1A2UA

Staphylococcal nuclease, v23c variant, complex with 1-n-butane thiol and 3',5'-thymidine diphosphate
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
135
structure length
134
Chain Sequence
LHKEPATLIKAIDGDTKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Mobile unnatural amino acid side chains in the core of staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Nuclease
total genus 34
structure length 134
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1998-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1a2uA00
4KY5A 1STYA 4H7BA 3P1HA 1SYEA 3D8GA 3V2TA 4K14A 2F0FA 1EYDA 4ODGA 1ENCA 4G57A 1II3A 2RDFA 3TP5A 2EYMA 2F0LA 5K5PA 3NXWA 1KABA 5JAVA 4N9TA 4LAAA 4F8MA 5CC4A 4NMZA 1SYFA 4K2LA 1NSNS 5CGKA 3QOJA 1SYDA 3TP7A 4B9XA 2PQEA 1ENAA 1A3VA 3C1FA 4K2KA 4PNYA 4KD3A 5DEHA 2F0UA 4ZQ3A 5E1FA 1EZ8A 4ZUIA 5M9OA 5KYLA 3MVVA 4EQNA 3D4WA 3NK9A 5EKKA 1EY6A 4NKLA 3SXHA 4KY7A 5C6AA 2RBMA 1EQVA 2F3WA 4KD4A 1TQOA 3MXPA 3TMEA 2F0PA 1EY5A 3OMGA 1SNCA 3SK4A 2F0SA 2F0OA 4MIUA 4K6DA 4KJNA 2F0VA 1SYBA 4K8JA 1KDBA 2SNSA 2WACA 3D4DA 1KAAA 3SK8A 3NQTA 4HMIA 4QMGA 1A2UA 3ITPA 5KIXA 1JOOA 4PMCA 2EYLA 2HQEA 3NUCA 2F0HA 5IGCA 5C4HA 3EJIA 3DHQA 2KQ3A 2PZUA 4J1MA 2F3VA 5HURA 5IIFA 4HMJA 3C1EA 1A2TA 1A3TA 5IGFA 2PYKA 4NP5A 3PMFA 5C5LA 1AEXA 3NHHA 3BDCA 1EZ6A 3QOLA 4HTHA 2F0GA 4K5VA 4K5XA 4NDXA 5J22A 1SYGA 3OWFA 4ID6A 4ZUJA 1EY8A 2F0IA 1SNQA 2EY1A 4QF4A 3VA5A 1SNDA 3RUZA 1RKNA 1STNA 3HEJA 5C4ZA 5IOCA 5KEEA 2OEOA 4DU9A 4EVOA 5C3WA 2EYJA 2F0KA 1KDCA 2EYHA 2ENBA 4KJOA 3DMUA 1EY7A 2PW5A 4J6HA 1F2ZA 2F0NA 2PZTA 4KTAA 4N9PA 3TP6A 1A3UA 4KV6A 3S9WA 4DFAA 5CR3A 5CV9A 4F7XA 3SR1A 3QB3A 5I6WA 1F2YA 1KDAA 5I9PA 5J39A 5CV8A 5KGUA 4EQPA 2OF1A 1EY4A 2PZWA 3D6CA 4WORA 5I9OA 2EY5A 5IGBA 3MZ5A 1EYAA 5F2DA 3MHBA 3SHLA 5IGDA 1F2MA 5NUCA 3LX0A 5IGEA 1SNMA 2F0MA 1JOKA 1SNOA 2KHSA 5DAUA 3MEHA 3ERQA 3EROA 4IZ8A 4RKLA 2EXZA 3P75A 4ME5A 3SK6A 4B9WA 1EY0A 5J1ZA 2F0TA 3OMCA 5CV4A 5JOBA 2F0WA 5IODA 5E3FA 4DGZA 1TT2A 5ISRA 1IHZA 4E6IA 1U9RA 4WRDA 3R3OA 5CV6A 2O4XA 1STBA 3T13A 1TR5A 5HGTA 2RKSA 4KHVA 4EQOA 5EGTA 4IALA 4RKBA 4K8IA 1JOQA 2F0EA 2F0QA 5I6YA 2F0JA 1SYCA 5IGGA 2F0DA 2EY2A 3BDLA 3NP8A 5CV7A 4IUNA 1NUCA 5KRUA 2PW7A 4YIJA 5CV5A 4I65A 4R8NA 5C3XA 1SNPA 3OSOA 4S3SA 2EYFA 1STAA 3T16A 3HZXA 4DF7A 2EYPA 4OL7A 1JORA 2EYOA 5EKLA 1STGA 1STHA 3H6MA 4K5WA 4PMBA 1EY9A 3EVQA 2EY6A 3E5SA 2SNMA 4TRDA 2SOBA 1EYCA 3U9OA 2OXPA 2NUCA 2LKVA 2M00A 4KY6A 4QB4A 2QDBA 5C5MA 5KYIA 3TP8A 3SK5A
chains in the Genus database with same CATH superfamily
1OXSC 1H9SA 5FLMH 1STEA 1NR2A 1ENCA 2HHHL 1TWHH 1DM0B 2JEBI 4DAMA 1JR0D 4K2LA 1NSNS 5LMUQ 3CPFA 5CGKA 1VQNA 4A75A 2PQEA 1ASYA 4DAPA 1V1QA 5AFWA 2N55A 3WDNA 2X6LA 2H4OA 4A4IA 3L2PA 2I5MX 2TSSA 1JJGA 2VL6A 1LUZA 5M3FG 2G5DA 1GD7A 1B9MA 4DXFA 3SK8A 4DR7L 3K58A 2JA6G 2R92G 4C1NK 1T9HA 3CCJA 2BCOA 5M3MH 3GTQH 4DK3C 1CKOA 1A2TA 2YTXA 1PH2A 1PXUA 1LTRD 4C2MB 3I4NB 5CC4A 1TS5A 4IUTA 3ONAB 4ZUJA 1P8LA 1QE6A 1SNDA 2LSSA 3A8IE 3KF8B 2NBFA 4RGTA 3CP0A 4EVOA 5C4XB 1KDCA 2MHVA 1QUQB 1VF7A 2A6ED 5EKIA 3SR1A 5IY0A 2P5ZX 1AW7A 1E2VA 1B70B 2A73B 4P71A 4EQPA 4UY8C 3TRZA 2HCCA 2Z9HA 3H15A 1L0XB 3SHLA 4HR7B 1CM9A 3S1RB 2Z6KC 3HOZB 3CKIB 3E0JA 4FXKC 4A3IG 1Y1VB 1CA5A 3G7LA 3GTJH 3PF5A 3TDQA 4HIMA 1SE4A 2WB1E 1C0AA 4UAIA 1JOQA 1B50A 2JK8A 5LMUL 2XGTA 3KOJA 2IX1A 1L2FA 3ERSX 4A93H 3K5LA 1U0LA 4C56C 4GZYC 4DN4M 4R4QA 2K14A 2EYOA 5EKLA 5AJ3Q 4QIWB 1LTLA 3QG1A 4PMBA 1TVXA 4DAYB 1F9SA 2JA6H 2R92H 1I3QH 1HUNA 5C5MA 2E5LQ 2LS01 4OONA 4FF2A 2PNRC 3WOFA 3CQZB 4KLKA 2F0FA 1DOLA 2XRQD 4L8JA 4K0KQ 2JSOA 3NXWA 1E2ZA 4DAVA 1TWHB 1MD2D 2AQ3B 3E9IA 4GN3B 3QIAA 3MXNB 1VQ6A 3FVQA 3KLSA 2K50A 2B2UC 1U5KA 1VDZA 4RG1A 5EKKA 1EQVA 1S5FD 1N34Q 3GD7A 2UUAQ 3TS2A 4MTKA 4A3CG 2E2JB 3GDEA 1TXYA 1S4ZA 1Q3LA 4DR5Q 1JWMD 1I4RA 1HQMC 2D0PA 3D4DA 1VS0A 1GKHA 4NW2A 4LFAL 4XDXA 2MGSA 2PZUA 2QA4A 1S3OA 3TREA 3ER0A 1A3TA 2HDMA 4A3IH 3M4QA 4NP5A 3LWEA 1EOTA 1EU3A 1D8LA 2NVQB 1NBWA 5M5XH 3VR6A 3DXJC 2HQLA 2QCPX 3R8BA 4X6AH 1FGBD 1NR4A 3KF8A 2X69A 2X6GA 3AEVA 2MPMA 2B2WA 5T1IA 4DA2A 2OF1A 2PZWA 2OCEA 1D6EC 4HAEA 4WORA 5GAGC 4M8AA 1RD9D 5AJ3L 2PNHA 2K04A 3MHBA 1F2MA 3LX0A 3RMHA 4IUQA 3P7JA 5D14A 1XNQQ 4DK0A 2DY8A 3C3LA 2A69D 1SMXA 2E5LL 4X66Q 4B3SQ 2WKDA 5G3LD 1YHBA 3CW2C 4TVAB 3J81i 4A3DH 1K28A 3PO3H 4K0KL 3U58A 3OWEB 1UAPA 2NVYB 1EIGA 1PFMA 2JA7G 3K6OA 5G3LF 1B53A 2D5DA 5EAYA 2M9VA 4DR2Q 1J6QA 3VYTA 4APVA 4A3CH 4OWTB 4R1JA 5M3FB 1N34L 3CXCA 2UUAL 5D3DA 2JA6B 3MFYA 1GM5A 1I3QB 1K83H 2K7VA 4KY5A 4DR5L 4L5RC 5KNDA 3TP5A 2RDFA 2KA7A 2J4XA 1KQSA 1BCPC 1CK1A 4LF6Q 4FXGC 1Z9FA 2F52A 3GQBA 3VA7A 3OIQA 3Q6SA 2K5QA 3SXHA 3VYRA 1WTPA 3S2DB 3M9BA 4L6TB 2OTJA 2K03A 3UE0A 2KUMA 3KFUA 1ICWA 3ZJYC 1H9KA 2F0HA 2N3SA 1BO0A 1LTBD 4RGOS 1MGSA 1NMGA 1XNQL 2JXMB 5EBCA 2A6HC 3TSSA 4K5XA 4U68A 2F0GA 4A3IB 4GLVB 5LL6S 4B3SL 4XIGS 1VQHA 2WB1B 2JA7H 5GAEC 3RUZA 1IW7C 1WVLA 3CC7A 5IOCA 2ASBA 1XTDA 3S2HB 4KN4C 4DV0Q 1HHVA 5JJKA 4HJ9A 4J6HA 3I56A 2PZTA 2Q2UA 2AKWB 3F8TA 2Q8IB 1A3UA 2QGQA 3S9WA 4UP9A 1GUOA 4DR2L 5KGUA 5ELNA 1XJVA 2C5CA 5IGBA 2FXQA 2WKCA 1Q82C 1TY2A 4JCVE 4CJ2C 3MTSA 1VQLA 3K0YA 5J22A 3ERQA 3KF6A 3NWSA 1LABA 3NTKA 3P75A 3EBEA 1IBKL 1W6JA 2A5HA 2E8GA 2OQKA 3VYUA 5JPMC 1K0SA 3K81C 2KCNA 1O7ZA 2CKZB 3BDLA 3J7AV 4LF6L 4LF7L 4Q5VA 1T5EA 3PIO3 1TIID 2B2YC 3HZXA 1EIHA 1W6KA 2UU9Q 1HA5A 4C3IH 2R93G 4OIKA 2A68C 2G9HD 4LFCQ 3TQYA 2RF4A 3TP8A 2K6AA 3HKSA 5JEAG 4XT3B 1PH7A 4EX5A 2V4DA 3NSWA 3M4OB 5JEAJ 3UDGA 1HNWQ 3FEWX 2WV6D 1K3RA 1NCVA 1NJIC 4XQNA 3WOEA 2GVBA 1JJCB 2XWBB 1U4LA 1A3VA 3V96A 4V190 4KK7A 1EZ8A 3O13A 2Q8RE 3IL8A 3OPOA 3Q0AA 1Q1BA 1ILPA 4EQNA 4Z9CB 4FO2A 1ML0D 1UE7A 3CCQA 4NKLA 4LF8Q 1B1ZA 3I7FA 1O80A 4KKTA 3MXPA 4DV0L 4IFDG 1CSPA 2BDNA 2E2IB 3GTOH 5CORA 3AB9A 1HNXQ 2A8VA 4IFDJ 2IPKD 4QMGA 1B9NA 1K3BC 4PMCA 1W3SA 5C0XI 1WTRA 2A6EC 2M2LA 4X3SA 1QWYA 1ZKOA 2E2DC 1G2SA 2EOTA 3W3AA 2ZXRA 2N88A 1PV4A 4XYOA 4TSSA 1PZID 3MXUA 2F0IA 1ZXTA 2EY1A 2N49A 3K0XA 1V9PA 1Q86C 2JA7B 1QNUA 4P73A 1IZ6A 2GN5A 3W1BA 1WCMG 1VQ7A 3J7A5 3A7LA 1SN8A 5CR3A 2R93H 3I4LA 1EIFA 2JA9A 2UU9L 5JJLA 1BCPB 3RLFA 5IT9E 5JEAH 1F2LA 4JI3Q 2WFWA 3G6JB 3LGJA 4LFCL 2KBNA 3EFXD 2F0WA 3G48A 3ND9A 3NELA 4P72A 4L63B 1IKLA 1TY0A 1GXDC 2NYZD 4RAUC 1EQTA 4K6LA 4C3HG 1Q46A 3U9SA 5EGTA 1HNWL 4JPBW 4BBRH 1SYCA 4PZ6A 1EOVA 1C4QA 1VQ4A 1U4RA 4UPAA 1TWGH 5C3XA 1SNPA 1PZJD 2EYPA 3Q8DA 3HOYG 2IHEA 5K36H 1HFNA 3KDFA 4LF8L 1Y8OB 2EY6A 3UDXA 1KTKA 2SNMA 4PV1C 3I8ZA 4LWCA 2OQ0A 2H1EA 1HNXL 1FNVA 1I4HA 2RA4A 2B2TC 2KHJA 3AYHB 2VZAA 2HCIA 1SYFA 4CBVA 3TP7A 1D5XC 4N8X1 2IHFA 2WP8J 3DWAA 4PNYA 1UE1A 2PQAB 4B08A 1WCMH 3CC2A 4IPCA 1HTLD 2JYOA 1L1OC 2WAQG 5C0XG 3U50C 4CHTB 5C0XJ 2VW9A 2RVLA 1LTGD 3MC0B 3GTOB 1KAAA 2VY3A 3I91A 3EQLC 3NUCA 4XT1B 1WYDA 3F2DA 1EFID 1IYVA 3VR2A 4PZ7A 3H3VI 4JI3L 4DXGA 1D2BA 3A0JA 4C3HH 1F9QA 2B63G 3DEPA 2K5DA 4K5VA 1G6ZA 1SYGA 2A69C 2B2VA 1PFBA 3A54A 1TS2A 4QIWE 4R4IA 1I50B 1DOMA 1JQYD 4FYDA 3CCEA 1KDAA 1DJRD 1R4PB 1A62A 1DOKA 1FGUA 4HIDA 2ZM6Q 4OX9Q 4BY7G 1WOCA 4JI8Q 1QJOA 4QY7A 4ME5A 4KKSA 3CC4A 5J1ZA 1HFGA 1TT2A 1Q8IA 1IHZA 2K01A 4A3GH 5L37A 1AZPA 4QJFA 5C3EH 1PFNA 2KCMA 2MP1A 2N78A 1RL2A 1RTOA 3BG3A 2JEAI 4PZ8A 3RN2A 4MTNA 5IGGA 5M5WH 4IUVA 5C0XH 3K59A 4R8NA 3CD6A 2VUMG 2I5LX 2KVMA 5I4DA 4DR4Q 1V1PA 1E24A 2ZXOA 4ZKCB 2NVXH 2LKVA 1WTQA 1SLJA 3NE5B 5M3MG 2K4KA 1G8ZD 1PDQA 3I4OA 5FKAC 1YNJD 3D8GA 3S24A 4LK1C 1HR0W 1UE5A 2CHBD 3EN2A 1SFOB 1KAWA 2A19A 3NEMA 1VQAA 3IKJA 4YWKA 1SYDA 5A2QE 2AQ1B 4B9XA 4RHRA 2JA5G 2NB0A 4GN5A 5DEHA 4B3RQ 3GTKH 4LF9Q 1S5CD 2HT1A 3BVGA 3D4RA 2PQAA 1PYWD 2NN6I 2RCNA 3HKZG 3HKZE 5FO7B 3RZDH 1O7YA 4CJ0B 1S40A 1EY5A 2C35B 3K5OA 4O42A 2F0OA 1JCKB 3ULJA 2SDFA 1PTOD 1D7QA 1XWEA 4BY7H 3R2IA 2K1BA 2VS1A 3UDFA 2KQ3A 2B8FA 3H3VC 2ZM6L 3NTIA 2JN4A 5E4XA 2EXDA 4OWWB 4OX9L 3GTPH 5FOBB 1PTOF 1PYSB 4JI8L 2PYKA 5C6AA 4Y52H 2A68D 3S1MH 1Z7TA 3NBHA 4ALPA 3VA5A 4JYAL 4A93G 1STNA 3TZUA 1J5EL 3D3RA 1A15A 2VUMH 4OWXB 2DNCA 1UE6A 4BBSG 4ZKBB 3TP6A 1W2BA 3HOYB 4GOPC 2YTVA 5JPNC 4U673 1AZQA 3MZ5A 2JQOA 5IGEA 1SNMA 1Y8NB 5M5YH 4DR4L 2K5WA 3SK6A 4B9WA 3EROA 1EY0A 1VMPA 5COYA 3AFPA 5I2XA 4KKUA 5ISRA 3M4PA 1CUKA 4ZLTF 2JA5H 1JICA 1BBUA 1JWSD 1L1OB 1STBA 1E3PA 1DYQA 1LT6D 4M1UB 2Y0SG 4RGNA 1G91A 2F0QA 4HJ5A 2MUYA 1M90C 5KRUA 5M5WB 4I65A 1Q90A 2WAQB 5EQ0A 4LF9L 1HA6A 4ABNA 2R7ZG 3H3VH 2KJXA 1KD1C 2R6GA 1I94Q 2G9DA 1EY9A 1MSGA 2E2HH 3SEBA 5C4JH 4HCEA 1Q81C 3NTHA 1F9PA 4A3MH 4F88A 4CKBA 1KHIA 2EYMA 2F0LA 4JW0A 3M85A 5JAVA 2B29A 4A76A 2NN6G 4HJ8A 2B63B 1WTOA 