  1LO5 D;  2NUC A;  1ESR A;  2XN9 C;  2NWG A;  4BA2 I;  2A5H A;  1JR0 D;  2ICI A;  2F0O A;  4KK7 A;  2C5C A;  2WAC A;  2Y0S B;  4V19 0;  1RD9 D;  3HG9 A;  3GQB A;  5CBE E;  2JA6 B;  3LWU A;  1TII D;  1NSN S;  4DFA A;  1MGS A;  2RA4 A;  2DN8 A;  4KY5 A;  1IKL A;  2O5I C;  4IFD J;  1CI3 M;  3OMG A;  4DAY A;  4QMG A;  1S4Z A;  4OO1 G;  3A54 A;  3HS0 C;  3O13 A;  4HED A;  2EDG A;  4NDX A;  2ZXP A;  3NWS A;  4KN7 C;  5CV6 A;  2EY1 A;  2Z4I A;  4RH6 A;  1HUM A;  3GTJ B;  2F0G A;  1XYI A;  2PZT A;  4G4K A;  1PFN A;  4C3H G;  5M3M B;  3SE0 A;  3RLF A;  3GD7 A;  2KHS A;  5E1F A;  2ZT9 C;  4B08 A;  5J1Z A;  1TS5 A;  4KV6 A;  4PMC A;  1HFG A;  4K2K A;  4C2M B;  4IUP A;  4UAI A;  3DWQ A;  1SYF A;  1U4M A;  3K5M A;  1WD1 A;  5FLX L;  4IUN A;  1TT2 A;  4Q0F A;  3J81 L;  5ELE A;  1A2U A;  2FMC A;  4ID6 A;  2RDF A;  2F0U A;  4KKT A;  3VR6 A;  4FXD A;  1FGB D;  3I3C A;  4C3J G;  2WAQ B;  2R6G A;  4Y7N B;  1L0X B;  2ENB A;  1STE A;  2Z4H A;  2E2H B;  3HKZ B;  3KLS A;  1R4Q B;  1SSO A;  1Q1B A;  4L63 B;  4BY1 B;  1PTO C;  2XSC A;  4XQN A;  2X6L A;  1S5F D;  1OXS C;  3J7A F;  3KF8 A;  1FNU A;  1GUG A;  1SJH D;  4C3I G;  1X32 A;  2F3V A;  2EXZ A;  5G3L F;  1F2Z A;  5E3F A;  3NHH A;  5EKL A;  3HEJ A;  4FP5 D;  3S16 B;  4ZRZ A;  2F3W A;  1TS3 A;  3RMH A;  4RGN A;  1LT3 D;  4K5X A;  3I4L A;  5EBC A;  2NBF A;  1EWH A;  3NQT A;  1PFM A;  5ISR A;  3TDQ A;  2EZV A;  1SXT A;  4O42 A;  1GUW A;  2EYH A;  2VB2 X;  3SXH A;  2NVX B;  3GTQ B;  1IYV A;  1QB5 D;  3RUZ A;  1EY9 A;  1O7Z A;  4OHJ A;  3J7Y W;  4FF1 A;  4BS9 A;  4HMJ A;  3TP6 A;  5IGG A;  1BXT A;  2NVY B;  4OIK A;  2DNC A;  5ELB A;  4BBR B;  2QDB A;  4CJ2 C;  3Q24 A;  2J4X A;  4AYB B;  2B8F A;  4ZKB B;  4DGZ A;  5A2Q L;  3DWA A;  4IFD H;  3ITP A;  3QIA A;  3T4A C;  1IL8 A;  1WCM B;  3BDL A;  3C46 A;  4X3K A;  3DXJ C;  5FO9 B;  2F0S A;  1BUV T;  4KD4 A;  1LAC A;  1A3V A;  1JCK B;  1EIG A;  2RDH A;  1WTO A;  3LX0 A;  1AW7 A;  4QB4 A;  3NTH A;  1QOH A;  2F1M A;  1U9R A;  4RCO A;  1JOR A;  3MFG A;  2PMZ B;  1EL0 A;  3N52 A;  2G9H D;  1GXD C;  5E4W C;  4CHT B;  1XXG A;  4DU9 A;  1D5M C;  3JAM L;  1CA5 A;  3SK8 A;  5AFW A;  3MA2 B;  1BCP C;  2B2Y C;  3M7G A;  1DXM A;  5C5M A;  1HQR D;  5F2D A;  1JE4 A;  3K5L A;  3AB9 A;  3DUZ A;  1VMC A;  4HTH A;  1TWH B;  4J6H A;  1TR5 A;  5C0X G;  3BS1 A;  1F2L A;  2F0M A;  2EJG C;  2KEE A;  3I73 A;  1UEA B;  5COR A;  2B2W A;  3PUY A;  1EYD A;  2L0C A;  3HOU B;  4KN4 C;  3PUZ A;  1T5E A;  3H6M A;  1XX8 A;  2OT2 A;  1BCP D;  1I6V C;  4F7X A;  4RGT A;  5I6Y A;  1B53 A;  2DY8 A;  2ID0 A;  3EQL C;  1AZQ A;  1MD2 D;  1B9M A;  5EGT A;  2L4N A;  3M4Y A;  5M5W B;  1MI2 A;  1II3 A;  3S1Q B;  2IX0 A;  3D3R A;  5KND A;  2J0T D;  2NTT A;  4KJO A;  5EJW A;  3URY A;  3T51 B;  2R7Z B;  2B8G A;  4OO1 I;  5DM6 3;  1S5E D;  1F2Y A;  4ABN A;  1V1P A;  3PUV A;  2M9V A;  1PRT F;  4F88 A;  1HQM C;  2D9U