1A34A

Satellite tobacco mosaic virus/rna complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
147
structure length
147
Chain Sequence
TGDNSNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGSLFSANFRTDSFTSVTVMSVRAWTQLTPPVNEYSFVRLKPLFKTGDSTEEFEGRASNINTRASVGYRIPTNLRQNTVAADNVCEVRSNCRQVALVISCCFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SATELLITE TOBACCO MOSAIC VIRUS)
publication title Refined structure of satellite tobacco mosaic virus at 1.8 A resolution.
pubmed doi rcsb
source organism Satellite tobacco mosaic virus
molecule tags Virus/rna
total genus 24
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 1998-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.220 Mainly Beta Sandwich Jelly Rolls Satellite virus coat domain 1a34A00
3J7MA 3J7NA 4OQ8A 1YC61 4OQ9A 4NIAA 1A34A 1CWPA 1JS9A 1ZA7A 1STMA 3J7LA
chains in the Genus database with same CATH superfamily
4K1YA 1RTVA 3LDBA 2DCJA 1SBDA 5K9YA 1M4WA 3LPFA 3B7MA 4KU8A 1VR3A 3AKQA 4LBLA 2P37A 4CU9A 1UX6A 4XUQA 3MHZA 2AENA 4GB31 1OPMA 1F2NA 2MEV2 2G9FA 3M3QA 3RJ2X 3IKWA 4PDWA 2RM23 2X05A 4XUPA 2CTVA 3PDQA 1AR91 2Q1MA 1K3IA 2PHWA 1W2OA 5HI0A 3DYMA 5E1RA 5KXBA 2P3YA 4JGYB 5C3RA 2XL9A 3VBUA 4BQXA 4XXPA 4H3WA 2OXBA 1JOJA 1W8TA 2AC1A 4LE3A 4XJ8A 5FP7A 3RS6A 3ZO0B 4COVA 2QZ2A 1AUYA 1DFQA 5LWBA 1HJFA 1WCUA 2HWD2 5A7WB 4A7ZA 1CAVB 4BMEA 5L73A 5EIYB 5IFTA 4UW6A 2CGPA 3SISA 1GU3A 1IS4A 4UOJA 4IEXA 4LLOA 3UJQA 1XNKA 2VNGA 4PHZA 1LU2A 5KWRA 2MEV1 4ONUA 4XDOA 2JIGA 2BERA 4UFIA 2DVAA 5C4WC 1R1A2 1ULDA 2VU9A 5FYYA 3GXUA 1F8VA 1YQ5A 2E51A 3J7LA 1GP4A 4PLMA 4MZUA 3RYPA 1W28A 1GWKA 4CXYA 5JI7A 1V9U2 2DWRA 2GC2A 2ZGTA 2R0FA 1QKQA 2V73A 2BNMA 5KC5A 4FPFA 3K3NA 1YFUA 3KCCA 3Q8AA 1JYWA 3I2JA 4CDQC 3AMHA 3KT1A 3MIFA 5D8AC 1W3VA 4LBNA 3N36A 2ORXA 1LGBA 3V0BA 5CFDB 1NZCA 1REEA 2WZR3 1TVGA 3ZFEA 3LA7A 4C1WA 2VZQA 3J7HA 1A78A 1DGWX 2PLV2 5FXWA 5FYTA 1ENSA 4XCBA 3GALA 4LXLA 1JU3A 2OZJA 2WAOA 1ZBA3 4FO9A 4QQLA 4XJ9A 1EAH3 2J7MA 1YQ6A 4E2QA 3NNMA 1LENA 1XBFA 2YXSA 4CZSA 2JB4A 1I3HA 2B46X 3ZXEA 3ZR6A 1IOAA 1V6KA 1C28A 1DGRA 3UV9A 3I2IA 4N43B 4RA0A 4KWUA 3U14A 4DXZA 3E97A 1MZEA 2VCMA 2VUDA 3T0BA 1J84A 1JN2P 1BZWA 5A6YA 1POV0 3GBFA 3R4UA 1PVC3 1WD4A 2JDZA 1COV1 2V4AA 3AYDA 1K5MC 3SCGA 3GJAA 2V4VA 3POGA 3KF5A 2FCVA 2PLV1 2E7AA 3AKSA 3GJBA 5ACA2 2BGPA 1S0FA 3MIHA 2BFUL 4BQ2A 4YLZA 1DQ6A 4EV0A 1RIRA 4NMIA 1W6OB 3B5LB 2OPKA 1JYTA 5FP3A 1HLCA 5C70A 2YGLA 4Y4YA 1ULGA 2JE9A 3T2TA 1G9CA 3HBZA 2OX0A 2RVAA 1LR5A 2GNMA 5T50A 2HWF3 2OVUA 2XJSA 4CEWC 1BHGA 3DL3A 2OZ6A 2PHXA 4B7EA 3FFQA 4TXWA 4ATEA 4OHXA 5A70A 1PMIA 1GSLA 3K51A 1PO12 2Y6GA 3MUZ1 4QQHA 3F2ZA 5H9QA 1PNGA 2ET7A 4Y22A 2CDOA 5FV3A 2FDFA 3ZN6A 5FY8A 4EROA 5ACA1 2J42A 4XJUA 2ZGRA 3D6EA 1KEXA 2QNKA 1S0CA 3VKMA 2N7GA 2WNVA 3VBFB 2I2SA 3W5NA 5I0DA 5LRSA 1OA2A 2DVBA 4L9BA 1YEWA 4Q4Y2 5DN2A 5JZGA 1AYN3 2WZPP 3U37A 1RUH3 5J96B 3ZFGC 2VZOA 5LATA 1RUI2 1L7RA 1MS8A 1OLQA 2X8KA 1NXMA 1JXNA 1AR82 2VTFA 5L19A 2NYYA 3P3PA 5DAQA 1POQA 3AYCA 5GKAC 3JB8A 5I93A 4O9EA 3RWKX 1PO11 4QX0A 1O4ZA 1ENXA 4IV3A 3NMBA 3VDDA 1MZFA 2ZBJA 5L36A 3V56A 1ULCA 4XIKA 3BALA 3K46A 3KHCA 1W2NA 3TEYA 3B69A 5FYSA 4YARA 1XSRA 4MV2A 1N1SA 5BYNA 4Q4Y1 1IKQA 1H30A 1LHUA 5F6LB 4BPZA 2Y60A 4GZ9A 3FUOA 3I7DA 3VBSC 1HB2A 2WWSA 3TNQA 3UT0A 2BOJA 4LKDA 2W1WA 1RUF3 4PIYA 4HT1T 4Q4V3 4XF0A 1ZX5A 5CKMA 5LCWL 1VMJA 2XG3A 3VV1A 4B3NA 2R062 2XOMA 4NVPA 5GM0A 5JOYA 1B35A 2ARBA 4NIIA 5F5IA 5FZAA 1UMIA 1V6MA 3HT2A 1PHMA 1YIPA 3DPRB 4UW5A 5L7OB 3W5MA 3ZN4A 5FBZA 4XUTA 4XFFA 3FUQA 1J58A 2OQ7A 3GNEA 3N7LA 4P5YA 4DINB 2ENRA 3ZFFC 3RZJA 1ZRCA 1HJGA 2E31A 3H3UA 4QXKA 2XJTA 4DUWA 4DOUA 4TLGA 3EQEA 4CCCA 3PTRB 4NOTA 4YVSA 2WWJA 4UT5A 1JHJA 1RGSA 4FPJA 3NAPA 4QPWA 5FYVA 5C3QA 4NHLA 1S0IA 1RUOA 4MHRA 2VOXA 3ACGA 1RUC1 2ET1A 2YU1A 4PF5A 2BGCA 2P34A 3MF6A 4M3CE 3ZN5A 2WQ4A 4AXOA 5CU1A 1MEC1 2WO1A 3I97A 2R061 1BYHA 1L7LA 5JSOA 5FKBA 3BTYA 3I3QA 4LBQA 3KS7A 1O3SA 2RJKA 1NG0A 1C1FA 2BWCA 3NNLA 1UPSA 1CONA 4HK9A 1DQ5A 1XB9A 1POV3 3PJQA 4OLLA 1RUJ3 2CWSA 3LQCA 4CUCA 4Q4X2 3EXUA 3C8XA 4S2FA 4AI2A 2HKXA 3BGAA 1XOYA 4GKXA 4CCLA 2Y6KA 5FYCA 2DUPA 3LIHA 4WM8A 2VQ0A 4MGYE 3UJOA 1BBT2 1FMD3 2AZ5A 4GULA 4AEDA 3F95A 4N43C 3O1TA 4MG2A 1CIYA 3IN9A 3PL0A 1PIV2 5LZ6A 1ODMA 4ASKA 2FZ2A 1AR63 3ZYRA 1VMFA 2ZPXA 4FFHA 2PELA 5JI9A 1HV1A 1HRV2 4QPIA 4AFDA 1NLRA 4CE8A 3UNPA 1H8VA 1NCRA 2K0GA 4W4ZA 1OOPC 3RZMA 1S4CA 3WD5A 5BV6A 3I2OA 1I6XA 5C6CA 2VMDA 4RR3B 4Q4X1 4CDWA 3UKNA 3T2OA 4CPBA 4ES9A 2D5HA 3ZDVA 4FFGA 5IVBA 4GH4A 4DXRA 4OULA 1UWWA 2XKPA 4K1ZA 5C7GA 5LEKA 4BZ4A 1DGLA 3WP6A 4B4PA 1QJY2 2HEYF 4QAWA 4KQ7A 3WQ7A 5E16A 3FWEA 1PIV1 5CKNA 1DZTA 3ITQA 4A6OA 2XWBB 1JZ6A 2DURA 1RHI2 3SEPA 3R05A 1ZRFA 1JW6A 2GP5A 1DGWA 3H7JA 2BVBA 3VBHA 1FXZA 3VHPA 1TZOA 5FPBA 1N1TA 1EV12 2NP0A 4DO0A 4P00B 2IUWA 5T5LA 3N9LA 3VBFC 3OG2A 4A2UA 1W9YA 4LE4A 1W9WA 4ZZ8A 1HRI2 3NJVA 3UK9A 1CGPA 4EN8B 3FBMA 2EIGA 4Q4W2 3NV4A 2ZHLA 1X7NA 4AL9A 5BNPC 1EP0A 1ZZBA 3O0WA 5FQ0B 1XC6A 2DUOA 2OQ6A 2W1QA 1NOVA 1UIKA 3LDKA 4QX7A 4XZPA 2Q8CA 5E88A 1UOFA 3USUB 1UQXA 4L97A 1YFXA 2Q0AA 1AL0G 2QDRA 2QKDA 1RHI1 4E8DA 3HT1A 4IQPA 1W6PB 3KCXA 1BVVA 3KD4A 5KR7A 2L9LA 4LBKA 1APNA 3EHKA 1SPPB 4N9HA 5EWSA 4NIAA 3WP3A 2ZGSA 1CN1A 2ZHKA 4GXLA 5FO8B 5FOJB 4A6SA 3AZVA 3J8F2 2HWC3 2WNUB 1QH6A 2Q8OA 4OMCA 4LIUA 3WNNA 3WNXA 4AW7A 2X5IB 4GAZA 2WUHA 2JG8A 1TEIA 5FZ6A 1LB2A 2D6OX 1HRI1 2Q4SA 2YY1A 4META 4OUEA 4Q4W1 1H8TC 3U0ZA 4LBQD 3AP6A 1VMHA 2D93A 4LUMA 5ABJA 1V6NA 1MS9A 5IVYA 4CP0A 3NNJA 2EIBA 1QQP3 3DCQA 1GZ9A 1BK0A 1I5PA 1NA1C 5BNNC 1EUUA 5FY7A 3E5XA 2FDKA 5AFEA 1S2BA 1SBFA 4LR4A 5FPVA 2XPJA 4HN0A 1B09A 2ZMLA 2ADEA 3MBWA 1V70A 4ITCA 4MGQA 5SV5A 5T52A 1PGL2 1QXJA 3J8F1 2WLPA 3JD73 2BDRA 5CZKA 3VBHC 4CCDA 1UU4A 2FQPA 2RS53 1GANA 4ISQA 3VBOC 2XBO3 3ZMOA 4AEMA 3CJIB 3S6PA 4BQWA 1DIWA 1LU1A 4IEQA 1LTEA 4XUNA 2ZX2A 3WV6A 4BJ0A 1UX7A 1Q43A 1NCQA 1VALA 4IE0A 1CAWA 3OD0A 5C8CA 4CRQA 4CPBD 3J4UH 1CESA 1W9TA 2Q30A 3J7NA 2DTYA 1OA4A 2F4LA 5I0UA 2R30A 2PYTA 4JKMA 3GDBA 4N90A 4WZCA 3M8LA 3UETA 1L7QA 2VVFA 2I74A 3CF6E 1ZVFA 3DN7A 4O9GA 4P9WA 5LRRA 4E4DX 3WQBA 5JLVA 1YWKA 2VD7A 1CAXB 4QHOA 4IEZA 2W5FA 4NWWA 1RINA 1BCXA 4GQ7A 4XPVA 4FCAA 3THPA 5KHIA 3HQUA 4QX2A 4XMAA 5F3IA 5C9AA 3FFZA 5FZGA 1RMU2 2D3SA 1OQ1A 4WV8A 1GMMA 4IE6A 1A34A 3PNAA 4CEYC 3JUUA 1MVQA 1P8JA 1OVSA 1XNAA 1QJX3 3WG1A 3ZKUA 3KWVA 1OI6A 3N4MA 1PZ8A 2QQPA 5DZGA 1YQ2A 5ABJC 5FZOA 4LT5A 5A1FA 4CSWA 2BYVE 4RR3C 2VPVA 3VHNA 4COYA 3AKPA 3ZVXA 1ASJ1 1RVF1 2K9ZA 4EWEA 4HSJA 2RDNA 4PBOA 3WNPA 1BLZA 1FOD2 3SC7X 1LOGA 2QQLA 3T09A 4OYUA 5JXGA 4R8HA 1JYIA 4YW4A 4OI1A 2EAKA 3A21A 4H2AA 5FCCA 5FZBA 4G3YC 2BBVA 1SCRA 5J7MA 4FXKB 4YW6A 1A8DA 2BBAA 2XWJB 3KM5A 1ND2C 4JTOA 1RMU1 2HWE3 1IS5A 1UO9A 1KDKA 3RFRA 5GLWA 1L3JA 2ZX3A 4HK8A 1N1VA 1R091 2W1SA 4DQAA 2VNVA 4JZRA 3I3EA 3SNMA 1GV9A 1PO22 3CEWA 3ALQA 3H1WA 4HVRA 4JCKA 1CX4A 4DZGA 3WG2A 4E9KA 3APBA 3VD5A 4AFBA 3OGRA 1A8MA 1G9FA 4HETA 2WQZC 4ARXA 1D4M3 2DU0A 4UW3A 4X6RB 3ZXGA 2JD9A 4EZ4A 1ND3B 1ZZ7A 1O59A 1W8ZA 3RMXA 4P02B 4DY5A 2O0OA 1Q5OA 4YRDA 4RQPA 1XNCA 5FOBB 2ZX4A 4LKFA 1UW8A 2RR13 2TBVA 2JG9C 5CKQA 3WF3A 2WQ8A 1GP5A 1OLMA 2QQIA 4IUGA 4NWVA 1MS0A 4NHKA 5H9PA 3BPZA 3H8OA 4FXGB 5F3EA 1YQ8A 5A32A 1D2QA 4XCAA 4DPNA 2XL7A 1QJZA 3HNYM 2PHTA 3O12A 3WSOA 2WINB 2BP6A 3H8UA 3H42B 1ZREA 4A44A 3OPTA 1WW4A 3AP5A 1PO21 4UF0A 4W6YA 5LA9A 3B9CA 4XHXA 5BNNB 5BNQA 4BH9A 5C3SA 4R9BA 2Q1ZB 4HPKB 1VB2A 3LAGA 2WT1A 2F6BA 2JDAA 3ME2A 3DKWA 2JXAA 1W0PA 5IVCA 1OH3A 3PIJA 1V00A 5CFCA 2RG4A 3AVSA 3NWKA 3D8CA 1HN1A 4H7LA 4TWTA 2HYKA 2ORZA 2VUJA 4UXAA 4DRVA 5I0SA 1IS6A 3WLUA 3B02A 1W39A 3CZJA 4XF3A 5FJKA 4BA6A 4J1XA 1DLCA 5JR2A 2QQMA 2UY8A 2Z69A 2XVLA 4XYXA 4HN1A 2VO5A 3UKTA 4FTSA 2HYXA 1WCKA 5F5AA 1BJQA 2JDYA 3I59A 4YPJA 5C4WB 2J22A 2ZEZA 2R073 3DV8A 4LUKA 5FBJA 3MLLA 5F6KA 5J37A 1RJ8A 4N7UA 2W2IA 4A7KA 2CYFA 1W99A 2RE9A 3S7EA 1LHOA 2X10A 5KXDA 1WMDA 3K48A 3QD6A 3SQOA 2YDEA 1DP0A 2WT2A 1W9SA 5EPAA 5BUVA 3CJIC 4PCRA 1JZ4A 1JHNA 4WVMB 4ASMB 2EXIA 3JQXA 4KG0A 1Z7S3 2VVEA 1PGW2 1JYVA 5D8AB 4LOTA 3WY6A 3HBKA 3I4IA 1CIWA 2W91A 4RFRB 4WBBA 1XYOA 4XTPA 2KD7A 4BU2A 2A70A 4E4ZA 4EYUA 5J1XA 3VLBB 3AVRA 2QQNA 1H4HA 2WO7A 4D3WA 3BIWE 4GWJA 4QM8A 