1A34A

Satellite tobacco mosaic virus/rna complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
147
structure length
147
Chain Sequence
TGDNSNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGSLFSANFRTDSFTSVTVMSVRAWTQLTPPVNEYSFVRLKPLFKTGDSTEEFEGRASNINTRASVGYRIPTNLRQNTVAADNVCEVRSNCRQVALVISCCFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SATELLITE TOBACCO MOSAIC VIRUS)
publication title Refined structure of satellite tobacco mosaic virus at 1.8 A resolution.
pubmed doi rcsb
source organism Satellite tobacco mosaic virus
molecule tags Virus/rna
total genus 24
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 1998-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.220 Mainly Beta Sandwich Jelly Rolls Satellite virus coat domain 1a34A00
1A34A 4OQ8A 1ZA7A 3J7NA 4NIAA 1CWPA 3J7LA 1JS9A 1YC61 4OQ9A 3J7MA 1STMA
chains in the Genus database with same CATH superfamily
4KWJA 1VRH3 4JX0A 1ULEA 4JGYB 4WVVA 3O7OA 2R1DA 4MGQA 3BIEA 1PNGA 3M3QA 1H2NA 2IXIA 3P5BA 2Y64A 2W9XA 1ZBE2 2ZX4A 4BQ5A 1MS1A 3USUB 1QDCA 1H30A 5JAXA 3OB8A 2ZAAA 5ANNA 5LA2A 1Z7S3 3LSEA 2RS11 2XL9A 1RUD3 4AGVA 4CCKA 4L97A 4A7ZA 4H3WA 3ZYBA 3RPQA 1ENXA 2XONA 1RVF2 3N7JA 2R30A 1UZZA 4YG3A 1HN0A 2JD4A 2ZEXA 1WBLA 1TE1B 5T5LA 4YVWC 5CKQA 2UWBA 3THDA 3U14A 1TEIA 3KS7A 1YIFA 1ZZCA 4FBFA 1OD5A 1MEC2 2PAKA 3FBYA 4JGYC 4QU2A 3JBG3 5JCTA 2VPVA 5FYHA 2DCJA 2JIGA 1BZWA 1AZDA 1S2KA 2J22A 2R063 2BP6A 3H1MA 3Q8BA 4FPEA 4LJHA 4AQSA 4C1XA 4Q4X2 3CNAA 4JQTA 3MW4A 3OYWA 1SCSA 4KI5M 3VKLA 4W50A 2ZX3A 1N1YA 2BERA 1ND2B 5KHIA 3F2ZA 4RR3A 2YHJA 1JHNA 1SQ4A 5E16A 4K8RB 3B9IA 4FPJA 5EWSA 1DFQA 1TMF1 4I02A 1W8WA 4ZU4A 3OEBA 4BOWA 5FYZA 2G9ZA 1AXZA 2UURA 3B7MA 2OYZA 4AFMA 1RJ7A 2FHRA 4N53B 4Q5OA 5BNOC 4C1WA 3ZVXA 3PTRB 2WWUA 1VBC3 1FV2A 1QJY2 4JGZC 2HKXA 4GULA 2WO3A 1NY72 2DBIA 2DVBA 1HB1A 3GJAA 5T50A 2XBO1 1Q8PA 2D40A 1AR62 5IUQA 1R083 4ASKA 1XU2A 2JKXA 3KWVA 1ZRFA 5L73A 1QJZA 4NIAA 2CL2A 5C5TA 5FAXA 1ZREA 1D2QA 1RUF3 4LIVA 3W9AA 4ZZ8A 1ND2C 1W3VA 1S2BA 2HWC2 3J9SA 4RS5A 5DUXA 4DY3A 3KT4A 4BE3A 3CDZB 4QGLA 4JAAA 4HT1T 1W6OB 4M3CE 4YVSA 2Q4SA 4UI9L 2ZHKA 4FXKB 4FAHA 2P37A 3BTYA 2W3JA 4Q2FA 3KCXA 4B4RA 1R081 1UN1A 3PUAA 4RSUA 5CFDB 3BU0A 2RS33 1C4RA 1UQXA 3DL3A 1CPMA 2E32A 2JX9A 3DYMA 5FZKA 3UNPA 2YU1A 2DDUA 2YUEA 3C7HA 4Q4V3 1RXFA 3UGGA 4ARYA 4FOQA 3WY6A 3ZN4A 4YG0A 2ZEWA 1RUJ3 1PO23 1FMD2 1PM7A 3BCWA 3FHAA 5HCBA 3J8F3 4BU2A 5BYNA 1G9AA 4NRMA 4F3JA 3ILRA 2PHXA 4FFFA 5F1RA 3VDDB 2PHWA 1RUC2 2QQIA 1ULPA 4LLOA 3AP5A 2MHFA 3NJZA 5GLTA 5KC6A 5LASA 3PIGA 3RQ0A 4DRVA 3WQ7A 3NJXA 1MACA 1E57A 2GNTA 1PO21 3J7NA 4COYA 3THTA 4P9YA 5F9TA 5KC5A 1IHMA 1OT5A 4QX8A 1UYZA 4M01A 2IZWA 1JODA 2P34A 3V65A 3LQCA 4ISRA 4QHZA 1VMJA 3T0DA 4J25A 4IE4A 5LEKA 2J1EA 3AKQA 3NV3A 5I0UA 3WX5A 3ZXFA 1JTZX 4BDVB 1HQNA 2K0GA 1REFA 5LA1A 2GNBA 2W0XA 5EJ1B 3M4FA 3BTXA 2FDKA 3NNGA 4YM1A 3LAGA 2JDUA 1OD3A 1US3A 3MEPA 3ZIXA 4PI2A 1LHOA 2AGSA 1CD3G 3K4AA 1VRH2 1STMA 3J7HA 3OYWB 4P9GA 5FZHA 2VCAA 5B4XA 4XC9A 4KL1A 4RR3B 5CADA 3VBOA 4CDQA 4XHBA 4DO0A 2R0HA 2B45X 1O91A 4NWWA 5C4WA 4NAOA 3OUJA 2VTXA 1NE4A 1Z7S2 1KITA 2CAVA 3EYPA 4QPGA 1QNYA 5JVVA 1RUD2 4IEOA 1ODMA 2X29A 2BBAA 1G7YA 3B5LB 1NE6A 4WVWA 4LO8A 1YLLA 4JKKA 4XETA 5D8AA 1GQPA 4LQRA 5F39A 3VBUB 1SBEA 3C7OA 3AM2A 3DCQA 5JZGB 3R4SA 4DXSA 5FPZA 3GZTB 5CAZA 4YGEA 1D7PM 3RVHA 2ZMLA 3UJQA 1LB2A 3MIDA 1DQ6A 3OPTA 2V72A 1W0NA 1KJRA 4XFGA 5LA0A 3JBG2 1VBD1 2X5IB 4C0HA 5DUVA 2R062 1V6OA 4LKEA 1MZEA 3W5NA 3IKWA 5AC91 3DPRA 3SISA 1XNAA 1OH4A 1DQ2A 1XPWA 2F17A 4N90A 5FYMA 1C8M1 1QJEA 4CUAA 2H6CA 4AWDA 5T5OA 3O1UA 2BZDA 1QQP3 1SZBA 4FTBA 4CDUB 2W91A 3GJBA 4XTMA 4TXWA 4X8NA 3U0ZA 3WQ1A 1F2NA 1AXYA 5LBBA 3RRDA 4V2VA 5T3NA 2AYHA 4AQTA 4E8DA 3MIEA 2RDQA 2PHUA 3HT2A 5JZGC 2RR11 4RGKA 1A34A 2N7GA 3BPSA 2ZGRA 4TN7A 1S2EA 4QDRA 4MZUA 1VBC2 5FYVA 5C6CA 1ENSA 1QGLA 4ZXKA 4A4AA 3LOBA 5A3PA 1WD4A 4PF1A 4QD2A 2KR2A 1Y3TA 3IDBB 4ZU7A 1R082 1S0GA 2QQWA 3U11A 4NPRA 1H8VA 1RUNA 4YSFA 4AK3A 5F3GA 1H2MA 1RUF2 4UBHA 5I8SA 3DXUA 3ITQA 4CDUC 1RUI1 1HV1A 4YWAA 1EUTA 1RL3A 2H0BA 3IDEA 4CP0A 1OLQA 3BOWA 1XRUA 1DG6A 3FBMA 2VZUA 4CEWC 1W90A 1NZCA 2RS53 2VBPA 4DPNA 2WT1A 1IQAA 5DDJ1 4YG6A 2P2KA 1YQ8A 2RS32 3ZO0B 4D94A 3ST7A 3NQHA 1UX6A 5FY8A 3U07A 4AQ2A 1JYTA 1W39A 3HQXA 1PHMA 4LHKA 3TEYA 3B9CA 4HPKB 3D6EA 4FPOB 3B69A 2BFUL 2OZJA 2R1BA 4Q4V2 3ZSKA 5KXBA 5C8CB 5JPNB 4AVAA 3SEEA 3ACFA 4BQ4A 1RUJ2 1PO22 5IFPA 5H9PA 3J8F2 4E4HA 3TN93 3O1PA 5EYXA 5FJHA 4D6QA 4WM8B 2QFEA 4WV8A 4BWOA 3VZOA 1W2TA 3FLTA 2VXRA 4EN6B 2RG4A 4KBBA 3RJ2X 4ISQA 3ZPYA 5F37A 3GM8A 3C2UA 1GV9A 5HXVA 5IYYA 2JDNA 2ZGNA 3W20A 2QVSB 4LO7A 4LBLA 2A73B 1PMIA 1O4ZA 1US2A 3JB8A 5D8AB 5KHKA 3RI9A 4ASMB 3KV9A 2GMEA 3GXUA 1BJQA 2VUJA 2WT0A 2V09A 3LIHA 4QMAA 3D82A 3LFIA 3OGGA 4KGQA 2JG8A 3IPVA 3A4UA 3U78A 3KHCA 1PZ7A 5BNQA 3O0VA 4PJYA 4WM8C 3WG1A 2NYYA 3ZMNA 4QXCA 4W8JA 3O1VA 2D44A 5FPLA 1JZ5A 1WW5A 1QIQA 2ZCWA 2R32A 5H9QA 2E9QA 2ARXA 4XF3A 2H6BA 4DXZA 1UKGA 1W9SA 3B3QE 3CO2A 5HCFA 3TAYA 1B35B 3HIFA 2ET7A 1FXZA 1DGLA 3Q9OA 3ZFEB 3W21A 1AUYA 4XILA 1HQWA 1N3OA 5BNPC 3APBA 4NAMA 3WW4A 4EN0A 5FMDA 4CXXA 3SH4A 5J1XA 1TQ5A 3F95A 1PX4A 1XJAA 1DHKB 3J7LA 2VW2A 2BV4A 5M0TA 4J1WA 3U4XA 2XVLA 2BWCA 3VBSA 5JMCA 2NP0A 3LD8A 1NA1A 1SLTA 3NNLA 5EZWA 1H8TA 2RE9A 1C8M2 1UMIA 2WZ8A 1UU4A 2WS93 4FPGA 3E5XA 4LITA 2JECA 2Z42A 3RGBA 1SLBA 3LSDA 3LKJA 2VU9A 3CZJA 1W9YA 1PM4A 3B94A 2Q8OA 2JG9A 5FUPA 1GP4A 4LHSA 1R091 3PUSA 2RV9A 3DKQA 4CDWA 5LY1A 2HYKA 3OG2A 3ZFEC 1OVPA 3EQEA 3N3HA 3UV9A 4I30A 4KWUA 3OF1A 4PDWA 1HJGA 1QQP2 1RUG3 2W92A 2DU1A 2ORXA 1OA3A 1IS4A 3K75B 3QOPA 1OOPA 1COV3 3LWCA 3IN9A 3TYJA 3WP3A 4AI9A 3LPGA 4M0NA 4HLTA 4XFCA 1XYPA 3DYOA 3PVOA 4FCAA 3A0KA 2TNFA 4OFGA 3OBTA 4XYXA 5A3UA 4Q0QA 3U4SA 1AR93 5FLJA 3WG4A 4D8MA 5J96B 1RXGA 1MR5A 3AYEA 2VMGA 3POGA 3H3LA 5FO9B 1A78A 2WNUA 2XLFA 4RL7A 4NRQA 4Y24A 5L36A 2K9ZA 2BOIA 2J42A 3M3IA 4P9LA 3TWIA 2D3SA 3IM0A 3VHOA 2D98A 1BBT1 3NV4A 4UXAA 2BTVC 2R041 5A33A 1UIJA 2UWCA 2QCSB 1ND3B 4FQZA 5CISA 5FQ0A 3B93A 4UW4A 2O14A 4XW3A 1J3QA 3KT1A 2XJTA 4OMDA 3KV4A 4AR2A 4Q26A 3UGHA 4P08A 2RS52 2ZHMA 4NE9A 4D69A 1CAVB 1BYHA 1NG0A 1JYIA 4KQ7A 2ZMNA 3ACGA 3J26N 4E2GA 1UY3A 3ZYIB 3LIGA 3PL0A 1OBNA 1OC1A 1UL9A 4PLMA 2QTWB 2ZOEB 4ONUA 5FTTC 1AR83 1A8MA 1ULDA 1W6NB 2Z5WA 3KLSA 2IUWA 4URAA 2BPA2 1ENQA 2VO5A 2WZR3 4B8EA 4I3PA 1VMHA 4MGZE 3CL1A 2NLRA 4YZ4A 1CAXB 2GAUA 5A7QA 3WSOA 2CGOA 4BPZA 3AVRA 1OURA 3TN92 4HKWA 3NV1A 4CP1A 3ENRA 1LOEA 3ZFGA 2O1QA 1H6XA 3AMQA 2F6BA 4YZ2A 2Q8EA 2JKBA 2QQMA 2W1WA 3OJBA 3UL2A 5L19A 3WHUA 5FP4A 3GDBA 1K42A 4UYBA 5FUNA 3OOXA 3WF1A 4Q29A 1F8VA 1FOD1 4XDQA 3OGVA 2HLEA 2WFPA 1W3XA 3O1TA 3MPBA 3IIIA 1FPN1 4FFHA 5JI9A 2A1XA 5HCHA 2WAAA 3S5QA 3BYWA 3SKVA 3CZUA 3ZXGA 5EIYB 5LBEA 1DGRN 2PMWB 3K4ZA 2W95A 2YGMA 3K3NA 5K4LA 5A7WB 4A41A 4TLFA 4NPMA 2VZ3A 1UZYA 1WMFA 2VECA 1VAMA 1J59A 2Q30A 2R073 2QQKA 1CZTA 1W9WA 1JBCA 2WC2A 1HRV1 4IESA 5A6XA 2YC2A 4DY5A 2RDNA 3WHTA 1W2NA 2G19A 4INDA 4PDWB 5A1AA 4W6YA 1NCQA 5K0UA 4WM7A 3IBMA 3R0RA 3LE0A 5C5UA 1DLCA 2VCBA 4KG0A 4P02B 2ATFA 3DN7A 3SMHA 2YPJA 1OKQA 1LTEA 4UFIA 4XMIA 1VALA 1YIPA 4TSVA 3FZ3A 2D6PA 3M3EA 2VQAA 3N9NA 3BIWE 4UFHA 1W2AX 2XLGA 1U12A 4RN5A 1GLHA 2XHNA 3IB3A 4S2FA 1L3JA 2HBUA 2YB7A 3T2QA 3SKJE 3KD4A 4IDZA 2A6WA 3ZFFA 1QOOA 2WS92 1JS9A 1POV3 4TTGA 1Q8SA 3H9AA 1OPOA 4CEYC 1MVQA 4YPJA 1IQDC 3U1XA 2VMEA 3UKTA 4NWVA 1Z0HA 5DMYA 1O4TA 4OI4A 3BPZA 3M8LA 2LS6A 1AYM3 1REDA 1UXXX 3ETQA 3MLJA 2ERFA 5LK7B 4FPHA 1V9U1 2A5ZA 3FUOA 3ABZA 5FZ6A 4AEJA 2WINB 2E6VA 3E97A 1ONAA 3U10A 1AL0G 2MEV1 4L0PA 4HVQA 2J1VA 3THCA 4AHWA 3WCSA 4B7KA 1COV2 2BNMA 2WLPA 2GN3A 2LM3A 4XVHA 4XTPA 3AL6A 4QXKA 2W2IA 2BGPA 4QU1A 4QHBA 2VZRA 4CCEA 2JB8A 5A32A 1EPZA 1X7NA 2VL4A 5GLVA 1ZBE1 2CGPA 2IVIB 2QDRA 4A7YA 3U75A 5I8TA 3WNMA 1LEDA 1L7QA 4EZ4A 4OQ8A 3T1LA 1E5SA 3HT1A 2E51A 3HBKA 2DVAA 5FY5A 3BVCA 3CHXA 4EE2A 1XNKA 1VBA3 1H0BA 1RVF1 4YVWA 5A3MA 5FY0A 4R4ZA 3O1OA 1ZNPA 2ET1A 2I74A 4AFCA 5FPUA 1MS0A 5APAA 3LEKA 3G6JB 4JGYA 1WW4A 5BNNC 3ASIA 3JXSA 5LWBA 3PUHA 2DF7A 4X6QB 5JMOA 1MEC1 1YQ5A 3RZMA 2VD7A 2WUHA 4D7TA 3VKNA 1JZ3A 3USUA 1HB3A 1IKPA 3NV2A 4NHMA 1AR82 2HWD3 4HN1A 4AGGA 2CAUA 3H1WA 4AAXA 1RB8G 2WZR2 3E6BA 4IV3C 3C7FA 1HRI3 4GWNA 1YFUA 4XBNA 5FBZA 2J1UA 1FOD2 2FDJA 4IV1B 5H9SA 1XNCA 1FNYA 4GMP0 5A80A 4YZ5A 2W1SA 5EJ3A 3HN3A 5BNOA 5C3SA 1QF3A 2ENRA 2HWD1 1ZX5A 