2BE5C 3S16B 2EE1A 4A3BG 4TKOB 1PH4A 1A63A 4XQQA 4FF3A 3M4YA 4L5QA 4BBSH 3C46A 3S17H 1WTVA 1BUVT 4ULLA 4JOIA 2F0SA 4DV4Q 1X65A 1DXMA 5HGQA 2BA1A 3RN5A 1NTGA 4OGQC 4BY7B 4GS3A 3J7AF 3A55A 5FO8B 1HH2P 4A3DG 3PO3G 3GTGH 1GUGA 4JBJA 3GTPB 4J15A 1EZ6A 3QJYA 1RCVD 1TWFH 1S5ED 1HNZQ 3L7ZC 4IPGA 3S1MB 2F03A 1EEID 2F0KA 5LMNW 4RCNA 2R7ZH 2DGYA 2JA8G 1K0RA 2AUKA 1HJPA 1R4QB 5E4WC 1C8CA 1JC7A 2ICEC 2ZTDA 5J39A 5E7NA 2OTLA 3D6CA 2Q8TA 1J9OA 3VDYA 3KYHC 5JJZA 4G4KA 1I94L 5IT9L 4WFN3 5M3MB 3GTQB 1RODA 1SNOA 3MEHA 1Y14B 1SBBB 2DUDA 2NN6H 4LNQA 1CA6A 4A3BH 4O0AA 3CCVA 4WRDA 2NWGA 5CV6A 4O1NA 4WJ4A 3PO2G 3T4AC 3G4SA 2NZHA 3DWQA 5CV7A 3KJPA 4IUNA 5ELOA 1NUCA 1MI2A 4ZYSA 1QUQA 2NTSA 5HY6A 2BH8A 1KNEA 3HKZB 3OSOA 1D5ZC 4IOCA 1SMYD 3DM1A 1RHPA 4ZCKA 4K5WA 3EVQA 3IFDA 2L12A 2K5VA 2YTYA 4OIJA 3A7AB 4LF5Q 2M00A 2FHTA 3MFGA 1QNKA 4XQJA 4DV4L 1TKWB 3CRLC 4H7BA 5C4JB 1MBYA 4GNXC 3GTJB 4LAAA 4A3KG 1BKBA 3L0OA 1DCZA 3QOJA 1KXLA 1LTSD 1N32Q 3FMCA 1ENAA 4GOPB 4A93B 4UDUC 1PRTD 4ZUIA 3I2ZA 3A5UA 4UHVA 1HNZL 1SDFA 2JA8H 3CMAA 3KBXA 4BBSB 5GADC 3BYTB 2Z0SA 2LXJA 3S17B 1EWCA 2R92B 3T51B 4A3FG 1PRTF 1LT5D 1JB3A 4DAYA 1SR3A 2O2LD 1VF5C 2Q2IA 2E76C 3JAME 1SSOA 3R2TA 4IQZA 2IJ0A 2HQEA 5IGCA 1HZ9A 2KCTA 4G7OC 2B2VC 4P2CB 4J1MA 2GVAA 4JV5Q 1QVFA 1KLUD 3C1EA 3D0FA 3S14H 3H94A 3MXNA 3QOLA 4KI0A 4NDXA 3GTGB 3PO2H 1XTCD 4RFBA 1T5XD 3T1YQ 2Y0SB 2QDLA 4X3UA 5ELDA 4JI2Q 1AP0A 4QF4A 1TWFB 5ELBA 3PF4A 1CZWA 1I4PA 1WD1A 3PUVA 4FDBA 1F9RA 2E74C 4KJOA 3DMUA 4C3IG 1MKHA 2F1MA 5IYBG 2R7ZB 4DFAA 1QVCA 3QB3A 3TN2A 4Q0FA 1I4QA 3PQIA 1LACA 1GOZA 3EA6A 5BN3A 3N52A 3CCRA 1JOKA 2FMCA 1DD2A 3PUYA 4LF5L 2F0TA 3OMCA 4X66L 3S1NH 4A3KH 3K57A 3OHXC 2CQAA 4BY1H 3HGBA 3T13A 4A3BB 5M5XB 1HRJA 4KHVA 4YY3Q 1K8AC 1YNJC 4RKBA 1AE2A 2CCZA 1CKMA 1C7YA 1N32L 2PW7A 3K7UC 2D2CC 4NPSA 3KJOA 4A3FH 1U4MA 1OXUA 4BA1I 2NVTH 1ASZA 1ICFB 5CYUA 3GTMH 3SDZA 4MN3A 4NB3A 3X3NA 3A56A 4FP5D 1J8IA 4KY6A 3NENA 1VQ8A 4RHSA 3RNUA 2L4NA 5BR8Q 3P1HA 1SYEA 3V2TA 4QGUA 1EWIA 4A3DB 3PO3B 1HPCA 1PTOC 2I46A 2AWOA 5A2QL 4JV5L 1E1TA 1WTHA 4GLAC 4ZQ3A 3B6YA 4KD3A 5C44G 5EPLA 1CQVA 1XPRA 3T1YL 1TWCH 1Q7YC 2EDGA 4JI2L 5FO9B 1PVOA 3D4WA 1LLRD 5IYBH 1EY6A 4IO9A 4KY7A 1S72A 2JA8B 4MZ9A 3BJUA 2XNAC 4KD4A 3PIPA 5BN4A 1E1OA 1JE5A 4Y7NH 4A3JH 1PH5A 1M1KC 1JWUD 1K83B 3I3CA 2DN8A 2F0VA 3NQTA 4O2DA 1FJGQ 1NMFA 1YVCA 2Z8LA 4XTCS 5C4HA 1YJ9A 5EPJA 1EL0A 2YYZA 1UNSA 5JVG3 1E22A 2R7FA 3NHHA 4IN3A 3S14B 4OO1I 1XNRQ 4BBRG 3PO2B 2UXBQ 1X3GA 1G291 1HCZA 1RKNA 5IT9c 5C4ZA 2PMZE 3J81j 4YY3L 5A35A 5GROA 5K36G 1VQ9A 1EY7A 4N9PA 4CKCA 3HOVG 4PG3A 2K05A 2BE5D 4F7XA 1QB5D 2Z6KA 1PTOH 2EY5A 1XMOQ 2J0TD 1S5BD 4OXPA 4DV6Q 5DAUA 3HOWG 1WFQA 4HCSA 5KNCA 5E3FA 5BR8L 4BWGB 3F2CA 2PPBC 1OXVA 2IW3A 3PV0A 5C44H 2RKSA 1V1OA 2L11A 1QG7A 4IALA 1MJCA 1VCIA 1TU2B 3DEOA 1CHQD 3KLRA 1WD0A 2IY5B 1ILQA 4YIJA 1YNXA 1BDOA 1H9RA 3EIVA 2KEEA 1X3FA 1STHA 1FNUA 2NVTB 2VXWA 1ENFA 3E5SA 3MWYW 2QKIC 5FLXE 4YCWA 1B8AA 2D0OA 1EFWA 5EJWA 4CDDC 1KNAA 2B2UA 4PQXA 4FF1A 4G57A 1FJGL 1II3A 1L0YB 3U4ZA 5KEEA 5K5PA 1KABA 3I90A 3SVMA 1SEBD 2XTIA 1LTID 1LTAD 2L55A 4N8FA 2MO0A 4K2KA 3T1HQ 2AWNA 3S15H 2AMCB 3H91A 4RGMA 2R7DA 1XNRL 3H0GH 2WINB 1CZGA 3Q23A 2UXBL 3HOVH 4IUPA 3E0EA 1X32A 1A6XA 3J80L 4C3IB 4R4OA 1NAPA 2SEBD 2IL8A 2F0PA 3OYYA 4MIUA 3AMUA 3D6WA 3KLSX 4Y7NB 5LHY1 4DR1Q 3A8JE 5CBAE 5JVH3 2CH4A 3IRBA 4H02A 1VQBA 1R9TH 1ET9A 3HOWH 4IUUA 1XMOL 4A3GG 1HUMA 4PMWA 4YHHQ 1YJWA 3BZCA 4XXEA 2R3ZA 5LL6X 1CKNB 4DV6L 3GTLH 5C3EG 3RR5A 1Y69U 1YNNC 2O5JC 3BDCA 1EY8A 1SNQA 2WAQE 1VQCA 1D1IA 2XN9C 4KTAA 2EJGC 1RF2D 4IJLA 3K80C 5I9PA 1YIJA 1PMRA 1MHWC 4R4CA 2QEXA 1I5FA 2NTTA 1GVPA 1PTOB 1NNXA 5F2DA 4DK1A 5IGDA 4C1NI 4WJ3M 4IZ8A 3DM3A 1SMYC 2B2WC 1H9SB 5IODA 1I4XA 4DGZA 4X62Q 4JVZA 4OHJA 3LNNA 2L9HA 4E6IA 1B7YB 3BVMA 4RCOA 3V05A 4EQOA 5C44B 2VQEQ 3W5OA 1EIYB 2L15A 3T1HL 2R93B 2NZOA 2R61A 3K7AH 4NXNQ 3T16A 3M7NA 2XVSA 4LF4Q 1STGA 3W1GA 3N6RA 1PRTC 1IL2A 4OO1H 4X64Q 4DUYQ 3AFQA 3S1QH 2OXPA 1X3PA 3QWNA 4DR1L 4K14A 3TEHB 1UUPA 1IBLQ 2QEJC 1CFMA 2ZJRA 1UWVA 2CQOA 4YHHL 5D65A 2Z1CA 4GN4B 1KL9A 4BBRB 4C2MH 3I4NH 3PCOB 1TWGB 3FP9A 2EPBA 2EVBA 2PMZB 1YEZA 2IT1A 1G6PA 1SJED 3HOVB 1VQFA 1DZ1A 1RJTA 2F3IA 3K8AA 3SK4A 1E2WA 3PSIA 3LWUA 4FNFA 4JBKA 2CFMA 4IOAA 3JAML 3X3MA 4XYQA 3STBD 1JOOA 1LYLA 3FRPB 1D1KA 4X65Q 1HR0Q 3DHQA 2YU9H 1TS3A 2K5HA 1PFSA 1R9TB 4HN7A 1YHAA 5HURA 1H9JA 2O5IC 1AE3A 4RH6A 4G7HC 1ET6A 3IFTA 1LV9A 2Z6BA 3J80i 2C9OA 1WCMB 4JK1C 3OIPA 2L5TA 1O78A 1K8GA 4JI1Q 2VQEL 2ENBA 2D62A 2ZTCA 4CDFC 4LUOA 4HJAA 2KENA 3PUWA 3BYYB 1HZCA 1CT1D 5I6WA 1KLGD 1X54A 4HSPA 4NXNL 1GUTA 2HDLA 1ESRA 3KLWA 4WJWA 4LF4L 2DNEA 1EYAA 1HZAA 3Q22A 1LM0A 3L9AX 4A3MG 3A5ZB 1B3QA 2FINB 2F0MA 1QZHA 3RZOH 4X64L 4DUYL 2ZT9C 3HS0C 3BZDB 4AH6A 2L0CA 4C3HB 3CU7A 3CPWA 3VR4A 2AUJD 1K8MA 1FNWA 3CQZH 1U9RA 3TBIB 2B2YA 3R3OA 4F87A 3RLOA 3E6ZX 4H44C 5HGTA 2ES2A 4DNIA 4IPHA 2UXDQ 1IBLL 3H09A 2RDHA 4K8IA 5DLQE 1OO9B 3MA2B 2F0JA 1I6HH 2EY2A 3M7GA 1XX8A 3A8KE 5CV5A 1BVSA 2ATWA 1VQGA 1KRTA 4DF7A 5EBDA 2GA4B 3K7AB 4LFBQ 3I73A 2IX0A 1SJHD 1CI3M 1OXXK 5JJIA 1YITA 4GKKQ 1GJXA 3BVZA 4TRDA 4JG2A 2E2JH 1X55A 3HG9A 3FKIG 3GP7A 4EGVA 3S1QB 4KHZA 2MFIA 4A3GB 3PUXA 5I2YA 3FPUB 2E75C 4ODGA 4V0BA 3J80c 3G6EA 2Y0SE 4X65L 1HR0L 1LT4D 5C3EB 4DV3Q 5GQOA 2K28A 2JP1A 3OW7A 3C1FA 4B3RL 2J7ZA 5E1FA 1VQPA 3CCMA 1GHJA 1UEAB 2NVQH 5IYDH 3MVVA 2OT2A 4BXXH 1WI5A 3CCLA 1WTXA 1V43A 4JI1L 1TQOA 3J7ZC 2ZTEA 3J81L 5D3IB 2NVXB 1SAPA 1I4GA 4K6DA 1HQRD 4KJNA 4HMIA 3MXGA 4H0LC 1YI2A 3PIP3 1PH9A 1BR9A 4LFAQ 1FYCA 3F2UA 2CW0D 1YJNA 2YU9B 1N36Q 2CWAA 5IGFA 1BQQT 5C5LA 4HTHA 3URYA 2LXKA 3NQIA 2LMCB 4DV2Q 3JC66 3GTKB 2JJQA 1EWHA 3ICEA 1WJJA 2LFNA 4ME3A 1VQKA 1PRTB 3J80E 3HEJA 1BBXC 3NWTA 2UXDL 5C3WA 2PI2E 3RZDB 1G51A 2EYJA 2NVYH 2WB1G 3JAMi 1XPOA 4B3TQ 2PW5A 2F0NA 4KV6A 2KECA 5CV9A 1VQIA 1JE4A 3F2BA 4FVMA 2KEDA 1PYBA 1Q1EA 3FKIH 4LFBL 5M3FH 2JE6I 4JI4Q 4J8QA 5CBEE 4GKKL 3RZOB 2ALYB 3WWVA 3U4VA 1H9MA 3ULPA 5DM73 3DUZA 4KMUC 4DV7Q 3HOXG 3I4MG 3FHWA 2PO4A 2UUBQ 4QCLA 4DV3L 2F0EA 2VUMB 2NZ1D 3NP8A 4CKEA 1JB7A 1X9NA 5LMNQ 5IP9G 1I6HB 4JBMA 3TS0A 2EYFA 1C9OA 1YNND 2RSOA 5GAHC 3S2DH 2B2TA 3P20A 4P74A 1S5DD 5FLXL 5M5YB 4L5TA 1JJ2A 4DR3Q 2B3GA 3FPPA 2JA5B 3BZKA 4R4TA 4JI7Q 2UXCQ 4F8MA 1L1OA 1IYUA 4RA8A 1C48A 2BDOA 3UDIA 2VNUD 1N36L 3JAMc 5BN5A 4DV2L 1ESFA 3E9HA 4GLXA 2D9UA 1YHQA 3FDTA 4C3JG 4AIMA 1B3AA 4LW1A 2ZJQA 1SE3A 3S2HH 2Z4HA 1X6OA 2E2HB 4B3TL 2K32A 3IAYA 2B39A 3CAMA 2AQ2B 4A3MB 1A0IA 2BA0A 4AQYQ 3EJIA 3K5MA 2Z4IA 2WIIB 2HUGA 3KF6B 5IIFA 4BY1G 5KNBA 3HOXH 3I4MH 4A3LG 2ID0A 4JI4L 1IYJB 4DUZQ 1VQ5A 3CF5A 1OXTA 3OWFA 1ZYRD 1AH9A 4DV7L 2UUBL 5IP9H 3NBIA 4HEDA 2DJGC 1SE8A 1HTPA 3C2PA 1GUNA 4IURA 2QW7A 5LMNL 5H1SE 4LMQD 1Z47A 3TZDA 1SXTA 1VQOA 1EY4A 1PH8A 4JI0Q 3E3XA 5ELEA 3CMEA 1SRUA 3FKIB 3GV3A 2VB3X 2EJFC 2EXZA 3W2DA 4CDCC 4QUFA 4DNRB 5FJ8G 5CV4A 2RHQB 2KOLA 4DR3L 1GHKA 3OOCA 4QL5A 1F77A 1IBMQ 1IBKQ 1N33Q 3M4OH 4DNTB 4BA2I 3AU7A 2XRSD 5ELCA 1TS4A 4EQ5A 4JI7L 2UXCL 5EPKA 3DWPA 1HXYD 1N9WA 2XWJB 4C3JH 1FD7D 4LF7Q 2DY7A 4A3JG 4OL7A 1YBYA 1JORA 2H5XA 3H6MA 2FFKB 1VQJA 2IWHA 2HIVA 2SOBA 1HZBA 1G2TA 2E2IH 1X3QA 1O7IA 1KRSA 3SK5A 4G7ZC 1Q12A 1PH6A 4DV1Q 4A3LH 4AQYL 1CSQA 1B44D 3AQQA 2MO1A 4N9TA 4LUVA 3J81c 1Y1WG 2I5HA 3STBC 2K33A 5IWAQ 1K8OA 1VQDA 4IFDI 2EIFA 4DUZL 4QUCA 1VMCA 4ZK9B 1V8QA 2Q2TA 3KUPA 3BS1A 3ND8A 2L1BA 3MEFA 1X56A 3MAQA 2DJFC 3K5NA 2A1AA 2MNAA 2K52A 3OMGA 1SNCA 2RQXA 1ONLA 2LY7A 1XPUA 1SYBA 4K8JA 1MIUA 1KDBA 1P16A 2SNSA 4IPDA 1PHJA 2EYLA 5FJ8H 3VR3A 4JI0L 2EQSA 2K5NA 3GO5A 4CGYB 5IP7G 1SE2A 1O7LA 3CCSA 2MJ8A 2TMPA 2I07B 1GUSA 1H95A 5DM63 1U4PA 1GO3E 3PMFA 3HOXB 2HD3A 4RMFA 3I4MB 3HOUG 1B2TA 2XSCA 4HIOA 1A8VA 4TQUS 1MJEA 4GOPA 1IBML 1QOHA 1N33L 1TWAH 4LUZA 1IKMA 5CMDA 2EYHA 1K9MC 3J81E 3HRZC 3QO2A 1F2ZA 1WTWA 1QZGA 3F1ZA 1F2YA 4JI6Q 4KHPQ 3KDFB 4POGA 2FMMA 3HP3A 4BS9A 1K73C 4RKLA 1AN8A 5JOBA 4A3EG 1E7ZA 1FL0A 1Y1WH 3G71A 3OTOQ 3I55A 3A74A 4DV1L 4POFA 1LTTD 5FLXc 3H0GG 3T53B 3R93A 2A74C 2BH2A 5IWAL 1PZKD 1EUJA 2CVRA 4AYBG 4AYBE 4C3JB 4GNXB 2VQFQ 1XMQQ 4JI5Q 1KIXA 3QR8A 1DGSA 1Y8PB 4OEMB 3U9OA 2NUCA 4OELB 2RHSB 2QDBA 3UI2A 4P75A 5IP7H 1STYA 3S1NB 4A3KB 1CQFA 1EYDA 2QILA 4H13C 4IJHA 5IE8A 4BY1B 1CTMA 3HOUH 3PUZA 1LO5D 1Z6HA 2FJ2A 1FR3A 4MHEA 2K75A 1JMCA 1EYGA 3ZYYX 2CW0C 1Q8KA 4CJ1B 5T1GA 1BF4A 3OW2A 1B4OA 5M9OA 5KYLA 1ZEQX 4A3FB 1I6VC 2RBMA 3GTMB 2PI2A 1I50H 3TMEA 1E0BA 4B3MQ 2ZXPA 1EQRA 2CH4W 1FVIA 1NE3A 1AFPA 2WACA 4DR6Q 3ITPA 1EQQA 4JI6L 4KHPL 1IL8A 4A3EH 4NXMQ 2F3VA 4JOIC 5FK9C 1AEXA 3GV6A 