2VVDA 1LODA 5KHJA 2Q1FA 3T4HB 1C8M1 3ZXJA 2OA2A 5C5TA 1V0AA 2R043 3IDAA 4RSUA 3C7OA 1KS4A 3H9AA 2VGDA 1QDCA 1QJEA 2R49A 3WNMA 4PDWB 3P3NA 3POWA 1NY71 1UD1A 3T1LA 2GC1A 4UYBA 1RUD3 4FFIA 1O8SA 3AB0A 1MQTA 3IT8A 4QPGA 4TYSA 1CQ9A 2DV9A 2PHFA 3OY8B 1H1AA 1PGW1 2VW1A 3EB7A 4RS5A 5A33A 2YG0A 3VBUB 4CDUC 3O1VA 1MS3A 2EXHA 3U1XA 5KXCA 4XDQA 3I3DA 3CL1A 4I0WB 3CMGA 4EJRA 1Y4WA 4QWNA 5FPAA 1K5MB 3Q8CA 3KQ4B 3S30A 3A0NA 4X8PA 2RM21 3BOPA 2ZHMA 4PIZA 4XJAA 5BXXA 2VL4A 5JWPA 2WR9A 5EHDA 1OPOA 1R1ZA 3IDBB 5FY9A 2QJVA 2MPFA 2VM9A 4CCNA 2P17A 1XNBA 2HWB3 3BVCA 1DG6A 3IWZA 4DY3A 1GQGA 2G19A 2J1SA 4MLOA 3S5QA 1RXFA 4CDXC 3TN93 1REFA 2DCZA 2J1VA 1QU0A 4XQWA 4YFZA 4FVVA 3LPGA 3UKVA 1CD3G 3ZXLA 3KGLA 3IAPA 1X9TA 2A6YA 1FATA 1FAYA 3LD8A 5FZ4A 5FDBA 2Q8DA 1UU6A 3WDTA 1IS3A 2QDNA 4CXWA 3OBAA 3MV11 1LHNA 4C1XA 4LO6B 1HQWA 1ZBA2 3MGUA 3PU3A 4K8RB 4DUXA 2PHLA 4EN0A 4C8DA 1J3RA 2D44A 5FP8A 2IXLA 1IPJA 3C7GA 4HVQA 3FN9A 1CAUB 2VAUA 2ZMKA 1GFF2 3ACLA 4M3CF 4OZOA 3VBRA 1ULEA 3DF0A 2WZ8A 4YW5A 2VC9A 3SMHA 1XE7A 3J26N 3ZFGB 3WDYA 1BXHA 4CP9A 1DYOA 3D5OA 1YCIA 2VMGA 1D0GA 2W47A 2RJ2A 4WVVA 2LUWA 4XFBA 2DVGA 4BQ3A 2PN5A 1VBD3 3NJXA 2WZR1 1Q8VA 4N9IA 2C1FA 3VKNA 3MZHA 3OYWB 2P1BA 1KFUL 2XLFA 5T5OA 1C8NA 1HV0A 2VCBA 4P9YA 5ERLA 4HANA 4AE2A 2E33A 3RZGA 5GLUA 3H1YA 1ZZ6A 1ZBA1 2MHFA 4BOWA 4IV1A 1EAH1 4QQ2A 3JBG3 1VBB3 1NLQA 3R0RA 2Q5TA 3BYWA 3R4SA 1NZIA 1ENQA 4HBNA 4LJHA 4O7XA 4RGAA 3KMHA 1W6NA 3ZIXA 4ZZ5A 3ZR5A 1W06A 4WM7C 5APAA 4QKDA 2A71A 3VBSB 4BLIA 1CWPA 1KGYA 2HWF2 2VJXA 5A3WA 2XGXA 1H6XA 1DQ2A 3SKVA 2BVVA 3PJYA 3WF2A 1PVC1 2E63A 4XC9A 4ZU5A 2RMU3 5BNOA 3ZOIA 3ZSKA 5I8TA 1JOPA 1Y9QA 4NIDA 4XABA 3M4FA 4TN7A 3ZYJB 2ZGUA 2D7FA 1VLNA 3B94A 1YRZA 2FMYA 2QBXA 3THCA 4FOYA 3AZWA 3VKOA 1JUHA 1S1AA 2CV6A 3DGTA 5FO9B 1R083 3AFGA 2VXJA 2GMMA 3N9NA 1JYNA 2B9VA 3WDVA 3ZFFB 4FP3A 5A7QA 3WR0A 1RUE3 2E9QA 2QUOA 4COUA 1X8EA 2J1RA 2RHPA 4XF1A 5LY1A 1RUG3 4HXCA 2Z42A 2VW0A 2FBEA 4RGGA 1RUH2 2GN7A 2WNVB 3AXDA 3KCYA 2ZAHA 2YBSA 2HWF1 1DYKA 3WNOA 1ULFA 5FLHA 4NPLA 2R1DA 4A45A 2B39A 5FJHA 1COV2 1SMVA 1VAKA 5DUVA 2BTVC 3W59A 3DYPA 5FY1A 3OPWA 2ZMNA 1LESA 1TME3 4D6QA 2JDHA 5EV7A 1AXKA 1AX0A 2DBIA 5T5JA 2D3RA 3N9OA 3NL1A 2ZABA 5FY5A 4FOVA 3WT3A 3TRSB 3DECA 1DDLA 4N8MA 5FXXA 3O0XA 5IW0A 4P9XA 4C91A 1WMXA 5GZFA 1HB1A 5FZHA 4FPEA 4JV4A 4QX8A 1Q56A 4PDWC 1AR73 3ACIA 4ZHNA 3AX4A 1TG7A 2EALA 2YC0A 4XETA 2ZTNA 2NMOA 4KU7A 1AYN1 5FMOS 3RNSA 1J3QA 4YZ2A 3AL6A 3OEAA 1RUH1 2QQWA 3ECQA 4AI1A 1IHMA 2WFF3 1US3A 3I8TA 3VBUC 1VBC3 4YVWA 2W52A 1DF0A 3T2QA 1WBLA 4RFT0 1N3PA 1SBEA 3MW2A 5IK5A 1WCSA 5FFOC 1CPNA 3O0VA 5A80A 5DUWA 5HV0A 2GH8A 2PFWA 1X82A 1JI6A 1OOPB 2E26A 1UKRA 4LBJA 1ULPA 4RL7A 2RS33 4Y20B 4ES8A 5FZMA 3AYAA 4NR1A 1O3RA 4PQQA 1RL3A 2RS13 4Q1RA 3W21A 2W1UA 4AVBA 1FX5A 4H7MA 4JHTA 3KLSA 3PLQA 4QX5A 4DXSA 2G1MA 4AAPA 3K4AA 5DAWA 3ZIWA 3KHBA 4QKNA 3PUQA 3KB5A 5GZGA 4NRQA 1RUF1 4Q4V1 1VAVA 1VRBA 4G4FA 3FLRA 4LIVA 4CUAA 3BCWA 4JGYA 4CP2A 3TNPB 3MO4A 5A6QA 1WLWA 1W3XA 1C1LA 1ZA4A 1SACA 1UIJA 2VXRA 2DVDA 1CJPA 4FFFA 3U78A 3LWCA 3GYDA 4ZONA 2Y8KA 2W46A 3QOPA 2IXJA 3FLPA 4YNIA 5C71A 3FHIB 2NLRA 3FX3A 1I5ZA 3ZFEC 4LK6A 5JSRA 3CJXA 1OQEA 4A41A 4AVSA 2HWD3 2J1TA 1REDA 3FHAA 3LEMA 4MO3M 2D6PA 5GZDA 5FZ7A 2VOTA 1GKBA 4OMDA 5BNPB 3QLQA 3HN1A 1WGPA 1G86A 1PNFA 2JDMA 2BPA2 3KT4A 3N9PA 4L2NA 4AGGA 4ATFA 1AR62 1G9DA 2JIJA 2YB7A 1JZ3A 3HNMA 1XSQA 3WF4A 4XHBA 3JZVA 3LE0A 1R1A3 3M3IA 4OZXA 4CUBA 2IXIA 2VZ1A 3A4UA 3RZZA 2Y38A 1POV1 1V6LA 1U12A 1RUJ1 1D0HA 1QOSA 2EICA 1U5ZA 1V9U3 3KV6A 3QCWA 2AREA 2GDFA 4QPIB 4Z1VA 5CFDA 5KXEA 4COWA 1G7YA 4CCEA 5FWEA 5LY2A 3PUAA 1FMD1 1WBFA 3RRDA 2P4EA 3FC0A 5L9BA 3N9MA 4JC1A 4KH9A 4PF1A 4EN9B 4Y1UA 5FZEA 1H8TB 2QE3A 5KHHA 1RUC2 2ZS6B 2O1QA 4LPLA 4NHXA 3SH4A 3V64A 1W03A 4GH4B 1KJRA 1AR61 1MEC2 3NRUA 1NXD1 4ZY9A 5LA0A 4XAAA 5FP4A 4Z2AA 3J7MA 4K8FA 2EXKA 4GIQA 1UMZA 2HBTA 1W2UA 1NA1B 2XQRA 3LFIA 2QQUA 4M0HA 4IEYA 4MOAA 1X8MA 2A6VA 2CHHA 3AJYA 4K40A 5HCBA 5A3OA 1H9WA 2QQKA 1SLCA 2YMZA 4UI9L 3UESA 4E4HA 1S0EA 1VRH3 2VW2A 1NKGA 3LSEA 3Q8BA 4BIOA 2GSYA 1PX3A 2DYCA 4SBVA 4JDOA 1S2EA 1G9BA 3LB9A 3VBHB 1GR3A 1YJLA 1HN0A 3VBOB 2IXCA 2WNVC 2NM1A 4XE9A 4RD7A 5F5QA 1PM7A 2A6ZA 2ZGQA 5F8PA 5JZGC 2LM3A 2YFUA 3N9QA 1WLCA 3CDZB 4L99A 3GCWA 2AEZA 1UKGA 2B4KA 2DCKA 3L9JT 1W6OA 4FI9A 4QKBA 2VBDA 5AVPA 3RJRA 4J1WA 2Z79A 3LCPA 1TMF3 5GLTA 3HQXA 4XQ4A 2BNNA 4CA9A 4HVOA 3B9IA 4ZKTB 4M00A 2VH9A 2VUAA 2I07B 2B5HA 3AZXA 5A1LA 2HWC2 4FAGA 2ZZJA 4IV3C 3VDDC 1UPIA 5LASA 1PMJX 4BB3A 1D7PM 5C5UA 2E53A 4W6XA 3VD3A 4OUMA 4QQPA 4Y3OA 5A3LA 5C33A 4XUOA 1X33A 2UU8A 4Y5SA 3OPZA 2WJSA 4YZ3A 1ZNPA 2WYSA 3NW4A 1HDKA 4IXLA 4XBQA 5FREA 2VZ3A 5IHRA 1VIWB 4LA2A 2BGOA 2E7QA 1XNDA 2IZWA 2NZ9A 2XONA 3POSA 2PHUA 3POYA 2W68A 3UGHA 4CEYB 4Y5Z0 4YW3A 1LECA 1I9RA 5HCAA 2DBNA 3M1HA 4QGNA 4WVZA 1IPKA 3FL7A 5ABJB 2WNOA 4BQ1A 2VTXA 4XJZA 4PT6A 1B35C 2D6KA 1Z0HA 1W8WA 5C3OA 2ERFA 3I54A 1QGLA 5JOXA 2X09A 5FZFA 3WW3A 4C0BA 4Y4RA 2HWC1 3O1PA 3JD72 2ZGPA 3ACFA 2HBUA 2XJRA 5HXMA 3H50A 1LGNA 4HMZA 4XXAA 1OFSA 3ZMNA 2CNAA 1PK6A 3INAA 1RUI3 3SLIA 5FUPA 2MNGA 1AR83 1GYKA 1OF3A 1U0AA 2YUEA 4EQVA 2VE1A 3FE5A 2AACA 3VB9A 4AI0A 4DIQA 3IM0A 4YVSC 3IDCB 1ND2B 2VBPA 3KV5A 5F32A 5AC93 3RSJA 3NAPC 1OXCA 2ARAA 3ON7A 1QQP1 3KV4A 2Z5WA 4M0NA 4C0HA 1M06G 2X53S 4XQDA 2VR4A 2TEPA 3EJKA 4GWIA 3BU7A 3IAQA 3NKGA 3WF1A 4Z2WA 5J48A 4LA3A 5LB6A 3M7AA 3O14A 1CAWB 4NJ4A 5FWJA 1DGRN 3PIGA 3T0DA 2G9GA 5IVJA 3ETQA 3LKJA 3H3LA 3AP7A 3JD71 4LQRA 1ODNA 2JE7A 3PUHA 1AX1A 4XDPA 4BDVB 2Y33A 2RS51 3DPRA 3I2FA 2XBO1 5DQ0A 2DF7A 5L7OA 1O4TA 4I3PA 4D7SA 5GJ6A 5K0UA 2ZGOA 2P6CA 4Y5TA 4CP1A 1EUTA 1O91A 1JS9A 2JG9B 4WM8C 3DYOA 4AEDC 4Q27A 4QGLA 4MVTA 2DCTA 1OD3A 3DKQA 2WSVA 3Q9OA 5EJZB 2B8MA 3PMEA 5C9AB 3OUIA 4EWDA 5HCFA 3AJZA 3H0OA 3ZLIA 3CNAA 2WS93 1UZZA 1W90A 2XJQA 3VN4A 2JWPA 2ZEWA 4JGZA 4QPIC 1LNSA 1FYUA 1NCRC 1VAMA 3D0JA 1JTZX 4D7YA 1XRUA 5DDJ3 3ZYFA 1ACCA 3ABZA 3AYEA 3GHNA 2DUQA 2P3KA 2OUHA 4CDWC 3AM2A 5FZ8A 3CLPA 5JSPA 4TZDA 2PA7A 2DU1A 2NMNA 3URFA 3LA3A 4P9LA 4HOOA 1E5IA 4GH4C 1DQ0A 4QDQA 5GALA 1GNYA 3K3OA 1WUVA 1C5IA 1J3PA 1QJU3 2HEVF 2YGMA 3LSDA 3MICA 4EE2A 1WCDJ 1LHWA 3HEIA 1QJX1 1QIQA 4GJZA 5DUXA 4YGBA 4IGOA 3HD8B 2A6WA 1LULA 3OD4A 2ZCWA 4CYDA 4YGCA 3POEA 1BBT3 4LO4B 1UYXA 1WW6A 1D4M2 3U4XA 1F5FA 4N53A 3ZPOA 3E1F1 4QGMA 3SH3A 3VDBA 2JEMA 4YG6A 2Q8EA 3VKLA 3POBA 3AKRA 5JXJA 2ILMA 2FCTA 5FYIA 5CISA 2YBKA 2RR12 1O7FA 3VGIA 2KR2A 1PGSA 1CZSA 1HRV3 1LAJA 2EF6A 3Q8FA 5FO7B 2R7EB 1W8OA 2HWE1 2VG9A 3BN6A 2B9UA 4H14A 4XBLA 1TQ5A 1OT5A 3K4DA 4RQPB 1Q8OA 1OUSA 5IJRA 2HH9A 1BMV2 4YM1A 1OVPA 4WVWA 5FUIA 1HIXA 5HV4A 2P5BA 1XE0A 4FPHA 3N35A 4B1LA 4QDRA 1AVBA 1ASJ2 1RC6A 1RVF2 2LRPA 2PHDA 2VQTA 4IEVA 4NPMA 4YM0A 5DAPA 5A32B 3S7IA 2JDNA 4PQ9A 1OSGA 4FPGA 5A3MA 1WLTA 1D4M1 2LROA 4JQRA 5FXVA 5KBFA 5LEJA 1OQDA 1QJY3 2ES3A 4Y1ZA 4KGQA 4QB1A 3AKTA 2QCSB 3HIFA 5KHGA 1V6IA 2RR11 4W6WA 3RYRA 2GC3A 4LNVA 1LOEA 4KBBA 3RZHA 1UZ0A 3MFAA 4YW7A 4CDUB 4YM3A 2JG8C 4QT6A 4CCOA 3UYJA 3OJBA 1R092 2XHKA 3QBQA 4YW1A 5F39A 3NV1A 1JYCA 4IEPA 3NV3A 3WCRA 1BMV1 1EV13 4YGEA 1W05A 3VDCA 4BE3A 5BY5A 5FMCA 4ISRA 2UYBA 1E5RA 1CZVA 1UYZA 3Q8EA 3PHMA 1Y7BA 1VJ2A 2R072 4XF4A 3RZKA 2LALA 3MEPA 3SHRA 3LOBA 3WG3A 4R4ZA 4HKWA 4AK3A 4BYYA 2ZGKA 1ZZ9A 3EMRA 4MXWB 1W6PA 3I59B 2VUCA 4Z82A 5CVRA 1S0GA 1YQCA 3ASIA 3GZEA 3KSCA 5H9RA 5AFBA 3A7QA 3ILNA 4CDXB 1WWYA 3OGVA 2WO3A 2D6MA 1H0BA 2ZJCA 3AZZA 3MI8A 1C5HA 4NIGA 2WNUA 1IG3A 2JDKA 3L2YA 1X50A 5DXDA 1QNYA 4Y26A 1LRHA 2X5IA 5E8AA 3VZMA 4FQZA 2LTNA 1HB3A 1CR7A 2YC4A 3CU7A 4YZ1A 4FBFA 4LTAA 5FY4A 2J1AA 1NCQC 4I0BA 3ZDSA 1LCLA 2R042 5C8CC 2R071 2V5DA 5CYYA 1KQRA 4PLOA 4UFJA 2EVXA 3R6SA 3OUJA 4HSLA 4XBNA 4MGZE 3ZPYA 1Y9MA 2D5FA 3RPQA 1O3QA 5EYXA 3WW2A 1US2A 3JCIA 2IXKA 5EYYA 1AHSA 2PMWB 4QHZA 5FYMA 4MXVA 3T3YA 1Z7S1 1FT9A 1BEV3 4IETA 2VMCA 2AYHA 2DCYA 3I2GA 4D0QA 2ZOEB 4IEOA 4R9CA 1G8WA 1UZYA 5FZCA 1AJKA 5C9AC 4QB6A 1QEXA 4LO7A 2WNEA 2PAKA 2ZHNA 5HXVA 3WX5A 1AL23 5IT6A 3G7DA 4KGGA 4RHV3 2BW8A 2R041 5LA1A 1H6YA 2C9AA 2BNOA 2BWAA 2HLEA 1JODA 2V72A 4JAAA 4URAA 2XVKA 1TNFA 2FDGA 2HWB2 1W9FA 3ILRA 3WG4A 2AGSA 1T6BX 4LKSA 1UY0A 3QACA 5F2SA 5FUNA 3WQ1A 3ZKYA 4AOCA 4YG0A 1RUD1 1QXRA 1UY2A 4WM7B 