2ZHLA 3VZNA 4XJ9A 1CJPA 1DYOA 4JGZA 3OBRA 1JH5A 1OLRA 4E27A 2C4XA 2EXKA 4LIUA 5LBCA 3VD3A 1QJY1 1VR3A 4BH9A 1YFXA 4ZPIA 5A7NA 3J7MA 1BXHA 1NY71 2YU2A 5BXXA 4KGGA 2VUAA 2VZQA 4GA9A 2WNEA 2BDRA 4GKYA 1DYKA 4I3GA 1OA2A 2RMU3 1LOAA 1ND2A 1HRV2 3B01A 3WDXA 4D6SA 3H8RA 3AZYA 2OX0A 3MBWA 2BUKA 2HWC1 1OLMA 4Q1RA 1L7LA 4COVA 4IV1C 4MOAA 4AEMA 2JWPA 1DGWA 2A71A 1DZQA 1I6XA 4QQPA 1I3HA 1ZZ8A 1EP0A 4N53A 4GALA 4QGMA 4J1XA 4ATEA 2R072 5FCCA 5FPVA 5FO7B 4XZPA 2MPFA 2YXSA 2HWB3 5JWPA 5EFUA 3ES1A 3TBDA 4LBOA 2P4EA 4OCTA 2JDMA 5AFEA 4OZXA 4D3WA 1DU3D 4AW7A 1FMD1 1E5HA 5GZEA 1KDKA 5DG1A 4YW2A 4PF5A 1MQTC 4F7ZA 4S2GA 4W65A 4NHKA 1SG3A 1KGYA 2WN2A 1CR7A 1W6OA 1MS3A 4QGNA 4WVMB 4Y33A 3AKTA 3PHMA 3AMPA 2A70A 1OMIA 2VVFA 1V6IA 2A6ZA 4CU7A 1QHDA 3FFQA 3M3OA 1RGSA 3T0BA 5LCWL 3LPFA 1G6NA 1IGOA 1HLCA 2NMOA 4K1ZA 5LA9A 2P1BA 1A3KA 2GC1A 1TNRA 1YI7A 3MIGA 1E5IA 4ZXEA 1SLAA 1GQGA 4UAPA 4OI0A 1G86A 3ZXLA 4FSJA 3HNBM 2HEYF 1UIKA 1VE0A 4BCUA 2DUOA 1CZVA 1PVC3 3CJXA 1AYM2 1JYCA 1X33A 4MGKE 2VBBA 2YROA 4NO4A 2J1TA 1QKQA 3KSCA 3URFA 3VDDA 1AR73 5FXWA 2VNRA 5IHRA 5FP7A 5T55A 4K3UA 1YC61 3LOIA 4JKMA 4IXLA 3WR0A 4DUXA 2CV6A 3ILNA 4Q0PA 1EV13 1ZM1A 5EXOA 4PIZA 1X50A 5FOBB 4YW6A 4CCDA 1VRH1 4LK6A 1BMV2 3RMYA 2ZKLA 4QQOA 5LW9A 3BI3A 4N8MA 5CBLA 1SMVA 2D3RA 2A3WA 4H14A 4PI0A 4TYSA 2W1UA 4LO5B 3V0BA 4MSVA 1RINA 4P9XA 5A3TA 1UYYA 1W8ZA 5BNOB 1W9TA 1X36A 1IG0A 1Z7S1 2PHTA 4NMIA 4B4PA 3GBWA 3T09A 4CE8A 2DFBA 1APNA 1RUD1 4JGZB 4B29A 2JD9A 3HN1A 2O0OA 2Z2SB 5HPOA 5J3UA 3ON7A 1VBB3 3FX3A 1VBA2 4L92A 5LB6A 4JV4A 2B9VA 5JOZA 4OUSA 5F5AA 3D3AA 1W6PB 4UW5A 4GB33 4M3CF 2XWBB 4HANA 3WP4A 3GZEA 3WOGA 4NVPA 2AACA 4AI8A 2G4IA 3CJIC 3JBG1 1BK0A 5JSPA 1DIWA 1LCLA 1VBB1 2R061 1LOGA 3SNMA 4XF0A 1HB4A 2WDBA 5I91A 5DZEA 4RYDA 2B42B 3DECA 4YZ3A 2HWD2 3HR9A 1UWWA 5C9AB 3VKOA 1UNBA 4IE0A 4GB31 2WSVA 2YPDA 1YWKA 1U5XA 3KHBA 1HRI2 5DAWA 1H6YA 3UKNA 3I2OA 1XE0A 1XU1A 4CU6A 3VBUA 2Q5TA 1UOGA 4A7KA 2G9GA 5FZ1A 2WZPP 5JZGA 4G4FA 1QJFA 3V0AA 1ZVFA 1LHVA 3OSDA 4HETA 5I93A 4LNVA 4XBQA 1OQ1A 3ZDVA 2X5IA 1DCSA 4XCAA 1VBC1 4JTOA 4OI1A 1QJU3 3PU8A 2VW1A 2BVBA 1OH3A 2UY9A 1JYNA 2VUDA 5KXEA 4KG8A 3WW3A 3AB0A 5FZAA 2X8KA 5C9AC 3ZXAC 2RMU2 1B09A 2I45A 3AJZA 2C9KA 4CDUA 2O8OA 1RUF1 3N7LA 4LBMA 3SCHA 3MIFA 4UFLA 4Y5Z0 2VM9A 4B7EA 3P3PA 5DUUA 3M2MA 4V1PA 2ZXQA 3S7EA 2XQXA 1BQPA 3MFAA 5JOXA 4CCOA 1GOHA 1K45A 3AK0A 1HXS3 1ZRRA 2GDFA 3IMNA 3T30A 1RMU3 4B1MA 4Z2AA 4M4PA 3E6CC 4I0WB 2RS31 4XIOA 3WXPA 1NUKA 4LR4A 5B2GB 2HWB2 4OZOA 2A3XA 5FZ4A 1YJLA 3VBRB 4AQ6A 3NSTA 4YNIA 3MPPG 5FO8B 4Q4V1 3WW2A 2WJSA 1DGRA 1EYBA 2R6QA 1RUE3 1QOSA 1U5ZA 5IVJA 1RUJ1 3ACIA 1HXS1 1KD7A 3S30A 3J8F1 1J84A 1T2XA 4Y4RA 2IXLA 2Y6KA 5BY5A 1BVVA 3N9LA 4MHRA 1S0IA 2FCVA 5L9VA 3INAA 3V0BB 3BODA 1O3SA 3VBFB 5L7OB 1Y4WA 3Q8AA 3ZKYA 1RUE1 4EQVA 4JVAA 3I2HA 3AVSA 1G9DA 3TEZA 1X8EA 3AYCA 2JICA 2Z79A 1ZZBA 4HPKA 2PN5A 2PHDA 2ZPXA 2Q1FA 2V4AA 3BB6A 2CDOA 2B4KA 2ZABA 3PMSA 5CVRA 3HD8B 3VBRC 5C8CA 1Y9GA 3ZYFA 1H4GA 2MNGA 3RZJA 5FXVA 3TRSB 4NROA 1H1IA 1Y43B 3Q8EA 5I0RA 3HWJA 3WF0A 1S0JA 3S5AA 2YGLA 4D6RA 1BLZA 1OF4A 1S0DA 2DCYA 1AR72 1LENA 4L9BA 4WM8A 1JYVA 4K6BA 3HBZA 4ZS3A 3N36A 3VLBB 4Q0UA 1TNFA 1EV12 3SCGA 1UYXA 3VBFC 4QX1A 4GJZA 2IFRA 5LRRA 5L7OC 3MYXA 4CXYA 4XEZA 2VULA 5FUIA 1UPSA 4A6OA 5IT6A 2QBXA 4AI1A 4AZZA 1RUH3 3I49A 5FPAA 1HKDA 5GJ6A 4AFAA 3QCWA 2PHRA 4K8FA 5L9RA 2XKOA 1W9FA 3WW1A 5F2SA 3VDAA 3UESA 4HZFA 3V0AB 5C70A 3MFCA 2GNMA 2PLV3 2WQZC 2NMNA 4LORA 4META 3CMGA 3G7DA 3WQBA 1GU3A 1S1AA 3AFKA 5E8AA 3ZPOA 1GZWB 2EXJA 1VBB2 1GFF2 1F31A 5FLIA 4YFZA 1DQ5A 3RYKA 1JZ6A 3ZMOA 1CGPA 3C7EA 2FZ1A 4AHZA 1LODA 2XJSA 3LFMA 2KM2A 5GZDA 2ZX0A 4GB32 4IE5A 1WW6A 2CWMA 5FY4A 2PLV1 3AMNA 1MS8A 2VOKA 2WQ8A 4KBZA 1B35A 2BGCA 4QB6A 4IGOA 4DS0A 3ZFEA 1NLRA 4CEWB 1WA6X 4M3CA 3OGSA 3BTAA 3KT7A 2V4VA 1V6KA 4HVRA 2J1RA 3NNMA 2GALA 1G8WA 4BQ2A 5C33A 5F6KA 1QQP1 5KBFA 3O0XA 3S7IA 3GZAA 1MPXA 1N1VA 4AYUA 2BOJA 3EO6A 2PA7A 3PIJA 4I0AA 2YC4A 3KGLA 5DG2A 1GZCA 3HEIA 2JEMA 3KZ4C 1HQLA 4KU7A 2I2SA 5GALA 3Q8CA 3O1SA 2XVKA 3ZXDA 1LU2A 5FDBA 2E31A 1WKYA 5FY7A 2QNKA 3NNFA 3MV01 2ARAA 5KXDA 1QJU2 3A23A 1HJFA 4QHOA 2ARBA 4LHNA 5EQUA 2BVVA 4GH4C 4Q0SA 2BJSA 1FX5A 1IPSA 5DAPA 2EXIA 1EY2A 3K48A 4W6XA 3R6SA 2GZWA 2E63A 3WQ0A 2WA4A 4XJAA 4OMCA 3V56A 5IATA 3UYJA 4RS5C 4GKXA 2P6HA 4BISA 1QOTA 4XAAA 2YBSA 1LJ7A 1GUIA 4JCKA 4K9SA 3WG2A 1ULCA 1X82A 5JXHA 4DUVA 5CKNA 1PGW1 1IG3A 3PVNA 2RS51 2RVAA 3I54A 2WBKA 3M70A 4LPLA 2RDRA 1HXS2 4RGGA 1ZA4A 2V73A 1RMU2 2R7EB 4MLOA 4G3YC 4RFT0 4BQ3A 1RTVA 4PBOA 3HQRA 2LTNA 4GWJA 4HK8A 1EPWA 5DAQA 3UGFA 3GHMA 2X05A 1ASJ3 1GICA 2ZGSA 3DUIA 4N9HA 5CNAA 5FYBA 4GIQA 4F8AA 2PXJA 2OUJA 1RUE2 3ZXJA 4E2QA 1AYN3 2W52A 1VAKA 2P3KA 1M4WA 1PMHX 1ND3A 3MI8A 1F15A 3SCFA 4CCNA 2EALA 2P17A 3TN91 1QEXA 1CPNA 1PNFA 3K77A 4OULA 1Q8OA 3WF3A 5GZCA 3DXTA 1U5YA 1AJKA 2VCCA 3HMYA 5FP9A 1CWPA 3LA3A 2HYXA 3NAPB 2WO2A 5BNPB 4JTNA 5C7GA 1YNAA 1J58A 1CAVA 2GNDA 3ETPA 3N9MA 5K9YA 1LGBA 4UFMA 5JR7B 2W87A 3AYAA 2VOVA 4HBNA 2GN7A 4BZ4A 3AP6A 4Y22B 5C3OA 3X29B 2P5BA 2C6SA 4R4XA 5GZFA 1W6NA 1NLQA 1VRBA 1K5MB 3LEMA 4HOOA 5JIAA 1JZ8A 4DXTA 4IE6A 4PLNA 1WLCA 2JE9A 2ZGKA 3TB0A 3H0OA 4XBLA 3SH5A 4AF9A 1CAXA 4MUVA 5FZ9A 3NO8A 2QZ3A 1K5JA 1UU6A 3KCCA 2LROA 5FZCA 3CKHA 3BUCA 1F5FA 1SBFA 2JDKA 4LBKA 1XYOA 3WF4A 4Z92B 3N7MA 1WCUA 1NYWA 4M3CB 2XJVA 3SITA 2K46A 2VZPA 3NAPC 3WLUA 4CCMA 4BXFA 3UETA 5FZGA 4CTEA 5IVCA 1NXD1 3ZX7A 1NQJA 3VBOC 1SLIA 2RM23 1RUH2 2CTVA 2TEPA 1W6QB 3PLQA 2D6KA 1RC6A 4R9AA 1URXA 4DMIA 4MGYE 3UJOA 3IAQA 1K5MC 4P9IA 2D6OX 2QQLA 3NNJA 4BYYA 3TNPB 5JLVA 4IEWA 2D6MA 4QPGC 3I97A 1W8HA 2PLV2 2WWSA 1DGWX 3OY8B 4FPCA 5A7WA 1RITA 2CGNA 4OI2A 5E6HA 2ZX1A 4UBGA 4IEYA 3NWKA 4AFBA 1I1EA 3QH7A 3HNMA 2PHLA 3S6PA 3AXEA 4HONA 2D6LX 3LA2A 2JDAA 1DLLA 2Y6GA 5ANQA 2E7QA 1CESA 2VAUA 1IS5A 2WS91 1IOAA 4QB2A 4CEYA 1C57A 2EA7A 3TEWA 1Q8VA 2RJLA 3NRUA 2VQTA 3MW3A 4U2AA 1PGL2 2ADEA 2CHHA 1LOBA 1QXPA 3N35A 2OQ6A 3POFA 3DPRC 3ZYHA 3T0AA 2JDYA 2QUOA 1CAWA 4HFSA 5JSRA 1C3HA 3ZIWA 1V6MA 2GP3A 2VTFA 4XHXA 4Q4W3 2JXAA 4XXAA 1WMXA 1PZ8A 1RUG1 3B00A 5GLWA 3TEXA 3WG3A 1XNDA 4QM9A 4XUPA 1WW7A 1GANA 1COV1 4ZONA 5G05L 2HWF3 3H8XA 2A7AA 2BNNA 4BM8A 4C0BA 1KJLA 5JXJA 1SLLA 2BNOA 2FBEA 2CSGA 2LRPA 2OT7A 3LA7A 4RHV3 5DZFA 2GMMA 2WR9A 1F4HA 2JB4A 3VD4A 1UCXA 1AR91 2EF6A 3H50A 4OUEA 3PDQA 5FKCA 2BGOA 4YGBA 5FZ3A 4HSLA 1OQEA 4Q8KA 4N7IA 2WWJA 4XZUG 1PGW2 1VBE3 3THPA 3P1IA 4Q1PA 1C5IA 4DUWA 2AR6A 3LDRA 5J7MA 2VBDA 3MUZ1 4QX7A 4XE9A 3MO4A 2OPWA 4YZ1A 5JR2A 4OUMA 4P9JA 1VLNA 4UT5A 4COUA 1BEV3 4ARXA 4IEPA 3I3BA 1PIV3 1XE7A 5ABJC 1W03A 2HH9A 3JCIA 2WIIB 1VBE1 4QPYA 4HN0A 2NM1A 3ZYGA 1W0PA 1KFUL 4IEXA 4LKFA 4F83A 2VUCA 5FYYA 3P6BA 4P5HA 3GZUC 4ZZ5A 1HV0A 2BBVA 3DKWA 1AR81 4HXCA 1ASJ2 1WA4A 1UOJA 1NCRC 3D0JA 1N3PA 4MXWB 2KD7A 3C8XA 1WGPA 2NZ9A 2WZR1 4IEZA 4Q8LA 3TOJA 4A45A 1WWYA 1KXGA 2OW4A 2FQPA 1AYN2 1POV0 1GKBA 5I0TA 1HN1A 5D2AA 2X10A 1UU5A 2DWRA 1IKQA 2FMDA 2OS2A 3JB4C 1DDLA 3PTYA 2VGDA 2WABA 1Q8QA 1J3PA 1UZWA 3ROUA 5CA6A 4HMZA 2QQPA 3OPWA 2WN3A 1PMJX 1KQRA 4QT6A 4LBNA 1DBNA 2XH6A 2ZACA 1J83A 4HKOA 5LEJA 4QQHA 3L2YA 4O9GA 1D0HA 1R1A3 4LO6B 5AFBA 1D4VB 4CU9A 4AVCA 1YYNA 2DCZA 4IV1A 4CEYB 4LE3A 5FIXA 5FPXA 1YJKA 2Q1MA 4N43B 1AF9A 2OIIA 1REEA 3I2IA 4L99A 5IK5A 2WO7A 4YGDA 5A6YA 3WP6A 3VGIA 4QKBA 3AZZA 1YRZA 3ZYRA 1LHUA 2R071 4MGSA 4EROA 1CAWB 1W8OA 1PGSA 1KDMA 4MADA 1S0BA 4OLLA 4BMBA 1G9BA 1SBDA 4D0QA 5LK5A 2VNGA 4XDOA 4A3ZA 3AC0A 5GM0A 2WFF3 2VXJA 3H8OA 1W0OA 2RM22 2XXZA 3AX4A 2IWGB 5FZDA 3O5SA 5JOYA 3I2JA 4XQDA 4NIIA 5I8YA 2YFZA 2FDGA 4ZKTB 3GCWA 5SV8A 5A7OA 4LKDA 1OVSA 4EWAA 4HVOA 4JHTA 5A3LA 3GNEA 4R9CA 5FYUA 1GSLA 2WQ4A 5GLUA 1JUHA 3WD5A 4N43C 4FVVA 3VBSC 1CONA 3OEAA 1G9FA 2VNVA 3CIHA 1NA1C 3PVEA 5FJKA 3SLIA 3WNOA 1Y9MA 3KF3A 5BUVA 1H8TC 1OLME 3KB5A 4IEQA 2GH8A 5CU1A 3BTZA 5A1LA 4QXHA 5FWJA 3HQUA 1Q43A 3L2HA 1POV1 5FYCA 4MX3A 1RUG2 3RG0A 4FOYA 3O1RA 5FMOL 2JG9C 4XFBA 5BNNB 4CDWC 5IJRA 1RUOA 1WLTA 5LBFA 1WBFA 3VL8A 3H7YA 5FZ8A 1AYM1 4GAZA 4LUKA 4NHLA 4CYDA 1V6NA 1WMEA 4Q4W2 1N47A 1GWMA 3ATGA 4WVMA 4FAGA 3K51A 3BN6A 1AR92 1MVEA 3HJRA 2ZGPA 2FCUA 3JU9A 4KWLA 4DXRA 4IV3B 1BK1A 4UFKA 2UY8A 1JZ7A 3B02A 1A6CA 2VZSA 2DU0A 4X8PA 4XFIA 4XQ4A 5A6ZA 1BMV1 2HWF2 4JZRA 2VMDA 5A7PA 3NVCA 2EIEA 4EN9B 3ZKUA 2WNVC 5LRSA 1UOFA 2AEYA 4RHV2 4KH9A 1NXMA 4KMQA 3VZKA 5FMBA 1C1LA 1OI6A 5FOJB 1Q3EA 3SH3A 4UW3A 1LR5A 