1X3EA 3D31A 1TWCB 3VYSA 3OTOL 4JBWA 1QCBD 3DLLA 1M4VA 1TWAB 3ULLA 4DU9A 2I0QA 4GKJQ 4I7ZC 1EU4A 4UP7A 4HSVA 4MNOA 4A3JB 4OO1G 3KK7A 5CV8A 2VQFL 1V1PB 1XMQL 4JI5L 4IFDH 2ICIA 5NUCA 2RCFA 1IXRA 3VR5A 2KHSA 5KIXA 2UUCQ 4RWSC 1OTCA 4HJ7A 1MSHA 4JC0A 2EZVA 5IYCG 4DKAC 4DV5Q 3I4NG 1XYIA 1Y1WB 1SFOH 1TR5A 2Q2HA 1JT8A 1PH3A 3CHBD 5DNFA 4FF4A 4CDEC 3HFZB 3I70A 5C4XG 3M3YH 4KN7C 2ZJPA 3SGIA 5J3BA 4GNXA 3Q24A 4ZRZA 4X3TA 1EEFD 4QB4A 4B3ML 1NY4A 1VQMA 4UP8A 4DR6L 2HIXA 4FXDA 5KYIA 3HOZG 1SROA 5ELFA 4NMZA 4NXML 3HOUB 1Y1VG 4HIKA 3NBHB 2QF7A 1BBWA 2F0UA 2OWOA 1PLFA 4DPGA 3PGZA 3RLNA 3CCUA 3NK9A 2EJMA 1ZYRC 2F3WA 4L5SA 2F4VQ 3BU2A 4GKJL 1BNZA 1YZ6A 3HOYH 3J7YW 1BCPD 1A2UA 3T56B 2HHHQ 1DONA 3I72A 1QILA 1D5MC 1CHPD 1RDPD 1PA6A 1XXGA 4YCVA 3CRKC 2N8NA 4HMJA 2AHOB 4A3EB 5IYCH 5FLMG 1M8AA 2RDGA 3UE1A 2UUCL 3SE0A 2F4IA 1BCPF 2VB2X 3S15B 2MQHA 4ID6A 3H0GB 1GUWA 2RSNA 4DV5L 4JYAQ 5C4XH 4YCUA 1RTNA 2OEOA 1J5EQ 3L3OC 2PCFB 4AYBB 4DR7Q 4LJZC 1UEBA 4YWMA 1RIPA 4X3KA 3HOWB 5I9OA 2A6HD 1VQEA 2CWPA 2XIWA 4I7AA 3S1RH 3GTLB 3HOZH 1IW7D 1CKNA 4ILWA 2KHIA 4X62L 1Y1VH 3NPPA 2B8GA 4R9WA 2O4XA 3KBGA 3BDOA 1KC8C 2B63H 1QVGA 3PIOA 3RD4A 5IYDG 3S16H 4ZAIA 5I6YA 4BXXG 2F0DA 4R8IA 1PH1A 1BXTA 2V1CC 4S3SA 1STAA 2YV5A 4YWLA 3M3YB 4QQBX 2BOSA 1N8RC 1L0WA 4DK6C 2KCCA 2F4VL 1EYCA 1BOSA 2IX3A 1LT3D 5TSSA
chains in the Genus database with same CATH topology
1OXSC 1H9SA 1STEA 1NR2A 1ENCA 1DM0B 2JEBI 1JR0D 4K2LA 1NSNS 5CGKA 2PQEA 4DAPA 5AFWA 2N55A 3WDNA 2X6LA 2H4OA 2TSSA 1B9MA 4DXFA 3SK8A 3K58A 4C1NK 2BCOA 1A2TA 1PXUA 1LTRD 4C2MB 3I4NB 5CC4A 1TS5A 4IUTA 3ONAB 4ZUJA 1QE6A 1SNDA 3A8IE 2NBFA 4RGTA 4EVOA 5C4XB 1KDCA 2MHVA 1VF7A 2A6ED 5EKIA 3SR1A 1AW7A 1E2VA 2A73B 4EQPA 2HCCA 1L0XB 3SHLA 4HR7B 1CM9A 3S1RB 3HOZB 3CKIB 3E0JA 4FXKC 1CA5A 1Y1VB 3G7LA 3TDQA 1SE4A 1JOQA 4UAIA 1B50A 2IX1A 3K5LA 4C56C 4GZYC 4DN4M 2EYOA 5EKLA 4QIWB 3QG1A 4PMBA 1TVXA 1F9SA 1HUNA 5C5MA 2LS01 4FF2A 2PNRC 3WOFA 3CQZB 2F0FA 1DOLA 2XRQD 4L8JA 2JSOA 3NXWA 1E2ZA 4DAVA 1TWHB 1MD2D 2AQ3B 3QIAA 3FVQA 3KLSA 2B2UC 1VDZA 5EKKA 1EQVA 1S5FD 3GD7A 2E2JB 1S4ZA 1Q3LA 1JWMD 1I4RA 1HQMC 3D4DA 4NW2A 4XDXA 2MGSA 2PZUA 1A3TA 2HDMA 4NP5A 3LWEA 1EOTA 1EU3A 2NVQB 3VR6A 3DXJC 2QCPX 3R8BA 1FGBD 1NR4A 3KF8A 2X69A 2X6GA 2MPMA 2B2WA 5T1IA 4DA2A 2OF1A 2PZWA 1D6EC 4HAEA 4WORA 4M8AA 1RD9D 2K04A 3MHBA 1F2MA 3LX0A 3RMHA 4IUQA 3P7JA 5D14A 4DK0A 2DY8A 3C3LA 2A69D 2WKDA 5G3LD 3OWEB 1UAPA 2NVYB 1EIGA 1PFMA 3K6OA 5G3LF 1B53A 2D5DA 2M9VA 3VYTA 5M3FB 5D3DA 2JA6B 3MFYA 1I3QB 2K7VA 4KY5A 5KNDA 3TP5A 2RDFA 2KA7A 2J4XA 1BCPC 1CK1A 4FXGC 3GQBA 3VA7A 3OIQA 3Q6SA 2K5QA 3SXHA 3VYRA 1WTPA 3S2DB 4L6TB 2K03A 2KUMA 1ICWA 1H9KA 2F0HA 1BO0A 1LTBD 4RGOS 1MGSA 2JXMB 5EBCA 2A6HC 3TSSA 4K5XA 4U68A 2F0GA 4A3IB 5LL6S 4XIGS 2WB1B 3RUZA 1IW7C 1WVLA 5IOCA 3S2HB 4KN4C 1HHVA 4J6HA 2PZTA 2Q8IB 1A3UA 3S9WA 1GUOA 5KGUA 2C5CA 5IGBA 2WKCA 1TY2A 4CJ2C 3MTSA 3K0YA 5J22A 3ERQA 3NWSA 1LABA 3NTKA 3P75A 1W6JA 2A5HA 5JPMC 3VYUA 2KCNA 1O7ZA 3BDLA 3J7AV 4Q5VA 1T5EA 3PIO3 1TIID 2B2YC 3HZXA 1EIHA 1W6KA 1HA5A 4OIKA 2A68C 2G9HD 3TP8A 2K6AA 5JEAG 4XT3B 2V4DA 3NSWA 3M4OB 5JEAJ 3FEWX 2WV6D 1NCVA 4XQNA 3WOEA 2XWBB 1U4LA 1A3VA 3V96A 4V190 4KK7A 1EZ8A 3O13A 2Q8RE 3IL8A 3OPOA 3Q0AA 1Q1BA 1ILPA 4EQNA 4Z9CB 4FO2A 1ML0D 4NKLA 1B1ZA 1O80A 4KKTA 3MXPA 4IFDG 2BDNA 2E2IB 5CORA 3AB9A 4IFDJ 2IPKD 4QMGA 1B9NA 4PMCA 5C0XI 1WTRA 2A6EC 2M2LA 4X3SA 1QWYA 1ZKOA 2E2DC 1G2SA 2EOTA 3W3AA 2ZXRA 2N88A 4XYOA 4TSSA 1PZID 3MXUA 2F0IA 1ZXTA 2EY1A 2JA7B 1QNUA 3A7LA 5CR3A 3I4LA 1BCPB 3RLFA 5IT9E 5JEAH 1F2LA 3G6JB 3EFXD 2F0WA 3ND9A 4L63B 1IKLA 1TY0A 1GXDC 2NYZD 4RAUC 1EQTA 4K6LA 4C3HG 3U9SA 5EGTA 1SYCA 1C4QA 1U4RA 5C3XA 1SNPA 1PZJD 2EYPA 5K36H 1HFNA 1Y8OB 2EY6A 1KTKA 2SNMA 4PV1C 3I8ZA 2H1EA 1FNVA 1I4HA 2RA4A 2B2TC 2HCIA 1SYFA 4CBVA 3TP7A 1D5XC 2WP8J 3DWAA 4PNYA 4B08A 1HTLD 2JYOA 5C0XG 4CHTB 5C0XJ 2RVLA 1LTGD 3MC0B 3GTOB 1KAAA 3I91A 3EQLC 3NUCA 4XT1B 1EFID 1IYVA 3VR2A 4DXGA 1D2BA 1F9QA 3DEPA 2K5DA 4K5VA 1G6ZA 1SYGA 2A69C 2B2VA 1PFBA 3A54A 1TS2A 1I50B 1DOMA 1JQYD 4FYDA 1KDAA 1DJRD 1R4PB 1DOKA 1QJOA 4ME5A 4KKSA 5J1ZA 1HFGA 1TT2A 1Q8IA 1IHZA 2K01A 1AZPA 1PFNA 2MP1A 1RTOA 3BG3A 2JEAI 5IGGA 4IUVA 5C0XH 3K59A 4R8NA 2KVMA 5I4DA 1V1PA 2ZXOA 4ZKCB 2LKVA 1WTQA 3NE5B 1G8ZD 1PDQA 5FKAC 1YNJD 3D8GA 4LK1C 2CHBD 1SFOB 3IKJA 1SYDA 5A2QE 2AQ1B 4B9XA 4RHRA 2NB0A 5DEHA 1S5CD 3BVGA 3D4RA 1PYWD 2NN6I 5FO7B 1O7YA 4CJ0B 1EY5A 3K5OA 4O42A 2F0OA 1JCKB 2SDFA 1PTOD 1XWEA 3R2IA 2K1BA 2KQ3A 2B8FA 3H3VC 3NTIA 5E4XA 5FOBB 1PTOF 2PYKA 5C6AA 2A68D 1Z7TA 3NBHA 3VA5A 1STNA 3TZUA 3D3RA 1A15A 2DNCA 4ZKBB 3TP6A 3HOYB 5JPNC 4U673 1AZQA 3MZ5A 5IGEA 1SNMA 1Y8NB 2K5WA 3SK6A 4B9WA 3EROA 1EY0A 1VMPA 5COYA 5I2XA 4KKUA 5ISRA 4ZLTF 1JICA 1JWSD 1STBA 1DYQA 1LT6D 4M1UB 4RGNA 1G91A 2F0QA 2MUYA 5KRUA 5M5WB 4I65A 1Q90A 2WAQB 5EQ0A 1HA6A 4ABNA 2KJXA 2R6GA 2G9DA 1EY9A 1MSGA 3SEBA 4HCEA 3NTHA 1F9PA 4F88A 4CKBA 2EYMA 2F0LA 3M85A 5JAVA 2NN6G 2B63B 1WTOA 2BE5C 3S16B 2EE1A 4TKOB 4XQQA 4FF3A 3M4YA 3C46A 1WTVA 1BUVT 4ULLA 2F0SA 1DXMA 2BA1A 4OGQC 4BY7B 3J7AF 3A55A 5FO8B 1GUGA 3GTPB 1EZ6A 3QJYA 1RCVD 1S5ED 3L7ZC 3S1MB 2F03A 1EEID 2F0KA 4RCNA 2AUKA 5E4WC 1R4QB 1C8CA 1JC7A 2ICEC 5J39A 3D6CA 2Q8TA 1J9OA 5JJZA 4G4KA 5IT9L 4WFN3 5M3MB 3GTQB 1RODA 1SNOA 3MEHA 1SBBB 2NN6H 1CA6A 4WRDA 2NWGA 5CV6A 4O1NA 3T4AC 3DWQA 5CV7A 4IUNA 1NUCA 1MI2A 4ZYSA 2NTSA 3OSOA 1KNEA 3HKZB 1D5ZC 1SMYD 3DM1A 1RHPA 4K5WA 3EVQA 3IFDA 2L12A 4OIJA 3A7AB 2M00A 2FHTA 3MFGA 1QNKA 4XQJA 1TKWB 3CRLC 4H7BA 5C4JB 1MBYA 3GTJB 4LAAA 3QOJA 1DCZA 1LTSD 3FMCA 1ENAA 4A93B 4UDUC 1PRTD 4ZUIA 1SDFA 3KBXA 4BBSB 3BYTB 3S17B 1EWCA 2R92B 3T51B 1PRTF 1LT5D 1JB3A 4DAYA 2O2LD 1VF5C 2E76C 3JAME 1SSOA 3R2TA 4IQZA 2IJ0A 2HQEA 5IGCA 4G7OC 2B2VC 4P2CB 4J1MA 1KLUD 3C1EA 3H94A 3MXNA 3QOLA 4KI0A 4NDXA 3GTGB 1XTCD 4RFBA 1T5XD 2Y0SB 4X3UA 5ELDA 1AP0A 4QF4A 1TWFB 5ELBA 1CZWA 1I4PA 1WD1A 3PUVA 1F9RA 2E74C 4KJOA 3DMUA 4C3IG 2F1MA 2R7ZB 4DFAA 3QB3A 3TN2A 4Q0FA 1I4QA 1LACA 1GOZA 3EA6A 5BN3A 3N52A 1JOKA 2FMCA 1DD2A 3PUYA 2F0TA 3OMCA 3K57A 3OHXC 2CQAA 3HGBA 3T13A 4A3BB 5M5XB 1HRJA 4KHVA 1YNJC 4RKBA 2PW7A 2D2CC 1U4MA 1OXUA 4BA1I 5CYUA 3SDZA 4MN3A 3X3NA 3A56A 4FP5D 1J8IA 4KY6A 4RHSA 2L4NA 3P1HA 1SYEA 3V2TA 4A3DB 3PO3B 1HPCA 1PTOC 2I46A 2AWOA 5A2QL 4ZQ3A 4KD3A 5EPLA 1CQVA 2EDGA 5FO9B 3D4WA 1LLRD 1EY6A 4KY7A 2JA8B 2XNAC 4KD4A 5BN4A 1JWUD 1K83B 3I3CA 2DN8A 2F0VA 3NQTA 2Z8LA 4XTCS 5C4HA 5EPJA 1EL0A 2YYZA 1UNSA 5JVG3 3NHHA 4IN3A 3S14B 4OO1I 3PO2B 1G291 1HCZA 1RKNA 5C4ZA 5A35A 5K36G 1EY7A 4N9PA 4CKCA 2K05A 2BE5D 4F7XA 1QB5D 1PTOH 2EY5A 2J0TD 1S5BD 5DAUA 4HCSA 5KNCA 5E3FA 4BWGB 2PPBC 1OXVA 2IW3A 3PV0A 2RKSA 1V1OA 2L11A 1QG7A 4IALA 1VCIA 1TU2B 3DEOA 1CHQD 3KLRA 1WD0A 1ILQA 4YIJA 1BDOA 1H9RA 2KEEA 1STHA 1FNUA 2NVTB 2VXWA 1ENFA 3E5SA 3MWYW 2QKIC 5FLXE 5EJWA 1KNAA 2B2UA 4PQXA 4FF1A 4G57A 1II3A 1L0YB 5KEEA 5K5PA 1KABA 3I90A 3SVMA 1SEBD 1LTID 1LTAD 2L55A 4K2KA 2AWNA 3H91A 4RGMA 2WINB 1CZGA 3Q23A 4IUPA 1X32A 1A6XA 3J80L 4C3IB 1NAPA 2SEBD 2IL8A 2F0PA 4MIUA 3AMUA 3D6WA 3KLSX 4Y7NB 5LHY1 3A8JE 5CBAE 5JVH3 1ET9A 4IUUA 1HUMA 4PMWA 4XXEA 2R3ZA 5LL6X 1Y69U 1YNNC 2O5JC 3BDCA 1EY8A 1SNQA 1D1IA 2XN9C 4KTAA 2EJGC 1RF2D 5I9PA 1PMRA 2NTTA 1PTOB 5F2DA 4DK1A 5IGDA 4C1NI 4IZ8A 1SMYC 2B2WC 1H9SB 5IODA 1I4XA 4DGZA 4E6IA 4OHJA 2L9HA 3LNNA 3BVMA 4RCOA 3V05A 4EQOA 5C44B 2R93B 2R61A 3T16A 3M7NA 2XVSA 1STGA 3N6RA 1PRTC 4OO1H 2OXPA 1X3PA 3QWNA 4K14A 1UUPA 2QEJC 1CFMA 5D65A 2Z1CA 4BBRB 1TWGB 2EPBA 2EVBA 2PMZB 2IT1A 1SJED 3HOVB 1DZ1A 1RJTA 3SK4A 1E2WA 3LWUA 4FNFA 3JAML 3X3MA 4XYQA 1JOOA 3FRPB 1D1KA 3DHQA 1TS3A 1R9TB 4HN7A 5HURA 1H9JA 2O5IC 4RH6A 4G7HC 1ET6A 3IFTA 1LV9A 2C9OA 1WCMB 4JK1C 3OIPA 2L5TA 1O78A 2ENBA 2D62A 3PUWA 3BYYB 1CT1D 5I6WA 1KLGD 4HSPA 1GUTA 2HDLA 1ESRA 4WJWA 2DNEA 1EYAA 3Q22A 3L9AX 2FINB 2F0MA 2ZT9C 3HS0C 3BZDB 4C3HB 2L0CA 3CU7A 3VR4A 2AUJD 1K8MA 1FNWA 1U9RA 3TBIB 2B2YA 3R3OA 4F87A 3E6ZX 4H44C 5HGTA 3H09A 2RDHA 4K8IA 1OO9B 3MA2B 2F0JA 2EY2A 3M7GA 1XX8A 3A8KE 5CV5A 4DF7A 5EBDA 2GA4B 3K7AB 3I73A 2IX0A 1SJHD 1CI3M 1OXXK 1GJXA 3BVZA 4TRDA 3HG9A 3GP7A 4EGVA 3S1QB 4KHZA 4A3GB 3PUXA 5I2YA 3FPUB 2E75C 4ODGA 4V0BA 1LT4D 5C3EB 2K28A 2JP1A 3OW7A 3C1FA 2J7ZA 5E1FA 1GHJA 1UEAB 3MVVA 2OT2A 1WTXA 1V43A 1TQOA 3J81L 5D3IB 2NVXB 1SAPA 1I4GA 4K6DA 1HQRD 4KJNA 4HMIA 3MXGA 4H0LC 3PIP3 1BR9A 1FYCA 3F2UA 2CW0D 2YU9B 5IGFA 1BQQT 5C5LA 3URYA 4HTHA 3NQIA 2LMCB 3GTKB 1EWHA 2LFNA 1PRTB 3J80E 3HEJA 1BBXC 3NWTA 5C3WA 3RZDB 2EYJA 2PW5A 2F0NA 4KV6A 2KECA 5CV9A 1JE4A 4FVMA 2KEDA 1Q1EA 2JE6I 4J8QA 5CBEE 3RZOB 1H9MA 5DM73 