3SEEA 5KC6A 1W6MB 4LULA 3RQ0A 3ZSLA 5LK7B 5D21A 3WUCA 3O1OA 3M70A 4L11A 1ZA7A 2IVIB 4NHMA 5EZWA 5CG9A 1CAXA 4BQYA 3GZTB 2FDHA 3CQOA 1NLSA 1C8M2 1ZBE3 3VZNA 2PAMA 3CIHA 3O1RA 1QOOA 4MGSA 3HWJA 5FRAA 2AUYA 4I3GA 2D40A 4QU2A 4MGKE 1JH5A 4JKLA 4W65A 5FPXA 2W0XA 3GBGA 4XFAA 4PI2A 1NY72 3ILFA 3IB3A 4P08A 2HWB1 4DXTA 3SXWA 3T0AA 3TEXA 1C57A 3SITA 4ZXEA 2R0HA 2ZXQA 4AVAA 3TN91 2VZVA 2ARCA 5T55A 1OHFA 1AYM3 4QQOA 3WVJA 3ZXKA 4BISA 5I0RA 3DEMA 2JB8A 5JIUA 2A3XA 5IK7A 5FZ3A 2Y0OA 4RQPC 3VBRB 1EYBA 2A5ZA 2WABA 4F7ZA 1VBD2 2BZDA 2W9XA 4LHKA 4O65A 4FTBA 1LEMA 1Z78A 5G05L 3WOGA 1VP6A 2RM22 3NJZA 4CP9B 1W2AX 1O3TA 2O8QA 4XFHA 4EN6B 3O1SA 3VD7A 4AFMA 1IQDC 2ETEA 1FOD3 2CU5A 1Q8PA 2CAUA 1PZ9A 2ID4A 5JXIA 1JZ8A 3J9SA 1JU4A 3CZUA 4GMP0 5EJ3A 5SV8A 4M01A 1IQAA 1LEDA 2VCAA 1XJAA 3KV9A 2UWBA 2Y6LA 4D6RA 3OBZA 2YROA 2YC2A 1S0JA 4FP2A 4IV1B 1A6CA 1PZ7A 3HOBA 3LOIA 4AVCA 4YM2A 3N7MA 4M4PA 3RI8A 4IERA 3AMPA 4DMIA 5CFCC 1NQDA 2W94A 1GZCA 3AMNA 2JDUA 4A4AA 1ND3A 2RMU2 4KNCA 5JVVA 4AGRA 4MGTA 4P14A 1VBD1 4ZU7A 1LHVA 1AXYA 2BFUS 3POFA 1J59A 2GP3A 1ST8A 1GQPA 1UZWA 1R082 4EZHA 5BNOB 3SKJE 3GF6A 5FPUA 1RUE2 2WA4A 3WF0A 3JBG1 1VBB1 3GCXA 5DUUA 1FPN3 3O5SA 1UOBA 5HCHA 2QQVA 3VL8A 3TBDA 2IC1A 3V0AA 5IAXA 1LJ7A 1D4VB 2CL2A 2Y6JA 3FJSA 4P9IA 5IWFA 3ZYIB 4BCUA 1G6NA 4N7IA 3BI3A 2WZR2 1AX2A 1OMIA 2OIIA 1H1IA 2Z2SB 3HNBM 4I0AA 2RMU1 3I3MA 1ZRDA 3ENRA 1G9AA 5A6XA 1GZWA 1XE8A 1VBE3 2YV8A 2ZGLA 2ZAAA 1CVNA 3IPVA 3THTA 3V0BB 1MZ6A 4LLFA 1XNTA 3DXTA 5JMOA 1EAH2 2VMHA 1R081 3ZFEB 1RUE1 1AR72 1NYWA 3VZLA 2XKOA 1WMFA 4XVHA 3U4SA 5CB7A 5A3NA 1RUG1 1SG3A 3SCHA 5FPZA 5C4WA 3IMMA 4Q0SA 4S2GA 4RYDA 4AEKA 5DABA 1DZRA 1STMA 2WA3A 1FV3A 3HAGA 4YZ5A 2BV4A 1VBC2 3GBWA 3MIGA 4UFKA 3I2DA 3AXEA 4W8JA 3WQ0A 1XQNA 4Y24A 3OB8A 1PVC2 4XILA 4IEUA 1MQTC 1S0BA 5E6HA 5GLZA 2BQPA 4QPGC 1TME1 2OPWA 5EXOA 2BRTA 2XR4A 1DU3D 4R9DA 3T1MA 2OS2A 3LEKA 4CVUA 4RS5C 4CXXA 2XB6C 4IE5A 4D8MA 4FAHA 2WRAA 3MF9A 1GBGA 2NPIA 4CDQA 1GWMA 2RS32 2GMPA 1JMUB 1HXS3 4QU1A 5D8AA 5FMDA 4ASLA 3RGBA 3FMGA 4HZFA 1VBA3 1MS1A 3U10A 2RS12 1WKYA 5CIRA 1AR71 1SLTA 5DG1A 4YYOA 2CSGA 1AXZA 5JXHA 1H2NA 2JKBA 1J1LA 5CG8A 4OUSA 1QHDA 3IBMA 3UGFA 4AI3A 2GZWA 2WFF1 3OGGA 1VBC1 1W6QA 1WZXA 2VMEA 4AWDA 5JIAA 1I1EA 1HQNA 1KD7A 4XF9A 5EJ1B 1QMJA 1SEFA 4COZA 4ZPIA 2H6BA 4TTGA 1OLME 3WDXA 5CEHA 1ZZ8A 4CU6A 4Y1XA 1BK1A 3GZUC 2BJSA 1S0DA 2PAEA 3OY8A 3WHUA 3VL9A 5F2WA 1LOCA 2RS31 3ZM8A 5GLVA 2ARXA 4M3CA 4JRLA 5CBLA 5D1IA 3WW1A 2EXJA 1YFWA 4DNYA 2RS11 2A7AA 4PJYA 4Y22B 1K5MA 4YSFA 4B29A 3LZZA 1AYN2 5EP9A 3ZN6B 5HBAA 3VD9A 2Y0IA 2AR6A 4GMP3 3MYXA 1WD3A 1W8UA 4IL7A 1Y43B 4IW3A 3M3OA 5JZGB 2XDVA 5K7PA 3VBRC 1BVP1 3VDAA 4BWOA 5JCTA 2WZEA 5HPOA 2B42B 4FOWA 1DBNA 1GQHA 3RVHA 5TSWA 1N1YA 4FQ4A 3IIIA 5LBBA 4I01A 3MIBA 3ZYHA 1YYNA 4RN5A 4CEWA 1QDOA 5LBEA 1YXWA 2I45A 2VQUA 4JQTA 1PM4A 2ZGMA 4KBZA 3MV01 2FCUA 4IV3B 3OTFA 3VDDB 4GALA 4FSJA 1F9KA 3LIGA 3ZSMA 4BQ4A 4DS0A 1DQ1A 1LOFA 3K4ZA 1RXGA 2HWD1 3WCSA 1GOFA 2KM2A 4IV1C 1T2XA 2D6LX 3WNLA 1WCQA 1RUF2 1U5YA 1UY4A 4GB33 4Q4V2 4D7TA 3VUOA 4JKKA 3TWIA 1UOJA 4OQ8A 1GNZA 1CAUA 2ZEXA 2VTXJ 1AR93 4IE7A 4FPYA 1R1A1 4XAEA 3JQWA 3H7YA 3MW4A 1OBNA 3B00A 2EIEA 4JTNA 3ZFGA 3OCPA 3CKHA 5L9RA 1B35B 1V9U1 5CNAA 5G04L 5BNOC 3PURA 1VRH2 2CGNA 2YHJA 4R52A 2GALA 4LO8A 5B2GB 2LS6A 1LOAA 5LW9A 3TEZA 5F37A 1HQLA 3OYWA 3D0SA 1UZVA 4HKLA 4GWMA 4UW4A 5LBFA 2ZKLA 2ZEYA 2BU9A 1RB8G 1XYPA 3KF3A 1OC1A 2MEV3 4AR2A 4YVSB 5FTTC 1FNYA 4XW3A 1ENRA 1MZ5A 1VPHA 5A7SA 3NAPB 1KDMA 4ARYA 4I09A 1N3OA 1ALYA 3A22A 3MPBA 5A6ZA 1TMF2 2XLAA 4NIHA 1RUJ2 3VBSA 5A7WA 4U2AA 1CAVA 1V6JA 4MYEA 1W8FA 5M0TA 4MADA 3ACHA 1OKQA 3NV2A 4LBQB 1VRH1 2FHRA 5FYZA 4C90A 3OUHA 3O1MA 1FMD2 2UURA 2UWCA 4Q0PA 3ZYGA 5FLJA 5BPXA 5FK7A 4LHSA 4NE9A 1UMHA 2ZGNA 4IGQA 1MACA 4OHZA 3H8RA 4AYUA 4IDZA 2D97A 1H2KA 5FZ0A 2JICA 2D3PA 4MSVA 5IVVA 3LF7A 3BTXA 4CUGA 2QQOA 2ADDA 2WSUA 3ZFFA 4WM8B 4D69A 2A3WA 1LOFC 4AEDB 1ZYBA 1F31A 3QH7A 5DG2A 3PVEA 4K9SA 1SFPA 2ATFA 2WT0A 4Q1PA 1T6GC 1NT0A 1YHFA 3ST7A 3HN3A 4LK7A 4YVWC 1TMF1 2VECA 1SLAA 3ZXFA 1RJ7A 2A6XA 5I0TA 5A7NA 2YYOA 1NCRB 1QH7A 3WHTA 4JDMA 3ZYPA 3LFMA 5B4NA 4A3ZA 4NAOA 5F9TA 4CDWB 3KVBA 3C3VA 4PI0A 3S57A 3G6JB 1RYYA 1COV3 3IMNA 2FD8A 2YU2A 3I3BA 2VMIA 2W39A 5E89A 3TB0A 1UL9A 1H4GA 4L0PA 4KWLA 2V09A 1K12A 2JD4A 5AC92 2PLV3 2C6SA 1PK6B 2P6HA 1KXGA 1O4YA 3LEGA 3M3CA 1GUIA 2A73B 2JX9A 1ONAA 3I49A 3WEZA 1UXZA 4N43A 3VZOA 4OI0A 5EFUA 1IGOA 2GMEA 2BEOA 3KQRA 4XFGA 4FTEA 3LEIA 2D6NA 4JGYC 1HB4A 4R9AA 3EO6A 3THDA 2OT7A 3KT7A 4RGKA 4AGVA 4LBOA 4LHLA 2TNFA 1A3KA 3K77A 4E4SA 1UY3A 5IVEA 1R64A 1AJOA 2B45X 3SCFA 5IVFA 1OOPA 4AAXA 1MPXA 2OYZA 4OHYA 1K45A 4LO5B 1RUI1 4Y20A 1BKZA 3S5AA 1AR81 3KGZA 3NSTA 4CU8A 4F8AA 1BQPA 3H1MA 5A3UA 4GJYA 2KXLA 2K2SA 1XU1A 5IATA 1ZM1A 5FAXA 2JDPA 5LBCA 5AC91 2AEYA 4K21A 2GC0A 1FV2A 5K0UB 4HL0A 1NAEA 4HONA 2PTMA 5FZDA 5ACA3 3JU9A 4AVVA 2WS92 1QNWA 4QHBA 2R16A 1WW7A 1UYYA 2JKXA 2W87A 4Y1VA 4Z92B 2FMDA 1W04A 2OKXA 4XACA 2OUJA 2RDSA 2WAAA 3C7FA 1NQJA 3QH6A 1SCSA 4TSVA 2C24A 5DDJ2 3CO2A 4Q0QA 5IK4A 1UF2C 3OGJA 2VNOA 1QF3A 1F4HA 1NUKA 3MLKA 3MIEA 4JGZB 4QMAA 1WA6X 2Z4FA 5J98B 3WINE 5DZFA 5CFDC 3RI9A 2CAVA 2NN8A 3POJA 4LMFA 4R4XA 3NVCA 3PVOA 4AHYA 1K5JA 2WBKA 2FDIA 2H6CA 1PO13 4QM9A 3OBTA 3RYKA 3VBFA 1U5IA 2YPDA 4BK4A 1QJU2 2JG8B 2VOWA 2C5DA 1SZBA 4YGDA 1JYXA 1QQP2 1S2KA 4JRAA 4QXHA 5K4LA 1KITA 3PU8A 5BNPA 4XZUG 4NHYA 2WS91 1CZTA 1MS4A 3D4KA 1F4AA 1KS5A 3PTYA 3P5BA 4Q4Y3 3HR9A 4V2VA 4DRRA 3AK0A 1XXNA 2JE8A 1HKDA 4K3UA 3AFKA 5DDJ1 3VZJA 3JB4C 4BHPA 2RS52 2XBO2 2H0VA 5FMOL 4SLIA 2IFRA 1GLHA 3PUIA 5CA6A 4N53B 3HMYA 1F5JA 4E2GA 3FLTA 1QJU1 5B4XA 3UGGA 4AZZA 4BK5A 2PHRA 2EAAA 4AHZA 5D2AA 3FHQA 1UN1A 2VULA 5DPNA 2IXHA 2YZ4A 4P9JA 1H8TA 4XOGA 3HQRA 1EY2A 3AC0A 1QY4A 1NCQB 2FDJA 3GM8A 4NUBA 5LK5A 5C8CB 1QXPA 1BBT1 2DVFA 2DDUA 2XQXA 3WZ1A 2Y6HA 4YG3A 4DEQA 2WL1A 1RUC3 3R4DB 4XEZA 1GOHA 1YJKA 1NA1A 3CBNA 4HKOA 5DAVA 4B1MA 5BNNA 5JUVA 1MEC3 5I8YA 2R32A 3AP4A 2R063 1FNZA 4ZU4A 3BU0A 4G9SB 3LDRA 1HRV1 1RITA 1SFYA 2W08A 1IZ3A 1X9PA 2XHNA 3M2MA 4NRMA 3RG0A 3PVNA 1XPWA 2QTWB 5AVAA 5F3GA 1F35A 1QJX2 3PVBB 3TYJA 2RV9A 5FKCA 3WUDA 3VBOA 2HEWF 1LKNA 4Q5OA 2CGOA 4YWAA 1JZ5A 3GGLA 2X29A 4QD2A 3MPPG 4K7JA 2O14A 4Q29A 5FK8A 1JUIA 2QQJA 2W92A 4PLNA 4H55A 4AHXA 3ZYBA 1OURA 5FYUA 1JZ7A 4ZS2A 1OFNA 5FZOB 2VZUA 3X29B 1QJY1 4GKYA 4B8EA 1WA4A 3I2HA 1MR5A 4KMQA 3V65A 4V2WA 4LITA 1WMEA 3LA2A 1W8NA 2BUKA 4I30A 3PUSA 3U07A 4YFWA 1IKPA 4NPRA 4AQ6A 2DTWA 2HWE2 2E6VA 4GWNA 4FPOB 1MS5A 2B7YA 1PK6C 5FZLA 5IFPA 3A23A 3FZ3A 3AL5A 1UXXX 4Q4X3 2GNBA 5A7PA 5F3CA 2A3YA 1EV11 2J1EA 3BB6A 5FYHA 4AQ2A 5A3PA 3VZKA 1SQ4A 3RZLA 2Y64A 4AG4A 4J6GA 4EWAA 4CEYA 3LGRA 1WW5A 2OW4A 1GZTA 3D82A 2ZX1A 4CTEA 1VE0A 3A0KA 1PIV3 5GZEA 3GHMA 4ZS3A 4BLJA 4RR3A 2G4IA 2H0BA 3S0MA 4Q2FA 2VNRA 5J36A 1BEV2 1UYPA 1C4RA 2VOKA 4XIOA 2QVSB 3DPRC 2EIDA 3KVAA 4IGPA 2C0ZA 5FY0A 5H9SA 5L7OC 3AZYA 1KRIA 4MHUA 1CX1A 1NX9A 5K0UC 1LOBA 5JMCA 4A3XA 1PX4A 2SLIA 4LOSA 1AL22 2ZKNA 2WWUA 4ORFA 5GZCA 1N47A 3I2KA 4Q8LA 4RHV2 1AZDA 3HPNA 1ND2A 5CAZA 1MVEA 2YFZA 3NO8A 2DFCA 4MH0E 5CADA 3C7HA 4URTA 2PXJA 2VMFA 2WDBA 1W2TA 2WN3A 2C4XA 1KJLA 1H9PA 3ORJA 4MGIE 4JGZC 4UF0B 5DZEA 5K8SA 4AVTA 3H3ZA 4LHNA 4Q8KA 4QPYA 1RHI3 4U36A 3VHRA 1JZ2A 2XUEA 1BEV1 5FZ1A 5FZKA 1W0OA 3OOXA 5CFCB 4Q26A 2IFWA 2W3JA 3IZOA 5A7OA 1E5SA 2WLQA 4UBHA 3ZXAC 1UNBA 5FIXA 4OHVA 3CHXA 5JOWA 4JVAA 1XYNA 1ZBE2 4FPCA 4DB5A 1AL21 1SLLA 3OGSA 2JG9A 5FQ0A 2JENA 4K6BA 2PQQA 5DMYA 1PGL1 1DYPA 4RHV1 1K42A 3USUA 1GOGA 2VZRA 1SLIA 1HRI3 2GU9A 4YZ4A 4Z07A 4Q0VA 3WW4A 3MFCA 3N3HA 2P2KA 2NQYA 4Q4W3 5JDBA 4V1PA 3BIEA 3ZX7A 4GA9A 1W8HA 1SLBA 3B01A 3VKFC 4ET7A 1SPPA 4OCTA 4ZXKA 1Z7S2 1V6OA 2C9KA 1AYM2 4N53C 5I91A 2QFEA 4QB2A 4B7KA 4CCJA 2P3JA 1J83A 4INDA 1Y9GA 3NJYA 3KZ4C 5JAXA 2BOIA 5LA2A 4D6SA 2JJ6A 2XUMA 1UOGA 2YPJA 3K2OA 3NQHA 4HLTA 1GWLA 1PVXA 3NNGA 1E57A 3NNFA 4PBPA 4WZFA 3J8F3 1ZBE1 3U11A 4HFSA 1IG0A 1O5LA 2XMLA 5F7UA 3BTZA 2RDRA 2RJLA 3JXSA 5J09A 4L8QA 3E6CC 2VZTA 1OD5A 2E32A 4A42A 1YO8A 4DFSA 2A1XA 1GNHA 1QWRA 1OLRA 1RUNA 4A7YA 1EPWA 1DZQA 4BIFA 1RUD2 3FBYA 2XJUA 2F4PA 4OHWA 5ISLA 4CCKA 5IUQA 3BOWA 5F5CA 4XURA 2WO2A 4K20A 4Y33A 2TUNA 4AI9A 5F1RA 1AYM1 2XH6A 