1O5UA 1XE8A 4BHPA 4JDMA 3WCRA 3ZSEA 1VBE2 5FFOC 4Q27A 2HBTA 4XQWA 4XUOA 4Z8BA 3R05A 5FR3A 1I9RA 1RJ8A 2EIBA 1CQ9A 3AP7A 2VZOA 1VBA1 1D4M3 5FYTA 4XFHA 3H42B 2Y26A 4P9WA 1BEV2 3JD73 4IL7A 4SLIA 1PIV2 3LGRA 4QDQA 3J4UH 3D8CA 4XCBA 3ZN6A 4WZCA 3FLPA 3ZXKA 4ES9A 2E53A 4O7XA 1RHI3 4IERA 3NKGA 4GWIA 4MVTA 4RD7A 4BQXA 2VMHA 5FK7A 5EYYA 5IK4A 4NIGA 1AL23 2Y0IA 1LOFC 4XMAA 4LLFA 3TNQA 4AVVA 5T5JA 4Y1UA 2VNOA 3JD71 1OFNA 2GMPA 2GSYA 4KNCA 3FJSA 1TME3 1XSQA 1CAUB 1QJX3 2D3PA 2Q1ZB 4IE7A 4NUBA 4CDXB 2GH2A 1OA4A 1HRI1 4GJYA 4DB5A 1KS4A 2ADDA 4AVTA 1RHI1 1LOCA 2TBVA 2DCKA 4FFGA 4U36A 1OUXA 5EP9A 5HI0A 2B8MA 2XJUA 4Y1ZA 1UF2C 4BJ0A 5JUVA 2Y6JA 1RYYA 4YM0A 3ZFGC 4BA6A 3VDBA 1W6PA 1CIYA 1AX0A 4Q0VA 5IWFA 4LBJA 4S2HA 5CFCC 3MIHA 1IS3A 1TME1 1QJX1 1MQTB 4CP9B 4Y20A 3I59A 5L9BA 1OXCA 3DEMA 1JHJA 2W5FA 4I0BA 2ZGLA 1IZ3A 2W46A 3WVJA 1SPPB 3MICA 5C9AA 4MGTA 1BCXA 3VZJA 4ET7A 3MLKA 1W2OA 2VOTA 1DYPA 1R1A2 2QE3A 3JUUA 1JMUB 1OF3A 1PO13 2RMU1 3PU3A 4JHZA 4CDXC 1F4AA 2JENA 3I2FA 4OHZA 3WDUA 4BLJA 4NIDA 2P3YA 1HDKA 2GU9A 2Y60A 3SEPA 4GXLA 2HEVF 2OQ7A 4HK9A 4RA0A 4XF4A 4CRQA 4FP3A 3WNXA 4NJ4A 5D21A 4Q4Y3 5KHHA 1FNZA 4FTSA 2D5FA 3JQWA 1Q5OA 4EV0A 2ZTNA 2JDZA 2HWB1 1UW8A 2CU5A 4CVUA 4WM7C 3POBA 1HIXA 2HWE3 2WFF2 3E6DA 3MF9A 4JKLA 4PHZA 4QDSA 3FHIB 4O61A 1GR3A 3POEA 4AOCA 3UK9A 4A2UA 3ACHA 1GOGA 5A6QA 4Q4Y1 1OHFA 1JU3A 1K12A 1U5IA 1DQ0A 4XACA 1W28A 1O4YA 2WRAA 5IFTA 1YFYA 1JYWA 5HV4A 5FXXA 1ZZ9A 1G9CA 1BHGA 4LA3A 2VCMA 2D93A 2LALA 2Y8KA 3ZSMA 4E4DX 2YBKA 2W08A 2D97A 4LMFA 1SDDB 2WA3A 3ZFFC 5DXDA 2YV8A 1PK6B 4GMP3 1O7FA 1SACA 1WCQA 2BW8A 4C91A 1MZ6A 4ZS2A 2GC0A 2ZAHA 5FLHA 1D2SA 4TWTA 3VBRA 4ES8A 3W58A 1NX9A 1VMFA 1UY1A 3N4MA 4G9SB 2JIJA 4MYEA 3ZN6B 1PVC1 3CJIB 1DQ1A 3FLRA 3FUQA 4E2SA 1DQ4A 4EN8B 1AR71 5F3EA 5HBAA 1UYPA 2RS13 3VBFA 4DQAA 3E5UA 4QPIB 3T1MA 5L7OA 1EV11 1DP0A 3VZMA 1K3IA 5F5IA 4AEDC 2EAKA 3GGLA 4L2NA 3GBGA 3KV6A 1M06G 4LXLA 2DVDA 1PK6C 3GHNA 3MZHA 4QQLA 1GOFA 3HOBA 2OKXA 1C8NA 4AAPA 4IUGA 2ETEA 1MS5A 4CCCA 1LGCA 5F5QA 4D7SA 2QZ2A 1JOJA 5FYSA 4KU8A 1JUIA 3EJKA 1OSGA 4H7MA 3VHPA 4Y20B 2HEWF 3I59B 1EUUA 3VBHC 4X6RB 1O59A 3RNSA 1D4M2 1OPMA 3BGAA 4R8HA 3P3NA 4I09A 4EN7B 3JD72 4QPIC 1VB2A 2VC9A 3CU7A 1JZ2A 3LZZA 1TMF3 2YY1A 4CP2A 1CVNA 4L8QA 3OPZA 2XQRA 3GBFA 5CG9A 4Y3OA 1RHI2 2XJQA 3LDKA 5T54A 2H0VA 2I07B 2QQJA 1AL22 1XC6A 3LDBA 3O0WA 1HX6A 3POIA 4YLZA 4BLIA 5F7UA 4JDNA 3ZYJB 4CU8A 3DGTA 4QAWA 2B7YA 1NKGA 2RJKA 1TME2 1QJX2 4NIHA 1XXNA 4EJRA 1T6GC 2QDNA 4LHLA 5E1RA 2FDIA 3NMBA 2XBO3 1GZWA 2Y34A 1S0FA 2VZVA 5KXCA 2Q8CA 3I4IA 4YFWA 2W1QA 4QKDA 2WLQA 3C3VA 4XURA 4ZHNA 3RDIA 2AENA 1GBGA 5B4NA 1W04A 4WVZA 5A7SA 3WF2A 1LESA 1ZZ7A 1YUDA 2ZGTA 3DF0A 3K4DA 3MUY1 1HB2A 4RQPB 4OHVA 4DINB 2YG0A 4RGAA 3FWEA 4LKSA 2BU9A 2Z69A 2Y33A 4HKLA 5DUWA 4AG4A 5K8SA 3OGRA 3NKTA 4QQ2A 4CEWA 1QJU1 3E1F1 4GH4A 4B3NA 4LTAA 1JW6A 1Y9QA 5IVYA 3A0NA 5IVEA 1PO12 4LOSA 2YBPA 4XPVA 3ZN5A 2Q0AA 4NHYA 5FREA 4ZU5A 4CZSA 2E33A 3IMMA 4FQ4A 4WZFA 2PQSA 4YM2A 5DPNA 1F5JA 5DQ0A 2WYSA 3T3YA 3RI8A 4N53C 2X09A 4E8CA 4LBQB 4Q4Y2 2RHPA 2UYAA 5FP3A 4QB1A 1RMU1 1I5PA 2D6NA 2DURA 3D0SA 4Y1YA 4RQPC 4Z82A 3FE5A 5J98B 1S0EA 4CUBA 1V6LA 3AKSA 3LB9A 3NJYA 2R16A 1IPJA 2WYFA 2FCTA 1GMMA 2HWE2 2VH9A 3PNAA 2FDFA 4I2OA 2ZBJA 2B5HA 5FWEA 4DFSA 2IFWA 2ILMA 3I2GA 2V5YA 3LCPA 4NN0A 5CB7A 3QD6A 3BKZA 3WDTA 3SC7X 4UF0A 1J1LA 2W39A 2IVJA 3AXDA 5CFDC 3EXUA 1C28A 1PVC2 4NOTA 3EMRA 4YW7A 2VR4A 1FV3A 2VMIA 3PJYA 3AMMA 5FK8A 4HG6B 5EJZB 2YFUA 4OHYA 1H1MA 1O3TA 2PAMA 5FZEA 2YMZA 1A8DA 1FYUA 4H55A 4ATFA 3KQRA 1FAYA 1FT9A 3QACA 3VDDC 1LRHA 4ORFA 5LY2A 3L9JT 2DV9A 3RZZA 4DRRA 3KM5A 1H2KA 3ALQA 2RS12 3KV5A 2D5HA 3NAPA 4FPYA 3T4VA 5BNPA 5IVFA 3AZXA 4MG2A 1WUVA 4LO4B 4AI3A 1H2LA 4BIOA 4BQ1A 4Y22A 1QH7A 2W68A 1SFPA 4BK4A 1XYNA 1K5MA 4Z07A 1RUH1 3MHZA 2JJ6A 4R9DA 3ES4A 3SXWA 1UZVA 2ID4A 3WNKA 2ZKNA 3MF6A 1W2UA 1VBD3 3QLQA 5LATA 4BIFA 3VZLA 3SQOA 4WBBA 2AC1A 1WMDA 5HCAA 1I5ZA 1LGNA 3I8TA 3WDWA 3OTFA 5AC93 2OA2A 2C24A 3H7JA 2WZEA 3ZR5A 1AJOA 1GWKA 3RSJA 1C8M3 1UKRA 4A3XA 3GF6A 5JOWA 3RZHA 1ULGA 4GH4B 2F4LA 2SLIA 2VTXJ 1LHWA 1LEMA 1UMZA 5BPXA 1C1FA 1JZ4A 1TMF2 2WT2A 4EWEA 2VQUA 3IAPA 4RR3C 1X8MA 4RS5B 4AEKA 1W8NA 3MIBA 4YVSB 1YFWA 1W6QA 3UT0A 4IEVA 4XFAA 4YW1A 1PGL1 2RR13 1ULOA 3RMXA 2DBNA 5TSWA 2J1AA 2PTMA 1N1SA 1GP5A 3H3ZA 3HNYM 5FYIA 1Z78A 3OY8A 1L7RA 1H1AA 2DYCA 2JE7A 3RYPA 1ULFA 3LEIA 2XBO2 2XLAA 3VD5A 1SLCA 1FATA 3VBUC 4AVSA 4JQRA 2F4PA 4PBPA 4QX3A 5FZLA 3VHNA 4ASLA 4JC1A 5F32A 1O8PA 2LUWA 3RFRA 2L9LA 1VPHA 4QWNA 1WLWA 4UWDA 1MS9A 2ZGOA 2ZGQA 3IDCB 3HAGA 4UFJA 1RUI3 1CIWA 3PJQA 1XQNA 2X5IC 2W47A 2ZX2A 5DN2A 1MS4A 5FZ0A 5JI7A 2VVEA 5FV3A 4CCJA 1MZ5A 2BRTA 4LA2A 3POYA 1H4HA 4YVSC 3FMGA 5DDJ3 4UF0B 4XJUA 1UO9A 4YW5A 1YHFA 4PQ9A 2J1SA 1ZZ6A 3POSA 3IT8A 3JQXA 1QDOA 1QXJA 1W8TA 5ABJA 4MXVA 3I3MA 2DTYA 4OHWA 3UKVA 1V6JA 2VJXA 5JPMB 3LF7A 2RJ2A 3O14A 4BXSV 3A21A 4GQ7A 3ZYPA 1UAIA 1UZ0A 1WCKA 5JIUA 3CQOA 4LOTA 4PT6A 2ZGUA 4CUGA 2HJIA 2O8QA 1OKOA 5FZOA 2EICA 2VG9A 5KR7A 3O12A 3WNNA 3ZM8A 1NCRA 3A7QA 4FFIA 4FOVA 5GZGA 3M3CA 1ASJ1 2C0ZA 3NJVA 4MO3M 5I0SA 4YW4A 2EAAA 2BFUS 2BYVE 4M4RA 3VKFC 4AXOA 1QY4A 1R1ZA 4GZ9A 2AREA 1JOBA 2XGXA 1AYN1 3RZLA 5J09A 2WKKA 4XJ8A 3RWKX 3VBOB 4CDQB 1YI9A 4TZDA 2CY6A 2FDHA 5C4WB 2OVUA 1LAJA 3S57A 1JU4A 1DF0A 4LUMA 1ZRIA 4XABA 4BQYA 1GWLA 2VZTA 3RZKA 4W6WA 4ITCA 4QPGB 5A3NA 2E7TA 2P3JA 5LZ6A 4C8DA 5DABA 1CX1A 1KS5A 3ELNA 2UYBA 4ZY9A 4BK5A 1SFNA 4O9EA 2FZ2A 2ZA9A 1UOBA 3K3OA 1JYXA 5FRAA 4AHXA 3ZLIA 1S4CA 3FFZA 3AYDA 5C8CC 4MXWA 4CPBD 2X53S 1E5RA 5T5PA 3AP4A 4UOJA 2VVDA 4MV2A 3IIAA 2NN8A 1EAH3 3GCXA 1WD3A 1W6MA 1PZ9A 4IGPA 4Y1VA 4FXGB 1CZSA 5KHGA 3WNPA 4CDQC 5FZBA 4FPKA 2TUNA 3DPRB 2XG3A 4I01A 5C4WC 1XB9A 3I3EA 5C71A 3T2OA 5CG8A 4GD4A 2AUYA 2XL7A 4LBQD 3T2TA 5JXGA 2ZEZA 4AGRA 5J36A 2OPKA 4XUTA 1T6BX 2IXHA 1EAH1 2YYOA 3RYRA 5C3RA 4PLOA 3ZSJA 5D8AC 2K2SA 5ACA3 2DUQA 4YARA 2RM21 2VQ0A 5AVPA 5JDBA 1VJ2A 4CSWA 3AZVA 4AFDA 2XJPA 2C9AA 4DZGA 4QKFA 3I3QA 4IW3A 1VBD2 5ERLA 5KHJA 4Y1XA 3WUCA 1NLSA 2JE8A 4N43A 3OCPA 5IK8A 1R093 4OHXA 3EB7A 4EYUA 3NW4A 5E88A 3WZ1A 5AC92 1SEFA 3RWNA 5ACA1 1QH6A 1XNBA 1GQHA 1XSRA 4V2WA 5A3OA 4MGIE 3R4DB 1P8JA 1SHWB 3QBQA 2QQNA 4A6SA 2VMCA 4QM8A 1B35C 1UXZA 2A6XA 1VAVA 2VOWA 3BOPA 3POJA 4FPFA 3V64A 5ABJB 3RS6A 4AL9A 2ZEYA 1VIWB 2RR12 1J3RA 2PAEA 3M7AA 4QXBA 2E7AA 5F3IA 3AL5A 3WDVA 3WP5A 1N3QA 2XVGA 4CUCA 4YM3A 2Z4FA 4Z1VA 3POWA 4AE2A 5FZFA 2CWSA 3QH6A 4Q4W1 1KRIA 4EWDA 1UY4A 2W94A 2WNOA 4XIKA 5KWRA 5FZOB 4QPWA 1OFSA 3S0MA 4AVBA 5IK7A 4C90A 4QKNA 1NCRB 5CZKA 5I0DA 5EV7A 3ZOIA 1BBT3 2R043 3OUHA 2XPJA 2EIGA 3D5OA 2WNVA 1OQDA 1QXRA 2OUHA 2SBAA 2HWF1 4E4SA 5JSOA 1OUSA 4BQWA 1RUI2 2AEZA 3K46A 4RHV1 4COZA 2QQVA 1UD1A 5FMCA 2XDVA 3DYPA 5BNNA 5ISLA 2FD8A 1NQDA 3AJYA 1GNYA 5DDJ2 5A1FA 2C5DA 2ZZQA 3PVBB 5H9RA 3BALA 5HV0A 1W99A 1ZRDA 2BWAA 5F8PA 2G1MA 5FZMA 5J48A 1LU1A 2AH2A 1GP6A 4XXPA 4CCLA 4JRLA 5IW0A 2XKPA 1BEV1 4IV3A 4CA9A 4OYUA 1PIV1 5FZIA 2G9FA 1O8SA 1YCIA 2ZHNA 3AFGA 4XFFA 4K1YA 3H1YA 2XJRA 1WLDA 2PQQA 4K7JA 3KCYA 2JG8B 1UPIA 3IPVB 4FP2A 5IAXA 1KEXA 1LOFA 4DOUA 4HSJA 2DCTA 4XOGA 3W5MA 4P00B 1W6MB 2B39A 4J6GA 3DV8A 2CYFA 1TZOA 3BU7A 1IPKA 4DEVA 1O3RA 3VUOA 4FI9A 3R4UA 3MDPA 4A42A 2QKDA 3JZVA 1SFYA 1XNTA 3IDAA 4IGQA 5F5CA 3T4HB 5FY1A 1FOD3 2C26A 4R9BA 2B46X 1GZ9A 4EZHA 3VV1A 1ND3C 4JRAA 4NR1A 1LKNA 5C8WA 2DTWA 3AMHA 1FPN3 2VW0A 3USSA 4L11A 4Z2WA 1GYKA 4XUQA 5CFCA 1LULA 1ODNA 4QX5A 4XUNA 4YYOA 5SV5A 3CEWA 3I7DA 3PUIA 1QNWA 3N7KA 3VDCA 2ZZJA 4URTA 3FHQA 2ZMKA 4IQPA 3ACLA 5IAVA 3AKRA 2C1FA 3HPNA 5JXIA 3OGJA 2JG8C 4JDOA 3KGZA 4LK7A 3E5QA 3VBSB 3AKPA 1NA1B 1HRV3 4CDXA 1CAUA 1AXKA 1FI2A 1H8TB 1Q56A 1R1A1 1ST8A 2GP5A 4Y5SA 4K20A 1EAH2 4FT8A 2JDHA 2JG9B 4HL0A 5DAVA 4OVEA 4CDWB 3ZXEA 1QMJA 2PYTA 1PVXA 3IZOA 1POQA 1QWRA 3VL9A 1XBFA 2VZ1A 3RZGA 1MQTA 1WZXA 4CP9A 2WSUA 3MLLA 1V70A 3VB9A 3OBAA 4PQQA 2IC1A 2WO1A 1OOPB 2GC2A 1TG7A 5IVVA 4NRPA 4XJWA 1H9PA 1YO8A 1SPPA 2WFF1 3ME2A 5ACA2 5IVBA 4RFRB 1ZA7A 1ENRA 4W4ZA 2IXJA 1C5HA 1D0GA 2A6YA 2D7FA 2JDPA 1TVGA 1W8UA 1JN2P 2WNVB 4A44A 4LE4A 4PCRA 2PELA 2IXCA 1ZBA3 1UY2A 2Y6HA 4CXWA 1R092 3KQ4B 2GC3A 2VOXA 2WNUB 3WT3A 3RJRA 4XF1A 2DUPA 2XR4A 1V9U3 1HW5A 1YQ2A 1GNHA 2NQYA 1V0AA 1AX1A 1H9WA 5A33B 2ZGMA 4H2AA 1SDWA 2MEV3 3A22A 1LNSA 2A3YA 4PDWC 2QJVA 4IEUA 5FQ0B 3AZWA 1ZBA1 3H8UA 4YGCA 2DVFA 4M00A 4P5YA 4QX2A 4E9KA 1OOPC 3CLPA 3I2DA 