3DUZA 4KMUC 2PO4A 4QCLA 2F0EA 2VUMB 2NZ1D 3NP8A 4CKEA 1I6HB 2EYFA 1YNND 2RSOA 2B2TA 3P20A 1S5DD 5FLXL 5M5YB 3FPPA 2JA5B 4F8MA 1IYUA 4RA8A 1C48A 2BDOA 2VNUD 5BN5A 1ESFA 2D9UA 3FDTA 4C3JG 1B3AA 1SE3A 2Z4HA 2E2HB 2K32A 3IAYA 2B39A 2AQ2B 4A3MB 2BA0A 3EJIA 3K5MA 2Z4IA 2WIIB 2HUGA 5IIFA 5KNBA 2ID0A 1OXTA 3OWFA 1ZYRD 3NBIA 4HEDA 1HTPA 3C2PA 1GUNA 4IURA 4LMQD 1Z47A 3TZDA 1SXTA 1EY4A 5ELEA 3GV3A 3FKIB 2VB3X 2EJFC 2EXZA 3W2DA 4QUFA 4DNRB 5CV4A 2KOLA 1GHKA 3OOCA 1F77A 4DNTB 4BA2I 3AU7A 2XRSD 5ELCA 1TS4A 5EPKA 3DWPA 1HXYD 2XWJB 1FD7D 2DY7A 4OL7A 1JORA 3H6MA 2FFKB 2IWHA 2SOBA 1G2TA 1X3QA 3SK5A 4G7ZC 1Q12A 1B44D 4N9TA 2K33A 1K8OA 4IFDI 4QUCA 1VMCA 4ZK9B 1V8QA 3KUPA 3BS1A 3ND8A 2L1BA 3MAQA 3K5NA 3OMGA 1SNCA 2RQXA 1ONLA 2LY7A 1SYBA 4K8JA 1KDBA 2SNSA 2EYLA 3VR3A 3GO5A 4CGYB 1SE2A 1O7LA 2MJ8A 2TMPA 2I07B 1GUSA 5DM63 1U4PA 3HOXB 3PMFA 3I4MB 1B2TA 2XSCA 4TQUS 1QOHA 1IKMA 5CMDA 2EYHA 3J81E 3HRZC 3QO2A 1F2ZA 1WTWA 1F2YA 2FMMA 3HP3A 4BS9A 4RKLA 1AN8A 5JOBA 1LTTD 3T53B 3R93A 2A74C 1PZKD 2CVRA 4C3JB 1Y8PB 3U9OA 2NUCA 2QDBA 3UI2A 1STYA 3S1NB 4A3KB 1CQFA 1EYDA 2QILA 4H13C 4BY1B 1CTMA 3PUZA 1LO5D 1Z6HA 2FJ2A 1FR3A 4MHEA 3ZYYX 2CW0C 4CJ1B 5T1GA 1BF4A 1B4OA 5M9OA 5KYLA 1ZEQX 4A3FB 1I6VC 2RBMA 3GTMB 3TMEA 1E0BA 2ZXPA 1AFPA 2WACA 3ITPA 1IL8A 2F3VA 5FK9C 1AEXA 3GV6A 3D31A 1TWCB 3VYSA 4JBWA 1QCBD 1M4VA 1TWAB 4DU9A 4I7ZC 1EU4A 4HSVA 4A3JB 4OO1G 3KK7A 5CV8A 1V1PB 4IFDH 2ICIA 5NUCA 3VR5A 2KHSA 5KIXA 4RWSC 1MSHA 2EZVA 1XYIA 1Y1WB 1TR5A 3CHBD 5DNFA 4FF4A 3I70A 4KN7C 3Q24A 4ZRZA 4X3TA 1EEFD 4QB4A 4FXDA 5KYIA 5ELFA 4NMZA 3HOUB 2QF7A 2F0UA 1PLFA 3NK9A 2EJMA 1ZYRC 2F3WA 1BNZA 3J7YW 1BCPD 1A2UA 3T56B 1DONA 3I72A 1QILA 1D5MC 1CHPD 1RDPD 1XXGA 3CRKC 4HMJA 4A3EB 1M8AA 2RDGA 3SE0A 2F4IA 1BCPF 2VB2X 3S15B 4ID6A 3H0GB 1GUWA 2RSNA 1RTNA 2OEOA 3L3OC 2PCFB 4AYBB 4LJZC 4X3KA 3HOWB 5I9OA 2A6HD 2XIWA 3GTLB 1IW7D 4ILWA 3NPPA 2B8GA 4R9WA 2O4XA 3KBGA 3BDOA 3RD4A 4ZAIA 5I6YA 2F0DA 4R8IA 1BXTA 4S3SA 1STAA 3M3YB 2BOSA 2KCCA 1EYCA 1BOSA 2IX3A 1LT3D 5TSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KY5 A;  1STY A;  4H7B A;  3P1H A;  1SYE A;  3D8G A;  3V2T A;  4K14 A;  2F0F A;  1EYD A;  4ODG A;  1ENC A;  4G57 A;  1II3 A;  2RDF A;  3TP5 A;  2EYM A;  2F0L A;  5K5P A;  3NXW A;  1KAB A;  5JAV A;  4N9T A;  4LAA A;  4F8M A;  5CC4 A;  4NMZ A;  1SYF A;  4K2L A;  1NSN S;  5CGK A;  3QOJ A;  1SYD A;  3TP7 A;  4B9X A;  2PQE A;  1ENA A;  1A3V A;  3C1F A;  4K2K A;  4PNY A;  4KD3 A;  5DEH A;  2F0U A;  4ZQ3 A;  5E1F A;  1EZ8 A;  4ZUI A;  5M9O A;  5KYL A;  3MVV A;  4EQN A;  3D4W A;  3NK9 A;  5EKK A;  1EY6 A;  4NKL A;  3SXH A;  4KY7 A;  5C6A A;  2RBM A;  1EQV A;  2F3W A;  4KD4 A;  1TQO A;  3MXP A;  3TME A;  2F0P A;  1EY5 A;  3OMG A;  1SNC A;  3SK4 A;  2F0S A;  2F0O A;  4MIU A;  4K6D A;  4KJN A;  2F0V A;  1SYB A;  4K8J A;  1KDB A;  2SNS A;  2WAC A;  3D4D A;  1KAA A;  3SK8 A;  3NQT A;  4HMI A;  4QMG A;  1A2U A;  3ITP A;  5KIX A;  1JOO A;  4PMC A;  2EYL A;  2HQE A;  3NUC A;  2F0H A;  5IGC A;  5C4H A;  3EJI A;  3DHQ A;  2KQ3 A;  2PZU A;  4J1M A;  2F3V A;  5HUR A;  5IIF A;  4HMJ A;  3C1E A;  1A2T A;  1A3T A;  5IGF A;  2PYK A;  4NP5 A;  3PMF A;  5C5L A;  1AEX A;  3NHH A;  3BDC A;  1EZ6 A;  3QOL A;  4HTH A;  2F0G A;  4K5V A;  4K5X A;  4NDX A;  5J22 A;  1SYG A;  3OWF A;  4ID6 A;  4ZUJ A;  1EY8 A;  2F0I A;  1SNQ A;  2EY1 A;  4QF4 A;  3VA5 A;  1SND A;  3RUZ A;  1RKN A;  1STN A;  3HEJ A;  5C4Z A;  5IOC A;  5KEE A;  2OEO A;  4DU9 A;  4EVO A;  5C3W A;  2EYJ A;  2F0K A;  1KDC A;  2EYH A;  2ENB A;  4KJO A;  3DMU A;  1EY7 A;  2PW5 A;  4J6H A;  1F2Z A;  2F0N A;  2PZT A;  4KTA A;  4N9P A;  3TP6 A;  1A3U A;  4KV6 A;  3S9W A;  4DFA A;  5CR3 A;  5CV9 A;  4F7X A;  3SR1 A;  3QB3 A;  5I6W A;  1F2Y A;  1KDA A;  5I9P A;  5J39 A;  5CV8 A;  5KGU A;  4EQP A;  2OF1 A;  1EY4 A;  2PZW A;  3D6C A;  4WOR A;  5I9O A;  2EY5 A;  5IGB A;  3MZ5 A;  1EYA A;  5F2D A;  3MHB A;  3SHL A;  5IGD A;  1F2M A;  5NUC A;  3LX0 A;  5IGE A;  1SNM A;  2F0M A;  1JOK A;  1SNO A;  2KHS A;  5DAU A;  3MEH A;  3ERQ A;  3ERO A;  4IZ8 A;  4RKL A;  2EXZ A;  3P75 A;  4ME5 A;  3SK6 A;  4B9W A;  1EY0 A;  5J1Z A;  2F0T A;  3OMC A;  5CV4 A;  5JOB A;  2F0W A;  5IOD A;  5E3F A;  4DGZ A;  1TT2 A;  5ISR A;  1IHZ A;  4E6I A;  1U9R A;  4WRD A;  3R3O A;  5CV6 A;  2O4X A;  1STB A;  3T13 A;  1TR5 A;  5HGT A;  2RKS A;  4KHV A;  4EQO A;  5EGT A;  4IAL A;  4RKB A;  4K8I A;  1JOQ A;  2F0E A;  2F0Q A;  5I6Y A;  2F0J A;  1SYC A;  5IGG A;  2F0D A;  2EY2 A;  3BDL A;  3NP8 A;  5CV7 A;  4IUN A;  1NUC A;  5KRU A;  2PW7 A;  4YIJ A;  5CV5 A;  4I65 A;  4R8N A;  5C3X A;  1SNP A;  3OSO A;  4S3S A;  2EYF A;  1STA A;  3T16 A;  3HZX A;  4DF7 A;  2EYP A;  4OL7 A;  1JOR A;  2EYO A;  5EKL A;  1STG A;  1STH A;  3H6M A;  4K5W A;  4PMB A;  1EY9 A;  3EVQ A;  2EY6 A;  3E5S A;  2SNM A;  4TRD A;  2SOB A;  1EYC A;  3U9O A;  2OXP A;  2NUC A;  2LKV A;  2M00 A;  4KY6 A;  4QB4 A;  2QDB A;  5C5M A;  5KYI A;  3TP8 A;  3SK5 A; 
#chains in the Genus database with same CATH topology
 1OXS C;  1H9S A;  5FLM H;  1STE A;  1NR2 A;  1ENC A;  2HHH L;  1TWH H;  1DM0 B;  2JEB I;  4DAM A;  1JR0 D;  4K2L A;  1NSN S;  5LMU Q;  3CPF A;  5CGK A;  1VQN A;  4A75 A;  2PQE A;  1ASY A;  4DAP A;  1V1Q A;  5AFW A;  2N55 A;  3WDN A;  2X6L A;  2H4O A;  4A4I A;  3L2P A;  2I5M X;  2TSS A;  1JJG A;  2VL6 A;  1LUZ A;  5M3F G;  2G5D A;  1GD7 A;  1B9M A;  4DXF A;  3SK8 A;  4DR7 L;  3K58 A;  2JA6 G;  2R92 G;  4C1N K;  1T9H A;  3CCJ A;  2BCO A;  5M3M H;  3GTQ H;  4DK3 C;  1CKO A;  1A2T A;  2YTX A;  1PH2 A;  1PXU A;  1LTR D;  4C2M B;  3I4N B;  5CC4 A;  1TS5 A;  4IUT A;  3ONA B;  4ZUJ A;  1P8L A;  1QE6 A;  1SND A;  2LSS A;  3A8I E;  3KF8 B;  2NBF A;  4RGT A;  3CP0 A;  4EVO A;  5C4X B;  1KDC A;  2MHV A;  1QUQ B;  1VF7 A;  2A6E D;  5EKI A;  3SR1 A;  5IY0 A;  2P5Z X;  1AW7 A;  1E2V A;  1B70 B;  2A73 B;  4P71 A;  4EQP A;  4UY8 C;  3TRZ A;  2HCC A;  2Z9H A;  3H15 A;  1L0X B;  3SHL A;  4HR7 B;  1CM9 A;  3S1R B;  2Z6K C;  3HOZ B;  3CKI B;  3E0J A;  4FXK C;  4A3I G;  1Y1V B;  1CA5 A;  3G7L A;  3GTJ H;  3PF5 A;  3TDQ A;  4HIM A;  1SE4 A;  2WB1 E;  1C0A A;  4UAI A;  1JOQ A;  1B50 A;  2JK8 A;  5LMU L;  2XGT A;  3KOJ A;  2IX1 A;  1L2F A;  3ERS X;  4A93 H;  3K5L A;  1U0L A;  4C56 C;  4GZY C;  4DN4 M;  4R4Q A;  2K14 A;  2EYO A;  5EKL A;  5AJ3 Q;  4QIW B;  1LTL A;  3QG1 A;  4PMB A;  1TVX A;  4DAY B;  1F9S A;  2JA6 H;  2R92 H;  1I3Q H;  1HUN A;  5C5M A;  2E5L Q;  2LS0 1;  4OON A;  4FF2 A;  2PNR C;  3WOF A;  3CQZ B;  4KLK A;  2F0F A;  1DOL A;  2XRQ D;  4L8J A;  4K0K Q;  2JSO A;  3NXW A;  1E2Z A;  4DAV A;  1TWH B;  1MD2 D;  2AQ3 B;  3E9I A;  4GN3 B;  3QIA A;  3MXN B;  1VQ6 A;  3FVQ A;  3KLS A;  2K50 A;  2B2U C;  1U5K A;  1VDZ A;  4RG1 A;  5EKK A;  1EQV A;  1S5F D;  1N34 Q;  3GD7 A;  2UUA Q;  3TS2 A;  4MTK A;  4A3C G;  2E2J B;  3GDE A;  1TXY A;  1S4Z A;  1Q3L A;  4DR5 Q;  1JWM D;  1I4R A;  1HQM C;  2D0P A;  3D4D A;  1VS0 A;  1GKH A;  4NW2 A;  4LFA L;  4XDX A;  2MGS A;  2PZU A;  2QA4 A;  1S3O A;  3TRE A;  3ER0 A;  1A3T A;  2HDM A;  4A3I H;  3M4Q A;  4NP5 A;  3LWE A;  1EOT A;  1EU3 A;  1D8L A;  2NVQ B;  1NBW A;  5M5X H;  3VR6 A;  3DXJ C;  2HQL A;  2QCP X;  3R8B A;  4X6A H;  1FGB D;  1NR4 A;  3KF8 A;  2X69 A;  2X6G A;  3AEV A;  2MPM A;  2B2W A;  5T1I A;  4DA2 A;  2OF1 A;  2PZW A;  2OCE A;  1D6E C;  4HAE A;  4WOR A;  5GAG C;  4M8A A;  1RD9 D;  5AJ3 L;  2PNH A;  2K04 A;  3MHB A;  1F2M A;  3LX0 A;  3RMH A;  4IUQ A;  3P7J A;  5D14 A;  1XNQ Q;  4DK0 A;  2DY8 A;  3C3L A;  2A69 D;  1SMX A;  2E5L L;  4X66 Q;  4B3S Q;  2WKD A;  5G3L D;  1YHB A;  3CW2 C;  4TVA B;  3J81 i;  4A3D H;  1K28 A;  3PO3 H;  4K0K L;  3U58 A;  3OWE B;  1UAP A;  2NVY B;  1EIG A;  1PFM A;  2JA7 G;  3K6O A;  5G3L F;  1B53 A;  2D5D A;  5EAY A;  2M9V A;  4DR2 Q;  1J6Q A;  3VYT A;  4APV A;  4A3C H;  4OWT B;  4R1J A;  5M3F B;  1N34 L;  3CXC A;  2UUA L;  5D3D A;  2JA6 B;  3MFY A;  1GM5 A;  1I3Q B;  1K83 H;  2K7V A;  4KY5 A;  4DR5 L;  4L5R C;  5KND A;  3TP5 A;  2RDF A;  2KA7 A;  2J4X A;  1KQS A;  1BCP C;  1CK1 A;  4LF6 Q;  4FXG C;  1Z9F A;  2F52 A;  3GQB A;  3VA7 A;  3OIQ A;  3Q6S A;  2K5Q A;  3SXH A;  3VYR A;  1WTP A;  3S2D B;  3M9B A;  4L6T B;  2OTJ A;  2K03 A;  3UE0 A;  2KUM A;  3KFU A;  1ICW A;  3ZJY C;  1H9K A;  2F0H A;  2N3S A;  1BO0 A;  1LTB D;  4RGO S;  1MGS A;  1NMG A;  1XNQ L;  2JXM B;  5EBC A;  2A6H C;  3TSS A;  4K5X A;  4U68 A;  2F0G A;  4A3I B;  4GLV B;  5LL6 S;  4B3S L;  4XIG S;  1VQH A;  2WB1 B;  2JA7 