2AH2A 4OVEA 4X6QB 4IESA 4FPKA 3B3QE 2CY6A 4L92A 3MW3A 2CWMA 1MQTB 3EBRA 3HJRA 3BUCA 4QPGB 1X36A 3CJIA 4OQ9A 4NAMA 1YLLA 4RS5B 5C3PA 2XVGA 3OEBA 5A33B 4YW2A 1NE6A 2UY9A 3BPSA 3B93A 4B4QA 2HJIA 2VZSA 2XJPA 1D2SA 1FOD1 5FZ9A 1Q3EA 2K46A 4JHZA 1TE1B 3POIA 3DXUA 2R6QA 3E5QA 1FPN2 4FT8A 4QX1A 1SFNA 2G9ZA 3O7OA 1SHWB 4LBMA 5FMBA 3SH5A 4CCMA 2VOVA 5JR7B 3BKZA 4TLFA 3N7JA 4OI4A 3TN92 5DAXA 2ZX0A 4O61A 3RMYA 3E5UA 3UL2A 2GNDA 3AMQA 2LW8A 3P6BA 4BXSV 1QJFA 4BMBA 4BQ5A 4X8NA 2RDQA 3T30A 1QOTA 1ZZCA 1PMHX 2WIIB 5L9VA 3W9AA 3MIDA 3V0AB 1U5XA 3OF1A 1ASJ3 1RVF3 4QKFA 5EQUA 4AQSA 1WLDA 2VY0A 4UFLA 1YC61 1H2MA 2WNUC 1EPZA 1VBE2 2J1UA 3BODA 3C7EA 3RDIA 1XU2A 3VHOA 3AMMA 3D3AA 1H2LA 2X5IC 4JDNA 2VCCA 3WP4A 4CDUA 1FI2A 3WP5A 3HVDA 3E6BA 1H1MA 4UAPA 4QX3A 1OKOA 5ANQA 5T3NA 1GZWB 4JX0A 1DHKB 4DEVA 4NO4A 4Q0UA 4QXBA 1FPN1 4E2SA 3IPVB 4S2HA 3U75A 2ZACA 1RMU3 4KWJA 3T4VA 3O1UA 1GICA 3ES1A 2KA3A 1DQ4A 3WDWA 1E5HA 1Q8QA 3MLJA 4XJWA 1R093 2E7TA 2F17A 4UFHA 3ES4A 4DUVA 2GH2A 2VQAA 3USSA 1OF4A 1AF9A 2WC2A 4MXWA 3W20A 1SDDB 3ROUA 4AI8A 4P9GA 3ATGA 2EA7A 3L2HA 1YI7A 4P5HA 4UFMA 1O8PA 1O6UA 4PIXA 4CDXA 4F83A 1CJDA 2WYFA 1W0NA 2SBAA 1HXS2 1VBE1 1LGCA 4GD4A 1YFYA 5I8SA 4BXFA 5JPNB 4AF9A 5FR3A 1VBA2 3JBG2 1VBB2 2FZ1A 1YNAA 2GN3A 3M3EA 4IEWA 4NROA 1OH4A 1UAIA 3IDEA 5ANNA 2JECA 1OUXA 3TAYA 4CDQB 4W50A 4QXCA 4OI2A 1Q8SA 1DLLA 2XLGA 4AEJA 4E27A 2Y26A 4UWDA 5FP9A 4FOQA 1JOBA 3NKTA 5FLIA 1TNRA 1W6NB 2XJVA 1J1TA 1KFXL 1F15A 1PO23 2UWAA 4NRPA 4B4RA 4D94A 1SDWA 4AFCA 2GNTA 1UY1A 1HW5A 3H8XA 1IPSA 1W6QB 3P1IA 3K75B 3ZXDA 5J3UA 4QDSA 1HXS1 1CPMA 2ZZQA 3DUIA 4S2DA 2WKKA 2Y34A 4Z8BA 4I02A 1VBA1 4IE4A 1DCSA 1S55A 2A75A 3AP9A 4KL1A 4AFAA 1C3HA 5KHKA 3PMSA 4AQTA 4F3JA 5FYBA 1RUG2 3ETPA 3OBRA 4LKEA 5A1AA 3OSDA 2GAUA 1UCXA 4M3CB 1ULOA 1UU5A 1ZRRA 2YBPA 4FPLA 4XFIA 4XFCA 1YUDA 2Y6FA 4Y1YA 3T2PA 2VBBA 4M4RA 5FXZA 1VB4A 3MUY1 3WDUA 4HPKA 2C26A 3C2UA 2O8OA 4HG6B 4XTMA 3BTAA 1TME2 5T5PA 2ZA9A 3W58A 1JBCA 5JOZA 4UBGA 5IAVA 5C8WA 2CDPA 3WXPA 2XXZA 4WM7A 1N3QA 4XMIA 2V5YA 3IIAA 1W6MA 5A3TA 4BM8A 1URXA 2WN2A 2IVJA 4CU7A 3T08A 4J25A 3TOJA 5T54A 5JPMB 4MX3A 5IYYA 4KWKA 2P3IA 3VD4A 4AHWA 1OA3A 3WNKA 4CEWB 2D98A 4GMP1 3ZSEA 3N7KA 4KG8A 4LORA 4GB32 2WFF2 2PQSA 3MDPA 3TEWA 2VZPA 3ZSJA 4EN7B 3GZAA 1C8M3 1HX6A 1AR92 2R1BA 2WFPA 2W95A 3E6DA 3EYPA 4MUVA 4NN0A 3RWNA 2IWGB 1NE4A 4LEJA 4WVMA 5FZIA 5IK8A 1GP6A 1Y3TA 1ZRIA 2D43A 2DFBA 1YIFA 4KI5M 4YVWB 2UYAA 4OFGA 1ND3C 4E8CA 2QZ3A 1YI9A 1O5UA 5FPLA 4I2OA 3ELNA
chains in the Genus database with same CATH topology
3J7MA 3J7NA 4OQ8A 1YC61 4OQ9A 4NIAA 1A34A 1CWPA 1JS9A 1ZA7A 1STMA 3J7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7M A;  3J7N A;  4OQ8 A;  1YC6 1;  4OQ9 A;  4NIA A;  1A34 A;  1CWP A;  1JS9 A;  1ZA7 A;  1STM A;  3J7L A; 
#chains in the Genus database with same CATH topology
 4K1Y A;  1RTV A;  3LDB A;  2DCJ A;  1SBD A;  5K9Y A;  1M4W A;  3LPF A;  3B7M A;  4KU8 A;  1VR3 A;  3AKQ A;  4LBL A;  2P37 A;  4CU9 A;  1UX6 A;  4XUQ A;  3MHZ A;  2AEN A;  4GB3 1;  1OPM A;  1F2N A;  2MEV 2;  2G9F A;  3M3Q A;  3RJ2 X;  3IKW A;  4PDW A;  2RM2 3;  2X05 A;  4XUP A;  2CTV A;  3PDQ A;  1AR9 1;  2Q1M A;  1K3I A;  2PHW A;  1W2O A;  5HI0 A;  3DYM A;  5E1R A;  5KXB A;  2P3Y A;  4JGY B;  5C3R A;  2XL9 A;  3VBU A;  4BQX A;  4XXP A;  4H3W A;  2OXB A;  1JOJ A;  1W8T A;  2AC1 A;  4LE3 A;  4XJ8 A;  5FP7 A;  3RS6 A;  3ZO0 B;  4COV A;  2QZ2 A;  1AUY A;  1DFQ A;  5LWB A;  1HJF A;  1WCU A;  2HWD 2;  5A7W B;  4A7Z A;  1CAV B;  4BME A;  5L73 A;  5EIY B;  5IFT A;  4UW6 A;  2CGP A;  3SIS A;  1GU3 A;  1IS4 A;  4UOJ A;  4IEX A;  4LLO A;  3UJQ A;  1XNK A;  2VNG A;  4PHZ A;  1LU2 A;  5KWR A;  2MEV 1;  4ONU A;  4XDO A;  2JIG A;  2BER A;  4UFI A;  2DVA A;  5C4W C;  1R1A 2;  1ULD A;  2VU9 A;  5FYY A;  3GXU A;  1F8V A;  1YQ5 A;  2E51 A;  3J7L A;  1GP4 A;  4PLM A;  4MZU A;  3RYP A;  1W28 A;  1GWK A;  4CXY A;  5JI7 A;  1V9U 2;  2DWR A;  2GC2 A;  2ZGT A;  2R0F A;  1QKQ A;  2V73 A;  2BNM A;  5KC5 A;  4FPF A;  3K3N A;  1YFU A;  3KCC A;  3Q8A A;  1JYW A;  3I2J A;  4CDQ C;  3AMH A;  3KT1 A;  3MIF A;  5D8A C;  1W3V A;  4LBN A;  3N36 A;  2ORX A;  1LGB A;  3V0B A;  5CFD B;  1NZC A;  1REE A;  2WZR 3;  1TVG A;  3ZFE A;  3LA7 A;  4C1W A;  2VZQ A;  3J7H A;  1A78 A;  1DGW X;  2PLV 2;  5FXW A;  5FYT A;  1ENS A;  4XCB A;  3GAL A;  4LXL A;  1JU3 A;  2OZJ A;  2WAO A;  1ZBA 3;  4FO9 A;  4QQL A;  4XJ9 A;  1EAH 3;  2J7M A;  1YQ6 A;  4E2Q A;  3NNM A;  1LEN A;  1XBF A;  2YXS A;  4CZS A;  2JB4 A;  1I3H A;  2B46 X;  3ZXE A;  3ZR6 A;  1IOA A;  1V6K A;  1C28 A;  1DGR A;  3UV9 A;  3I2I A;  4N43 B;  4RA0 A;  4KWU A;  3U14 A;  4DXZ A;  3E97 A;  1MZE A;  2VCM A;  2VUD A;  3T0B A;  1J84 A;  1JN2 P;  1BZW A;  5A6Y A;  1POV 0;  3GBF A;  3R4U A;  1PVC 3;  1WD4 A;  2JDZ A;  1COV 1;  2V4A A;  3AYD A;  1K5M C;  3SCG A;  3GJA A;  2V4V A;  3POG A;  3KF5 A;  2FCV A;  2PLV 1;  2E7A A;  3AKS A;  3GJB A;  5ACA 2;  2BGP A;  1S0F A;  3MIH A;  2BFU L;  4BQ2 A;  4YLZ A;  1DQ6 A;  4EV0 A;  1RIR A;  4NMI A;  1W6O B;  3B5L B;  2OPK A;  1JYT A;  5FP3 A;  1HLC A;  5C70 A;  2YGL A;  4Y4Y A;  1ULG A;  2JE9 A;  3T2T A;  1G9C A;  3HBZ A;  2OX0 A;  2RVA A;  1LR5 A;  2GNM A;  5T50 A;  2HWF 3;  2OVU A;  2XJS A;  4CEW C;  1BHG A;  3DL3 A;  2OZ6 A;  2PHX A;  4B7E A;  3FFQ A;  4TXW A;  4ATE A;  4OHX A;  5A70 A;  1PMI A;  1GSL A;  3K51 A;  1PO1 2;  2Y6G A;  3MUZ 1;  4QQH A;  3F2Z A;  5H9Q A;  1PNG A;  2ET7 A;  4Y22 A;  2CDO A;  5FV3 A;  2FDF A;  3ZN6 A;  5FY8 A;  4ERO A;  5ACA 1;  2J42 A;  4XJU A;  2ZGR A;  3D6E A;  1KEX A;  2QNK A;  1S0C A;  3VKM A;  2N7G A;  2WNV A;  3VBF B;  2I2S A;  3W5N A;  5I0D A;  5LRS A;  1OA2 A;  2DVB A;  4L9B A;  1YEW A;  4Q4Y 2;  5DN2 A;  5JZG A;  1AYN 3;  2WZP P;  3U37 A;  1RUH 3;  5J96 B;  3ZFG C;  2VZO A;  5LAT A;  1RUI 2;  1L7R A;  1MS8 A;  1OLQ A;  2X8K A;  1NXM A;  1JXN A;  1AR8 2;  2VTF A;  5L19 A;  2NYY A;  3P3P A;  5DAQ A;  1POQ A;  3AYC A;  5GKA C;  3JB8 A;  5I93 A;  4O9E A;  3RWK X;  1PO1 1;  4QX0 A;  1O4Z A;  1ENX A;  4IV3 A;  3NMB A;  3VDD A;  1MZF A;  2ZBJ A;  5L36 A;  3V56 A;  1ULC A;  4XIK A;  3BAL A;  3K46 A;  3KHC A;  1W2N A;  3TEY A;  3B69 A;  5FYS A;  4YAR A;  1XSR A;  4MV2 A;  1N1S A;  5BYN A;  4Q4Y 1;  1IKQ A;  1H30 A;  1LHU A;  5F6L B;  4BPZ A;  2Y60 A;  4GZ9 A;  3FUO A;  3I7D A;  3VBS C;  1HB2 A;  2WWS A;  3TNQ A;  3UT0 A;  2BOJ A;  4LKD A;  2W1W A;  1RUF 3;  4PIY A;  4HT1 T;  4Q4V 3;  4XF0 A;  1ZX5 A;  5CKM A;  5LCW L;  1VMJ A;  2XG3 A;  3VV1 A;  4B3N A;  2R06 2;  2XOM A;  4NVP A;  5GM0 A;  5JOY A;  1B35 A;  2ARB A;  4NII A;  5F5I A;  5FZA A;  1UMI A;  1V6M A;  3HT2 A;  1PHM A;  1YIP A;  3DPR B;  4UW5 A;  5L7O B;  3W5M A;  3ZN4 A;  5FBZ A;  4XUT A;  4XFF A;  3FUQ A;  1J58 A;  2OQ7 A;  3GNE A;  3N7L A;  4P5Y A;  4DIN B;  2ENR A;  3ZFF C;  3RZJ A;  1ZRC A;  1HJG A;  2E31 A;  3H3U A;  4QXK A;  2XJT A;  4DUW A;  4DOU A;  4TLG A;  3EQE A;  4CCC A;  3PTR B;  4NOT A;  4YVS A;  2WWJ A;  4UT5 A;  1JHJ A;  1RGS A;  4FPJ A;  3NAP A;  4QPW A;  5FYV A;  5C3Q A;  4NHL A;  1S0I A;  1RUO A;  4MHR A;  2VOX A;  3ACG A;  1RUC 1;  2ET1 A;  2YU1 A;  4PF5 A;  2BGC A;  2P34 A;  3MF6 A;  4M3C E;  3ZN5 A;  2WQ4 A;  4AXO A;  5CU1 A;  1MEC 1;  2WO1 A;  3I97 A;  2R06 1;  1BYH A;  1L7L A;  5JSO A;  5FKB A;  3BTY A;  3I3Q A;  4LBQ A;  3KS7 A;  1O3S A;  2RJK A;  1NG0 A;  1C1F A;  2BWC A;  3NNL A;  1UPS A;  1CON A;  4HK9 A;  1DQ5 A;  1XB9 A;  1POV 3;  3PJQ A;  4OLL A;  1RUJ 3;  2CWS A;  3LQC A;  4CUC A;  4Q4X 2;  3EXU A;  3C8X A;  4S2F A;  4AI2 A;  2HKX A;  3BGA A;  1XOY A;  4GKX A;  4CCL A;  2Y6K A;  5FYC A;  2DUP A;  3LIH A;  4WM8 A;  2VQ0 A;  4MGY E;  3UJO A;  1BBT 2;  1FMD 3;  2AZ5 A;  4GUL A;  4AED A;  3F95 A;  4N43 C;  3O1T A;  4MG2 A;  1CIY A;  3IN9 A;  3PL0 A;  1PIV 2;  5LZ6 A;  1ODM A;  4ASK A;  2FZ2 A;  1AR6 3;  3ZYR A;  1VMF A;  2ZPX A;  4FFH A;  2PEL A;  5JI9 A;  1HV1 A;  1HRV 2;  4QPI A;  4AFD A;  1NLR A;  4CE8 A;  3UNP A;  1H8V A;  1NCR A;  2K0G A;  4W4Z A;  1OOP C;  3RZM A;  1S4C A;  3WD5 A;  5BV6 A;  3I2O A;  1I6X A;  5C6C A;  2VMD A;  4RR3 B;  4Q4X 1;  4CDW A;  3UKN A;  3T2O A;  4CPB A;  4ES9 A;  2D5H A;  3ZDV