4MH0E 3CF6E 4KWKA 1PX3A 1YXWA 1V00A 5D1IA 1ZBE3 2BEOA 2KXLA 2ES3A 5HXMA 2XB6C 4K21A 3MW2A 4XDPA 3FC0A 3ZR6A 3Q8FA 2PHFA 3O1MA 2LW8A 2XUEA 3M1HA 2CDPA 2YZ4A 3OD4A 3GYDA 4AEDA 5CKMA 3ORJA 2EXHA 2P3IA 4S2DA 5FMOS 2WNUC 4P14A 5BV6A 1BBT2 2R042 2E26A 2A75A 1NOVA 3EHKA 1RVF3 3PMEA 1PK6A 4PIYA 5K7PA 4YW3A 3AP9A 3I2KA 2ZS6B 2NPIA 3WEZA 4XF9A 3ZFGB 3LEGA 1WCDJ 2AZ5A 1WCSA 3N9QA 4FOWA 1W8FA 4XAEA 3H3UA 1YEWA 4B4QA 5CFCB 1MEC3 2UWAA 1O3QA 4UW6A 2V5DA 4Y26A 2YDEA 3CJIA 3EBRA 1KFXL 5DAXA 2VE1A 3VBHA 4NPLA 2Y6FA 4TLGA 1Y7BA 1S0CA 4Q4X3 3FN9A 4DNYA 5GLZA 1ALYA 3FL7A 3OD0A 3WV6A 3VHRA 3MV11 1D4M1 4QPIA 1JI6A 1AHSA 4N9IA 5EHDA 4D7YA 4Y5TA 1F35A 2WL1A 5A70A 3PUQA 3OUIA 3N9PA 5G04L 2YC0A 2ZJCA 2A6VA 1W05A 4AI2A 1LECA 3IWZA 1CJDA 4Q4X1 5FXZA 5DZGA 4Y4YA 4XJZA 3VKMA 5C3PA 4GWMA 1F9KA 4O65A 1AL21 4MHUA 1IS6A 2XOMA 5F6LB 1UY0A 2EVXA 1LHNA 3KVBA 1ACCA 2Y38A 3I3DA 3WDYA 2XWJB 1QJY3 3WUDA 2R0FA 2R49A 3KMHA 5E89A 1X9PA 2Q8DA 4NHXA 4FO9A 1NCQB 1UMHA 2VY0A 4N7UA 4WM7B 5K0UB 1AR63 2VMFA 3D4KA 1AX2A 1FPN2 2IXKA 1MZFA 3VN4A 3MGUA 2XMLA 3VD9A 2XUMA 2QQOA 1ZRCA 2HWC3 3ZSLA 1YQCA 5FY9A 4LT5A 1RIRA 2KA3A 4H7LA 4B1LA 3ZDSA 3T08A 1O6UA 1CX4A 1AR61 1JXNA 2DFCA 3K2OA 1NAEA 3SHRA 5C3QA 5FKBA 4FTEA 5GKAC 3VD7A 4AHYA 2WAOA 2RDSA 2P6CA 1N1TA 5FZ7A 3ZFFB 4R52A 2QQUA 3N9OA 1CN1A 4LEJA 3T2PA 1PO11 4QX0A 4DEQA 1GNZA 1DZTA 1R64A 3C7GA 4LULA 1JOPA 2FMYA 1NCQC 1UX7A 2OZ6A 2Y6LA 3NL1A 1S55A 3PURA 4K40A 4SBVA 5K0UC 1FMD3 5CIRA 1U0AA 1X9TA 5CEHA 3ECQA 5FBJA 4RQPA 4M0HA 1RUC3 5A3WA 2DVGA 1AVBA 1VP6A 4YRDA 2UU8A 5EPAA 1NT0A 2D43A 1O5LA 5AVAA 1DZRA 1GZTA 1J1TA 1NZIA 2BQPA 2HWE1 4AEDB 1BVP1 4CPBA 4OQ9A 2ARCA 4E4ZA 2J7MA 3OBZA 2CNAA 1QU0A 2XHKA 5A32B 3HVDA 1RUC1 2EIDA 4BB3A 5J37A 4PIXA 4FPLA 5FPBA 3WINE 4COWA 1ZBA2 2Y0OA 3GALA 1SCRA 1YQ6A 5T52A 3KVAA 2PFWA 5CFDA 2ORZA 2B9UA 4BMEA 5FP8A 1V9U2 5F2WA 3U37A 4LBQA 5F3CA 3WNLA 4IETA 3ILFA 1XOYA 3VBHB 2OXBA 4AI0A 1VB4A 4DIQA 2MEV2 1BKZA 4GMP1 5CYYA 4YVWB 1W06A 3W59A 1ZYBA 3CBNA 3KF5A
chains in the Genus database with same CATH topology
1A34A 4OQ8A 1ZA7A 3J7NA 4NIAA 1CWPA 3J7LA 1JS9A 1YC61 4OQ9A 3J7MA 1STMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A34 A;  4OQ8 A;  1ZA7 A;  3J7N A;  4NIA A;  1CWP A;  3J7L A;  1JS9 A;  1YC6 1;  4OQ9 A;  3J7M A;  1STM A; 
#chains in the Genus database with same CATH topology
 4KWJ A;  1VRH 3;  4JX0 A;  1ULE A;  4JGY B;  4WVV A;  3O7O A;  2R1D A;  4MGQ A;  3BIE A;  1PNG A;  3M3Q A;  1H2N A;  2IXI A;  3P5B A;  2Y64 A;  2W9X A;  1ZBE 2;  2ZX4 A;  4BQ5 A;  1MS1 A;  3USU B;  1QDC A;  1H30 A;  5JAX A;  3OB8 A;  2ZAA A;  5ANN A;  5LA2 A;  1Z7S 3;  3LSE A;  2RS1 1;  2XL9 A;  1RUD 3;  4AGV A;  4CCK A;  4L97 A;  4A7Z A;  4H3W A;  3ZYB A;  3RPQ A;  1ENX A;  2XON A;  1RVF 2;  3N7J A;  2R30 A;  1UZZ A;  4YG3 A;  1HN0 A;  2JD4 A;  2ZEX A;  1WBL A;  1TE1 B;  5T5L A;  4YVW C;  5CKQ A;  2UWB A;  3THD A;  3U14 A;  1TEI A;  3KS7 A;  1YIF A;  1ZZC A;  4FBF A;  1OD5 A;  1MEC 2;  2PAK A;  3FBY A;  4JGY C;  4QU2 A;  3JBG 3;  5JCT A;  2VPV A;  5FYH A;  2DCJ A;  2JIG A;  1BZW A;  1AZD A;  1S2K A;  2J22 A;  2R06 3;  2BP6 A;  3H1M A;  3Q8B A;  4FPE A;  4LJH A;  4AQS A;  4C1X A;  4Q4X 2;  3CNA A;  4JQT A;  3MW4 A;  3OYW A;  1SCS A;  4KI5 M;  3VKL A;  4W50 A;  2ZX3 A;  1N1Y A;  2BER A;  1ND2 B;  5KHI A;  3F2Z A;  4RR3 A;  2YHJ A;  1JHN A;  1SQ4 A;  5E16 A;  4K8R B;  3B9I A;  4FPJ A;  5EWS A;  1DFQ A;  1TMF 1;  4I02 A;  1W8W A;  4ZU4 A;  3OEB A;  4BOW A;  5FYZ A;  2G9Z A;  1AXZ A;  2UUR A;  3B7M A;  2OYZ A;  4AFM A;  1RJ7 A;  2FHR A;  4N53 B;  4Q5O A;  5BNO C;  4C1W A;  3ZVX A;  3PTR B;  2WWU A;  1VBC 3;  1FV2 A;  1QJY 2;  4JGZ C;  2HKX A;  4GUL A;  2WO3 A;  1NY7 2;  2DBI A;  2DVB A;  1HB1 A;  3GJA A;  5T50 A;  2XBO 1;  1Q8P A;  2D40 A;  1AR6 2;  5IUQ A;  1R08 3;  4ASK A;  1XU2 A;  2JKX A;  3KWV A;  1ZRF A;  5L73 A;  1QJZ A;  4NIA A;  2CL2 A;  5C5T A;  5FAX A;  1ZRE A;  1D2Q A;  1RUF 3;  4LIV A;  3W9A A;  4ZZ8 A;  1ND2 C;  1W3V A;  1S2B A;  2HWC 2;  3J9S A;  4RS5 A;  5DUX A;  4DY3 A;  3KT4 A;  4BE3 A;  3CDZ B;  4QGL A;  4JAA A;  4HT1 T;  1W6O B;  4M3C E;  4YVS A;  2Q4S A;  4UI9 L;  2ZHK A;  4FXK B;  4FAH A;  2P37 A;  3BTY A;  2W3J A;  4Q2F A;  3KCX A;  4B4R A;  1R08 1;  1UN1 A;  3PUA A;  4RSU A;  5CFD B;  3BU0 A;  2RS3 3;  1C4R A;  1UQX A;  3DL3 A;  1CPM A;  2E32 A;  2JX9 A;  3DYM A;  5FZK A;  3UNP A;  2YU1 A;  2DDU A;  2YUE A;  3C7H A;  4Q4V 3;  1RXF A;  3UGG A;  4ARY A;  4FOQ A;  3WY6 A;  3ZN4 A;  4YG0 A;  2ZEW A;  1RUJ 3;  1PO2 3;  1FMD 2;  1PM7 A;  3BCW A;  3FHA A;  5HCB A;  3J8F 3;  4BU2 A;  5BYN A;  1G9A A;  4NRM A;  4F3J A;  3ILR A;  2PHX A;  4FFF A;  5F1R A;  3VDD B;  2PHW A;  1RUC 2;  2QQI A;  1ULP A;  4LLO A;  3AP5 A;  2MHF A;  3NJZ A;  5GLT A;  5KC6 A;  5LAS A;  3PIG A;  3RQ0 A;  4DRV A;  3WQ7 A;  3NJX A;  1MAC A;  1E57 A;  2GNT A;  1PO2 1;  3J7N A;  4COY A;  3THT A;  4P9Y A;  5F9T A;  5KC5 A;  1IHM A;  1OT5 A;  4QX8 A;  1UYZ A;  4M01 A;  2IZW A;  1JOD A;  2P34 A;  3V65 A;  3LQC A;  4ISR A;  4QHZ A;  1VMJ A;  3T0D A;  4J25 A;  4IE4 A;  5LEK A;  2J1E A;  3AKQ A;  3NV3 A;  5I0U A;  3WX5 A;  3ZXF A;  1JTZ X;  4BDV B;  1HQN A;  2K0G A;  1REF A;  5LA1 A;  2GNB A;  2W0X A;  5EJ1 B;  3M4F A;  3BTX A;  2FDK A;  3NNG A;  4YM1 A;  3LAG A;  2JDU A;  1OD3 A;  1US3 A;  3MEP A;  3ZIX A;  4PI2 A;  1LHO A;  2AGS A;  1CD3 G;  3K4A A;  1VRH 2;  1STM A;  3J7H A;  3OYW B;  4P9G A;  5FZH A;  2VCA A;  5B4X A;  4XC9 A;  4KL1 A;  4RR3 B;  5CAD A;  3VBO A;  4CDQ A;  4XHB A;  4DO0 A;  2R0H A;  2B45 X;  1O91 A;  4NWW A;  5C4W A;  4NAO A;  3OUJ A;  2VTX A;  1NE4 A;  1Z7S 2;  1KIT A;  2CAV A;  3EYP A;  4QPG A;  1QNY A;  5JVV A;  1RUD 2;  4IEO A;  1ODM A;  2X29 A;  2BBA A;  1G7Y A;  3B5L B;  1NE6 A;  4WVW A;  4LO8 A;  1YLL A;  4JKK A;  4XET A;  5D8A A;  1GQP A;  4LQR A;  5F39 A;  3VBU B;  1SBE A;  3C7O A;  3AM2 A;  3DCQ A;  5JZG B;  3R4S A;  4DXS A;  5FPZ A;  3GZT B;  5CAZ A;  4YGE A;  1D7P M;  3RVH A;  2ZML A;  3UJQ A;  1LB2 A;  3MID A;  1DQ6 A;  3OPT A;  2V72 A;  1W0N A;  1KJR A;  4XFG A;  5LA0 A;  3JBG 2;  1VBD 1;  2X5I B;  4C0H A;  5DUV A;  2R06 2;  1V6O A;  4LKE A;  1MZE A;  3W5N A;  3IKW A;  5AC9 1;  3DPR A;  3SIS A;  1XNA A;  1OH4 A;  1DQ2 A;  1XPW A;  2F17 A;  4N90 A;  5FYM A;  1C8M 1;  1QJE A;  4CUA A;  2H6C A;  4AWD A;  5T5O A;  3O1U A;  2BZD A;  1QQP 3;  1SZB A;  4FTB A;  4CDU B;  2W91 A;  3GJB A;  4XTM A;  4TXW A;  4X8N A;  3U0Z A;  3WQ1 A;  1F2N A;  1AXY A;  5LBB A;  3RRD A;  4V2V A;  5T3N A;  2AYH A;  4AQT A;  4E8D A;  3MIE A;  2RDQ A;  2PHU A;  3HT2 A;  5JZG C;  2RR1 1;  4RGK A;  1A34 A;  2N7G A;  3BPS A;  2ZGR A;  4TN7 A;  1S2E A;  4QDR A;  4MZU A;  1VBC 2;  5FYV A;  5C6C A;  1ENS A;  1QGL A;  4ZXK A;  4A4A A;  3LOB A;  5A3P A;  1WD4 A;  4PF1 A;  4QD2 A;  2KR2 A;  1Y3T A;  3IDB B;  4ZU7 A;  1R08 2;  1S0G A;  2QQW A;  3U11 A;  4NPR A;  1H8V A;  1RUN A;  4YSF A;  4AK3 A;  5F3G A;  1H2M A;  1RUF 2;  4UBH A;  5I8S A;  3DXU A;  3ITQ A;  4CDU C;  1RUI 1;  1HV1 A;  4YWA A;  1EUT A;  1RL3 A;  2H0B A;  3IDE A;  4CP0 A;  1OLQ A;  3BOW A;  1XRU A;  1DG6 A;  3FBM A;  2VZU A;  4CEW C;  1W90 A;  1NZC A;  2RS5 3;  2VBP A;  4DPN A;  2WT1 A;  1IQA A;  5DDJ 1;  4YG6 A;  2P2K A;  1YQ8 A;  2RS3 2;  3ZO0 B;  4D94 A;  3ST7 A;  3NQH A;  1UX6 A;  5FY8 A;  3U07 A;  4AQ2 A;  1JYT A;  1W39 A;  3HQX A;  1PHM A;  4LHK A;  3TEY A;  3B9C A;  4HPK B;  3D6E A;  4FPO B;  3B69 A;  2BFU L;  2OZJ A;  2R1B A;  4Q4V 2;  3ZSK A;  5KXB A;  5C8C B;  5JPN B;  4AVA A;  3SEE A;  3ACF A;  4BQ4 A;  1RUJ 2;  1PO2 2;  5IFP A;  5H9P A;  3J8F 2;  4E4H A;  3TN9 3;  3O1P A;  5EYX A;  5FJH A;  4D6Q A;  4WM8 B;  2QFE A;  4WV8 A;  4BWO A;  3VZO A;  1W2T A;  3FLT A;  2VXR A;  4EN6 B;  2RG4 A;  4KBB A;  3RJ2 X;  4ISQ A;  3ZPY A;  5F37 A;  3GM8 A;  3C2U A;  1GV9 A;  5HXV A;  5IYY A;  2JDN A;  2ZGN A;  3W20 A;  2QVS B;  4LO7 A;  4LBL A;  2A73 B;  1PMI A;  1O4Z A;  1US2 A;  3JB8 A;  5D8A B;  5KHK A;  3RI9 A;  4ASM B;  3KV9 A;  2GME A;  3GXU A;  1BJQ A;  2VUJ A;  2WT0 A;  2V09 A;  3LIH A;  4QMA A;  3D82 A;  3LFI A;  3OGG A;  4KGQ A;  2JG8 A;  3IPV A;  3A4U A;  3U78 A;  3KHC A;  1PZ7 A;  5BNQ A;  3O0V A;  4PJY A;  4WM8 C;  3WG1 A;  2NYY A;  3ZMN A;  4QXC A;  4W8J A;  3O1V A;  2D44 A;  5FPL A;  1JZ5 A;  1WW5 A;  1QIQ A;  2ZCW A;  2R32 A;  5H9Q A;  2E9Q