H;  5GAE C;  3RUZ A;  1IW7 C;  1WVL A;  3CC7 A;  5IOC A;  2ASB A;  1XTD A;  3S2H B;  4KN4 C;  4DV0 Q;  1HHV A;  5JJK A;  4HJ9 A;  4J6H A;  3I56 A;  2PZT A;  2Q2U A;  2AKW B;  3F8T A;  2Q8I B;  1A3U A;  2QGQ A;  3S9W A;  4UP9 A;  1GUO A;  4DR2 L;  5KGU A;  5ELN A;  1XJV A;  2C5C A;  5IGB A;  2FXQ A;  2WKC A;  1Q82 C;  1TY2 A;  4JCV E;  4CJ2 C;  3MTS A;  1VQL A;  3K0Y A;  5J22 A;  3ERQ A;  3KF6 A;  3NWS A;  1LAB A;  3NTK A;  3P75 A;  3EBE A;  1IBK L;  1W6J A;  2A5H A;  2E8G A;  2OQK A;  3VYU A;  5JPM C;  1K0S A;  3K81 C;  2KCN A;  1O7Z A;  2CKZ B;  3BDL A;  3J7A V;  4LF6 L;  4LF7 L;  4Q5V A;  1T5E A;  3PIO 3;  1TII D;  2B2Y C;  3HZX A;  1EIH A;  1W6K A;  2UU9 Q;  1HA5 A;  4C3I H;  2R93 G;  4OIK A;  2A68 C;  2G9H D;  4LFC Q;  3TQY A;  2RF4 A;  3TP8 A;  2K6A A;  3HKS A;  5JEA G;  4XT3 B;  1PH7 A;  4EX5 A;  2V4D A;  3NSW A;  3M4O B;  5JEA J;  3UDG A;  1HNW Q;  3FEW X;  2WV6 D;  1K3R A;  1NCV A;  1NJI C;  4XQN A;  3WOE A;  2GVB A;  1JJC B;  2XWB B;  1U4L A;  1A3V A;  3V96 A;  4V19 0;  4KK7 A;  1EZ8 A;  3O13 A;  2Q8R E;  3IL8 A;  3OPO A;  3Q0A A;  1Q1B A;  1ILP A;  4EQN A;  4Z9C B;  4FO2 A;  1ML0 D;  1UE7 A;  3CCQ A;  4NKL A;  4LF8 Q;  1B1Z A;  3I7F A;  1O80 A;  4KKT A;  3MXP A;  4DV0 L;  4IFD G;  1CSP A;  2BDN A;  2E2I B;  3GTO H;  5COR A;  3AB9 A;  1HNX Q;  2A8V A;  4IFD J;  2IPK D;  4QMG A;  1B9N A;  1K3B C;  4PMC A;  1W3S A;  5C0X I;  1WTR A;  2A6E C;  2M2L A;  4X3S A;  1QWY A;  1ZKO A;  2E2D C;  1G2S A;  2EOT A;  3W3A A;  2ZXR A;  2N88 A;  1PV4 A;  4XYO A;  4TSS A;  1PZI D;  3MXU A;  2F0I A;  1ZXT A;  2EY1 A;  2N49 A;  3K0X A;  1V9P A;  1Q86 C;  2JA7 B;  1QNU A;  4P73 A;  1IZ6 A;  2GN5 A;  3W1B A;  1WCM G;  1VQ7 A;  3J7A 5;  3A7L A;  1SN8 A;  5CR3 A;  2R93 H;  3I4L A;  1EIF A;  2JA9 A;  2UU9 L;  5JJL A;  1BCP B;  3RLF A;  5IT9 E;  5JEA H;  1F2L A;  4JI3 Q;  2WFW A;  3G6J B;  3LGJ A;  4LFC L;  2KBN A;  3EFX D;  2F0W A;  3G48 A;  3ND9 A;  3NEL A;  4P72 A;  4L63 B;  1IKL A;  1TY0 A;  1GXD C;  2NYZ D;  4RAU C;  1EQT A;  4K6L A;  4C3H G;  1Q46 A;  3U9S A;  5EGT A;  1HNW L;  4JPB W;  4BBR H;  1SYC A;  4PZ6 A;  1EOV A;  1C4Q A;  1VQ4 A;  1U4R A;  4UPA A;  1TWG H;  5C3X A;  1SNP A;  1PZJ D;  2EYP A;  3Q8D A;  3HOY G;  2IHE A;  5K36 H;  1HFN A;  3KDF A;  4LF8 L;  1Y8O B;  2EY6 A;  3UDX A;  1KTK A;  2SNM A;  4PV1 C;  3I8Z A;  4LWC A;  2OQ0 A;  2H1E A;  1HNX L;  1FNV A;  1I4H A;  2RA4 A;  2B2T C;  2KHJ A;  3AYH B;  2VZA A;  2HCI A;  1SYF A;  4CBV A;  3TP7 A;  1D5X C;  4N8X 1;  2IHF A;  2WP8 J;  3DWA A;  4PNY A;  1UE1 A;  2PQA B;  4B08 A;  1WCM H;  3CC2 A;  4IPC A;  1HTL D;  2JYO A;  1L1O C;  2WAQ G;  5C0X G;  3U50 C;  4CHT B;  5C0X J;  2VW9 A;  2RVL A;  1LTG D;  3MC0 B;  3GTO B;  1KAA A;  2VY3 A;  3I91 A;  3EQL C;  3NUC A;  4XT1 B;  1WYD A;  3F2D A;  1EFI D;  1IYV A;  3VR2 A;  4PZ7 A;  3H3V I;  4JI3 L;  4DXG A;  1D2B A;  3A0J A;  4C3H H;  1F9Q A;  2B63 G;  3DEP A;  2K5D A;  4K5V A;  1G6Z A;  1SYG A;  2A69 C;  2B2V A;  1PFB A;  3A54 A;  1TS2 A;  4QIW E;  4R4I A;  1I50 B;  1DOM A;  1JQY D;  4FYD A;  3CCE A;  1KDA A;  1DJR D;  1R4P B;  1A62 A;  1DOK A;  1FGU A;  4HID A;  2ZM6 Q;  4OX9 Q;  4BY7 G;  1WOC A;  4JI8 Q;  1QJO A;  4QY7 A;  4ME5 A;  4KKS A;  3CC4 A;  5J1Z A;  1HFG A;  1TT2 A;  1Q8I A;  1IHZ A;  2K01 A;  4A3G H;  5L37 A;  1AZP A;  4QJF A;  5C3E H;  1PFN A;  2KCM A;  2MP1 A;  2N78 A;  1RL2 A;  1RTO A;  3BG3 A;  2JEA I;  4PZ8 A;  3RN2 A;  4MTN A;  5IGG A;  5M5W H;  4IUV A;  5C0X H;  3K59 A;  4R8N A;  3CD6 A;  2VUM G;  2I5L X;  2KVM A;  5I4D A;  4DR4 Q;  1V1P A;  1E24 A;  2ZXO A;  4ZKC B;  2NVX H;  2LKV A;  1WTQ A;  1SLJ A;  3NE5 B;  5M3M G;  2K4K A;  1G8Z D;  1PDQ A;  3I4O A;  5FKA C;  1YNJ D;  3D8G A;  3S24 A;  4LK1 C;  1HR0 W;  1UE5 A;  2CHB D;  3EN2 A;  1SFO B;  1KAW A;  2A19 A;  3NEM A;  1VQA A;  3IKJ A;  4YWK A;  1SYD A;  5A2Q E;  2AQ1 B;  4B9X A;  4RHR A;  2JA5 G;  2NB0 A;  4GN5 A;  5DEH A;  4B3R Q;  3GTK H;  4LF9 Q;  1S5C D;  2HT1 A;  3BVG A;  3D4R A;  2PQA A;  1PYW D;  2NN6 I;  2RCN A;  3HKZ G;  3HKZ E;  5FO7 B;  3RZD H;  1O7Y A;  4CJ0 B;  1S40 A;  1EY5 A;  2C35 B;  3K5O A;  4O42 A;  2F0O A;  1JCK B;  3ULJ A;  2SDF A;  1PTO D;  1D7Q A;  1XWE A;  4BY7 H;  3R2I A;  2K1B A;  2VS1 A;  3UDF A;  2KQ3 A;  2B8F A;  3H3V C;  2ZM6 L;  3NTI A;  2JN4 A;  5E4X A;  2EXD A;  4OWW B;  4OX9 L;  3GTP H;  5FOB B;  1PTO F;  1PYS B;  4JI8 L;  2PYK A;  5C6A A;  4Y52 H;  2A68 D;  3S1M H;  1Z7T A;  3NBH A;  4ALP A;  3VA5 A;  4JYA L;  4A93 G;  1STN A;  3TZU A;  1J5E L;  3D3R A;  1A15 A;  2VUM H;  4OWX B;  2DNC A;  1UE6 A;  4BBS G;  4ZKB B;  3TP6 A;  1W2B A;  3HOY B;  4GOP C;  2YTV A;  5JPN C;  4U67 3;  1AZQ A;  3MZ5 A;  2JQO A;  5IGE A;  1SNM A;  1Y8N B;  5M5Y H;  4DR4 L;  2K5W A;  3SK6 A;  4B9W A;  3ERO A;  1EY0 A;  1VMP A;  5COY A;  3AFP A;  5I2X A;  4KKU A;  5ISR A;  3M4P A;  1CUK A;  4ZLT F;  2JA5 H;  1JIC A;  1BBU A;  1JWS D;  1L1O B;  1STB A;  1E3P A;  1DYQ A;  1LT6 D;  4M1U B;  2Y0S G;  4RGN A;  1G91 A;  2F0Q A;  4HJ5 A;  2MUY A;  1M90 C;  5KRU A;  5M5W B;  4I65 A;  1Q90 A;  2WAQ B;  5EQ0 A;  4LF9 L;  1HA6 A;  4ABN A;  2R7Z G;  3H3V H;  2KJX A;  1KD1 C;  2R6G A;  1I94 Q;  2G9D A;  1EY9 A;  1MSG A;  2E2H H;  3SEB A;  5C4J H;  4HCE A;  1Q81 C;  3NTH A;  1F9P A;  4A3M H;  4F88 A;  4CKB A;  1KHI A;  2EYM A;  2F0L A;  4JW0 A;  3M85 A;  5JAV A;  2B29 A;  4A76 A;  2NN6 G;  4HJ8 A;  2B63 B;  1WTO A;  2BE5 C;  3S16 B;  2EE1 A;  4A3B G;  4TKO B;  1PH4 A;  1A63 A;  4XQQ A;  4FF3 A;  3M4Y A;  4L5Q A;  4BBS H;  3C46 A;  3S17 H;  1WTV A;  1BUV T;  4ULL A;  4JOI A;  2F0S A;  4DV4 Q;  1X65 A;  1DXM A;  5HGQ A;  2BA1 A;  3RN5 A;  1NTG A;  4OGQ C;  4BY7 B;  4GS3 A;  3J7A F;  3A55 A;  5FO8 B;  1HH2 P;  4A3D G;  3PO3 G;  3GTG H;  1GUG A;  4JBJ A;  3GTP B;  4J15 A;  1EZ6 A;  3QJY A;  1RCV D;  1TWF H;  1S5E D;  1HNZ Q;  3L7Z C;  4IPG A;  3S1M B;  2F03 A;  1EEI D;  2F0K A;  5LMN W;  4RCN A;  2R7Z H;  2DGY A;  2JA8 G;  1K0R A;  2AUK A;  1HJP A;  1R4Q B;  5E4W C;  1C8C A;  1JC7 A;  2ICE C;  2ZTD A;  5J39 A;  5E7N A;  2OTL A;  3D6C A;  2Q8T A;  1J9O A;  3VDY A;  3KYH C;  5JJZ A;  4G4K A;  1I94 L;  5IT9 L;  4WFN 3;  5M3M B;  3GTQ B;  1ROD A;  1SNO A;  3MEH A;  1Y14 B;  1SBB B;  2DUD A;  2NN6 H;  4LNQ A;  1CA6 A;  4A3B H;  4O0A A;  3CCV A;  4WRD A;  2NWG A;  5CV6 A;  4O1N A;  4WJ4 A;  3PO2 G;  3T4A C;  3G4S A;  2NZH A;  3DWQ A;  5CV7 A;  3KJP A;  4IUN A;  5ELO A;  1NUC A;  1MI2 A;  4ZYS A;  1QUQ A;  2NTS A;  5HY6 A;  2BH8 A;  1KNE A;  3HKZ B;  3OSO A;  1D5Z C;  4IOC A;  1SMY D;  3DM1 A;  1RHP A;  4ZCK A;  4K5W A;  3EVQ A;  3IFD A;  2L12 A;  2K5V A;  2YTY A;  4OIJ A;  3A7A B;  4LF5 Q;  2M00 A;  2FHT A;  3MFG A;  1QNK A;  4XQJ A;  4DV4 L;  1TKW B;  3CRL C;  4H7B A;  5C4J B;  1MBY A;  4GNX C;  3GTJ B;  4LAA A;  4A3K G;  1BKB A;  3L0O A;  1DCZ A;  3QOJ A;  1KXL A;  1LTS D;  1N32 Q;  3FMC A;  1ENA A;  4GOP B;  4A93 B;  4UDU C;  1PRT D;  4ZUI A;  3I2Z A;  3A5U A;  4UHV A;  1HNZ L;  1SDF A;  2JA8 H;  3CMA A;  3KBX A;  4BBS B;  5GAD C;  3BYT B;  2Z0S A;  2LXJ A;  3S17 B;  1EWC A;  2R92 B;  3T51 B;  4A3F G;  1PRT F;  1LT5 D;  1JB3 A;  4DAY A;  1SR3 A;  2O2L D;  1VF5 C;  2Q2I A;  2E76 C;  3JAM E;  1SSO A;  3R2T A;  4IQZ A;  2IJ0 A;  2HQE A;  5IGC A;  1HZ9 A;  2KCT A;  4G7O C;  2B2V C;  4P2C B;  4J1M A;  2GVA A;  4JV5 Q;  1QVF A;  1KLU D;  3C1E A;  3D0F A;  3S14 H;  3H94 A;  3MXN A;  3QOL A;  4KI0 A;  4NDX A;  3GTG B;  3PO2 H;  1XTC D;  4RFB A;  1T5X D;  3T1Y Q;  2Y0S B;  2QDL A;  4X3U A;  5ELD A;  4JI2 Q;  1AP0 A;  4QF4 A;  1TWF B;  5ELB A;  3PF4 A;  1CZW A;  1I4P A;  1WD1 A;  3PUV A;  4FDB A;  1F9R A;  2E74 C;  4KJO A;  3DMU A;  4C3I G;  1MKH A;  2F1M A;  5IYB G;  2R7Z B;  4DFA A;  1QVC A;  3QB3 A;  3TN2 A;  4Q0F A;  1I4Q A;  3PQI A;  1LAC A;  1GOZ A;  3EA6 A;  5BN3 A;  3N52 A;  3CCR A;  1JOK A;  2FMC A;  1DD2 A;  3PUY A;  4LF5 L;  2F0T A;  3OMC A;  4X66 L;  3S1N H;  4A3K H;  3K57 A;  3OHX C;  2CQA A;  4BY1 H;  3HGB A;  3T13 A;  4A3B B;  5M5X B;  1HRJ A;  4KHV A;  4YY3 Q;  1K8A C;  1YNJ C;  4RKB A;  1AE2 A;  2CCZ A;  1CKM A;  1C7Y A;  1N32 L;  2PW7 A;  3K7U C;  2D2C C;  4NPS A;  3KJO A;  4A3F H;  1U4M A;  1OXU A;  4BA1 I;  2NVT H;  1ASZ A;  1ICF B;  5CYU A;  3GTM H;  3SDZ A;  4MN3 A;  4NB3 A;  3X3N A;  3A56 A;  4FP5 D;  1J8I A;  4KY6 A;  3NEN A;  1VQ8 A;  4RHS A;  3RNU A;  2L4N A;  5BR8 Q;  3P1H A;  1SYE A;  3V2T A;  4QGU A;  1EWI A;  4A3D B;  3PO3 B;  1HPC A;  1PTO C;  2I46 A;  2AWO