A;  4FFG A;  5IVB A;  4GH4 A;  4DXR A;  4OUL A;  1UWW A;  2XKP A;  4K1Z A;  5C7G A;  5LEK A;  4BZ4 A;  1DGL A;  3WP6 A;  4B4P A;  1QJY 2;  2HEY F;  4QAW A;  4KQ7 A;  3WQ7 A;  5E16 A;  3FWE A;  1PIV 1;  5CKN A;  1DZT A;  3ITQ A;  4A6O A;  2XWB B;  1JZ6 A;  2DUR A;  1RHI 2;  3SEP A;  3R05 A;  1ZRF A;  1JW6 A;  2GP5 A;  1DGW A;  3H7J A;  2BVB A;  3VBH A;  1FXZ A;  3VHP A;  1TZO A;  5FPB A;  1N1T A;  1EV1 2;  2NP0 A;  4DO0 A;  4P00 B;  2IUW A;  5T5L A;  3N9L A;  3VBF C;  3OG2 A;  4A2U A;  1W9Y A;  4LE4 A;  1W9W A;  4ZZ8 A;  1HRI 2;  3NJV A;  3UK9 A;  1CGP A;  4EN8 B;  3FBM A;  2EIG A;  4Q4W 2;  3NV4 A;  2ZHL A;  1X7N A;  4AL9 A;  5BNP C;  1EP0 A;  1ZZB A;  3O0W A;  5FQ0 B;  1XC6 A;  2DUO A;  2OQ6 A;  2W1Q A;  1NOV A;  1UIK A;  3LDK A;  4QX7 A;  4XZP A;  2Q8C A;  5E88 A;  1UOF A;  3USU B;  1UQX A;  4L97 A;  1YFX A;  2Q0A A;  1AL0 G;  2QDR A;  2QKD A;  1RHI 1;  4E8D A;  3HT1 A;  4IQP A;  1W6P B;  3KCX A;  1BVV A;  3KD4 A;  5KR7 A;  2L9L A;  4LBK A;  1APN A;  3EHK A;  1SPP B;  4N9H A;  5EWS A;  4NIA A;  3WP3 A;  2ZGS A;  1CN1 A;  2ZHK A;  4GXL A;  5FO8 B;  5FOJ B;  4A6S A;  3AZV A;  3J8F 2;  2HWC 3;  2WNU B;  1QH6 A;  2Q8O A;  4OMC A;  4LIU A;  3WNN A;  3WNX A;  4AW7 A;  2X5I B;  4GAZ A;  2WUH A;  2JG8 A;  1TEI A;  5FZ6 A;  1LB2 A;  2D6O X;  1HRI 1;  2Q4S A;  2YY1 A;  4MET A;  4OUE A;  4Q4W 1;  1H8T C;  3U0Z A;  4LBQ D;  3AP6 A;  1VMH A;  2D93 A;  4LUM A;  5ABJ A;  1V6N A;  1MS9 A;  5IVY A;  4CP0 A;  3NNJ A;  2EIB A;  1QQP 3;  3DCQ A;  1GZ9 A;  1BK0 A;  1I5P A;  1NA1 C;  5BNN C;  1EUU A;  5FY7 A;  3E5X A;  2FDK A;  5AFE A;  1S2B A;  1SBF A;  4LR4 A;  5FPV A;  2XPJ A;  4HN0 A;  1B09 A;  2ZML A;  2ADE A;  3MBW A;  1V70 A;  4ITC A;  4MGQ A;  5SV5 A;  5T52 A;  1PGL 2;  1QXJ A;  3J8F 1;  2WLP A;  3JD7 3;  2BDR A;  5CZK A;  3VBH C;  4CCD A;  1UU4 A;  2FQP A;  2RS5 3;  1GAN A;  4ISQ A;  3VBO C;  2XBO 3;  3ZMO A;  4AEM A;  3CJI B;  3S6P A;  4BQW A;  1DIW A;  1LU1 A;  4IEQ A;  1LTE A;  4XUN A;  2ZX2 A;  3WV6 A;  4BJ0 A;  1UX7 A;  1Q43 A;  1NCQ A;  1VAL A;  4IE0 A;  1CAW A;  3OD0 A;  5C8C A;  4CRQ A;  4CPB D;  3J4U H;  1CES A;  1W9T A;  2Q30 A;  3J7N A;  2DTY A;  1OA4 A;  2F4L A;  5I0U A;  2R30 A;  2PYT A;  4JKM A;  3GDB A;  4N90 A;  4WZC A;  3M8L A;  3UET A;  1L7Q A;  2VVF A;  2I74 A;  3CF6 E;  1ZVF A;  3DN7 A;  4O9G A;  4P9W A;  5LRR A;  4E4D X;  3WQB A;  5JLV A;  1YWK A;  2VD7 A;  1CAX B;  4QHO A;  4IEZ A;  2W5F A;  4NWW A;  1RIN A;  1BCX A;  4GQ7 A;  4XPV A;  4FCA A;  3THP A;  5KHI A;  3HQU A;  4QX2 A;  4XMA A;  5F3I A;  5C9A A;  3FFZ A;  5FZG A;  1RMU 2;  2D3S A;  1OQ1 A;  4WV8 A;  1GMM A;  4IE6 A;  1A34 A;  3PNA A;  4CEY C;  3JUU A;  1MVQ A;  1P8J A;  1OVS A;  1XNA A;  1QJX 3;  3WG1 A;  3ZKU A;  3KWV A;  1OI6 A;  3N4M A;  1PZ8 A;  2QQP A;  5DZG A;  1YQ2 A;  5ABJ C;  5FZO A;  4LT5 A;  5A1F A;  4CSW A;  2BYV E;  4RR3 C;  2VPV A;  3VHN A;  4COY A;  3AKP A;  3ZVX A;  1ASJ 1;  1RVF 1;  2K9Z A;  4EWE A;  4HSJ A;  2RDN A;  4PBO A;  3WNP A;  1BLZ A;  1FOD 2;  3SC7 X;  1LOG A;  2QQL A;  3T09 A;  4OYU A;  5JXG A;  4R8H A;  1JYI A;  4YW4 A;  4OI1 A;  2EAK A;  3A21 A;  4H2A A;  5FCC A;  5FZB A;  4G3Y C;  2BBV A;  1SCR A;  5J7M A;  4FXK B;  4YW6 A;  1A8D A;  2BBA A;  2XWJ B;  3KM5 A;  1ND2 C;  4JTO A;  1RMU 1;  2HWE 3;  1IS5 A;  1UO9 A;  1KDK A;  3RFR A;  5GLW A;  1L3J A;  2ZX3 A;  4HK8 A;  1N1V A;  1R09 1;  2W1S A;  4DQA A;  2VNV A;  4JZR A;  3I3E A;  3SNM A;  1GV9 A;  1PO2 2;  3CEW A;  3ALQ A;  3H1W A;  4HVR A;  4JCK A;  1CX4 A;  4DZG A;  3WG2 A;  4E9K A;  3APB A;  3VD5 A;  4AFB A;  3OGR A;  1A8M A;  1G9F A;  4HET A;  2WQZ C;  4ARX A;  1D4M 3;  2DU0 A;  4UW3 A;  4X6R B;  3ZXG A;  2JD9 A;  4EZ4 A;  1ND3 B;  1ZZ7 A;  1O59 A;  1W8Z A;  3RMX A;  4P02 B;  4DY5 A;  2O0O A;  1Q5O A;  4YRD A;  4RQP A;  1XNC A;  5FOB B;  2ZX4 A;  4LKF A;  1UW8 A;  2RR1 3;  2TBV A;  2JG9 C;  5CKQ A;  3WF3 A;  2WQ8 A;  1GP5 A;  1OLM A;  2QQI A;  4IUG A;  4NWV A;  1MS0 A;  4NHK A;  5H9P A;  3BPZ A;  3H8O A;  4FXG B;  5F3E A;  1YQ8 A;  5A32 A;  1D2Q A;  4XCA A;  4DPN A;  2XL7 A;  1QJZ A;  3HNY M;  2PHT A;  3O12 A;  3WSO A;  2WIN B;  2BP6 A;  3H8U A;  3H42 B;  1ZRE A;  4A44 A;  3OPT A;  1WW4 A;  3AP5 A;  1PO2 1;  4UF0 A;  4W6Y A;  5LA9 A;  3B9C A;  4XHX A;  5BNN B;  5BNQ A;  4BH9 A;  5C3S A;  4R9B A;  2Q1Z B;  4HPK B;  1VB2 A;  3LAG A;  2WT1 A;  2F6B A;  2JDA A;  3ME2 A;  3DKW A;  2JXA A;  1W0P A;  5IVC A;  1OH3 A;  3PIJ A;  1V00 A;  5CFC A;  2RG4 A;  3AVS A;  3NWK A;  3D8C A;  1HN1 A;  4H7L A;  4TWT A;  2HYK A;  2ORZ A;  2VUJ A;  4UXA A;  4DRV A;  5I0S A;  1IS6 A;  3WLU A;  3B02 A;  1W39 A;  3CZJ A;  4XF3 A;  5FJK A;  4BA6 A;  4J1X A;  1DLC A;  5JR2 A;  2QQM A;  2UY8 A;  2Z69 A;  2XVL A;  4XYX A;  4HN1 A;  2VO5 A;  3UKT A;  4FTS A;  2HYX A;  1WCK A;  5F5A A;  1BJQ A;  2JDY A;  3I59 A;  4YPJ A;  5C4W B;  2J22 A;  2ZEZ A;  2R07 3;  3DV8 A;  4LUK A;  5FBJ A;  3MLL A;  5F6K A;  5J37 A;  1RJ8 A;  4N7U A;  2W2I A;  4A7K A;  2CYF A;  1W99 A;  2RE9 A;  3S7E A;  1LHO A;  2X10 A;  5KXD A;  1WMD A;  3K48 A;  3QD6 A;  3SQO A;  2YDE A;  1DP0 A;  2WT2 A;  1W9S A;  5EPA A;  5BUV A;  3CJI C;  4PCR A;  1JZ4 A;  1JHN A;  4WVM B;  4ASM B;  2EXI A;  3JQX A;  4KG0 A;  1Z7S 3;  2VVE A;  1PGW 2;  1JYV A;  5D8A B;  4LOT A;  3WY6 A;  3HBK A;  3I4I A;  1CIW A;  2W91 A;  4RFR B;  4WBB A;  1XYO A;  4XTP A;  2KD7 A;  4BU2 A;  2A70 A;  4E4Z A;  4EYU A;  5J1X A;  3VLB B;  3AVR A;  2QQN A;  1H4H A;  2WO7 A;  4D3W A;  3BIW E;  4GWJ A;  4QM8 A;  2VVD A;  1LOD A;  5KHJ A;  2Q1F A;  3T4H B;  1C8M 1;  3ZXJ A;  2OA2 A;  5C5T A;  1V0A A;  2R04 3;  3IDA A;  4RSU A;  3C7O A;  1KS4 A;  3H9A A;  2VGD A;  1QDC A;  1QJE A;  2R49 A;  3WNM A;  4PDW B;  3P3N A;  3POW A;  1NY7 1;  1UD1 A;  3T1L A;  2GC1 A;  4UYB A;  1RUD 3;  4FFI A;  1O8S A;  3AB0 A;  1MQT A;  3IT8 A;  4QPG A;  4TYS A;  1CQ9 A;  2DV9 A;  2PHF A;  3OY8 B;  1H1A A;  1PGW 1;  2VW1 A;  3EB7 A;  4RS5 A;  5A33 A;  2YG0 A;  3VBU B;  4CDU C;  3O1V A;  1MS3 A;  2EXH A;  3U1X A;  5KXC A;  4XDQ A;  3I3D A;  3CL1 A;  4I0W B;  3CMG A;  4EJR A;  1Y4W A;  4QWN A;  5FPA A;  1K5M B;  3Q8C A;  3KQ4 B;  3S30 A;  3A0N A;  4X8P A;  2RM2 1;  3BOP A;  2ZHM A;  4PIZ A;  4XJA A;  5BXX A;  2VL4 A;  5JWP A;  2WR9 A;  5EHD A;  1OPO A;  1R1Z A;  3IDB B;  5FY9 A;  2QJV A;  2MPF A;  2VM9 A;  4CCN A;  2P17 A;  1XNB A;  2HWB 3;  3BVC A;  1DG6 A;  3IWZ A;  4DY3 A;  1GQG A;  2G19 A;  2J1S A;  4MLO A;  3S5Q A;  1RXF A;  4CDX C;  3TN9 3;  1REF A;  2DCZ A;  2J1V A;  1QU0 A;  4XQW A;  4YFZ A;  4FVV A;  3LPG A;  3UKV A;  1CD3 G;  3ZXL A;  3KGL A;  3IAP A;  1X9T A;  2A6Y A;  1FAT A;  1FAY A;  3LD8 A;  5FZ4 A;  5FDB A;  2Q8D A;  1UU6 A;  3WDT A;  1IS3 A;  2QDN A;  4CXW A;  3OBA A;  3MV1 1;  1LHN A;  4C1X A;  4LO6 B;  1HQW A;  1ZBA 2;  3MGU A;  3PU3 A;  4K8R B;  4DUX A;  2PHL A;  4EN0 A;  4C8D A;  1J3R A;  2D44 A;  5FP8 A;  2IXL A;  1IPJ A;  3C7G A;  4HVQ A;  3FN9 A;  1CAU B;  2VAU A;  2ZMK A;  1GFF 2;  3ACL A;  4M3C F;  4OZO A;  3VBR A;  1ULE A;  3DF0 A;  2WZ8 A;  4YW5 A;  2VC9 A;  3SMH A;  1XE7 A;  3J26 N;  3ZFG B;  3WDY A;  1BXH A;  4CP9 A;  1DYO A;  3D5O A;  1YCI A;  2VMG A;  1D0G A;  2W47 A;  2RJ2 A;  4WVV A;  2LUW A;  4XFB A;  2DVG A;  4BQ3 A;  2PN5 A;  1VBD 3;  3NJX A;  2WZR 1;  1Q8V A;  4N9I A;  2C1F A;  3VKN A;  3MZH A;  3OYW B;  2P1B A;  1KFU L;  2XLF A;  5T5O A;  1C8N A;  1HV0 A;  2VCB A;  4P9Y A;  5ERL A;  4HAN A;  4AE2 A;  2E33 A;  3RZG A;  5GLU A;  3H1Y A;  1ZZ6 A;  1ZBA 1;  2MHF A;  4BOW A;  4IV1 A;  1EAH 1;  4QQ2 A;  3JBG 3;  1VBB 3;  1NLQ A;  3R0R A;  2Q5T A;  3BYW A;  3R4S A;  1NZI A;  1ENQ A;  4HBN A;  4LJH A;  4O7X A;  4RGA A;  3KMH A;  1W6N A;  3ZIX A;  4ZZ5 A;  3ZR5 A;  1W06 A;  4WM7 C;  5APA A;  4QKD A;  2A71 A;  3VBS B;  4BLI A;  1CWP A;  1KGY A;  2HWF 2;  2VJX A;  5A3W A;  2XGX A;  1H6X A;  1DQ2 A;  3SKV A;  2BVV A;  3PJY A;  3WF2 A;  1PVC 1;  2E63 A;  4XC9 A;  4ZU5 A;  2RMU 3;  5BNO A;  3ZOI A;  3ZSK A;  5I8T A;  1JOP A;  1Y9Q A;  4NID A;  4XAB A;  3M4F A;  4TN7 A;  3ZYJ B;  2ZGU A;  2D7F A;  1VLN A;  3B94 A;  1YRZ A;  2FMY A;  2QBX A;  3THC A;  4FOY A;  3AZW A;  3VKO A;  1JUH