A;  2ARX A;  4XF3 A;  2H6B A;  4DXZ A;  1UKG A;  1W9S A;  3B3Q E;  3CO2 A;  5HCF A;  3TAY A;  1B35 B;  3HIF A;  2ET7 A;  1FXZ A;  1DGL A;  3Q9O A;  3ZFE B;  3W21 A;  1AUY A;  4XIL A;  1HQW A;  1N3O A;  5BNP C;  3APB A;  4NAM A;  3WW4 A;  4EN0 A;  5FMD A;  4CXX A;  3SH4 A;  5J1X A;  1TQ5 A;  3F95 A;  1PX4 A;  1XJA A;  1DHK B;  3J7L A;  2VW2 A;  2BV4 A;  5M0T A;  4J1W A;  3U4X A;  2XVL A;  2BWC A;  3VBS A;  5JMC A;  2NP0 A;  3LD8 A;  1NA1 A;  1SLT A;  3NNL A;  5EZW A;  1H8T A;  2RE9 A;  1C8M 2;  1UMI A;  2WZ8 A;  1UU4 A;  2WS9 3;  4FPG A;  3E5X A;  4LIT A;  2JEC A;  2Z42 A;  3RGB A;  1SLB A;  3LSD A;  3LKJ A;  2VU9 A;  3CZJ A;  1W9Y A;  1PM4 A;  3B94 A;  2Q8O A;  2JG9 A;  5FUP A;  1GP4 A;  4LHS A;  1R09 1;  3PUS A;  2RV9 A;  3DKQ A;  4CDW A;  5LY1 A;  2HYK A;  3OG2 A;  3ZFE C;  1OVP A;  3EQE A;  3N3H A;  3UV9 A;  4I30 A;  4KWU A;  3OF1 A;  4PDW A;  1HJG A;  1QQP 2;  1RUG 3;  2W92 A;  2DU1 A;  2ORX A;  1OA3 A;  1IS4 A;  3K75 B;  3QOP A;  1OOP A;  1COV 3;  3LWC A;  3IN9 A;  3TYJ A;  3WP3 A;  4AI9 A;  3LPG A;  4M0N A;  4HLT A;  4XFC A;  1XYP A;  3DYO A;  3PVO A;  4FCA A;  3A0K A;  2TNF A;  4OFG A;  3OBT A;  4XYX A;  5A3U A;  4Q0Q A;  3U4S A;  1AR9 3;  5FLJ A;  3WG4 A;  4D8M A;  5J96 B;  1RXG A;  1MR5 A;  3AYE A;  2VMG A;  3POG A;  3H3L A;  5FO9 B;  1A78 A;  2WNU A;  2XLF A;  4RL7 A;  4NRQ A;  4Y24 A;  5L36 A;  2K9Z A;  2BOI A;  2J42 A;  3M3I A;  4P9L A;  3TWI A;  2D3S A;  3IM0 A;  3VHO A;  2D98 A;  1BBT 1;  3NV4 A;  4UXA A;  2BTV C;  2R04 1;  5A33 A;  1UIJ A;  2UWC A;  2QCS B;  1ND3 B;  4FQZ A;  5CIS A;  5FQ0 A;  3B93 A;  4UW4 A;  2O14 A;  4XW3 A;  1J3Q A;  3KT1 A;  2XJT A;  4OMD A;  3KV4 A;  4AR2 A;  4Q26 A;  3UGH A;  4P08 A;  2RS5 2;  2ZHM A;  4NE9 A;  4D69 A;  1CAV B;  1BYH A;  1NG0 A;  1JYI A;  4KQ7 A;  2ZMN A;  3ACG A;  3J26 N;  4E2G A;  1UY3 A;  3ZYI B;  3LIG A;  3PL0 A;  1OBN A;  1OC1 A;  1UL9 A;  4PLM A;  2QTW B;  2ZOE B;  4ONU A;  5FTT C;  1AR8 3;  1A8M A;  1ULD A;  1W6N B;  2Z5W A;  3KLS A;  2IUW A;  4URA A;  2BPA 2;  1ENQ A;  2VO5 A;  2WZR 3;  4B8E A;  4I3P A;  1VMH A;  4MGZ E;  3CL1 A;  2NLR A;  4YZ4 A;  1CAX B;  2GAU A;  5A7Q A;  3WSO A;  2CGO A;  4BPZ A;  3AVR A;  1OUR A;  3TN9 2;  4HKW A;  3NV1 A;  4CP1 A;  3ENR A;  1LOE A;  3ZFG A;  2O1Q A;  1H6X A;  3AMQ A;  2F6B A;  4YZ2 A;  2Q8E A;  2JKB A;  2QQM A;  2W1W A;  3OJB A;  3UL2 A;  5L19 A;  3WHU A;  5FP4 A;  3GDB A;  1K42 A;  4UYB A;  5FUN A;  3OOX A;  3WF1 A;  4Q29 A;  1F8V A;  1FOD 1;  4XDQ A;  3OGV A;  2HLE A;  2WFP A;  1W3X A;  3O1T A;  3MPB A;  3III A;  1FPN 1;  4FFH A;  5JI9 A;  2A1X A;  5HCH A;  2WAA A;  3S5Q A;  3BYW A;  3SKV A;  3CZU A;  3ZXG A;  5EIY B;  5LBE A;  1DGR N;  2PMW B;  3K4Z A;  2W95 A;  2YGM A;  3K3N A;  5K4L A;  5A7W B;  4A41 A;  4TLF A;  4NPM A;  2VZ3 A;  1UZY A;  1WMF A;  2VEC A;  1VAM A;  1J59 A;  2Q30 A;  2R07 3;  2QQK A;  1CZT A;  1W9W A;  1JBC A;  2WC2 A;  1HRV 1;  4IES A;  5A6X A;  2YC2 A;  4DY5 A;  2RDN A;  3WHT A;  1W2N A;  2G19 A;  4IND A;  4PDW B;  5A1A A;  4W6Y A;  1NCQ A;  5K0U A;  4WM7 A;  3IBM A;  3R0R A;  3LE0 A;  5C5U A;  1DLC A;  2VCB A;  4KG0 A;  4P02 B;  2ATF A;  3DN7 A;  3SMH A;  2YPJ A;  1OKQ A;  1LTE A;  4UFI A;  4XMI A;  1VAL A;  1YIP A;  4TSV A;  3FZ3 A;  2D6P A;  3M3E A;  2VQA A;  3N9N A;  3BIW E;  4UFH A;  1W2A X;  2XLG A;  1U12 A;  4RN5 A;  1GLH A;  2XHN A;  3IB3 A;  4S2F A;  1L3J A;  2HBU A;  2YB7 A;  3T2Q A;  3SKJ E;  3KD4 A;  4IDZ A;  2A6W A;  3ZFF A;  1QOO A;  2WS9 2;  1JS9 A;  1POV 3;  4TTG A;  1Q8S A;  3H9A A;  1OPO A;  4CEY C;  1MVQ A;  4YPJ A;  1IQD C;  3U1X A;  2VME A;  3UKT A;  4NWV A;  1Z0H A;  5DMY A;  1O4T A;  4OI4 A;  3BPZ A;  3M8L A;  2LS6 A;  1AYM 3;  1RED A;  1UXX X;  3ETQ A;  3MLJ A;  2ERF A;  5LK7 B;  4FPH A;  1V9U 1;  2A5Z A;  3FUO A;  3ABZ A;  5FZ6 A;  4AEJ A;  2WIN B;  2E6V A;  3E97 A;  1ONA A;  3U10 A;  1AL0 G;  2MEV 1;  4L0P A;  4HVQ A;  2J1V A;  3THC A;  4AHW A;  3WCS A;  4B7K A;  1COV 2;  2BNM A;  2WLP A;  2GN3 A;  2LM3 A;  4XVH A;  4XTP A;  3AL6 A;  4QXK A;  2W2I A;  2BGP A;  4QU1 A;  4QHB A;  2VZR A;  4CCE A;  2JB8 A;  5A32 A;  1EPZ A;  1X7N A;  2VL4 A;  5GLV A;  1ZBE 1;  2CGP A;  2IVI B;  2QDR A;  4A7Y A;  3U75 A;  5I8T A;  3WNM A;  1LED A;  1L7Q A;  4EZ4 A;  4OQ8 A;  3T1L A;  1E5S A;  3HT1 A;  2E51 A;  3HBK A;  2DVA A;  5FY5 A;  3BVC A;  3CHX A;  4EE2 A;  1XNK A;  1VBA 3;  1H0B A;  1RVF 1;  4YVW A;  5A3M A;  5FY0 A;  4R4Z A;  3O1O A;  1ZNP A;  2ET1 A;  2I74 A;  4AFC A;  5FPU A;  1MS0 A;  5APA A;  3LEK A;  3G6J B;  4JGY A;  1WW4 A;  5BNN C;  3ASI A;  3JXS A;  5LWB A;  3PUH A;  2DF7 A;  4X6Q B;  5JMO A;  1MEC 1;  1YQ5 A;  3RZM A;  2VD7 A;  2WUH A;  4D7T A;  3VKN A;  1JZ3 A;  3USU A;  1HB3 A;  1IKP A;  3NV2 A;  4NHM A;  1AR8 2;  2HWD 3;  4HN1 A;  4AGG A;  2CAU A;  3H1W A;  4AAX A;  1RB8 G;  2WZR 2;  3E6B A;  4IV3 C;  3C7F A;  1HRI 3;  4GWN A;  1YFU A;  4XBN A;  5FBZ A;  2J1U A;  1FOD 2;  2FDJ A;  4IV1 B;  5H9S A;  1XNC A;  1FNY A;  4GMP 0;  5A80 A;  4YZ5 A;  2W1S A;  5EJ3 A;  3HN3 A;  5BNO A;  5C3S A;  1QF3 A;  2ENR A;  2HWD 1;  1ZX5 A;  2ZHL A;  3VZN A;  4XJ9 A;  1CJP A;  1DYO A;  4JGZ A;  3OBR A;  1JH5 A;  1OLR A;  4E27 A;  2C4X A;  2EXK A;  4LIU A;  5LBC A;  3VD3 A;  1QJY 1;  1VR3 A;  4BH9 A;  1YFX A;  4ZPI A;  5A7N A;  3J7M A;  1BXH A;  1NY7 1;  2YU2 A;  5BXX A;  4KGG A;  2VUA A;  2VZQ A;  4GA9 A;  2WNE A;  2BDR A;  4GKY A;  1DYK A;  4I3G A;  1OA2 A;  2RMU 3;  1LOA A;  1ND2 A;  1HRV 2;  3B01 A;  3WDX A;  4D6S A;  3H8R A;  3AZY A;  2OX0 A;  3MBW A;  2BUK A;  2HWC 1;  1OLM A;  4Q1R A;  1L7L A;  4COV A;  4IV1 C;  4MOA A;  4AEM A;  2JWP A;  1DGW A;  2A71 A;  1DZQ A;  1I6X A;  4QQP A;  1I3H A;  1ZZ8 A;  1EP0 A;  4N53 A;  4GAL A;  4QGM A;  4J1X A;  4ATE A;  2R07 2;  5FCC A;  5FPV A;  5FO7 B;  4XZP A;  2MPF A;  2YXS A;  2HWB 3;  5JWP A;  5EFU A;  3ES1 A;  3TBD A;  4LBO A;  2P4E A;  4OCT A;  2JDM A;  5AFE A;  4OZX A;  4D3W A;  1DU3 D;  4AW7 A;  1FMD 1;  1E5H A;  5GZE A;  1KDK A;  5DG1 A;  4YW2 A;  4PF5 A;  1MQT C;  4F7Z A;  4S2G A;  4W65 A;  4NHK A;  1SG3 A;  1KGY A;  2WN2 A;  1CR7 A;  1W6O A;  1MS3 A;  4QGN A;  4WVM B;  4Y33 A;  3AKT A;  3PHM A;  3AMP A;  2A70 A;  1OMI A;  2VVF A;  1V6I A;  2A6Z A;  4CU7 A;  1QHD A;  3FFQ A;  3M3O A;  1RGS A;  3T0B A;  5LCW L;  3LPF A;  1G6N A;  1IGO A;  1HLC A;  2NMO A;  4K1Z A;  5LA9 A;  2P1B A;  1A3K A;  2GC1 A;  1TNR A;  1YI7 A;  3MIG A;  1E5I A;  4ZXE A;  1SLA A;  1GQG A;  4UAP A;  4OI0 A;  1G86 A;  3ZXL A;  4FSJ A;  3HNB M;  2HEY F;  1UIK A;  1VE0 A;  4BCU A;  2DUO A;  1CZV A;  1PVC 3;  3CJX A;  1AYM 2;  1JYC A;  1X33 A;  4MGK E;  2VBB A;  2YRO A;  4NO4 A;  2J1T A;  1QKQ A;  3KSC A;  3URF A;  3VDD A;  1AR7 3;  5FXW A;  2VNR A;  5IHR A;  5FP7 A;  5T55 A;  4K3U A;  1YC6 1;  3LOI A;  4JKM A;  4IXL A;  3WR0 A;  4DUX A;  2CV6 A;  3ILN A;  4Q0P A;  1EV1 3;  1ZM1 A;  5EXO A;  4PIZ A;  1X50 A;  5FOB B;  4YW6 A;  4CCD A;  1VRH 1;  4LK6 A;  1BMV 2;  3RMY A;  2ZKL A;  4QQO A;  5LW9 A;  3BI3 A;  4N8M A;  5CBL A;  1SMV A;  2D3R A;  2A3W A;  4H14 A;  4PI0 A;  4TYS A;  2W1U A;  4LO5 B;  3V0B A;  4MSV A;  1RIN A;  4P9X A;  5A3T A;  1UYY A;  1W8Z A;  5BNO B;  1W9T A;  1X36 A;  1IG0 A;  1Z7S 1;  2PHT A;  4NMI A;  4B4P A;  3GBW A;  3T09 A;  4CE8 A;  2DFB A;  1APN A;  1RUD 1;  4JGZ B;  4B29 A;  2JD9 A;  3HN1 A;  2O0O A;  2Z2S B;  5HPO A;  5J3U A;  3ON7 A;  1VBB 3;  3FX3 A;  1VBA 2;  4L92 A;  5LB6 A;  4JV4 A;  2B9V A;  5JOZ A;  4OUS A;  5F5A A;  3D3A A;  1W6P B;  4UW5 A;  4GB3 3;  4M3C F;  2XWB B;  4HAN A;  3WP4 A;  3GZE A;  3WOG A;  4NVP A;  2AAC A;  4AI8 A;  2G4I A;  3CJI C;  3JBG 1;  1BK0 A;  5JSP A;  1DIW A;  1LCL A;  1VBB 1;  2R06 1;  1LOG A;  3SNM A;  4XF0 A;  1HB4 A;  2WDB A;  5I91 A;  5DZE A;  4RYD A;  2B42 B;  3DEC A;  4YZ3 A;  2HWD 2;  3HR9 A;  1UWW A;  5C9A B;  3VKO A;  1UNB A;  4IE0 A;  4GB3 1;  2WSV A;  2YPD A;  1YWK A;  1U5X A;  3KHB A;  1HRI 2;  5DAW A;  1H6Y A;  3UKN A;  3I2O A;  1XE0 A;  1XU1 A;  4CU6 A;  3VBU A;  2Q5T A;  1UOG A;  4A7K A;  2G9G A;  5FZ1 A;  2WZP P;  5JZG A;  4G4F A;  1QJF A;  3V0A A;  1ZVF A;  1LHV A;  3OSD A;  4HET A;  5I93 A;  4LNV A;  4XBQ A;  1OQ1 A;  3ZDV A;  2X5I A;  1DCS A;  4XCA A;  1VBC 1;  4JTO A;  4OI1 A;  1QJU 3;  3PU8 A;  2VW1 A;  2BVB A;  1OH3 A;  2UY9 A;  1JYN A;  2VUD A;  5KXE A;  