A;  5A2Q L;  4JV5 L;  1E1T A;  1WTH A;  4GLA C;  4ZQ3 A;  3B6Y A;  4KD3 A;  5C44 G;  5EPL A;  1CQV A;  1XPR A;  3T1Y L;  1TWC H;  1Q7Y C;  2EDG A;  4JI2 L;  5FO9 B;  1PVO A;  3D4W A;  1LLR D;  5IYB H;  1EY6 A;  4IO9 A;  4KY7 A;  1S72 A;  2JA8 B;  4MZ9 A;  3BJU A;  2XNA C;  4KD4 A;  3PIP A;  5BN4 A;  1E1O A;  1JE5 A;  4Y7N H;  4A3J H;  1PH5 A;  1M1K C;  1JWU D;  1K83 B;  3I3C A;  2DN8 A;  2F0V A;  3NQT A;  4O2D A;  1FJG Q;  1NMF A;  1YVC A;  2Z8L A;  4XTC S;  5C4H A;  1YJ9 A;  5EPJ A;  1EL0 A;  2YYZ A;  1UNS A;  5JVG 3;  1E22 A;  2R7F A;  3NHH A;  4IN3 A;  3S14 B;  4OO1 I;  1XNR Q;  4BBR G;  3PO2 B;  2UXB Q;  1X3G A;  1G29 1;  1HCZ A;  1RKN A;  5IT9 c;  5C4Z A;  2PMZ E;  3J81 j;  4YY3 L;  5A35 A;  5GRO A;  5K36 G;  1VQ9 A;  1EY7 A;  4N9P A;  4CKC A;  3HOV G;  4PG3 A;  2K05 A;  2BE5 D;  4F7X A;  1QB5 D;  2Z6K A;  1PTO H;  2EY5 A;  1XMO Q;  2J0T D;  1S5B D;  4OXP A;  4DV6 Q;  5DAU A;  3HOW G;  1WFQ A;  4HCS A;  5KNC A;  5E3F A;  5BR8 L;  4BWG B;  3F2C A;  2PPB C;  1OXV A;  2IW3 A;  3PV0 A;  5C44 H;  2RKS A;  1V1O A;  2L11 A;  1QG7 A;  4IAL A;  1MJC A;  1VCI A;  1TU2 B;  3DEO A;  1CHQ D;  3KLR A;  1WD0 A;  2IY5 B;  1ILQ A;  4YIJ A;  1YNX A;  1BDO A;  1H9R A;  3EIV A;  2KEE A;  1X3F A;  1STH A;  1FNU A;  2NVT B;  2VXW A;  1ENF A;  3E5S A;  3MWY W;  2QKI C;  5FLX E;  4YCW A;  1B8A A;  2D0O A;  1EFW A;  5EJW A;  4CDD C;  1KNA A;  2B2U A;  4PQX A;  4FF1 A;  4G57 A;  1FJG L;  1II3 A;  1L0Y B;  3U4Z A;  5KEE A;  5K5P A;  1KAB A;  3I90 A;  3SVM A;  1SEB D;  2XTI A;  1LTI D;  1LTA D;  2L55 A;  4N8F A;  2MO0 A;  4K2K A;  3T1H Q;  2AWN A;  3S15 H;  2AMC B;  3H91 A;  4RGM A;  2R7D A;  1XNR L;  3H0G H;  2WIN B;  1CZG A;  3Q23 A;  2UXB L;  3HOV H;  4IUP A;  3E0E A;  1X32 A;  1A6X A;  3J80 L;  4C3I B;  4R4O A;  1NAP A;  2SEB D;  2IL8 A;  2F0P A;  3OYY A;  4MIU A;  3AMU A;  3D6W A;  3KLS X;  4Y7N B;  5LHY 1;  4DR1 Q;  3A8J E;  5CBA E;  5JVH 3;  2CH4 A;  3IRB A;  4H02 A;  1VQB A;  1R9T H;  1ET9 A;  3HOW H;  4IUU A;  1XMO L;  4A3G G;  1HUM A;  4PMW A;  4YHH Q;  1YJW A;  3BZC A;  4XXE A;  2R3Z A;  5LL6 X;  1CKN B;  4DV6 L;  3GTL H;  5C3E G;  3RR5 A;  1Y69 U;  1YNN C;  2O5J C;  3BDC A;  1EY8 A;  1SNQ A;  2WAQ E;  1VQC A;  1D1I A;  2XN9 C;  4KTA A;  2EJG C;  1RF2 D;  4IJL A;  3K80 C;  5I9P A;  1YIJ A;  1PMR A;  1MHW C;  4R4C A;  2QEX A;  1I5F A;  2NTT A;  1GVP A;  1PTO B;  1NNX A;  5F2D A;  4DK1 A;  5IGD A;  4C1N I;  4WJ3 M;  4IZ8 A;  3DM3 A;  1SMY C;  2B2W C;  1H9S B;  5IOD A;  1I4X A;  4DGZ A;  4X62 Q;  4JVZ A;  4OHJ A;  3LNN A;  2L9H A;  4E6I A;  1B7Y B;  3BVM A;  4RCO A;  3V05 A;  4EQO A;  5C44 B;  2VQE Q;  3W5O A;  1EIY B;  2L15 A;  3T1H L;  2R93 B;  2NZO A;  2R61 A;  3K7A H;  4NXN Q;  3T16 A;  3M7N A;  2XVS A;  4LF4 Q;  1STG A;  3W1G A;  3N6R A;  1PRT C;  1IL2 A;  4OO1 H;  4X64 Q;  4DUY Q;  3AFQ A;  3S1Q H;  2OXP A;  1X3P A;  3QWN A;  4DR1 L;  4K14 A;  3TEH B;  1UUP A;  1IBL Q;  2QEJ C;  1CFM A;  2ZJR A;  1UWV A;  2CQO A;  4YHH L;  5D65 A;  2Z1C A;  4GN4 B;  1KL9 A;  4BBR B;  4C2M H;  3I4N H;  3PCO B;  1TWG B;  3FP9 A;  2EPB A;  2EVB A;  2PMZ B;  1YEZ A;  2IT1 A;  1G6P A;  1SJE D;  3HOV B;  1VQF A;  1DZ1 A;  1RJT A;  2F3I A;  3K8A A;  3SK4 A;  1E2W A;  3PSI A;  3LWU A;  4FNF A;  4JBK A;  2CFM A;  4IOA A;  3JAM L;  3X3M A;  4XYQ A;  3STB D;  1JOO A;  1LYL A;  3FRP B;  1D1K A;  4X65 Q;  1HR0 Q;  3DHQ A;  2YU9 H;  1TS3 A;  2K5H A;  1PFS A;  1R9T B;  4HN7 A;  1YHA A;  5HUR A;  1H9J A;  2O5I C;  1AE3 A;  4RH6 A;  4G7H C;  1ET6 A;  3IFT A;  1LV9 A;  2Z6B A;  3J80 i;  2C9O A;  1WCM B;  4JK1 C;  3OIP A;  2L5T A;  1O78 A;  1K8G A;  4JI1 Q;  2VQE L;  2ENB A;  2D62 A;  2ZTC A;  4CDF C;  4LUO A;  4HJA A;  2KEN A;  3PUW A;  3BYY B;  1HZC A;  1CT1 D;  5I6W A;  1KLG D;  1X54 A;  4HSP A;  4NXN L;  1GUT A;  2HDL A;  1ESR A;  3KLW A;  4WJW A;  4LF4 L;  2DNE A;  1EYA A;  1HZA A;  3Q22 A;  1LM0 A;  3L9A X;  4A3M G;  3A5Z B;  1B3Q A;  2FIN B;  2F0M A;  1QZH A;  3RZO H;  4X64 L;  4DUY L;  2ZT9 C;  3HS0 C;  3BZD B;  4AH6 A;  2L0C A;  4C3H B;  3CU7 A;  3CPW A;  3VR4 A;  2AUJ D;  1K8M A;  1FNW A;  3CQZ H;  1U9R A;  3TBI B;  2B2Y A;  3R3O A;  4F87 A;  3RLO A;  3E6Z X;  4H44 C;  5HGT A;  2ES2 A;  4DNI A;  4IPH A;  2UXD Q;  1IBL L;  3H09 A;  2RDH A;  4K8I A;  5DLQ E;  1OO9 B;  3MA2 B;  2F0J A;  1I6H H;  2EY2 A;  3M7G A;  1XX8 A;  3A8K E;  5CV5 A;  1BVS A;  2ATW A;  1VQG A;  1KRT A;  4DF7 A;  5EBD A;  2GA4 B;  3K7A B;  4LFB Q;  3I73 A;  2IX0 A;  1SJH D;  1CI3 M;  1OXX K;  5JJI A;  1YIT A;  4GKK Q;  1GJX A;  3BVZ A;  4TRD A;  4JG2 A;  2E2J H;  1X55 A;  3HG9 A;  3FKI G;  3GP7 A;  4EGV A;  3S1Q B;  4KHZ A;  2MFI A;  4A3G B;  3PUX A;  5I2Y A;  3FPU B;  2E75 C;  4ODG A;  4V0B A;  3J80 c;  3G6E A;  2Y0S E;  4X65 L;  1HR0 L;  1LT4 D;  5C3E B;  4DV3 Q;  5GQO A;  2K28 A;  2JP1 A;  3OW7 A;  3C1F A;  4B3R L;  2J7Z A;  5E1F A;  1VQP A;  3CCM A;  1GHJ A;  1UEA B;  2NVQ H;  5IYD H;  3MVV A;  2OT2 A;  4BXX H;  1WI5 A;  3CCL A;  1WTX A;  1V43 A;  4JI1 L;  1TQO A;  3J7Z C;  2ZTE A;  3J81 L;  5D3I B;  2NVX B;  1SAP A;  1I4G A;  4K6D A;  1HQR D;  4KJN A;  4HMI A;  3MXG A;  4H0L C;  1YI2 A;  3PIP 3;  1PH9 A;  1BR9 A;  4LFA Q;  1FYC A;  3F2U A;  2CW0 D;  1YJN A;  2YU9 B;  1N36 Q;  2CWA A;  5IGF A;  1BQQ T;  5C5L A;  4HTH A;  3URY A;  2LXK A;  3NQI A;  2LMC B;  4DV2 Q;  3JC6 6;  3GTK B;  2JJQ A;  1EWH A;  3ICE A;  1WJJ A;  2LFN A;  4ME3 A;  1VQK A;  1PRT B;  3J80 E;  3HEJ A;  1BBX C;  3NWT A;  2UXD L;  5C3W A;  2PI2 E;  3RZD B;  1G51 A;  2EYJ A;  2NVY H;  2WB1 G;  3JAM i;  1XPO A;  4B3T Q;  2PW5 A;  2F0N A;  4KV6 A;  2KEC A;  5CV9 A;  1VQI A;  1JE4 A;  3F2B A;  4FVM A;  2KED A;  1PYB A;  1Q1E A;  3FKI H;  4LFB L;  5M3F H;  2JE6 I;  4JI4 Q;  4J8Q A;  5CBE E;  4GKK L;  3RZO B;  2ALY B;  3WWV A;  3U4V A;  1H9M A;  3ULP A;  5DM7 3;  3DUZ A;  4KMU C;  4DV7 Q;  3HOX G;  3I4M G;  3FHW A;  2PO4 A;  2UUB Q;  4QCL A;  4DV3 L;  2F0E A;  2VUM B;  2NZ1 D;  3NP8 A;  4CKE A;  1JB7 A;  1X9N A;  5LMN Q;  5IP9 G;  1I6H B;  4JBM A;  3TS0 A;  2EYF A;  1C9O A;  1YNN D;  2RSO A;  5GAH C;  3S2D H;  2B2T A;  3P20 A;  4P74 A;  1S5D D;  5FLX L;  5M5Y B;  4L5T A;  1JJ2 A;  4DR3 Q;  2B3G A;  3FPP A;  2JA5 B;  3BZK A;  4R4T A;  4JI7 Q;  2UXC Q;  4F8M A;  1L1O A;  1IYU A;  4RA8 A;  1C48 A;  2BDO A;  3UDI A;  2VNU D;  1N36 L;  3JAM c;  5BN5 A;  4DV2 L;  1ESF A;  3E9H A;  4GLX A;  2D9U A;  1YHQ A;  3FDT A;  4C3J G;  4AIM A;  1B3A A;  4LW1 A;  2ZJQ A;  1SE3 A;  3S2H H;  2Z4H A;  1X6O A;  2E2H B;  4B3T L;  2K32 A;  3IAY A;  2B39 A;  3CAM A;  2AQ2 B;  4A3M B;  1A0I A;  2BA0 A;  4AQY Q;  3EJI A;  3K5M A;  2Z4I A;  2WII B;  2HUG A;  3KF6 B;  5IIF A;  4BY1 G;  5KNB A;  3HOX H;  3I4M H;  4A3L G;  2ID0 A;  4JI4 L;  1IYJ B;  4DUZ Q;  1VQ5 A;  3CF5 A;  1OXT A;  3OWF A;  1ZYR D;  1AH9 A;  4DV7 L;  2UUB L;  5IP9 H;  3NBI A;  4HED A;  2DJG C;  1SE8 A;  1HTP A;  3C2P A;  1GUN A;  4IUR A;  2QW7 A;  5LMN L;  5H1S E;  4LMQ D;  1Z47 A;  3TZD A;  1SXT A;  1VQO A;  1EY4 A;  1PH8 A;  4JI0 Q;  3E3X A;  5ELE A;  3CME A;  1SRU A;  3FKI B;  3GV3 A;  2VB3 X;  2EJF C;  2EXZ A;  3W2D A;  4CDC C;  4QUF A;  4DNR B;  5FJ8 G;  5CV4 A;  2RHQ B;  2KOL A;  4DR3 L;  1GHK A;  3OOC A;  4QL5 A;  1F77 A;  1IBM Q;  1IBK Q;  1N33 Q;  3M4O H;  4DNT B;  4BA2 I;  3AU7 A;  2XRS D;  5ELC A;  1TS4 A;  4EQ5 A;  4JI7 L;  2UXC L;  5EPK A;  3DWP A;  1HXY D;  1N9W A;  2XWJ B;  4C3J H;  1FD7 D;  4LF7 Q;  2DY7 A;  4A3J G;  4OL7 A;  1YBY A;  1JOR A;  2H5X A;  3H6M A;  2FFK B;  1VQJ A;  2IWH A;  2HIV A;  2SOB A;  1HZB A;  1G2T A;  2E2I H;  1X3Q A;  1O7I A;  1KRS A;  3SK5 A;  4G7Z C;  1Q12 A;  1PH6 A;  4DV1 Q;  4A3L H;  4AQY L;  1CSQ A;  1B44 D;  3AQQ A;  2MO1 A;  4N9T A;  4LUV A;  3J81 c;  1Y1W G;  2I5H A;  3STB C;  2K33 A;  5IWA Q;  1K8O A;  1VQD A;  4IFD I;  2EIF A;  4DUZ L;  4QUC A;  1VMC A;  4ZK9 B;  1V8Q A;  2Q2T A;  3KUP A;  3BS1 A;  3ND8 A;  2L1B A;  3MEF A;  1X56 A;  3MAQ A;  2DJF C;  3K5N A;  2A1A A;  2MNA A;  2K52 A;  3OMG A;  1SNC A;  2RQX A;  1ONL A;  2LY7 A;  1XPU A;  1SYB A;  4K8J A;  1MIU A;  1KDB A;  1P16 A;  2SNS A;  4IPD A;  1PHJ A;  2EYL A;  5FJ8 H;  3VR3 A;  4JI0 L;  2EQS A;  2K5N A;  3GO5 A;  4CGY B;  5IP7 G;  1SE2 A;  1O7L A;  3CCS A;  2MJ8 A;  2TMP A;  2I07 B;  1GUS A;  1H95 A;  5DM6 3;  1U4P A;  1GO3 E;  3PMF A;  3HOX B;  2HD3 A;  4RMF A;  3I4M B;  3HOU G;  1B2T A;  2XSC A;  4HIO A;  1A8V A;  4TQU S;  1MJE A;  4GOP A;  1IBM L;  1QOH A;  1N33 L;  1TWA H;  4LUZ A;  1IKM A;  5CMD A;  2EYH A;  1K9M C;  3J81 E;  3HRZ C;  3QO2 A;  1F2Z A;  1WTW A;  1QZG A;  3F1Z A;  1F2Y A;  4JI6 Q;  4KHP Q;  3KDF B;  4POG A;  2FMM A;  3HP3 A;  4BS9 A;  1K73 C;  4RKL A;  1AN8 A;  5JOB A;  4A3E G;  1E7Z A;  1FL0 A;  1Y1W H;  3G71 A;  3OTO Q;  3I55 A;  3A74 A;  4DV1 L;  4POF A;  1LTT D;  5FLX c;  3H0G G;  3T53 B;  3R93 A;  2A74 C;  2BH2 A;  5IWA L;  1PZK D;  1EUJ A;  2CVR A;  4AYB G;  4AYB E;  4C3J B;  4GNX B;  2VQF Q;  1XMQ Q;  4JI5 Q;  1KIX A;  3QR8 A;  1DGS A;  1Y8P B;  4OEM B;  3U9O A;  2NUC A;  4OEL B;  2RHS B;  2QDB A;  3UI2 A;  4P75 A;  5IP7 H;  1STY A;  3S1N B;  4A3K B;  1CQF A;  1EYD A;  2QIL A;  4H13 C;  4IJH A;  5IE8 A;  4BY1 B;  1CTM A;  3HOU H;  3PUZ A;  1LO5 D;  1Z6H A;  2FJ2 A;  1FR3 A;  4MHE A;  2K75 A;  1JMC A;  1EYG A;  3ZYY X;  2CW0 C;  1Q8K A;  4CJ1 B;  5T1G A;  1BF4 A;  3OW2 A;  1B4O A;  5M9O A;  5KYL A;  1ZEQ X;  4A3F B;  1I6V C;  2RBM A;  3GTM B;  2PI2 A;  1I50 H;  3TME A;  1E0B A;  4B3M Q;  2ZXP A;  1EQR A;  2CH4 W;  1FVI A;  1NE3 A;  1AFP A;  2WAC A;  4DR6 Q;  3ITP A;  1EQQ A;  4JI6 L;  4KHP L;  1IL8 A;  4A3E H;  4NXM Q;  2F3V A;  4JOI C;  5FK9 C;  1AEX A;  3GV6 A;  1X3E A;  3D31 A;  1TWC B;  3VYS A;  3OTO L;  4JBW A;  1QCB D;  3DLL A;  1M4V A;  1TWA B;  3ULL A;  4DU9 A;  2I0Q A;  4GKJ Q;  4I7Z C;  1EU4 A;  4UP7 A;  4HSV A;  4MNO A;  4A3J B;  4OO1 G;  3KK7 A;  5CV8 A;  2VQF L;  1V1P B;  1XMQ L;  4JI5 L;  4IFD H;  2ICI A;  5NUC A;  2RCF A;  1IXR A;  3VR5 A;  2KHS A;  5KIX A;  2UUC Q;  4RWS C;  1OTC A;  4HJ7 A;  1MSH A;  4JC0 A;  2EZV A;  5IYC G;  4DKA C;  4DV5 Q;  3I4N G;  1XYI A;  1Y1W B;  1SFO H;  1TR5 A;  2Q2H A;  1JT8 A;  1PH3 A;  3CHB D;  5DNF A;  4FF4 A;  4CDE C;  3HFZ B;  3I70 A;  5C4X G;  3M3Y H;  4KN7 C;  2ZJP A;  3SGI A;  5J3B A;  4GNX A;  3Q24 A;  4ZRZ A;  4X3T A;  1EEF D;  4QB4 A;  4B3M L;  1NY4 A;  1VQM A;  4UP8 A;  4DR6 L;  2HIX A;  4FXD A;  5KYI A;  3HOZ G;  1SRO A;  5ELF A;  4NMZ A;  4NXM L;  3HOU B;  1Y1V G;  4HIK A;  3NBH B;  2QF7 A;  1BBW A;  2F0U A;  2OWO A;  1PLF A;  4DPG A;  3PGZ A;  3RLN A;  3CCU A;  3NK9 A;  2EJM A;  1ZYR C;  2F3W A;  4L5S A;  2F4V Q;  3BU2 A;  4GKJ L;  1BNZ A;  1YZ6 A;  3HOY H;  3J7Y W;  1BCP D;  1A2U A;  3T56 B;  2HHH Q;  1DON A;  3I72 A;  1QIL A;  1D5M C;  1CHP D;  1RDP D;  1PA6 A;  1XXG A;  4YCV A;  3CRK C;  2N8N A;  4HMJ A;  2AHO B;  4A3E B;  5IYC H;  5FLM G;  1M8A A;  2RDG A;  3UE1 A;  2UUC L;  3SE0 A;  2F4I A;  1BCP F;  2VB2 X;  3S15 B;  2MQH A;  4ID6 A;  3H0G B;  1GUW A;  2RSN A;  4DV5 L;  4JYA Q;  5C4X H;  4YCU A;  1RTN A;  2OEO A;  1J5E Q;  3L3O C;  2PCF B;  4AYB B;  4DR7 Q;  4LJZ C;  1UEB A;  4YWM A;  1RIP A;  4X3K A;  3HOW B;  5I9O A;  2A6H D;  1VQE A;  2CWP A;  2XIW A;  4I7A A;  3S1R H;  3GTL B;  3HOZ H;  1IW7 D;  1CKN A;  4ILW A;  2KHI A;  4X62 L;  1Y1V H;  3NPP A;  2B8G A;  4R9W A;  2O4X A;  3KBG A;  3BDO A;  1KC8 C;  2B63 H;  1QVG A;  3PIO A;  3RD4 A;  5IYD G;  3S16 H;  4ZAI A;  5I6Y A;  4BXX G;  2F0D A;  4R8I A;  1PH1 A;  1BXT A;  2V1C C;  4S3S A;  1STA A;  2YV5 A;  4YWL A;  3M3Y B;  4QQB X;  2BOS A;  1N8R C;  1L0W A;  4DK6 C;  2KCC A;  2F4V L;  1EYC A;  1BOS A;  2IX3 A;  1LT3 D;  5TSS A; 
#chains in the Genus database with same CATH homology
 1OXS C;  1H9S A;  1STE A;  1NR2 A;  1ENC A;  1DM0 B;  2JEB I;  1JR0 D;  4K2L A;  1NSN S;  5CGK A;  2PQE A;  4DAP A;  5AFW A;  2N55 A;  3WDN A;  2X6L A;  2H4O A;  2TSS A;  1B9M A;  4DXF A;  3SK8 A;  3K58 A;  4C1N K;  2BCO A;  1A2T A;  1PXU A;  1LTR D;  4C2M B;  3I4N B;  5CC4 A;  1TS5 A;  4IUT A;  3ONA B;  4ZUJ A;  1QE6 A;  1SND A;  3A8I E;  2NBF A;  4RGT A;  4EVO A;  5C4X B;  1KDC A;  2MHV A;  1VF7 A;  2A6E D;  5EKI A;  3SR1 A;  1AW7 A;  1E2V A;  2A73 B;  4EQP A;  2HCC A;  1L0X B;  3SHL A;  4HR7 B;  1CM9 A;  3S1R B;  3HOZ B;  3CKI B;  3E0J A;  4FXK C;  1CA5 A;  1Y1V B;  3G7L A;  3TDQ A;  1SE4 A;  1JOQ A;  4UAI A;  1B50 A;  2IX1 A;  3K5L A;  4C56 C;  4GZY C;  4DN4 M;  2EYO A;  5EKL A;  4QIW B;  3QG1 A;  4PMB A;  1TVX A;  1F9S A;  1HUN A;  5C5M A;  2LS0 1;  4FF2 A;  2PNR C;  3WOF A;  3CQZ B;  2F0F A;  1DOL A;  2XRQ D;  4L8J A;  2JSO A;  3NXW A;  1E2Z A;  4DAV A;  1TWH B;  1MD2 D;  2AQ3 B;  3QIA A;  3FVQ A;  3KLS A;  2B2U C;  1VDZ A;  5EKK A;  1EQV A;  1S5F D;  3GD7 A;  2E2J B;  1S4Z A;  1Q3L A;  1JWM D;  1I4R A;  1HQM C;  3D4D A;  4NW2 A;  4XDX A;  2MGS A;  2PZU A;  1A3T A;  2HDM A;  4NP5 A;  3LWE A;  1EOT A;  1EU3 A;  2NVQ B;  3VR6 A;  3DXJ C;  2QCP X;  3R8B A;  1FGB D;  1NR4 A;  3KF8 A;  2X69 A;  2X6G A;  2MPM A;  2B2W A;  5T1I A;  4DA2 A;  2OF1 A;  2PZW A;  1D6E C;  4HAE A;  4WOR A;  4M8A A;  1RD9 D;  2K04 A;  3MHB A;  1F2M A;  3LX0 A;  3RMH A;  4IUQ A;  3P7J A;  5D14 A;  4DK0 A;  2DY8 A;  3C3L A;  2A69 D;  2WKD A;  5G3L D;  3OWE B;  1UAP A;  2NVY B;  1EIG A;  1PFM A;  3K6O A;  5G3L F;  1B53 A;  2D5D A;  2M9V A;  3VYT A;  5M3F B;  5D3D A;  2JA6 B;  3MFY A;  1I3Q B;  2K7V A;  4KY5 A;  5KND A;  3TP5 A;  2RDF A;  2KA7 A;  2J4X A;  1BCP C;  1CK1 A;  4FXG C;  3GQB A;  3VA7 A;  3OIQ A;  3Q6S A;  2K5Q A;  3SXH A;  3VYR A;  1WTP A;  3S2D B;  4L6T B;  2K03 A;  2KUM A;  1ICW A;  1H9K A;  2F0H A;  1BO0 A;  1LTB D;  4RGO S;  1MGS A;  2JXM B;  5EBC A;  2A6H C;  3TSS A;  4K5X A;  4U68 A;  2F0G A;  4A3I B;  5LL6 S;  4XIG S;  2WB1 B;  3RUZ A;  1IW7 C;  1WVL A;  5IOC A;  3S2H B;  4KN4 C;  1HHV A;  4J6H A;  2PZT A;  2Q8I B;  1A3U A;  3S9W A;  1GUO A;  5KGU A;  2C5C A;  5IGB A;  2WKC A;  1TY2 A;  4CJ2 C;  3MTS A;  3K0Y A;  5J22 A;  3ERQ A;  3NWS A;  1LAB A;  3NTK A;  3P75 A;  1W6J A;  2A5H A;  5JPM C;  3VYU A;  2KCN A;  1O7Z A;  3BDL A;  3J7A V;  4Q5V A;  1T5E A;  3PIO 3;  1TII D;  2B2Y C;  3HZX A;  1EIH A;  1W6K A;  1HA5 A;  4OIK A;  2A68 C;  2G9H D;  3TP8 A;  2K6A A;  5JEA G;  4XT3 B;  2V4D A;  3NSW A;  3M4O B;  5JEA J;  3FEW X;  2WV6 D;  1NCV A;  4XQN A;  3WOE A;  2XWB B;  1U4L A;  1A3V A;  3V96 A;  4V19 0;  4KK7 A;  1EZ8 A;  3O13 A;  2Q8R E;  3IL8 A;  3OPO A;  3Q0A A;  1Q1B A;  1ILP A;  4EQN A;  4Z9C B;  4FO2 A;  1ML0 D;  4NKL A;  1B1Z A;  1O80 A;  4KKT A;  3MXP A;  4IFD G;  2BDN A;  2E2I B;  5COR A;  3AB9 A;  4IFD J;  2IPK D;  4QMG A;  1B9N A;  4PMC A;  5C0X I;  1WTR A;  2A6E C;  2M2L A;  4X3S A;  1QWY A;  1ZKO A;  2E2D C;  1G2S A;  2EOT A;  3W3A A;  2ZXR A;  2N88 A;  4XYO A;  4TSS A;  1PZI D;  3MXU A;  2F0I A;  1ZXT A;  2EY1 A;  2JA7 B;  1QNU A;  3A7L A;  5CR3 A;  3I4L A;  1BCP B;  3RLF A;  5IT9 E;  5JEA H;  1F2L A;  3G6J B;  3EFX D;  2F0W A;  3ND9 A;  4L63 B;  1IKL A;  1TY0 A;  1GXD C;  2NYZ D;  4RAU C;  1EQT A;  4K6L A;  4C3H G;  3U9S A;  5EGT A;  1SYC A;  1C4Q A;  1U4R A;  5C3X A;  1SNP A;  1PZJ D;  2EYP A;  5K36 H;  1HFN A;  1Y8O B;  2EY6 A;  1KTK A;  2SNM A;  4PV1 C;  3I8Z A;  2H1E A;  1FNV A;  1I4H A;  2RA4 A;  2B2T C;  2HCI A;  1SYF A;  4CBV A;  3TP7 A;  1D5X C;  2WP8 J;  3DWA A;  4PNY A;  4B08 A;  1HTL D;  2JYO A;  5C0X G;  4CHT B;  5C0X J;  2RVL A;  1LTG D;  3MC0 B;  3GTO B;  1KAA A;  3I91 A;  3EQL C;  3NUC A;  4XT1 B;  1EFI D;  1IYV A;  3VR2 A;  4DXG A;  1D2B A;  1F9Q A;  3DEP A;  2K5D A;  4K5V A;  1G6Z A;  1SYG A;  2A69 C;  2B2V A;  1PFB A;  3A54 A;  1TS2 A;  1I50 B;  1DOM A;  1JQY D;  4FYD A;  1KDA A;  1DJR D;  1R4P B;  1DOK A;  1QJO A;  4ME5 A;  4KKS A;  5J1Z A;  1HFG A;  1TT2 A;  1Q8I A;  1IHZ A;  2K01 A;  1AZP A;  1PFN A;  2MP1 A;  1RTO A;  3BG3 A;  2JEA I;  5IGG A;  4IUV A;  5C0X H;  3K59 A;  4R8N A;  2KVM A;  5I4D A;  1V1P A;  2ZXO A;  4ZKC B;  2LKV A;  1WTQ A;  3NE5 B;  1G8Z D;  1PDQ A;  5FKA C;  1YNJ D;  3D8G A;  4LK1 C;  2CHB D;  1SFO B;  3IKJ A;  1SYD A;  5A2Q E;  2AQ1 B;  4B9X A;  4RHR A;  2NB0 A;  5DEH A;  1S5C D;  3BVG A;  3D4R A;  1PYW D;  2NN6 I;  5FO7 B;  1O7Y A;  4CJ0 B;  1EY5 A;  3K5O A;  4O42 A;  2F0O A;  1JCK B;  2SDF A;  1PTO D;  1XWE A;  3R2I A;  2K1B A;  2KQ3 A;  2B8F A;  3H3V C;  3NTI A;  5E4X A;  5FOB B;  1PTO F;  2PYK A;  5C6A A;  2A68 D;  1Z7T A;  3NBH A;  3VA5 A;  1STN A;  3TZU A;  3D3R A;  1A15 A;  2DNC A;  4ZKB B;  3TP6 A;  3HOY B;  5JPN C;  4U67 3;  1AZQ A;  3MZ5 A;  5IGE A;  1SNM A;  1Y8N B;  2K5W A;  3SK6 A;  4B9W A;  3ERO A;  1EY0 A;  1VMP A;  5COY A;  5I2X A;  4KKU A;  5ISR A;  4ZLT F;  1JIC A;  1JWS D;  1STB A;  1DYQ A;  1LT6 D;  4M1U B;  4RGN A;  1G91 A;  2F0Q A;  2MUY A;  5KRU A;  5M5W B;  4I65 A;  1Q90 A;  2WAQ B;  5EQ0 A;  1HA6 A;  4ABN A;  2KJX A;  2R6G A;  2G9D A;  1EY9 A;  1MSG A;  3SEB A;  4HCE A;  3NTH A;  1F9P A;  4F88 A;  4CKB A;  2EYM A;  2F0L