A;  1S1A A;  2CV6 A;  3DGT A;  5FO9 B;  1R08 3;  3AFG A;  2VXJ A;  2GMM A;  3N9N A;  1JYN A;  2B9V A;  3WDV A;  3ZFF B;  4FP3 A;  5A7Q A;  3WR0 A;  1RUE 3;  2E9Q A;  2QUO A;  4COU A;  1X8E A;  2J1R A;  2RHP A;  4XF1 A;  5LY1 A;  1RUG 3;  4HXC A;  2Z42 A;  2VW0 A;  2FBE A;  4RGG A;  1RUH 2;  2GN7 A;  2WNV B;  3AXD A;  3KCY A;  2ZAH A;  2YBS A;  2HWF 1;  1DYK A;  3WNO A;  1ULF A;  5FLH A;  4NPL A;  2R1D A;  4A45 A;  2B39 A;  5FJH A;  1COV 2;  1SMV A;  1VAK A;  5DUV A;  2BTV C;  3W59 A;  3DYP A;  5FY1 A;  3OPW A;  2ZMN A;  1LES A;  1TME 3;  4D6Q A;  2JDH A;  5EV7 A;  1AXK A;  1AX0 A;  2DBI A;  5T5J A;  2D3R A;  3N9O A;  3NL1 A;  2ZAB A;  5FY5 A;  4FOV A;  3WT3 A;  3TRS B;  3DEC A;  1DDL A;  4N8M A;  5FXX A;  3O0X A;  5IW0 A;  4P9X A;  4C91 A;  1WMX A;  5GZF A;  1HB1 A;  5FZH A;  4FPE A;  4JV4 A;  4QX8 A;  1Q56 A;  4PDW C;  1AR7 3;  3ACI A;  4ZHN A;  3AX4 A;  1TG7 A;  2EAL A;  2YC0 A;  4XET A;  2ZTN A;  2NMO A;  4KU7 A;  1AYN 1;  5FMO S;  3RNS A;  1J3Q A;  4YZ2 A;  3AL6 A;  3OEA A;  1RUH 1;  2QQW A;  3ECQ A;  4AI1 A;  1IHM A;  2WFF 3;  1US3 A;  3I8T A;  3VBU C;  1VBC 3;  4YVW A;  2W52 A;  1DF0 A;  3T2Q A;  1WBL A;  4RFT 0;  1N3P A;  1SBE A;  3MW2 A;  5IK5 A;  1WCS A;  5FFO C;  1CPN A;  3O0V A;  5A80 A;  5DUW A;  5HV0 A;  2GH8 A;  2PFW A;  1X82 A;  1JI6 A;  1OOP B;  2E26 A;  1UKR A;  4LBJ A;  1ULP A;  4RL7 A;  2RS3 3;  4Y20 B;  4ES8 A;  5FZM A;  3AYA A;  4NR1 A;  1O3R A;  4PQQ A;  1RL3 A;  2RS1 3;  4Q1R A;  3W21 A;  2W1U A;  4AVB A;  1FX5 A;  4H7M A;  4JHT A;  3KLS A;  3PLQ A;  4QX5 A;  4DXS A;  2G1M A;  4AAP A;  3K4A A;  5DAW A;  3ZIW A;  3KHB A;  4QKN A;  3PUQ A;  3KB5 A;  5GZG A;  4NRQ A;  1RUF 1;  4Q4V 1;  1VAV A;  1VRB A;  4G4F A;  3FLR A;  4LIV A;  4CUA A;  3BCW A;  4JGY A;  4CP2 A;  3TNP B;  3MO4 A;  5A6Q A;  1WLW A;  1W3X A;  1C1L A;  1ZA4 A;  1SAC A;  1UIJ A;  2VXR A;  2DVD A;  1CJP A;  4FFF A;  3U78 A;  3LWC A;  3GYD A;  4ZON A;  2Y8K A;  2W46 A;  3QOP A;  2IXJ A;  3FLP A;  4YNI A;  5C71 A;  3FHI B;  2NLR A;  3FX3 A;  1I5Z A;  3ZFE C;  4LK6 A;  5JSR A;  3CJX A;  1OQE A;  4A41 A;  4AVS A;  2HWD 3;  2J1T A;  1RED A;  3FHA A;  3LEM A;  4MO3 M;  2D6P A;  5GZD A;  5FZ7 A;  2VOT A;  1GKB A;  4OMD A;  5BNP B;  3QLQ A;  3HN1 A;  1WGP A;  1G86 A;  1PNF A;  2JDM A;  2BPA 2;  3KT4 A;  3N9P A;  4L2N A;  4AGG A;  4ATF A;  1AR6 2;  1G9D A;  2JIJ A;  2YB7 A;  1JZ3 A;  3HNM A;  1XSQ A;  3WF4 A;  4XHB A;  3JZV A;  3LE0 A;  1R1A 3;  3M3I A;  4OZX A;  4CUB A;  2IXI A;  2VZ1 A;  3A4U A;  3RZZ A;  2Y38 A;  1POV 1;  1V6L A;  1U12 A;  1RUJ 1;  1D0H A;  1QOS A;  2EIC A;  1U5Z A;  1V9U 3;  3KV6 A;  3QCW A;  2ARE A;  2GDF A;  4QPI B;  4Z1V A;  5CFD A;  5KXE A;  4COW A;  1G7Y A;  4CCE A;  5FWE A;  5LY2 A;  3PUA A;  1FMD 1;  1WBF A;  3RRD A;  2P4E A;  3FC0 A;  5L9B A;  3N9M A;  4JC1 A;  4KH9 A;  4PF1 A;  4EN9 B;  4Y1U A;  5FZE A;  1H8T B;  2QE3 A;  5KHH A;  1RUC 2;  2ZS6 B;  2O1Q A;  4LPL A;  4NHX A;  3SH4 A;  3V64 A;  1W03 A;  4GH4 B;  1KJR A;  1AR6 1;  1MEC 2;  3NRU A;  1NXD 1;  4ZY9 A;  5LA0 A;  4XAA A;  5FP4 A;  4Z2A A;  3J7M A;  4K8F A;  2EXK A;  4GIQ A;  1UMZ A;  2HBT A;  1W2U A;  1NA1 B;  2XQR A;  3LFI A;  2QQU A;  4M0H A;  4IEY A;  4MOA A;  1X8M A;  2A6V A;  2CHH A;  3AJY A;  4K40 A;  5HCB A;  5A3O A;  1H9W A;  2QQK A;  1SLC A;  2YMZ A;  4UI9 L;  3UES A;  4E4H A;  1S0E A;  1VRH 3;  2VW2 A;  1NKG A;  3LSE A;  3Q8B A;  4BIO A;  2GSY A;  1PX3 A;  2DYC A;  4SBV A;  4JDO A;  1S2E A;  1G9B A;  3LB9 A;  3VBH B;  1GR3 A;  1YJL A;  1HN0 A;  3VBO B;  2IXC A;  2WNV C;  2NM1 A;  4XE9 A;  4RD7 A;  5F5Q A;  1PM7 A;  2A6Z A;  2ZGQ A;  5F8P A;  5JZG C;  2LM3 A;  2YFU A;  3N9Q A;  1WLC A;  3CDZ B;  4L99 A;  3GCW A;  2AEZ A;  1UKG A;  2B4K A;  2DCK A;  3L9J T;  1W6O A;  4FI9 A;  4QKB A;  2VBD A;  5AVP A;  3RJR A;  4J1W A;  2Z79 A;  3LCP A;  1TMF 3;  5GLT A;  3HQX A;  4XQ4 A;  2BNN A;  4CA9 A;  4HVO A;  3B9I A;  4ZKT B;  4M00 A;  2VH9 A;  2VUA A;  2I07 B;  2B5H A;  3AZX A;  5A1L A;  2HWC 2;  4FAG A;  2ZZJ A;  4IV3 C;  3VDD C;  1UPI A;  5LAS A;  1PMJ X;  4BB3 A;  1D7P M;  5C5U A;  2E53 A;  4W6X A;  3VD3 A;  4OUM A;  4QQP A;  4Y3O A;  5A3L A;  5C33 A;  4XUO A;  1X33 A;  2UU8 A;  4Y5S A;  3OPZ A;  2WJS A;  4YZ3 A;  1ZNP A;  2WYS A;  3NW4 A;  1HDK A;  4IXL A;  4XBQ A;  5FRE A;  2VZ3 A;  5IHR A;  1VIW B;  4LA2 A;  2BGO A;  2E7Q A;  1XND A;  2IZW A;  2NZ9 A;  2XON A;  3POS A;  2PHU A;  3POY A;  2W68 A;  3UGH A;  4CEY B;  4Y5Z 0;  4YW3 A;  1LEC A;  1I9R A;  5HCA A;  2DBN A;  3M1H A;  4QGN A;  4WVZ A;  1IPK A;  3FL7 A;  5ABJ B;  2WNO A;  4BQ1 A;  2VTX A;  4XJZ A;  4PT6 A;  1B35 C;  2D6K A;  1Z0H A;  1W8W A;  5C3O A;  2ERF A;  3I54 A;  1QGL A;  5JOX A;  2X09 A;  5FZF A;  3WW3 A;  4C0B A;  4Y4R A;  2HWC 1;  3O1P A;  3JD7 2;  2ZGP A;  3ACF A;  2HBU A;  2XJR A;  5HXM A;  3H50 A;  1LGN A;  4HMZ A;  4XXA A;  1OFS A;  3ZMN A;  2CNA A;  1PK6 A;  3INA A;  1RUI 3;  3SLI A;  5FUP A;  2MNG A;  1AR8 3;  1GYK A;  1OF3 A;  1U0A A;  2YUE A;  4EQV A;  2VE1 A;  3FE5 A;  2AAC A;  3VB9 A;  4AI0 A;  4DIQ A;  3IM0 A;  4YVS C;  3IDC B;  1ND2 B;  2VBP A;  3KV5 A;  5F32 A;  5AC9 3;  3RSJ A;  3NAP C;  1OXC A;  2ARA A;  3ON7 A;  1QQP 1;  3KV4 A;  2Z5W A;  4M0N A;  4C0H A;  1M06 G;  2X53 S;  4XQD A;  2VR4 A;  2TEP A;  3EJK A;  4GWI A;  3BU7 A;  3IAQ A;  3NKG A;  3WF1 A;  4Z2W A;  5J48 A;  4LA3 A;  5LB6 A;  3M7A A;  3O14 A;  1CAW B;  4NJ4 A;  5FWJ A;  1DGR N;  3PIG A;  3T0D A;  2G9G A;  5IVJ A;  3ETQ A;  3LKJ A;  3H3L A;  3AP7 A;  3JD7 1;  4LQR A;  1ODN A;  2JE7 A;  3PUH A;  1AX1 A;  4XDP A;  4BDV B;  2Y33 A;  2RS5 1;  3DPR A;  3I2F A;  2XBO 1;  5DQ0 A;  2DF7 A;  5L7O A;  1O4T A;  4I3P A;  4D7S A;  5GJ6 A;  5K0U A;  2ZGO A;  2P6C A;  4Y5T A;  4CP1 A;  1EUT A;  1O91 A;  1JS9 A;  2JG9 B;  4WM8 C;  3DYO A;  4AED C;  4Q27 A;  4QGL A;  4MVT A;  2DCT A;  1OD3 A;  3DKQ A;  2WSV A;  3Q9O A;  5EJZ B;  2B8M A;  3PME A;  5C9A B;  3OUI A;  4EWD A;  5HCF A;  3AJZ A;  3H0O A;  3ZLI A;  3CNA A;  2WS9 3;  1UZZ A;  1W90 A;  2XJQ A;  3VN4 A;  2JWP A;  2ZEW A;  4JGZ A;  4QPI C;  1LNS A;  1FYU A;  1NCR C;  1VAM A;  3D0J A;  1JTZ X;  4D7Y A;  1XRU A;  5DDJ 3;  3ZYF A;  1ACC A;  3ABZ A;  3AYE A;  3GHN A;  2DUQ A;  2P3K A;  2OUH A;  4CDW C;  3AM2 A;  5FZ8 A;  3CLP A;  5JSP A;  4TZD A;  2PA7 A;  2DU1 A;  2NMN A;  3URF A;  3LA3 A;  4P9L A;  4HOO A;  1E5I A;  4GH4 C;  1DQ0 A;  4QDQ A;  5GAL A;  1GNY A;  3K3O A;  1WUV A;  1C5I A;  1J3P A;  1QJU 3;  2HEV F;  2YGM A;  3LSD A;  3MIC A;  4EE2 A;  1WCD J;  1LHW A;  3HEI A;  1QJX 1;  1QIQ A;  4GJZ A;  5DUX A;  4YGB A;  4IGO A;  3HD8 B;  2A6W A;  1LUL A;  3OD4 A;  2ZCW A;  4CYD A;  4YGC A;  3POE A;  1BBT 3;  4LO4 B;  1UYX A;  1WW6 A;  1D4M 2;  3U4X A;  1F5F A;  4N53 A;  3ZPO A;  3E1F 1;  4QGM A;  3SH3 A;  3VDB A;  2JEM A;  4YG6 A;  2Q8E A;  3VKL A;  3POB A;  3AKR A;  5JXJ A;  2ILM A;  2FCT A;  5FYI A;  5CIS A;  2YBK A;  2RR1 2;  1O7F A;  3VGI A;  2KR2 A;  1PGS A;  1CZS A;  1HRV 3;  1LAJ A;  2EF6 A;  3Q8F A;  5FO7 B;  2R7E B;  1W8O A;  2HWE 1;  2VG9 A;  3BN6 A;  2B9U A;  4H14 A;  4XBL A;  1TQ5 A;  1OT5 A;  3K4D A;  4RQP B;  1Q8O A;  1OUS A;  5IJR A;  2HH9 A;  1BMV 2;  4YM1 A;  1OVP A;  4WVW A;  5FUI A;  1HIX A;  5HV4 A;  2P5B A;  1XE0 A;  4FPH A;  3N35 A;  4B1L A;  4QDR A;  1AVB A;  1ASJ 2;  1RC6 A;  1RVF 2;  2LRP A;  2PHD A;  2VQT A;  4IEV A;  4NPM A;  4YM0 A;  5DAP A;  5A32 B;  3S7I A;  2JDN A;  4PQ9 A;  1OSG A;  4FPG A;  5A3M A;  1WLT A;  1D4M 1;  2LRO A;  4JQR A;  5FXV A;  5KBF A;  5LEJ A;  1OQD A;  1QJY 3;  2ES3 A;  4Y1Z A;  4KGQ A;  4QB1 A;  3AKT A;  2QCS B;  3HIF A;  5KHG A;  1V6I A;  2RR1 1;  4W6W A;  3RYR A;  2GC3 A;  4LNV A;  1LOE A;  4KBB A;  3RZH A;  1UZ0 A;  3MFA A;  4YW7 A;  4CDU B;  4YM3 A;  2JG8 C;  4QT6 A;  4CCO A;  3UYJ A;  3OJB A;  1R09 2;  2XHK A;  3QBQ A;  4YW1 A;  5F39 A;  3NV1 A;  1JYC A;  4IEP A;  3NV3 A;  3WCR A;  1BMV 1;  1EV1 3;  4YGE A;  1W05 A;  3VDC A;  4BE3 A;  5BY5 A;  5FMC A;  4ISR A;  2UYB A;  1E5R A;  1CZV A;  1UYZ A;  3Q8E A;  3PHM A;  1Y7B A;  1VJ2 A;  2R07 2;  4XF4 A;  3RZK A;  2LAL A;  3MEP A;  3SHR A;  3LOB A;  3WG3 A;  4R4Z A;  4HKW A;  