4KG8 A;  3WW3 A;  3AB0 A;  5FZA A;  2X8K A;  5C9A C;  3ZXA C;  2RMU 2;  1B09 A;  2I45 A;  3AJZ A;  2C9K A;  4CDU A;  2O8O A;  1RUF 1;  3N7L A;  4LBM A;  3SCH A;  3MIF A;  4UFL A;  4Y5Z 0;  2VM9 A;  4B7E A;  3P3P A;  5DUU A;  3M2M A;  4V1P A;  2ZXQ A;  3S7E A;  2XQX A;  1BQP A;  3MFA A;  5JOX A;  4CCO A;  1GOH A;  1K45 A;  3AK0 A;  1HXS 3;  1ZRR A;  2GDF A;  3IMN A;  3T30 A;  1RMU 3;  4B1M A;  4Z2A A;  4M4P A;  3E6C C;  4I0W B;  2RS3 1;  4XIO A;  3WXP A;  1NUK A;  4LR4 A;  5B2G B;  2HWB 2;  4OZO A;  2A3X A;  5FZ4 A;  1YJL A;  3VBR B;  4AQ6 A;  3NST A;  4YNI A;  3MPP G;  5FO8 B;  4Q4V 1;  3WW2 A;  2WJS A;  1DGR A;  1EYB A;  2R6Q A;  1RUE 3;  1QOS A;  1U5Z A;  5IVJ A;  1RUJ 1;  3ACI A;  1HXS 1;  1KD7 A;  3S30 A;  3J8F 1;  1J84 A;  1T2X A;  4Y4R A;  2IXL A;  2Y6K A;  5BY5 A;  1BVV A;  3N9L A;  4MHR A;  1S0I A;  2FCV A;  5L9V A;  3INA A;  3V0B B;  3BOD A;  1O3S A;  3VBF B;  5L7O B;  1Y4W A;  3Q8A A;  3ZKY A;  1RUE 1;  4EQV A;  4JVA A;  3I2H A;  3AVS A;  1G9D A;  3TEZ A;  1X8E A;  3AYC A;  2JIC A;  2Z79 A;  1ZZB A;  4HPK A;  2PN5 A;  2PHD A;  2ZPX A;  2Q1F A;  2V4A A;  3BB6 A;  2CDO A;  2B4K A;  2ZAB A;  3PMS A;  5CVR A;  3HD8 B;  3VBR C;  5C8C A;  1Y9G A;  3ZYF A;  1H4G A;  2MNG A;  3RZJ A;  5FXV A;  3TRS B;  4NRO A;  1H1I A;  1Y43 B;  3Q8E A;  5I0R A;  3HWJ A;  3WF0 A;  1S0J A;  3S5A A;  2YGL A;  4D6R A;  1BLZ A;  1OF4 A;  1S0D A;  2DCY A;  1AR7 2;  1LEN A;  4L9B A;  4WM8 A;  1JYV A;  4K6B A;  3HBZ A;  4ZS3 A;  3N36 A;  3VLB B;  4Q0U A;  1TNF A;  1EV1 2;  3SCG A;  1UYX A;  3VBF C;  4QX1 A;  4GJZ A;  2IFR A;  5LRR A;  5L7O C;  3MYX A;  4CXY A;  4XEZ A;  2VUL A;  5FUI A;  1UPS A;  4A6O A;  5IT6 A;  2QBX A;  4AI1 A;  4AZZ A;  1RUH 3;  3I49 A;  5FPA A;  1HKD A;  5GJ6 A;  4AFA A;  3QCW A;  2PHR A;  4K8F A;  5L9R A;  2XKO A;  1W9F A;  3WW1 A;  5F2S A;  3VDA A;  3UES A;  4HZF A;  3V0A B;  5C70 A;  3MFC A;  2GNM A;  2PLV 3;  2WQZ C;  2NMN A;  4LOR A;  4MET A;  3CMG A;  3G7D A;  3WQB A;  1GU3 A;  1S1A A;  3AFK A;  5E8A A;  3ZPO A;  1GZW B;  2EXJ A;  1VBB 2;  1GFF 2;  1F31 A;  5FLI A;  4YFZ A;  1DQ5 A;  3RYK A;  1JZ6 A;  3ZMO A;  1CGP A;  3C7E A;  2FZ1 A;  4AHZ A;  1LOD A;  2XJS A;  3LFM A;  2KM2 A;  5GZD A;  2ZX0 A;  4GB3 2;  4IE5 A;  1WW6 A;  2CWM A;  5FY4 A;  2PLV 1;  3AMN A;  1MS8 A;  2VOK A;  2WQ8 A;  4KBZ A;  1B35 A;  2BGC A;  4QB6 A;  4IGO A;  4DS0 A;  3ZFE A;  1NLR A;  4CEW B;  1WA6 X;  4M3C A;  3OGS A;  3BTA A;  3KT7 A;  2V4V A;  1V6K A;  4HVR A;  2J1R A;  3NNM A;  2GAL A;  1G8W A;  4BQ2 A;  5C33 A;  5F6K A;  1QQP 1;  5KBF A;  3O0X A;  3S7I A;  3GZA A;  1MPX A;  1N1V A;  4AYU A;  2BOJ A;  3EO6 A;  2PA7 A;  3PIJ A;  4I0A A;  2YC4 A;  3KGL A;  5DG2 A;  1GZC A;  3HEI A;  2JEM A;  3KZ4 C;  1HQL A;  4KU7 A;  2I2S A;  5GAL A;  3Q8C A;  3O1S A;  2XVK A;  3ZXD A;  1LU2 A;  5FDB A;  2E31 A;  1WKY A;  5FY7 A;  2QNK A;  3NNF A;  3MV0 1;  2ARA A;  5KXD A;  1QJU 2;  3A23 A;  1HJF A;  4QHO A;  2ARB A;  4LHN A;  5EQU A;  2BVV A;  4GH4 C;  4Q0S A;  2BJS A;  1FX5 A;  1IPS A;  5DAP A;  2EXI A;  1EY2 A;  3K48 A;  4W6X A;  3R6S A;  2GZW A;  2E63 A;  3WQ0 A;  2WA4 A;  4XJA A;  4OMC A;  3V56 A;  5IAT A;  3UYJ A;  4RS5 C;  4GKX A;  2P6H A;  4BIS A;  1QOT A;  4XAA A;  2YBS A;  1LJ7 A;  1GUI A;  4JCK A;  4K9S A;  3WG2 A;  1ULC A;  1X82 A;  5JXH A;  4DUV A;  5CKN A;  1PGW 1;  1IG3 A;  3PVN A;  2RS5 1;  2RVA A;  3I54 A;  2WBK A;  3M70 A;  4LPL A;  2RDR A;  1HXS 2;  4RGG A;  1ZA4 A;  2V73 A;  1RMU 2;  2R7E B;  4MLO A;  4G3Y C;  4RFT 0;  4BQ3 A;  1RTV A;  4PBO A;  3HQR A;  2LTN A;  4GWJ A;  4HK8 A;  1EPW A;  5DAQ A;  3UGF A;  3GHM A;  2X05 A;  1ASJ 3;  1GIC A;  2ZGS A;  3DUI A;  4N9H A;  5CNA A;  5FYB A;  4GIQ A;  4F8A A;  2PXJ A;  2OUJ A;  1RUE 2;  3ZXJ A;  4E2Q A;  1AYN 3;  2W52 A;  1VAK A;  2P3K A;  1M4W A;  1PMH X;  1ND3 A;  3MI8 A;  1F15 A;  3SCF A;  4CCN A;  2EAL A;  2P17 A;  3TN9 1;  1QEX A;  1CPN A;  1PNF A;  3K77 A;  4OUL A;  1Q8O A;  3WF3 A;  5GZC A;  3DXT A;  1U5Y A;  1AJK A;  2VCC A;  3HMY A;  5FP9 A;  1CWP A;  3LA3 A;  2HYX A;  3NAP B;  2WO2 A;  5BNP B;  4JTN A;  5C7G A;  1YNA A;  1J58 A;  1CAV A;  2GND A;  3ETP A;  3N9M A;  5K9Y A;  1LGB A;  4UFM A;  5JR7 B;  2W87 A;  3AYA A;  2VOV A;  4HBN A;  2GN7 A;  4BZ4 A;  3AP6 A;  4Y22 B;  5C3O A;  3X29 B;  2P5B A;  2C6S A;  4R4X A;  5GZF A;  1W6N A;  1NLQ A;  1VRB A;  1K5M B;  3LEM A;  4HOO A;  5JIA A;  1JZ8 A;  4DXT A;  4IE6 A;  4PLN A;  1WLC A;  2JE9 A;  2ZGK A;  3TB0 A;  3H0O A;  4XBL A;  3SH5 A;  4AF9 A;  1CAX A;  4MUV A;  5FZ9 A;  3NO8 A;  2QZ3 A;  1K5J A;  1UU6 A;  3KCC A;  2LRO A;  5FZC A;  3CKH A;  3BUC A;  1F5F A;  1SBF A;  2JDK A;  4LBK A;  1XYO A;  3WF4 A;  4Z92 B;  3N7M A;  1WCU A;  1NYW A;  4M3C B;  2XJV A;  3SIT A;  2K46 A;  2VZP A;  3NAP C;  3WLU A;  4CCM A;  4BXF A;  3UET A;  5FZG A;  4CTE A;  5IVC A;  1NXD 1;  3ZX7 A;  1NQJ A;  3VBO C;  1SLI A;  2RM2 3;  1RUH 2;  2CTV A;  2TEP A;  1W6Q B;  3PLQ A;  2D6K A;  1RC6 A;  4R9A A;  1URX A;  4DMI A;  4MGY E;  3UJO A;  3IAQ A;  1K5M C;  4P9I A;  2D6O X;  2QQL A;  3NNJ A;  4BYY A;  3TNP B;  5JLV A;  4IEW A;  2D6M A;  4QPG C;  3I97 A;  1W8H A;  2PLV 2;  2WWS A;  1DGW X;  3OY8 B;  4FPC A;  5A7W A;  1RIT A;  2CGN A;  4OI2 A;  5E6H A;  2ZX1 A;  4UBG A;  4IEY A;  3NWK A;  4AFB A;  1I1E A;  3QH7 A;  3HNM A;  2PHL A;  3S6P A;  3AXE A;  4HON A;  2D6L X;  3LA2 A;  2JDA A;  1DLL A;  2Y6G A;  5ANQ A;  2E7Q A;  1CES A;  2VAU A;  1IS5 A;  2WS9 1;  1IOA A;  4QB2 A;  4CEY A;  1C57 A;  2EA7 A;  3TEW A;  1Q8V A;  2RJL A;  3NRU A;  2VQT A;  3MW3 A;  4U2A A;  1PGL 2;  2ADE A;  2CHH A;  1LOB A;  1QXP A;  3N35 A;  2OQ6 A;  3POF A;  3DPR C;  3ZYH A;  3T0A A;  2JDY A;  2QUO A;  1CAW A;  4HFS A;  5JSR A;  1C3H A;  3ZIW A;  1V6M A;  2GP3 A;  2VTF A;  4XHX A;  4Q4W 3;  2JXA A;  4XXA A;  1WMX A;  1PZ8 A;  1RUG 1;  3B00 A;  5GLW A;  3TEX A;  3WG3 A;  1XND A;  4QM9 A;  4XUP A;  1WW7 A;  1GAN A;  1COV 1;  4ZON A;  5G05 L;  2HWF 3;  3H8X A;  2A7A A;  2BNN A;  4BM8 A;  4C0B A;  1KJL A;  5JXJ A;  1SLL A;  2BNO A;  2FBE A;  2CSG A;  2LRP A;  2OT7 A;  3LA7 A;  4RHV 3;  5DZF A;  2GMM A;  2WR9 A;  1F4H A;  2JB4 A;  3VD4 A;  1UCX A;  1AR9 1;  2EF6 A;  3H50 A;  4OUE A;  3PDQ A;  5FKC A;  2BGO A;  4YGB A;  5FZ3 A;  4HSL A;  1OQE A;  4Q8K A;  4N7I A;  2WWJ A;  4XZU G;  1PGW 2;  1VBE 3;  3THP A;  3P1I A;  4Q1P A;  1C5I A;  4DUW A;  2AR6 A;  3LDR A;  5J7M A;  2VBD A;  3MUZ 1;  4QX7 A;  4XE9 A;  3MO4 A;  2OPW A;  4YZ1 A;  5JR2 A;  4OUM A;  4P9J A;  1VLN A;  4UT5 A;  4COU A;  1BEV 3;  4ARX A;  4IEP A;  3I3B A;  1PIV 3;  1XE7 A;  5ABJ C;  1W03 A;  2HH9 A;  3JCI A;  2WII B;  1VBE 1;  4QPY A;  4HN0 A;  2NM1 A;  3ZYG A;  1W0P A;  1KFU L;  4IEX A;  4LKF A;  4F83 A;  2VUC A;  5FYY A;  3P6B A;  4P5H A;  3GZU C;  4ZZ5 A;  1HV0 A;  2BBV A;  3DKW A;  1AR8 1;  4HXC A;  1ASJ 2;  1WA4 A;  1UOJ A;  1NCR C;  3D0J A;  1N3P A;  4MXW B;  2KD7 A;  3C8X A;  1WGP A;  2NZ9 A;  2WZR 1;  4IEZ A;  4Q8L A;  3TOJ A;  4A45 A;  1WWY A;  1KXG A;  2OW4 A;  2FQP A;  1AYN 2;  1POV 0;  1GKB A;  5I0T A;  1HN1 A;  5D2A A;  2X10 A;  1UU5 A;  2DWR A;  1IKQ A;  2FMD A;  2OS2 A;  3JB4 C;  1DDL A;  3PTY A;  2VGD A;  2WAB A;  1Q8Q A;  1J3P A;  1UZW A;  3ROU A;  5CA6 A;  4HMZ A;  2QQP A;  3OPW A;  2WN3 A;  1PMJ X;  1KQR A;  4QT6 A;  4LBN A;  1DBN A;  2XH6 A;  2ZAC A;  1J83 A;  4HKO A;  5LEJ A;  4QQH A;  3L2Y A;  4O9G A;  1D0H A;  1R1A 3;  4LO6 B;  5AFB A;  1D4V B;  4CU9 A;  4AVC A;  1YYN A;  2DCZ A;  4IV1 A;  4CEY B;  4LE3 A;  5FIX A;  5FPX A;  1YJK A;  2Q1M A;  4N43 B;  1AF9 A;  2OII A;  1REE A;  3I2I A;  4L99 A;  5IK5 A;  2WO7 A;  4YGD A;  5A6Y A;  3WP6 A;  3VGI A;  4QKB A;  3AZZ A;  1YRZ A;  3ZYR A;  1LHU A;  2R07 1;  4MGS A;  4ERO A;  1CAW B;  1W8O A;  1PGS A;  1KDM A;  4MAD A;  1S0B A;  4OLL A;  4BMB A;  1G9B A;  1SBD A;  4D0Q A;  5LK5 A;  2VNG A;  4XDO A;  4A3Z A;  3AC0 A;  5GM0 A;  2WFF 3;  2VXJ A;  3H8O A;  1W0O A;  2RM2 2;  2XXZ A;  3AX4 A;  2IWG B;  5FZD A;  3O5S A;  5JOY A;  3I2J A;  4XQD A;  4NII A;  5I8Y A;  2YFZ A;  2FDG A;  4ZKT B;  3GCW A;  5SV8 A;  5A7O A;  4LKD A;  1OVS A;  4EWA A;  4HVO A;  4JHT A;  5A3L A;  3GNE A;  4R9C A;  5FYU A;  1GSL A;  2WQ4 A;  5GLU A;  1JUH A;  3WD5 A;  4N43 C;  4FVV A;  3VBS C;  1CON A;  3OEA A;  1G9F A;  2VNV A;  3CIH A;  1NA1 C;  3PVE A;  5FJK A;  3SLI A;  3WNO A;  1Y9M A;  3KF3 A;  5BUV A;  1H8T C;  1OLM E;  3KB5 A;  4IEQ A;  2GH8 A;  5CU1 A;  3BTZ A;  5A1L A;  4QXH A;  5FWJ A;  3HQU A;  1Q43 A;  3L2H A;  1POV 1;  5FYC A;  4MX3 A;  1RUG 2;  3RG0 A;  4FOY A;  3O1R A;  5FMO L;  2JG9 C;  4XFB A;  5BNN B;  4CDW C;  5IJR A;  1RUO A;  1WLT A;  5LBF A;  1WBF A;  3VL8 A;  3H7Y A;  5FZ8 A;  1AYM 1;  4GAZ A;  4LUK A;  4NHL A;  4CYD A;  1V6N A;  1WME A;  4Q4W 2;  1N47 A;  1GWM A;  3ATG A;  4WVM A;  4FAG A;  3K51 A;  3BN6 A;  1AR9 2;  1MVE A;  3HJR A;  2ZGP A;  2FCU A;  3JU9 A;  4KWL A;  4DXR A;  4IV3 B;  1BK1 A;  4UFK A;  2UY8 A;  1JZ7 A;  3B02 A;  1A6C A;  2VZS A;  2DU0 A;  4X8P A;  4XFI A;  4XQ4 A;  5A6Z A;  1BMV 1;  2HWF 2;  4JZR A;  2VMD A;  5A7P A;  3NVC A;  2EIE A;  4EN9 B;  3ZKU A;  2WNV C;  5LRS A;  1UOF A;  2AEY A;  4RHV 2;  4KH9 A;  1NXM A;  4KMQ A;  3VZK A;  5FMB A;  1C1L A;  1OI6 A;  5FOJ B;  1Q3E A;  3SH3 A;  4UW3 A;  1LR5 A;  1O5U A;  1XE8 A;  4BHP A;  4JDM A;  3WCR A;  3ZSE A;  1VBE 2;  5FFO C;  4Q27 A;  2HBT A;  4XQW A;  4XUO A;  4Z8B A;  3R05 A;  5FR3 A;  1I9R A;  1RJ8 A;  2EIB A;  1CQ9 A;  3AP7 A;  2VZO A;  1VBA 1;  1D4M 3;  5FYT A;  4XFH A;  3H42 B;  2Y26 A;  4P9W A;  1BEV 2;  3JD7 3;  4IL7 A;  4SLI A;  1PIV 2;  3LGR A;  4QDQ A;  3J4U H;  3D8C A;  4XCB A;  3ZN6 A;  4WZC A;  3FLP A;  3ZXK A;  4ES9 A;  2E53 A;  4O7X A;  1RHI 3;  4IER A;  3NKG A;  4GWI A;  4MVT A;  4RD7 A;  4BQX A;  2VMH A;  5FK7 A;  5EYY A;  5IK4 A;  4NIG A;  1AL2 3;  2Y0I A;  1LOF C;  4XMA A;  4LLF A;  3TNQ A;  4AVV A;  5T5J A;  4Y1U A;  2VNO A;  3JD7 1;  1OFN A;  2GMP A;  2GSY A;  4KNC A;  3FJS A;  1TME 3;  1XSQ A;  1CAU B;  1QJX 3;  2D3P A;  2Q1Z B;  4IE7 A;  4NUB A;  4CDX B;  2GH2 A;  1OA4 A;  1HRI 1;  4GJY A;  4DB5 A;  1KS4 A;  2ADD A;  4AVT A;  1RHI 1;  1LOC A;  2TBV A;  2DCK A;  4FFG A;  4U36 A;  1OUX A;  5EP9 A;  5HI0 A;  2B8M A;  2XJU A;  4Y1Z A;  1UF2 C;  4BJ0 A;  5JUV A;  2Y6J A;  1RYY A;  4YM0 A;  3ZFG C;  4BA6 A;  3VDB A;  1W6P A;  1CIY A;  1AX0 A;  4Q0V A;  5IWF A;  4LBJ A;  4S2H A;  5CFC C;  3MIH A;  1IS3 A;  1TME 1;  1QJX 1;  1MQT B;  4CP9 B;  4Y20 A;  3I59 A;  5L9B A;  1OXC A;  3DEM A;  1JHJ A;  2W5F A;  4I0B A;  2ZGL A;  1IZ3 A;  2W46 A;  3WVJ A;  1SPP B;  3MIC A;  5C9A A;  4MGT A;  1BCX A;  3VZJ A;  4ET7 A;  3MLK A;  1W2O A;  2VOT A;  1DYP A;  1R1A 2;  2QE3 A;  3JUU A;  1JMU B;  1OF3 A;  1PO1 3;  2RMU 1;  3PU3 A;  4JHZ A;  4CDX C;  1F4A A;  2JEN A;  3I2F A;  4OHZ A;  3WDU A;  4BLJ A;  4NID A;  2P3Y A;  1HDK A;  2GU9 A;  2Y60 A;  3SEP A;  4GXL A;  2HEV F;  2OQ7 A;  4HK9 A;  4RA0 A;  4XF4 A;  4CRQ A;  4FP3 A;  3WNX A;  4NJ4 A;  5D21 A;  4Q4Y 3;  5KHH A;  1FNZ A;  4FTS A;  2D5F A;  3JQW A;  1Q5O A;  4EV0 A;  2ZTN A;  2JDZ A;  2HWB 1;  1UW8 A;  2CU5 A;  4CVU A;  4WM7 C;  3POB A;  1HIX A;  2HWE 3;  2WFF 2;  3E6D A;  3MF9 A;  4JKL A;  4PHZ A;  4QDS A;  3FHI B;  4O61 A;  1GR3 A;  3POE A;  4AOC A;  3UK9 A;  4A2U A;  3ACH A;  1GOG A;  5A6Q A;  4Q4Y 1;  1OHF A;  1JU3 A;  1K12 A;  1U5I A;  1DQ0 A;  4XAC A;  1W28 A;  1O4Y A;  2WRA A;  5IFT A;  1YFY A;  1JYW A;  5HV4 A;  5FXX A;  1ZZ9 A;  1G9C A;  1BHG A;  4LA3 A;  2VCM A;  2D93 A;  2LAL A;  2Y8K A;  3ZSM A;  4E4D X;  2YBK A;  2W08 A;  2D97 A;  4LMF A;  1SDD B;  2WA3 A;  3ZFF C;  5DXD A;  2YV8 A;  1PK6 B;  4GMP 3;  1O7F A;  1SAC A;  1WCQ A;  2BW8 A;  4C91 A;  1MZ6 A;  4ZS2 A;  2GC0 A;  2ZAH A;  5FLH A;  1D2S A;  4TWT A;  3VBR A;  4ES8 A;  3W58 A;  1NX9 A;  1VMF A;  1UY1 A;  3N4M A;  4G9S B;  2JIJ A;  4MYE A;  3ZN6 B;  1PVC 1;  3CJI B;  1DQ1 A;  3FLR A;  3FUQ A;  4E2S A;  1DQ4 A;  4EN8 B;  1AR7 1;  5F3E A;  5HBA A;  1UYP A;  2RS1 3;  3VBF A;  4DQA A;  3E5U A;  4QPI B;  3T1M A;  5L7O A;  1EV1 1;  1DP0 A;  3VZM A;  1K3I A;  5F5I A;  4AED C;  2EAK A;  3GGL A;  4L2N A;  3GBG A;  3KV6 A;  1M06 G;  4LXL A;  2DVD A;  1PK6 C;  3GHN A;  3MZH A;  4QQL A;  1GOF A;  3HOB A;  2OKX A;  1C8N A;  4AAP A;  4IUG A;  2ETE A;  1MS5 A;  4CCC A;  1LGC A;  5F5Q A;  4D7S A;  2QZ2 A;  1JOJ A;  5FYS A;  4KU8 A;  1JUI A;  3EJK A;  1OSG A;  4H7M A;  3VHP A;  4Y20 B;  2HEW F;  3I59 B;  1EUU A;  3VBH C;  4X6R B;  1O59 A;  3RNS A;  1D4M 2;  1OPM A;  3BGA A;  4R8H A;  3P3N A;  4I09 A;  4EN7 B;  3JD7 2;  4QPI C;  1VB2 A;  2VC9 A;  3CU7 A;  1JZ2 A;  3LZZ A;  1TMF 3;  2YY1 A;  4CP2 A;  1CVN A;  4L8Q A;  3OPZ A;  2XQR A;  3GBF A;  5CG9 A;  4Y3O A;  1RHI 2;  2XJQ A;  3LDK A;  5T54 A;  2H0V A;  2I07 B;  2QQJ A;  1AL2 2;  1XC6 A;  3LDB A;  3O0W A;  1HX6 A;  3POI A;  4YLZ A;  4BLI A;  5F7U A;  4JDN A;  3ZYJ B;  4CU8 A;  3DGT A;  4QAW A;  2B7Y A;  1NKG A;  2RJK A;  1TME 2;  1QJX 2;  4NIH A;  1XXN A;  4EJR A;  1T6G C;  2QDN A;  4LHL A;  5E1R A;  2FDI A;  3NMB A;  2XBO 3;  1GZW A;  2Y34 A;  1S0F A;  2VZV A;  5KXC A;  2Q8C A;  3I4I A;  4YFW A;  2W1Q A;  4QKD A;  2WLQ A;  3C3V A;  4XUR A;  4ZHN A;  3RDI A;  2AEN A;  1GBG A;  5B4N A;  1W04 A;  4WVZ A;  5A7S A;  3WF2 A;  1LES A;  1ZZ7 A;  1YUD A;  2ZGT A;  3DF0 A;  3K4D A;  3MUY 1;  1HB2 A;  4RQP B;  4OHV A;  4DIN B;  2YG0 A;  4RGA A;  3FWE A;  4LKS A;  2BU9 A;  2Z69 A;  2Y33 A;  4HKL A;  5DUW A;  4AG4 A;  5K8S A;  3OGR A;  3NKT A;  4QQ2 A;  4CEW A;  1QJU 1;  3E1F 1;  4GH4 A;  4B3N A;  4LTA A;  1JW6 A;  1Y9Q A;  5IVY A;  3A0N A;  5IVE A;  1PO1 2;  4LOS A;  2YBP A;  4XPV A;  3ZN5 A;  2Q0A A;  4NHY A;  5FRE A;  4ZU5 A;  4CZS A;  2E33 A;  3IMM A;  4FQ4 A;  4WZF A;  2PQS A;  4YM2 A;  5DPN A;  1F5J A;  5DQ0 A;  2WYS A;  3T3Y A;  3RI8 A;  4N53 C;  2X09 A;  4E8C A;  4LBQ B;  4Q4Y 2;  2RHP A;  2UYA A;  5FP3 A;  4QB1 A;  1RMU 1;  1I5P A;  2D6N A;  2DUR A;  3D0S A;  4Y1Y A;  4RQP C;  4Z82 A;  3FE5 A;  5J98 B;  1S0E A;  4CUB A;  1V6L A;  3AKS A;  3LB9 A;  3NJY A;  2R16 A;  1IPJ A;  2WYF A;  2FCT A;  1GMM A;  2HWE 2;  2VH9 A;  3PNA A;  2FDF A;  4I2O A;  2ZBJ A;  2B5H A;  5FWE A;  4DFS A;  2IFW A;  2ILM A;  3I2G A;  2V5Y A;  3LCP A;  4NN0 A;  5CB7 A;  3QD6 A;  3BKZ A;  3WDT A;  3SC7 X;  4UF0 A;  1J1L A;  2W39 A;  2IVJ A;  3AXD A;  5CFD C;  3EXU A;  1C28 A;  1PVC 2;  4NOT A;  3EMR A;  4YW7 A;  2VR4 A;  1FV3 A;  2VMI A;  3PJY A;  3AMM A;  5FK8 A;  4HG6 B;  5EJZ B;  2YFU A;  4OHY A;  1H1M A;  1O3T A;  2PAM A;  5FZE A;  2YMZ A;  1A8D A;  1FYU A;  4H55 A;  4ATF A;  3KQR A;  1FAY A;  1FT9 A;  3QAC A;  3VDD C;  1LRH A;  4ORF A;  5LY2 A;  3L9J T;  2DV9 A;  3RZZ A;  4DRR A;  3KM5 A;  1H2K A;  3ALQ A;  2RS1 2;  3KV5 A;  2D5H A;  3NAP A;  4FPY A;  3T4V A;  5BNP A;  5IVF A;  3AZX A;  4MG2 A;  1WUV A;  4LO4 B;  4AI3 A;  1H2L A;  4BIO A;  4BQ1 A;  4Y22 A;  1QH7 A;  2W68 A;  1SFP A;  4BK4 A;  1XYN A;  1K5M A;  4Z07 A;  1RUH 1;  3MHZ A;  2JJ6 A;  4R9D A;  3ES4 A;  3SXW A;  1UZV A;  2ID4 A;  3WNK A;  2ZKN A;  3MF6 A;  1W2U A;  1VBD 3;  3QLQ A;  5LAT A;  4BIF A;  3VZL A;  3SQO A;  4WBB A;  2AC1 A;  1WMD A;  5HCA A;  1I5Z A;  1LGN A;  3I8T A;  3WDW A;  3OTF A;  5AC9 3;  2OA2 A;  2C24 A;  3H7J A;  2WZE A;  3ZR5 A;  1AJO A;  1GWK A;  3RSJ A;  1C8M 3;  1UKR A;  4A3X A;  3GF6 A;  5JOW A;  3RZH A;  1ULG A;  4GH4 B;  2F4L A;  2SLI A;  2VTX J;  1LHW A;  1LEM A;  1UMZ A;  5BPX A;  1C1F A;  1JZ4 A;  1TMF 2;  2WT2 A;  4EWE A;  2VQU A;  3IAP A;  4RR3 C;  1X8M A;  4RS5 B;  4AEK A;  1W8N A;  3MIB A;  4YVS B;  1YFW A;  1W6Q A;  3UT0 A;  4IEV A;  4XFA A;  4YW1 A;  1PGL 1;  2RR1 3;  1ULO A;  3RMX A;  2DBN A;  5TSW A;  2J1A A;  2PTM A;  1N1S A;  1GP5 A;  3H3Z A;  3HNY M;  5FYI A;  1Z78 A;  3OY8 A;  1L7R A;  1H1A A;  2DYC A;  2JE7 A;  3RYP A;  1ULF A;  3LEI A;  2XBO 2;  2XLA A;  3VD5 A;  1SLC A;  1FAT A;  3VBU C;  4AVS A;  4JQR A;  2F4P A;  4PBP A;  4QX3 A;  5FZL A;  3VHN A;  4ASL A;  4JC1 A;  5F32 A;  1O8P A;  2LUW A;  3RFR A;  2L9L A;  1VPH A;  4QWN A;  1WLW A;  4UWD A;  1MS9 A;  2ZGO A;  2ZGQ A;  3IDC B;  3HAG A;  4UFJ A;  1RUI 3;  1CIW A;  3PJQ A;  1XQN A;  2X5I C;  2W47 A;  2ZX2 A;  5DN2 A;  1MS4 A;  5FZ0 A;  5JI7 A;  2VVE A;  5FV3 A;  4CCJ A;  1MZ5 A;  2BRT A;  4LA2 A;  3POY A;  1H4H A;  4YVS C;  3FMG A;  5DDJ 3;  4UF0 B;  4XJU A;  1UO9 A;  4YW5 A;  1YHF A;  4PQ9 A;  2J1S A;  1ZZ6 A;  3POS A;  3IT8 A;  3JQX A;  1QDO A;  1QXJ A;  1W8T A;  5ABJ A;  4MXV A;  3I3M A;  2DTY A;  4OHW A;  3UKV A;  1V6J A;  2VJX A;  5JPM B;  3LF7 A;  2RJ2 A;  3O14 A;  4BXS V;  3A21 A;  4GQ7 A;  3ZYP A;  1UAI A;  1UZ0 A;  1WCK A;  5JIU A;  3CQO A;  4LOT A;  