A;  3M85 A;  5JAV A;  2NN6 G;  2B63 B;  1WTO A;  2BE5 C;  3S16 B;  2EE1 A;  4TKO B;  4XQQ A;  4FF3 A;  3M4Y A;  3C46 A;  1WTV A;  1BUV T;  4ULL A;  2F0S A;  1DXM A;  2BA1 A;  4OGQ C;  4BY7 B;  3J7A F;  3A55 A;  5FO8 B;  1GUG A;  3GTP B;  1EZ6 A;  3QJY A;  1RCV D;  1S5E D;  3L7Z C;  3S1M B;  2F03 A;  1EEI D;  2F0K A;  4RCN A;  2AUK A;  5E4W C;  1R4Q B;  1C8C A;  1JC7 A;  2ICE C;  5J39 A;  3D6C A;  2Q8T A;  1J9O A;  5JJZ A;  4G4K A;  5IT9 L;  4WFN 3;  5M3M B;  3GTQ B;  1ROD A;  1SNO A;  3MEH A;  1SBB B;  2NN6 H;  1CA6 A;  4WRD A;  2NWG A;  5CV6 A;  4O1N A;  3T4A C;  3DWQ A;  5CV7 A;  4IUN A;  1NUC A;  1MI2 A;  4ZYS A;  2NTS A;  3OSO A;  1KNE A;  3HKZ B;  1D5Z C;  1SMY D;  3DM1 A;  1RHP A;  4K5W A;  3EVQ A;  3IFD A;  2L12 A;  4OIJ A;  3A7A B;  2M00 A;  2FHT A;  3MFG A;  1QNK A;  4XQJ A;  1TKW B;  3CRL C;  4H7B A;  5C4J B;  1MBY A;  3GTJ B;  4LAA A;  3QOJ A;  1DCZ A;  1LTS D;  3FMC A;  1ENA A;  4A93 B;  4UDU C;  1PRT D;  4ZUI A;  1SDF A;  3KBX A;  4BBS B;  3BYT B;  3S17 B;  1EWC A;  2R92 B;  3T51 B;  1PRT F;  1LT5 D;  1JB3 A;  4DAY A;  2O2L D;  1VF5 C;  2E76 C;  3JAM E;  1SSO A;  3R2T A;  4IQZ A;  2IJ0 A;  2HQE A;  5IGC A;  4G7O C;  2B2V C;  4P2C B;  4J1M A;  1KLU D;  3C1E A;  3H94 A;  3MXN A;  3QOL A;  4KI0 A;  4NDX A;  3GTG B;  1XTC D;  4RFB A;  1T5X D;  2Y0S B;  4X3U A;  5ELD A;  1AP0 A;  4QF4 A;  1TWF B;  5ELB A;  1CZW A;  1I4P A;  1WD1 A;  3PUV A;  1F9R A;  2E74 C;  4KJO A;  3DMU A;  4C3I G;  2F1M A;  2R7Z B;  4DFA A;  3QB3 A;  3TN2 A;  4Q0F A;  1I4Q A;  1LAC A;  1GOZ A;  3EA6 A;  5BN3 A;  3N52 A;  1JOK A;  2FMC A;  1DD2 A;  3PUY A;  2F0T A;  3OMC A;  3K57 A;  3OHX C;  2CQA A;  3HGB A;  3T13 A;  4A3B B;  5M5X B;  1HRJ A;  4KHV A;  1YNJ C;  4RKB A;  2PW7 A;  2D2C C;  1U4M A;  1OXU A;  4BA1 I;  5CYU A;  3SDZ A;  4MN3 A;  3X3N A;  3A56 A;  4FP5 D;  1J8I A;  4KY6 A;  4RHS A;  2L4N A;  3P1H A;  1SYE A;  3V2T A;  4A3D B;  3PO3 B;  1HPC A;  1PTO C;  2I46 A;  2AWO A;  5A2Q L;  4ZQ3 A;  4KD3 A;  5EPL A;  1CQV A;  2EDG A;  5FO9 B;  3D4W A;  1LLR D;  1EY6 A;  4KY7 A;  2JA8 B;  2XNA C;  4KD4 A;  5BN4 A;  1JWU D;  1K83 B;  3I3C A;  2DN8 A;  2F0V A;  3NQT A;  2Z8L A;  4XTC S;  5C4H A;  5EPJ A;  1EL0 A;  2YYZ A;  1UNS A;  5JVG 3;  3NHH A;  4IN3 A;  3S14 B;  4OO1 I;  3PO2 B;  1G29 1;  1HCZ A;  1RKN A;  5C4Z A;  5A35 A;  5K36 G;  1EY7 A;  4N9P A;  4CKC A;  2K05 A;  2BE5 D;  4F7X A;  1QB5 D;  1PTO H;  2EY5 A;  2J0T D;  1S5B D;  5DAU A;  4HCS A;  5KNC A;  5E3F A;  4BWG B;  2PPB C;  1OXV A;  2IW3 A;  3PV0 A;  2RKS A;  1V1O A;  2L11 A;  1QG7 A;  4IAL A;  1VCI A;  1TU2 B;  3DEO A;  1CHQ D;  3KLR A;  1WD0 A;  1ILQ A;  4YIJ A;  1BDO A;  1H9R A;  2KEE A;  1STH A;  1FNU A;  2NVT B;  2VXW A;  1ENF A;  3E5S A;  3MWY W;  2QKI C;  5FLX E;  5EJW A;  1KNA A;  2B2U A;  4PQX A;  4FF1 A;  4G57 A;  1II3 A;  1L0Y B;  5KEE A;  5K5P A;  1KAB A;  3I90 A;  3SVM A;  1SEB D;  1LTI D;  1LTA D;  2L55 A;  4K2K A;  2AWN A;  3H91 A;  4RGM A;  2WIN B;  1CZG A;  3Q23 A;  4IUP A;  1X32 A;  1A6X A;  3J80 L;  4C3I B;  1NAP A;  2SEB D;  2IL8 A;  2F0P A;  4MIU A;  3AMU A;  3D6W A;  3KLS X;  4Y7N B;  5LHY 1;  3A8J E;  5CBA E;  5JVH 3;  1ET9 A;  4IUU A;  1HUM A;  4PMW A;  4XXE A;  2R3Z A;  5LL6 X;  1Y69 U;  1YNN C;  2O5J C;  3BDC A;  1EY8 A;  1SNQ A;  1D1I A;  2XN9 C;  4KTA A;  2EJG C;  1RF2 D;  5I9P A;  1PMR A;  2NTT A;  1PTO B;  5F2D A;  4DK1 A;  5IGD A;  4C1N I;  4IZ8 A;  1SMY C;  2B2W C;  1H9S B;  5IOD A;  1I4X A;  4DGZ A;  4E6I A;  4OHJ A;  2L9H A;  3LNN A;  3BVM A;  4RCO A;  3V05 A;  4EQO A;  5C44 B;  2R93 B;  2R61 A;  3T16 A;  3M7N A;  2XVS A;  1STG A;  3N6R A;  1PRT C;  4OO1 H;  2OXP A;  1X3P A;  3QWN A;  4K14 A;  1UUP A;  2QEJ C;  1CFM A;  5D65 A;  2Z1C A;  4BBR B;  1TWG B;  2EPB A;  2EVB A;  2PMZ B;  2IT1 A;  1SJE D;  3HOV B;  1DZ1 A;  1RJT A;  3SK4 A;  1E2W A;  3LWU A;  4FNF A;  3JAM L;  3X3M A;  4XYQ A;  1JOO A;  3FRP B;  1D1K A;  3DHQ A;  1TS3 A;  1R9T B;  4HN7 A;  5HUR A;  1H9J A;  2O5I C;  4RH6 A;  4G7H C;  1ET6 A;  3IFT A;  1LV9 A;  2C9O A;  1WCM B;  4JK1 C;  3OIP A;  2L5T A;  1O78 A;  2ENB A;  2D62 A;  3PUW A;  3BYY B;  1CT1 D;  5I6W A;  1KLG D;  4HSP A;  1GUT A;  2HDL A;  1ESR A;  4WJW A;  2DNE A;  1EYA A;  3Q22 A;  3L9A X;  2FIN B;  2F0M A;  2ZT9 C;  3HS0 C;  3BZD B;  4C3H B;  2L0C A;  3CU7 A;  3VR4 A;  2AUJ D;  1K8M A;  1FNW A;  1U9R A;  3TBI B;  2B2Y A;  3R3O A;  4F87 A;  3E6Z X;  4H44 C;  5HGT A;  3H09 A;  2RDH A;  4K8I A;  1OO9 B;  3MA2 B;  2F0J A;  2EY2 A;  3M7G A;  1XX8 A;  3A8K E;  5CV5 A;  4DF7 A;  5EBD A;  2GA4 B;  3K7A B;  3I73 A;  2IX0 A;  1SJH D;  1CI3 M;  1OXX K;  1GJX A;  3BVZ A;  4TRD A;  3HG9 A;  3GP7 A;  4EGV A;  3S1Q B;  4KHZ A;  4A3G B;  3PUX A;  5I2Y A;  3FPU B;  2E75 C;  4ODG A;  4V0B A;  1LT4 D;  5C3E B;  2K28 A;  2JP1 A;  3OW7 A;  3C1F A;  2J7Z A;  5E1F A;  1GHJ A;  1UEA B;  3MVV A;  2OT2 A;  1WTX A;  1V43 A;  1TQO A;  3J81 L;  5D3I B;  2NVX B;  1SAP A;  1I4G A;  4K6D A;  1HQR D;  4KJN A;  4HMI A;  3MXG A;  4H0L C;  3PIP 3;  1BR9 A;  1FYC A;  3F2U A;  2CW0 D;  2YU9 B;  5IGF A;  1BQQ T;  5C5L A;  3URY A;  4HTH A;  3NQI A;  2LMC B;  3GTK B;  1EWH A;  2LFN A;  1PRT B;  3J80 E;  3HEJ A;  1BBX C;  3NWT A;  5C3W A;  3RZD B;  2EYJ A;  2PW5 A;  2F0N A;  4KV6 A;  2KEC A;  5CV9 A;  1JE4 A;  4FVM A;  2KED A;  1Q1E A;  2JE6 I;  4J8Q A;  5CBE E;  3RZO B;  1H9M A;  5DM7 3;  3DUZ A;  4KMU C;  2PO4 A;  4QCL A;  2F0E A;  2VUM B;  2NZ1 D;  3NP8 A;  4CKE A;  1I6H B;  2EYF A;  1YNN D;  2RSO A;  2B2T A;  3P20 A;  1S5D D;  5FLX L;  5M5Y B;  3FPP A;  2JA5 B;  4F8M A;  1IYU A;  4RA8 A;  1C48 A;  2BDO A;  2VNU D;  5BN5 A;  1ESF A;  2D9U A;  3FDT A;  4C3J G;  1B3A A;  1SE3 A;  2Z4H A;  2E2H B;  2K32 A;  3IAY A;  2B39 A;  2AQ2 B;  4A3M B;  2BA0 A;  3EJI A;  3K5M A;  2Z4I A;  2WII B;  2HUG A;  5IIF A;  5KNB A;  2ID0 A;  1OXT A;  3OWF A;  1ZYR D;  3NBI A;  4HED A;  1HTP A;  3C2P A;  1GUN A;  4IUR A;  4LMQ D;  1Z47 A;  3TZD A;  1SXT A;  1EY4 A;  5ELE A;  3GV3 A;  3FKI B;  2VB3 X;  2EJF C;  2EXZ A;  3W2D A;  4QUF A;  4DNR B;  5CV4 A;  2KOL A;  1GHK A;  3OOC A;  1F77 A;  4DNT B;  4BA2 I;  3AU7 A;  2XRS D;  5ELC A;  1TS4 A;  5EPK A;  3DWP A;  1HXY D;  2XWJ B;  1FD7 D;  2DY7 A;  4OL7 A;  1JOR A;  3H6M A;  2FFK B;  2IWH A;  2SOB A;  1G2T A;  1X3Q A;  3SK5 A;  4G7Z C;  1Q12 A;  1B44 D;  4N9T A;  2K33 A;  1K8O A;  4IFD I;  4QUC A;  1VMC A;  4ZK9 B;  1V8Q A;  3KUP A;  3BS1 A;  3ND8 A;  2L1B A;  3MAQ A;  3K5N A;  3OMG A;  1SNC A;  2RQX A;  1ONL A;  2LY7 A;  1SYB A;  4K8J A;  1KDB A;  2SNS A;  2EYL A;  3VR3 A;  3GO5 A;  4CGY B;  1SE2 A;  1O7L A;  2MJ8 A;  2TMP A;  2I07 B;  1GUS A;  5DM6 3;  1U4P A;  3HOX B;  3PMF A;  3I4M B;  1B2T A;  2XSC A;  4TQU S;  1QOH A;  1IKM A;  5CMD A;  2EYH A;  3J81 E;  3HRZ C;  3QO2 A;  1F2Z A;  1WTW A;  1F2Y A;  2FMM A;  3HP3 A;  4BS9 A;  4RKL A;  1AN8 A;  5JOB A;  1LTT D;  3T53 B;  3R93 A;  2A74 C;  1PZK D;  2CVR A;  4C3J B;  1Y8P B;  3U9O A;  2NUC A;  2QDB A;  3UI2 A;  1STY A;  3S1N B;  4A3K B;  1CQF A;  1EYD A;  2QIL A;  4H13 C;  4BY1 B;  1CTM A;  3PUZ A;  1LO5 D;  1Z6H A;  2FJ2 A;  1FR3 A;  4MHE A;  3ZYY X;  2CW0 C;  4CJ1 B;  5T1G A;  1BF4 A;  1B4O A;  5M9O A;  5KYL A;  1ZEQ X;  4A3F B;  1I6V C;  2RBM A;  3GTM B;  3TME A;  1E0B A;  2ZXP A;  1AFP A;  2WAC A;  3ITP A;  1IL8 A;  2F3V A;  5FK9 C;  1AEX A;  3GV6 A;  3D31 A;  1TWC B;  3VYS A;  4JBW A;  1QCB D;  1M4V A;  1TWA B;  4DU9 A;  4I7Z C;  1EU4 A;  4HSV A;  4A3J B;  4OO1 G;  3KK7 A;  5CV8 A;  1V1P B;  4IFD H;  2ICI A;  5NUC A;  3VR5 A;  2KHS A;  5KIX A;  4RWS C;  1MSH A;  2EZV A;  1XYI A;  1Y1W B;  1TR5 A;  3CHB D;  5DNF A;  4FF4 A;  3I70 A;  4KN7 C;  3Q24 A;  4ZRZ A;  4X3T A;  1EEF D;  4QB4 A;  4FXD A;  5KYI A;  5ELF A;  4NMZ A;  3HOU B;  2QF7 A;  2F0U A;  1PLF A;  3NK9 A;  2EJM A;  1ZYR C;  2F3W A;  1BNZ A;  3J7Y W;  1BCP D;  1A2U A;  3T56 B;  1DON A;  3I72 A;  1QIL A;  1D5M C;  1CHP D;  1RDP D;  1XXG A;  3CRK C;  4HMJ A;  4A3E B;  1M8A A;  2RDG A;  3SE0 A;  2F4I A;  1BCP F;  2VB2 X;  3S15 B;  4ID6 A;  3H0G B;  1GUW A;  2RSN A;  1RTN A;  2OEO A;  3L3O C;  2PCF B;  4AYB B;  4LJZ C;  4X3K A;  3HOW B;  5I9O A;  2A6H D;  2XIW A;  3GTL B;  1IW7 D;  4ILW A;  3NPP A;  2B8G A;  4R9W A;  2O4X A;  3KBG A;  3BDO A;  3RD4 A;  4ZAI A;  5I6Y A;  2F0D A;  4R8I A;  1BXT A;  4S3S A;  1STA A;  3M3Y B;  2BOS A;  2KCC A;  1EYC A;  1BOS A;  2IX3 A;  1LT3 D;  5TSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...