4AK3 A;  4BYY A;  2ZGK A;  1ZZ9 A;  3EMR A;  4MXW B;  1W6P A;  3I59 B;  2VUC A;  4Z82 A;  5CVR A;  1S0G A;  1YQC A;  3ASI A;  3GZE A;  3KSC A;  5H9R A;  5AFB A;  3A7Q A;  3ILN A;  4CDX B;  1WWY A;  3OGV A;  2WO3 A;  2D6M A;  1H0B A;  2ZJC A;  3AZZ A;  3MI8 A;  1C5H A;  4NIG A;  2WNU A;  1IG3 A;  2JDK A;  3L2Y A;  1X50 A;  5DXD A;  1QNY A;  4Y26 A;  1LRH A;  2X5I A;  5E8A A;  3VZM A;  4FQZ A;  2LTN A;  1HB3 A;  1CR7 A;  2YC4 A;  3CU7 A;  4YZ1 A;  4FBF A;  4LTA A;  5FY4 A;  2J1A A;  1NCQ C;  4I0B A;  3ZDS A;  1LCL A;  2R04 2;  5C8C C;  2R07 1;  2V5D A;  5CYY A;  1KQR A;  4PLO A;  4UFJ A;  2EVX A;  3R6S A;  3OUJ A;  4HSL A;  4XBN A;  4MGZ E;  3ZPY A;  1Y9M A;  2D5F A;  3RPQ A;  1O3Q A;  5EYX A;  3WW2 A;  1US2 A;  3JCI A;  2IXK A;  5EYY A;  1AHS A;  2PMW B;  4QHZ A;  5FYM A;  4MXV A;  3T3Y A;  1Z7S 1;  1FT9 A;  1BEV 3;  4IET A;  2VMC A;  2AYH A;  2DCY A;  3I2G A;  4D0Q A;  2ZOE B;  4IEO A;  4R9C A;  1G8W A;  1UZY A;  5FZC A;  1AJK A;  5C9A C;  4QB6 A;  1QEX A;  4LO7 A;  2WNE A;  2PAK A;  2ZHN A;  5HXV A;  3WX5 A;  1AL2 3;  5IT6 A;  3G7D A;  4KGG A;  4RHV 3;  2BW8 A;  2R04 1;  5LA1 A;  1H6Y A;  2C9A A;  2BNO A;  2BWA A;  2HLE A;  1JOD A;  2V72 A;  4JAA A;  4URA A;  2XVK A;  1TNF A;  2FDG A;  2HWB 2;  1W9F A;  3ILR A;  3WG4 A;  2AGS A;  1T6B X;  4LKS A;  1UY0 A;  3QAC A;  5F2S A;  5FUN A;  3WQ1 A;  3ZKY A;  4AOC A;  4YG0 A;  1RUD 1;  1QXR A;  1UY2 A;  4WM7 B;  3SEE A;  5KC6 A;  1W6M B;  4LUL A;  3RQ0 A;  3ZSL A;  5LK7 B;  5D21 A;  3WUC A;  3O1O A;  3M70 A;  4L11 A;  1ZA7 A;  2IVI B;  4NHM A;  5EZW A;  5CG9 A;  1CAX A;  4BQY A;  3GZT B;  2FDH A;  3CQO A;  1NLS A;  1C8M 2;  1ZBE 3;  3VZN A;  2PAM A;  3CIH A;  3O1R A;  1QOO A;  4MGS A;  3HWJ A;  5FRA A;  2AUY A;  4I3G A;  2D40 A;  4QU2 A;  4MGK E;  1JH5 A;  4JKL A;  4W65 A;  5FPX A;  2W0X A;  3GBG A;  4XFA A;  4PI2 A;  1NY7 2;  3ILF A;  3IB3 A;  4P08 A;  2HWB 1;  4DXT A;  3SXW A;  3T0A A;  3TEX A;  1C57 A;  3SIT A;  4ZXE A;  2R0H A;  2ZXQ A;  4AVA A;  3TN9 1;  2VZV A;  2ARC A;  5T55 A;  1OHF A;  1AYM 3;  4QQO A;  3WVJ A;  3ZXK A;  4BIS A;  5I0R A;  3DEM A;  2JB8 A;  5JIU A;  2A3X A;  5IK7 A;  5FZ3 A;  2Y0O A;  4RQP C;  3VBR B;  1EYB A;  2A5Z A;  2WAB A;  4F7Z A;  1VBD 2;  2BZD A;  2W9X A;  4LHK A;  4O65 A;  4FTB A;  1LEM A;  1Z78 A;  5G05 L;  3WOG A;  1VP6 A;  2RM2 2;  3NJZ A;  4CP9 B;  1W2A X;  1O3T A;  2O8Q A;  4XFH A;  4EN6 B;  3O1S A;  3VD7 A;  4AFM A;  1IQD C;  2ETE A;  1FOD 3;  2CU5 A;  1Q8P A;  2CAU A;  1PZ9 A;  2ID4 A;  5JXI A;  1JZ8 A;  3J9S A;  1JU4 A;  3CZU A;  4GMP 0;  5EJ3 A;  5SV8 A;  4M01 A;  1IQA A;  1LED A;  2VCA A;  1XJA A;  3KV9 A;  2UWB A;  2Y6L A;  4D6R A;  3OBZ A;  2YRO A;  2YC2 A;  1S0J A;  4FP2 A;  4IV1 B;  1A6C A;  1PZ7 A;  3HOB A;  3LOI A;  4AVC A;  4YM2 A;  3N7M A;  4M4P A;  3RI8 A;  4IER A;  3AMP A;  4DMI A;  5CFC C;  1NQD A;  2W94 A;  1GZC A;  3AMN A;  2JDU A;  4A4A A;  1ND3 A;  2RMU 2;  4KNC A;  5JVV A;  4AGR A;  4MGT A;  4P14 A;  1VBD 1;  4ZU7 A;  1LHV A;  1AXY A;  2BFU S;  3POF A;  1J59 A;  2GP3 A;  1ST8 A;  1GQP A;  1UZW A;  1R08 2;  4EZH A;  5BNO B;  3SKJ E;  3GF6 A;  5FPU A;  1RUE 2;  2WA4 A;  3WF0 A;  3JBG 1;  1VBB 1;  3GCX A;  5DUU A;  1FPN 3;  3O5S A;  1UOB A;  5HCH A;  2QQV A;  3VL8 A;  3TBD A;  2IC1 A;  3V0A A;  5IAX A;  1LJ7 A;  1D4V B;  2CL2 A;  2Y6J A;  3FJS A;  4P9I A;  5IWF A;  3ZYI B;  4BCU A;  1G6N A;  4N7I A;  3BI3 A;  2WZR 2;  1AX2 A;  1OMI A;  2OII A;  1H1I A;  2Z2S B;  3HNB M;  4I0A A;  2RMU 1;  3I3M A;  1ZRD A;  3ENR A;  1G9A A;  5A6X A;  1GZW A;  1XE8 A;  1VBE 3;  2YV8 A;  2ZGL A;  2ZAA A;  1CVN A;  3IPV A;  3THT A;  3V0B B;  1MZ6 A;  4LLF A;  1XNT A;  3DXT A;  5JMO A;  1EAH 2;  2VMH A;  1R08 1;  3ZFE B;  1RUE 1;  1AR7 2;  1NYW A;  3VZL A;  2XKO A;  1WMF A;  4XVH A;  3U4S A;  5CB7 A;  5A3N A;  1RUG 1;  1SG3 A;  3SCH A;  5FPZ A;  5C4W A;  3IMM A;  4Q0S A;  4S2G A;  4RYD A;  4AEK A;  5DAB A;  1DZR A;  1STM A;  2WA3 A;  1FV3 A;  3HAG A;  4YZ5 A;  2BV4 A;  1VBC 2;  3GBW A;  3MIG A;  4UFK A;  3I2D A;  3AXE A;  4W8J A;  3WQ0 A;  1XQN A;  4Y24 A;  3OB8 A;  1PVC 2;  4XIL A;  4IEU A;  1MQT C;  1S0B A;  5E6H A;  5GLZ A;  2BQP A;  4QPG C;  1TME 1;  2OPW A;  5EXO A;  2BRT A;  2XR4 A;  1DU3 D;  4R9D A;  3T1M A;  2OS2 A;  3LEK A;  4CVU A;  4RS5 C;  4CXX A;  2XB6 C;  4IE5 A;  4D8M A;  4FAH A;  2WRA A;  3MF9 A;  1GBG A;  2NPI A;  4CDQ A;  1GWM A;  2RS3 2;  2GMP A;  1JMU B;  1HXS 3;  4QU1 A;  5D8A A;  5FMD A;  4ASL A;  3RGB A;  3FMG A;  4HZF A;  1VBA 3;  1MS1 A;  3U10 A;  2RS1 2;  1WKY A;  5CIR A;  1AR7 1;  1SLT A;  5DG1 A;  4YYO A;  2CSG A;  1AXZ A;  5JXH A;  1H2N A;  2JKB A;  1J1L A;  5CG8 A;  4OUS A;  1QHD A;  3IBM A;  3UGF A;  4AI3 A;  2GZW A;  2WFF 1;  3OGG A;  1VBC 1;  1W6Q A;  1WZX A;  2VME A;  4AWD A;  5JIA A;  1I1E A;  1HQN A;  1KD7 A;  4XF9 A;  5EJ1 B;  1QMJ A;  1SEF A;  4COZ A;  4ZPI A;  2H6B A;  4TTG A;  1OLM E;  3WDX A;  5CEH A;  1ZZ8 A;  4CU6 A;  4Y1X A;  1BK1 A;  3GZU C;  2BJS A;  1S0D A;  2PAE A;  3OY8 A;  3WHU A;  3VL9 A;  5F2W A;  1LOC A;  2RS3 1;  3ZM8 A;  5GLV A;  2ARX A;  4M3C A;  4JRL A;  5CBL A;  5D1I A;  3WW1 A;  2EXJ A;  1YFW A;  4DNY A;  2RS1 1;  2A7A A;  4PJY A;  4Y22 B;  1K5M A;  4YSF A;  4B29 A;  3LZZ A;  1AYN 2;  5EP9 A;  3ZN6 B;  5HBA A;  3VD9 A;  2Y0I A;  2AR6 A;  4GMP 3;  3MYX A;  1WD3 A;  1W8U A;  4IL7 A;  1Y43 B;  4IW3 A;  3M3O A;  5JZG B;  2XDV A;  5K7P A;  3VBR C;  1BVP 1;  3VDA A;  4BWO A;  5JCT A;  2WZE A;  5HPO A;  2B42 B;  4FOW A;  1DBN A;  1GQH A;  3RVH A;  5TSW A;  1N1Y A;  4FQ4 A;  3III A;  5LBB A;  4I01 A;  3MIB A;  3ZYH A;  1YYN A;  4RN5 A;  4CEW A;  1QDO A;  5LBE A;  1YXW A;  2I45 A;  2VQU A;  4JQT A;  1PM4 A;  2ZGM A;  4KBZ A;  3MV0 1;  2FCU A;  4IV3 B;  3OTF A;  3VDD B;  4GAL A;  4FSJ A;  1F9K A;  3LIG A;  3ZSM A;  4BQ4 A;  4DS0 A;  1DQ1 A;  1LOF A;  3K4Z A;  1RXG A;  2HWD 1;  3WCS A;  1GOF A;  2KM2 A;  4IV1 C;  1T2X A;  2D6L X;  3WNL A;  1WCQ A;  1RUF 2;  1U5Y A;  1UY4 A;  4GB3 3;  4Q4V 2;  4D7T A;  3VUO A;  4JKK A;  3TWI A;  1UOJ A;  4OQ8 A;  1GNZ A;  1CAU A;  2ZEX A;  2VTX J;  1AR9 3;  4IE7 A;  4FPY A;  1R1A 1;  4XAE A;  3JQW A;  3H7Y A;  3MW4 A;  1OBN A;  3B00 A;  2EIE A;  4JTN A;  3ZFG A;  3OCP A;  3CKH A;  5L9R A;  1B35 B;  1V9U 1;  5CNA A;  5G04 L;  5BNO C;  3PUR A;  1VRH 2;  2CGN A;  2YHJ A;  4R52 A;  2GAL A;  4LO8 A;  5B2G B;  2LS6 A;  1LOA A;  5LW9 A;  3TEZ A;  5F37 A;  1HQL A;  3OYW A;  3D0S A;  1UZV A;  4HKL A;  4GWM A;  4UW4 A;  5LBF A;  2ZKL A;  2ZEY A;  2BU9 A;  1RB8 G;  1XYP A;  3KF3 A;  1OC1 A;  2MEV 3;  4AR2 A;  4YVS B;  5FTT C;  1FNY A;  4XW3 A;  1ENR A;  1MZ5 A;  1VPH A;  5A7S A;  3NAP B;  1KDM A;  4ARY A;  4I09 A;  1N3O A;  1ALY A;  3A22 A;  3MPB A;  5A6Z A;  1TMF 2;  2XLA A;  4NIH A;  1RUJ 2;  3VBS A;  5A7W A;  4U2A A;  1CAV A;  1V6J A;  4MYE A;  1W8F A;  5M0T A;  4MAD A;  3ACH A;  1OKQ A;  3NV2 A;  4LBQ B;  1VRH 1;  2FHR A;  5FYZ A;  4C90 A;  3OUH A;  3O1M A;  1FMD 2;  2UUR A;  2UWC A;  4Q0P A;  3ZYG A;  5FLJ A;  5BPX A;  5FK7 A;  4LHS A;  4NE9 A;  1UMH A;  2ZGN A;  4IGQ A;  1MAC A;  4OHZ A;  3H8R A;  4AYU A;  4IDZ A;  2D97 A;  1H2K A;  5FZ0 A;  2JIC A;  2D3P A;  4MSV A;  5IVV A;  3LF7 A;  3BTX A;  4CUG A;  2QQO A;  2ADD A;  2WSU A;  3ZFF A;  4WM8 B;  4D69 A;  2A3W A;  1LOF C;  4AED B;  1ZYB A;  1F31 A;  3QH7 A;  5DG2 A;  3PVE A;  4K9S A;  1SFP A;  2ATF A;  2WT0 A;  4Q1P A;  1T6G C;  1NT0 A;  1YHF A;  3ST7 A;  3HN3 A;  4LK7 A;  4YVW C;  1TMF 1;  2VEC A;  1SLA A;  3ZXF A;  1RJ7 A;  2A6X A;  5I0T A;  5A7N A;  2YYO A;  1NCR B;  1QH7 A;  3WHT A;  4JDM A;  3ZYP A;  3LFM A;  5B4N A;  4A3Z A;  4NAO A;  5F9T A;  4CDW B;  3KVB A;  3C3V A;  4PI0 A;  3S57 A;  3G6J B;  1RYY A;  1COV 3;  3IMN A;  2FD8 A;  2YU2 A;  3I3B A;  2VMI A;  2W39 A;  5E89 A;  3TB0 A;  1UL9 A;  1H4G A;  4L0P A;  4KWL A;  2V09 A;  1K12 A;  2JD4 A;  5AC9 2;  2PLV 3;  2C6S A;  1PK6 B;  2P6H A;  1KXG A;  1O4Y A;  3LEG A;  3M3C A;  1GUI A;  2A73 B;  2JX9 A;  1ONA A;  3I49 A;  3WEZ A;  1UXZ A;  4N43 A;  3VZO A;  4OI0 A;  5EFU A;  1IGO A;  2GME A;  2BEO A;  3KQR A;  4XFG A;  4FTE A;  3LEI A;  2D6N A;  4JGY C;  1HB4 A;  4R9A A;  