4PT6 A;  2ZGU A;  4CUG A;  2HJI A;  2O8Q A;  1OKO A;  5FZO A;  2EIC A;  2VG9 A;  5KR7 A;  3O12 A;  3WNN A;  3ZM8 A;  1NCR A;  3A7Q A;  4FFI A;  4FOV A;  5GZG A;  3M3C A;  1ASJ 1;  2C0Z A;  3NJV A;  4MO3 M;  5I0S A;  4YW4 A;  2EAA A;  2BFU S;  2BYV E;  4M4R A;  3VKF C;  4AXO A;  1QY4 A;  1R1Z A;  4GZ9 A;  2ARE A;  1JOB A;  2XGX A;  1AYN 1;  3RZL A;  5J09 A;  2WKK A;  4XJ8 A;  3RWK X;  3VBO B;  4CDQ B;  1YI9 A;  4TZD A;  2CY6 A;  2FDH A;  5C4W B;  2OVU A;  1LAJ A;  3S57 A;  1JU4 A;  1DF0 A;  4LUM A;  1ZRI A;  4XAB A;  4BQY A;  1GWL A;  2VZT A;  3RZK A;  4W6W A;  4ITC A;  4QPG B;  5A3N A;  2E7T A;  2P3J A;  5LZ6 A;  4C8D A;  5DAB A;  1CX1 A;  1KS5 A;  3ELN A;  2UYB A;  4ZY9 A;  4BK5 A;  1SFN A;  4O9E A;  2FZ2 A;  2ZA9 A;  1UOB A;  3K3O A;  1JYX A;  5FRA A;  4AHX A;  3ZLI A;  1S4C A;  3FFZ A;  3AYD A;  5C8C C;  4MXW A;  4CPB D;  2X53 S;  1E5R A;  5T5P A;  3AP4 A;  4UOJ A;  2VVD A;  4MV2 A;  3IIA A;  2NN8 A;  1EAH 3;  3GCX A;  1WD3 A;  1W6M A;  1PZ9 A;  4IGP A;  4Y1V A;  4FXG B;  1CZS A;  5KHG A;  3WNP A;  4CDQ C;  5FZB A;  4FPK A;  2TUN A;  3DPR B;  2XG3 A;  4I01 A;  5C4W C;  1XB9 A;  3I3E A;  5C71 A;  3T2O A;  5CG8 A;  4GD4 A;  2AUY A;  2XL7 A;  4LBQ D;  3T2T A;  5JXG A;  2ZEZ A;  4AGR A;  5J36 A;  2OPK A;  4XUT A;  1T6B X;  2IXH A;  1EAH 1;  2YYO A;  3RYR A;  5C3R A;  4PLO A;  3ZSJ A;  5D8A C;  2K2S A;  5ACA 3;  2DUQ A;  4YAR A;  2RM2 1;  2VQ0 A;  5AVP A;  5JDB A;  1VJ2 A;  4CSW A;  3AZV A;  4AFD A;  2XJP A;  2C9A A;  4DZG A;  4QKF A;  3I3Q A;  4IW3 A;  1VBD 2;  5ERL A;  5KHJ A;  4Y1X A;  3WUC A;  1NLS A;  2JE8 A;  4N43 A;  3OCP A;  5IK8 A;  1R09 3;  4OHX A;  3EB7 A;  4EYU A;  3NW4 A;  5E88 A;  3WZ1 A;  5AC9 2;  1SEF A;  3RWN A;  5ACA 1;  1QH6 A;  1XNB A;  1GQH A;  1XSR A;  4V2W A;  5A3O A;  4MGI E;  3R4D B;  1P8J A;  1SHW B;  3QBQ A;  2QQN A;  4A6S A;  2VMC A;  4QM8 A;  1B35 C;  1UXZ A;  2A6X A;  1VAV A;  2VOW A;  3BOP A;  3POJ A;  4FPF A;  3V64 A;  5ABJ B;  3RS6 A;  4AL9 A;  2ZEY A;  1VIW B;  2RR1 2;  1J3R A;  2PAE A;  3M7A A;  4QXB A;  2E7A A;  5F3I A;  3AL5 A;  3WDV A;  3WP5 A;  1N3Q A;  2XVG A;  4CUC A;  4YM3 A;  2Z4F A;  4Z1V A;  3POW A;  4AE2 A;  5FZF A;  2CWS A;  3QH6 A;  4Q4W 1;  1KRI A;  4EWD A;  1UY4 A;  2W94 A;  2WNO A;  4XIK A;  5KWR A;  5FZO B;  4QPW A;  1OFS A;  3S0M A;  4AVB A;  5IK7 A;  4C90 A;  4QKN A;  1NCR B;  5CZK A;  5I0D A;  5EV7 A;  3ZOI A;  1BBT 3;  2R04 3;  3OUH A;  2XPJ A;  2EIG A;  3D5O A;  2WNV A;  1OQD A;  1QXR A;  2OUH A;  2SBA A;  2HWF 1;  4E4S A;  5JSO A;  1OUS A;  4BQW A;  1RUI 2;  2AEZ A;  3K46 A;  4RHV 1;  4COZ A;  2QQV A;  1UD1 A;  5FMC A;  2XDV A;  3DYP A;  5BNN A;  5ISL A;  2FD8 A;  1NQD A;  3AJY A;  1GNY A;  5DDJ 2;  5A1F A;  2C5D A;  2ZZQ A;  3PVB B;  5H9R A;  3BAL A;  5HV0 A;  1W99 A;  1ZRD A;  2BWA A;  5F8P A;  2G1M A;  5FZM A;  5J48 A;  1LU1 A;  2AH2 A;  1GP6 A;  4XXP A;  4CCL A;  4JRL A;  5IW0 A;  2XKP A;  1BEV 1;  4IV3 A;  4CA9 A;  4OYU A;  1PIV 1;  5FZI A;  2G9F A;  1O8S A;  1YCI A;  2ZHN A;  3AFG A;  4XFF A;  4K1Y A;  3H1Y A;  2XJR A;  1WLD A;  2PQQ A;  4K7J A;  3KCY A;  2JG8 B;  1UPI A;  3IPV B;  4FP2 A;  5IAX A;  1KEX A;  1LOF A;  4DOU A;  4HSJ A;  2DCT A;  4XOG A;  3W5M A;  4P00 B;  1W6M B;  2B39 A;  4J6G A;  3DV8 A;  2CYF A;  1TZO A;  3BU7 A;  1IPK A;  4DEV A;  1O3R A;  3VUO A;  4FI9 A;  3R4U A;  3MDP A;  4A42 A;  2QKD A;  3JZV A;  1SFY A;  1XNT A;  3IDA A;  4IGQ A;  5F5C A;  3T4H B;  5FY1 A;  1FOD 3;  2C26 A;  4R9B A;  2B46 X;  1GZ9 A;  4EZH A;  3VV1 A;  1ND3 C;  4JRA A;  4NR1 A;  1LKN A;  5C8W A;  2DTW A;  3AMH A;  1FPN 3;  2VW0 A;  3USS A;  4L11 A;  4Z2W A;  1GYK A;  4XUQ A;  5CFC A;  1LUL A;  1ODN A;  4QX5 A;  4XUN A;  4YYO A;  5SV5 A;  3CEW A;  3I7D A;  3PUI A;  1QNW A;  3N7K A;  3VDC A;  2ZZJ A;  4URT A;  3FHQ A;  2ZMK A;  4IQP A;  3ACL A;  5IAV A;  3AKR A;  2C1F A;  3HPN A;  5JXI A;  3OGJ A;  2JG8 C;  4JDO A;  3KGZ A;  4LK7 A;  3E5Q A;  3VBS B;  3AKP A;  1NA1 B;  1HRV 3;  4CDX A;  1CAU A;  1AXK A;  1FI2 A;  1H8T B;  1Q56 A;  1R1A 1;  1ST8 A;  2GP5 A;  4Y5S A;  4K20 A;  1EAH 2;  4FT8 A;  2JDH A;  2JG9 B;  4HL0 A;  5DAV A;  4OVE A;  4CDW B;  3ZXE A;  1QMJ A;  2PYT A;  1PVX A;  3IZO A;  1POQ A;  1QWR A;  3VL9 A;  1XBF A;  2VZ1 A;  3RZG A;  1MQT A;  1WZX A;  4CP9 A;  2WSU A;  3MLL A;  1V70 A;  3VB9 A;  3OBA A;  4PQQ A;  2IC1 A;  2WO1 A;  1OOP B;  2GC2 A;  1TG7 A;  5IVV A;  4NRP A;  4XJW A;  1H9P A;  1YO8 A;  1SPP A;  2WFF 1;  3ME2 A;  5ACA 2;  5IVB A;  4RFR B;  1ZA7 A;  1ENR A;  4W4Z A;  2IXJ A;  1C5H A;  1D0G A;  2A6Y A;  2D7F A;  2JDP A;  1TVG A;  1W8U A;  1JN2 P;  2WNV B;  4A44 A;  4LE4 A;  4PCR A;  2PEL A;  2IXC A;  1ZBA 3;  1UY2 A;  2Y6H A;  4CXW A;  1R09 2;  3KQ4 B;  2GC3 A;  2VOX A;  2WNU B;  3WT3 A;  3RJR A;  4XF1 A;  2DUP A;  2XR4 A;  1V9U 3;  1HW5 A;  1YQ2 A;  1GNH A;  2NQY A;  1V0A A;  1AX1 A;  1H9W A;  5A33 B;  2ZGM A;  4H2A A;  1SDW A;  2MEV 3;  3A22 A;  1LNS A;  2A3Y A;  4PDW C;  2QJV A;  4IEU A;  5FQ0 B;  3AZW A;  1ZBA 1;  3H8U A;  4YGC A;  2DVF A;  4M00 A;  4P5Y A;  4QX2 A;  4E9K A;  1OOP C;  3CLP A;  3I2D A;  4MH0 E;  3CF6 E;  4KWK A;  1PX3 A;  1YXW A;  1V00 A;  5D1I A;  1ZBE 3;  2BEO A;  2KXL A;  2ES3 A;  5HXM A;  2XB6 C;  4K21 A;  3MW2 A;  4XDP A;  3FC0 A;  3ZR6 A;  3Q8F A;  2PHF A;  3O1M A;  2LW8 A;  2XUE A;  3M1H A;  2CDP A;  2YZ4 A;  3OD4 A;  3GYD A;  4AED A;  5CKM A;  3ORJ A;  2EXH A;  2P3I A;  4S2D A;  5FMO S;  2WNU C;  4P14 A;  5BV6 A;  1BBT 2;  2R04 2;  2E26 A;  2A75 A;  1NOV A;  3EHK A;  1RVF 3;  3PME A;  1PK6 A;  4PIY A;  5K7P A;  4YW3 A;  3AP9 A;  3I2K A;  2ZS6 B;  2NPI A;  3WEZ A;  4XF9 A;  3ZFG B;  3LEG A;  1WCD J;  2AZ5 A;  1WCS A;  3N9Q A;  4FOW A;  1W8F A;  4XAE A;  3H3U A;  1YEW A;  4B4Q A;  5CFC B;  1MEC 3;  2UWA A;  1O3Q A;  4UW6 A;  2V5D A;  4Y26 A;  2YDE A;  3CJI A;  3EBR A;  1KFX L;  5DAX A;  2VE1 A;  3VBH A;  4NPL A;  2Y6F A;  4TLG A;  1Y7B A;  1S0C A;  4Q4X 3;  3FN9 A;  4DNY A;  5GLZ A;  1ALY A;  3FL7 A;  3OD0 A;  3WV6 A;  3VHR A;  3MV1 1;  1D4M 1;  4QPI A;  1JI6 A;  1AHS A;  4N9I A;  5EHD A;  4D7Y A;  4Y5T A;  1F35 A;  2WL1 A;  5A70 A;  3PUQ A;  3OUI A;  3N9P A;  5G04 L;  2YC0 A;  2ZJC A;  2A6V A;  1W05 A;  4AI2 A;  1LEC A;  3IWZ A;  1CJD A;  4Q4X 1;  5FXZ A;  5DZG A;  4Y4Y A;  4XJZ A;  3VKM A;  5C3P A;  4GWM A;  1F9K A;  4O65 A;  1AL2 1;  4MHU A;  1IS6 A;  2XOM A;  5F6L B;  1UY0 A;  2EVX A;  1LHN A;  3KVB A;  1ACC A;  2Y38 A;  3I3D A;  3WDY A;  2XWJ B;  1QJY 3;  3WUD A;  2R0F A;  2R49 A;  3KMH A;  5E89 A;  1X9P A;  2Q8D A;  4NHX A;  4FO9 A;  1NCQ B;  1UMH A;  2VY0 A;  4N7U A;  4WM7 B;  5K0U B;  1AR6 3;  2VMF A;  3D4K A;  1AX2 A;  1FPN 2;  2IXK A;  1MZF A;  3VN4 A;  3MGU A;  2XML A;  3VD9 A;  2XUM A;  2QQO A;  1ZRC A;  2HWC 3;  3ZSL A;  1YQC A;  5FY9 A;  4LT5 A;  1RIR A;  2KA3 A;  4H7L A;  4B1L A;  3ZDS A;  3T08 A;  1O6U A;  1CX4 A;  1AR6 1;  1JXN A;  2DFC A;  3K2O A;  1NAE A;  3SHR A;  5C3Q A;  5FKB A;  4FTE A;  5GKA C;  3VD7 A;  4AHY A;  2WAO A;  2RDS A;  2P6C A;  1N1T A;  5FZ7 A;  3ZFF B;  4R52 A;  2QQU A;  3N9O A;  1CN1 A;  4LEJ A;  3T2P A;  1PO1 1;  4QX0 A;  4DEQ A;  1GNZ A;  1DZT A;  1R64 A;  3C7G A;  4LUL A;  1JOP A;  2FMY A;  1NCQ C;  1UX7 A;  2OZ6 A;  2Y6L A;  3NL1 A;  1S55 A;  3PUR A;  4K40 A;  4SBV A;  5K0U C;  1FMD 3;  5CIR A;  1U0A A;  1X9T A;  5CEH A;  3ECQ A;  5FBJ A;  4RQP A;  4M0H A;  1RUC 3;  5A3W A;  2DVG A;  1AVB A;  1VP6 A;  4YRD A;  2UU8 A;  5EPA A;  1NT0 A;  2D43 A;  1O5L A;  5AVA A;  1DZR A;  1GZT A;  1J1T A;  1NZI A;  2BQP A;  2HWE 1;  4AED B;  1BVP 1;  4CPB A;  4OQ9 A;  2ARC A;  4E4Z A;  2J7M A;  3OBZ A;  2CNA A;  1QU0 A;  2XHK A;  5A32 B;  3HVD A;  1RUC 1;  2EID A;  4BB3 A;  5J37 A;  4PIX A;  4FPL A;  5FPB A;  3WIN E;  4COW A;  1ZBA 2;  2Y0O A;  3GAL A;  1SCR A;  1YQ6 A;  5T52 A;  3KVA A;  2PFW A;  5CFD A;  2ORZ A;  2B9U A;  4BME A;  5FP8 A;  1V9U 2;  5F2W A;  3U37 A;  4LBQ A;  5F3C A;  3WNL A;  4IET A;  3ILF A;  1XOY A;  3VBH B;  2OXB A;  4AI0 A;  1VB4 A;  4DIQ A;  2MEV 2;  1BKZ A;  4GMP 1;  5CYY A;  4YVW B;  1W06 A;  3W59 A;  1ZYB A;  3CBN A;  3KF5 A; 
#chains in the Genus database with same CATH homology
 1A34 A;  4OQ8 A;  1ZA7 A;  3J7N A;  4NIA A;  1CWP A;  3J7L A;  1JS9 A;  1YC6 1;  4OQ9 A;  3J7M A;  1STM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...