A;  1S5D D;  3HOY B;  2B2U C;  1AZP A;  4HSV A;  1PZI D;  5IIF A;  2EY6 A;  5C4J B;  2BDN A;  3C3L A;  2F0H A;  2NYZ D;  3MFY A;  2M00 A;  2JEB I;  1SE2 A;  5D65 A;  3GTO B;  5C3W A;  4DK0 A;  3SK6 A;  1GUT A;  2QKI C;  2WP8 J;  3K59 A;  4K6L A;  2MJ8 A;  1CQV A;  4XDX A;  4CJ0 B;  1A6X A;  3VA5 A;  2HQE A;  1ET6 A;  2L9H A;  4U67 3;  1FYC A;  1BDO A;  2SNS A;  5JPM C;  3G7L A;  5DM7 3;  5D14 A;  2KVM A;  3W2D A;  1JOK A;  1LT5 D;  1SYC A;  1SNM A;  4PV1 C;  5C4Z A;  1H9J A;  1QG7 A;  1OXT A;  5KNB A;  4XQQ A;  2WB1 B;  3K6O A;  4BBS B;  5BN5 A;  1AFP A;  5IGF A;  4LK1 C;  1HTP A;  1H9S B;  3P7J A;  5E4X A;  2ZXR A;  1SDF A;  2VUM B;  4NP5 A;  4RHR A;  4NKL A;  4LJZ C;  3GTG B;  4CKE A;  2MGS A;  1TS4 A;  2CHB D;  1SJE D;  1WTP A;  4DN4 M;  2A6E C;  2JXM B;  1U4L A;  3Q0A A;  1WD0 A;  3DWP A;  2F03 A;  3VYS A;  2EYJ A;  1LT4 D;  3D4R A;  4XTC S;  3FRP B;  4WJW A;  4JBW A;  1ML0 D;  1FR3 A;  1LTI D;  3EVQ A;  2NZ1 D;  4XXE A;  1MSG A;  1HXY D;  5KYI A;  3HOV B;  1C8C A;  3EJI A;  5G3L D;  1WTQ A;  4EQO A;  1JC7 A;  1VDZ A;  3A7A B;  1HRJ A;  1SBB B;  1QNK A;  4FNF A;  3H3V C;  3S1N B;  4QF4 A;  3T16 A;  4LAA A;  3TP5 A;  3U9S A;  1H9R A;  4H13 C;  2JYO A;  2F0F A;  2AUJ D;  4RGM A;  3ND9 A;  5C3X A;  2Z8L A;  3J7A V;  4P2C B;  1MSH A;  2XIW A;  1HA6 A;  3AMU A;  2JP1 A;  1SNP A;  2JA8 B;  1RHP A;  3CRK C;  1HHV A;  1UNS A;  3A7L A;  2OF1 A;  4Q5V A;  4A3I B;  5IT9 E;  2M2L A;  1W6K A;  5FO8 B;  1WTW A;  3OPO A;  2KA7 A;  1SEB D;  4ZUJ A;  2PO4 A;  4A3K B;  1Q90 A;  1W6J A;  1JQY D;  4IUU A;  5DNF A;  2SOB A;  3FDT A;  4QUF A;  1DZ1 A;  5IGC A;  2B2W C;  2F0E A;  2RSO A;  4G7Z C;  5C44 B;  1CT1 D;  3SK5 A;  4IUV A;  4X3T A;  1JIC A;  2X69 A;  5DAU A;  3EFX D;  1K8O A;  3VR3 A;  2PYK A;  3V2T A;  1LTS D;  2RDG A;  4V0B A;  5D3D A;  3MXG A;  4FF2 A;  4HSP A;  2LKV A;  3VYT A;  2K5D A;  5C0X I;  2WKC A;  3H91 A;  5J22 A;  4J8Q A;  1VMP A;  3I70 A;  5D3I B;  4UDU C;  3TME A;  3BVG A;  1STN A;  3IFT A;  3HGB A;  2E2D C;  4FXG C;  1BCP B;  5EKK A;  5EBD A;  2HCI A;  2K05 A;  3L7Z C;  1R9T B;  1U4P A;  4H0L C;  1JOQ A;  3QB3 A;  1LTT D;  2E2I B;  2XWJ B;  3U9O A;  2F0L A;  1D6E C;  3GP7 A;  1KAA A;  4ODG A;  1YNN C;  1UAP A;  4R8N A;  4KTA A;  4IUT A;  2E2J B;  5KGU A;  2L12 A;  3PUX A;  1IYU A;  1ENC A;  3MZ5 A;  1PRT C;  3FPU B;  5JEA J;  2FMM A;  4N9T A;  2AQ3 B;  2XVS A;  4J1M A;  1STG A;  3WDN A;  5K36 H;  2K28 A;  1WTX A;  3SK4 A;  1GUN A;  3GO5 A;  2KOL A;  3FKI B;  4RKB A;  4A93 B;  4GZY C;  3T56 B;  5JJZ A;  5KNC A;  3H09 A;  4MN3 A;  4WFN 3;  2KUM A;  3M85 A;  5CMD A;  5NUC A;  4IUR A;  2MHV A;  1SAP A;  3NSW A;  4CKC A;  3A8K E;  3M3Y B;  1LAB A;  2E76 C;  4QIW B;  2ICE C;  2MPM A;  1Y8N B;  4H7B A;  1YNN D;  3S2H B;  1BNZ A;  4OO1 H;  1GHJ A;  1CM9 A;  1RTN A;  1EIH A;  2D62 A;  1I4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...