3EO6 A;  3THD A;  2OT7 A;  3KT7 A;  4RGK A;  4AGV A;  4LBO A;  4LHL A;  2TNF A;  1A3K A;  3K77 A;  4E4S A;  1UY3 A;  5IVE A;  1R64 A;  1AJO A;  2B45 X;  3SCF A;  5IVF A;  1OOP A;  4AAX A;  1MPX A;  2OYZ A;  4OHY A;  1K45 A;  4LO5 B;  1RUI 1;  4Y20 A;  1BKZ A;  3S5A A;  1AR8 1;  3KGZ A;  3NST A;  4CU8 A;  4F8A A;  1BQP A;  3H1M A;  5A3U A;  4GJY A;  2KXL A;  2K2S A;  1XU1 A;  5IAT A;  1ZM1 A;  5FAX A;  2JDP A;  5LBC A;  5AC9 1;  2AEY A;  4K21 A;  2GC0 A;  1FV2 A;  5K0U B;  4HL0 A;  1NAE A;  4HON A;  2PTM A;  5FZD A;  5ACA 3;  3JU9 A;  4AVV A;  2WS9 2;  1QNW A;  4QHB A;  2R16 A;  1WW7 A;  1UYY A;  2JKX A;  2W87 A;  4Y1V A;  4Z92 B;  2FMD A;  1W04 A;  2OKX A;  4XAC A;  2OUJ A;  2RDS A;  2WAA A;  3C7F A;  1NQJ A;  3QH6 A;  1SCS A;  4TSV A;  2C24 A;  5DDJ 2;  3CO2 A;  4Q0Q A;  5IK4 A;  1UF2 C;  3OGJ A;  2VNO A;  1QF3 A;  1F4H A;  1NUK A;  3MLK A;  3MIE A;  4JGZ B;  4QMA A;  1WA6 X;  2Z4F A;  5J98 B;  3WIN E;  5DZF A;  5CFD C;  3RI9 A;  2CAV A;  2NN8 A;  3POJ A;  4LMF A;  4R4X A;  3NVC A;  3PVO A;  4AHY A;  1K5J A;  2WBK A;  2FDI A;  2H6C A;  1PO1 3;  4QM9 A;  3OBT A;  3RYK A;  3VBF A;  1U5I A;  2YPD A;  4BK4 A;  1QJU 2;  2JG8 B;  2VOW A;  2C5D A;  1SZB A;  4YGD A;  1JYX A;  1QQP 2;  1S2K A;  4JRA A;  4QXH A;  5K4L A;  1KIT A;  3PU8 A;  5BNP A;  4XZU G;  4NHY A;  2WS9 1;  1CZT A;  1MS4 A;  3D4K A;  1F4A A;  1KS5 A;  3PTY A;  3P5B A;  4Q4Y 3;  3HR9 A;  4V2V A;  4DRR A;  3AK0 A;  1XXN A;  2JE8 A;  1HKD A;  4K3U A;  3AFK A;  5DDJ 1;  3VZJ A;  3JB4 C;  4BHP A;  2RS5 2;  2XBO 2;  2H0V A;  5FMO L;  4SLI A;  2IFR A;  1GLH A;  3PUI A;  5CA6 A;  4N53 B;  3HMY A;  1F5J A;  4E2G A;  3FLT A;  1QJU 1;  5B4X A;  3UGG A;  4AZZ A;  4BK5 A;  2PHR A;  2EAA A;  4AHZ A;  5D2A A;  3FHQ A;  1UN1 A;  2VUL A;  5DPN A;  2IXH A;  2YZ4 A;  4P9J A;  1H8T A;  4XOG A;  3HQR A;  1EY2 A;  3AC0 A;  1QY4 A;  1NCQ B;  2FDJ A;  3GM8 A;  4NUB A;  5LK5 A;  5C8C B;  1QXP A;  1BBT 1;  2DVF A;  2DDU A;  2XQX A;  3WZ1 A;  2Y6H A;  4YG3 A;  4DEQ A;  2WL1 A;  1RUC 3;  3R4D B;  4XEZ A;  1GOH A;  1YJK A;  1NA1 A;  3CBN A;  4HKO A;  5DAV A;  4B1M A;  5BNN A;  5JUV A;  1MEC 3;  5I8Y A;  2R32 A;  3AP4 A;  2R06 3;  1FNZ A;  4ZU4 A;  3BU0 A;  4G9S B;  3LDR A;  1HRV 1;  1RIT A;  1SFY A;  2W08 A;  1IZ3 A;  1X9P A;  2XHN A;  3M2M A;  4NRM A;  3RG0 A;  3PVN A;  1XPW A;  2QTW B;  5AVA A;  5F3G A;  1F35 A;  1QJX 2;  3PVB B;  3TYJ A;  2RV9 A;  5FKC A;  3WUD A;  3VBO A;  2HEW F;  1LKN A;  4Q5O A;  2CGO A;  4YWA A;  1JZ5 A;  3GGL A;  2X29 A;  4QD2 A;  3MPP G;  4K7J A;  2O14 A;  4Q29 A;  5FK8 A;  1JUI A;  2QQJ A;  2W92 A;  4PLN A;  4H55 A;  4AHX A;  3ZYB A;  1OUR A;  5FYU A;  1JZ7 A;  4ZS2 A;  1OFN A;  5FZO B;  2VZU A;  3X29 B;  1QJY 1;  4GKY A;  4B8E A;  1WA4 A;  3I2H A;  1MR5 A;  4KMQ A;  3V65 A;  4V2W A;  4LIT A;  1WME A;  3LA2 A;  1W8N A;  2BUK A;  4I30 A;  3PUS A;  3U07 A;  4YFW A;  1IKP A;  4NPR A;  4AQ6 A;  2DTW A;  2HWE 2;  2E6V A;  4GWN A;  4FPO B;  1MS5 A;  2B7Y A;  1PK6 C;  5FZL A;  5IFP A;  3A23 A;  3FZ3 A;  3AL5 A;  1UXX X;  4Q4X 3;  2GNB A;  5A7P A;  5F3C A;  2A3Y A;  1EV1 1;  2J1E A;  3BB6 A;  5FYH A;  4AQ2 A;  5A3P A;  3VZK A;  1SQ4 A;  3RZL A;  2Y64 A;  4AG4 A;  4J6G A;  4EWA A;  4CEY A;  3LGR A;  1WW5 A;  2OW4 A;  1GZT A;  3D82 A;  2ZX1 A;  4CTE A;  1VE0 A;  3A0K A;  1PIV 3;  5GZE A;  3GHM A;  4ZS3 A;  4BLJ A;  4RR3 A;  2G4I A;  2H0B A;  3S0M A;  4Q2F A;  2VNR A;  5J36 A;  1BEV 2;  1UYP A;  1C4R A;  2VOK A;  4XIO A;  2QVS B;  3DPR C;  2EID A;  3KVA A;  4IGP A;  2C0Z A;  5FY0 A;  5H9S A;  5L7O C;  3AZY A;  1KRI A;  4MHU A;  1CX1 A;  1NX9 A;  5K0U C;  1LOB A;  5JMC A;  4A3X A;  1PX4 A;  2SLI A;  4LOS A;  1AL2 2;  2ZKN A;  2WWU A;  4ORF A;  5GZC A;  1N47 A;  3I2K A;  4Q8L A;  4RHV 2;  1AZD A;  3HPN A;  1ND2 A;  5CAZ A;  1MVE A;  2YFZ A;  3NO8 A;  2DFC A;  4MH0 E;  5CAD A;  3C7H A;  4URT A;  2PXJ A;  2VMF A;  2WDB A;  1W2T A;  2WN3 A;  2C4X A;  1KJL A;  1H9P A;  3ORJ A;  4MGI E;  4JGZ C;  4UF0 B;  5DZE A;  5K8S A;  4AVT A;  3H3Z A;  4LHN A;  4Q8K A;  4QPY A;  1RHI 3;  4U36 A;  3VHR A;  1JZ2 A;  2XUE A;  1BEV 1;  5FZ1 A;  5FZK A;  1W0O A;  3OOX A;  5CFC B;  4Q26 A;  2IFW A;  2W3J A;  3IZO A;  5A7O A;  1E5S A;  2WLQ A;  4UBH A;  3ZXA C;  1UNB A;  5FIX A;  4OHV A;  3CHX A;  5JOW A;  4JVA A;  1XYN A;  1ZBE 2;  4FPC A;  4DB5 A;  1AL2 1;  1SLL A;  3OGS A;  2JG9 A;  5FQ0 A;  2JEN A;  4K6B A;  2PQQ A;  5DMY A;  1PGL 1;  1DYP A;  4RHV 1;  1K42 A;  3USU A;  1GOG A;  2VZR A;  1SLI A;  1HRI 3;  2GU9 A;  4YZ4 A;  4Z07 A;  4Q0V A;  3WW4 A;  3MFC A;  3N3H A;  2P2K A;  2NQY A;  4Q4W 3;  5JDB A;  4V1P A;  3BIE A;  3ZX7 A;  4GA9 A;  1W8H A;  1SLB A;  3B01 A;  3VKF C;  4ET7 A;  1SPP A;  4OCT A;  4ZXK A;  1Z7S 2;  1V6O A;  2C9K A;  1AYM 2;  4N53 C;  5I91 A;  2QFE A;  4QB2 A;  4B7K A;  4CCJ A;  2P3J A;  1J83 A;  4IND A;  1Y9G A;  3NJY A;  3KZ4 C;  5JAX A;  2BOI A;  5LA2 A;  4D6S A;  2JJ6 A;  2XUM A;  1UOG A;  2YPJ A;  3K2O A;  3NQH A;  4HLT A;  1GWL A;  1PVX A;  3NNG A;  1E57 A;  3NNF A;  4PBP A;  4WZF A;  3J8F 3;  1ZBE 1;  3U11 A;  4HFS A;  1IG0 A;  1O5L A;  2XML A;  5F7U A;  3BTZ A;  2RDR A;  2RJL A;  3JXS A;  5J09 A;  4L8Q A;  3E6C C;  2VZT A;  1OD5 A;  2E32 A;  4A42 A;  1YO8 A;  4DFS A;  2A1X A;  1GNH A;  1QWR A;  1OLR A;  1RUN A;  4A7Y A;  1EPW A;  1DZQ A;  4BIF A;  1RUD 2;  3FBY A;  2XJU A;  2F4P A;  4OHW A;  5ISL A;  4CCK A;  5IUQ A;  3BOW A;  5F5C A;  4XUR A;  2WO2 A;  4K20 A;  4Y33 A;  2TUN A;  4AI9 A;  5F1R A;  1AYM 1;  2XH6 A;  2AH2 A;  4OVE A;  4X6Q B;  4IES A;  4FPK A;  3B3Q E;  2CY6 A;  4L92 A;  3MW3 A;  2CWM A;  1MQT B;  3EBR A;  3HJR A;  3BUC A;  4QPG B;  1X36 A;  3CJI A;  4OQ9 A;  4NAM A;  1YLL A;  4RS5 B;  5C3P A;  2XVG A;  3OEB A;  5A33 B;  4YW2 A;  1NE6 A;  2UY9 A;  3BPS A;  3B93 A;  4B4Q A;  2HJI A;  2VZS A;  2XJP A;  1D2S A;  1FOD 1;  5FZ9 A;  1Q3E A;  2K46 A;  4JHZ A;  1TE1 B;  3POI A;  3DXU A;  2R6Q A;  3E5Q A;  1FPN 2;  4FT8 A;  4QX1 A;  1SFN A;  2G9Z A;  3O7O A;  1SHW B;  4LBM A;  5FMB A;  3SH5 A;  4CCM A;  2VOV A;  5JR7 B;  3BKZ A;  4TLF A;  3N7J A;  4OI4 A;  3TN9 2;  5DAX A;  2ZX0 A;  4O61 A;  3RMY A;  3E5U A;  3UL2 A;  2GND A;  3AMQ A;  2LW8 A;  3P6B A;  4BXS V;  1QJF A;  4BMB A;  4BQ5 A;  4X8N A;  2RDQ A;  3T30 A;  1QOT A;  1ZZC A;  1PMH X;  2WII B;  5L9V A;  3W9A A;  3MID A;  3V0A B;  1U5X A;  3OF1 A;  1ASJ 3;  1RVF 3;  4QKF A;  5EQU A;  4AQS A;  1WLD A;  2VY0 A;  4UFL A;  1YC6 1;  1H2M A;  2WNU C;  1EPZ A;  1VBE 2;  2J1U A;  3BOD A;  3C7E A;  3RDI A;  1XU2 A;  3VHO A;  3AMM A;  3D3A A;  1H2L A;  2X5I C;  4JDN A;  2VCC A;  3WP4 A;  4CDU A;  1FI2 A;  3WP5 A;  3HVD A;  3E6B A;  1H1M A;  4UAP A;  4QX3 A;  1OKO A;  5ANQ A;  5T3N A;  1GZW B;  4JX0 A;  1DHK B;  4DEV A;  4NO4 A;  4Q0U A;  4QXB A;  1FPN 1;  4E2S A;  3IPV B;  4S2H A;  3U75 A;  2ZAC A;  1RMU 3;  4KWJ A;  3T4V A;  3O1U A;  1GIC A;  3ES1 A;  2KA3 A;  1DQ4 A;  3WDW A;  1E5H A;  1Q8Q A;  3MLJ A;  4XJW A;  1R09 3;  2E7T A;  2F17 A;  4UFH A;  3ES4 A;  4DUV A;  2GH2 A;  2VQA A;  3USS A;  1OF4 A;  1AF9 A;  2WC2 A;  4MXW A;  3W20 A;  1SDD B;  3ROU A;  4AI8 A;  4P9G A;  3ATG A;  2EA7 A;  3L2H A;  1YI7 A;  4P5H A;  4UFM A;  1O8P A;  1O6U A;  4PIX A;  4CDX A;  4F83 A;  1CJD A;  2WYF A;  1W0N A;  2SBA A;  1HXS 2;  1VBE 1;  1LGC A;  4GD4 A;  1YFY A;  5I8S A;  4BXF A;  5JPN B;  4AF9 A;  5FR3 A;  1VBA 2;  3JBG 2;  1VBB 2;  2FZ1 A;  1YNA A;  2GN3 A;  3M3E A;  4IEW A;  4NRO A;  1OH4 A;  1UAI A;  3IDE A;  5ANN A;  2JEC A;  1OUX A;  3TAY A;  4CDQ B;  4W50 A;  4QXC A;  4OI2 A;  1Q8S A;  1DLL A;  2XLG A;  4AEJ A;  4E27 A;  2Y26 A;  4UWD A;  5FP9 A;  4FOQ A;  1JOB A;  3NKT A;  5FLI A;  1TNR A;  1W6N B;  2XJV A;  1J1T A;  1KFX L;  1F15 A;  1PO2 3;  2UWA A;  4NRP A;  4B4R A;  4D94 A;  1SDW A;  4AFC A;  2GNT A;  1UY1 A;  1HW5 A;  3H8X A;  1IPS A;  1W6Q B;  3P1I A;  3K75 B;  3ZXD A;  5J3U A;  4QDS A;  1HXS 1;  1CPM A;  2ZZQ A;  3DUI A;  4S2D A;  2WKK A;  2Y34 A;  4Z8B A;  4I02 A;  1VBA 1;  4IE4 A;  1DCS A;  1S55 A;  2A75 A;  3AP9 A;  4KL1 A;  4AFA A;  1C3H A;  5KHK A;  3PMS A;  4AQT A;  4F3J A;  5FYB A;  1RUG 2;  3ETP A;  3OBR A;  4LKE A;  5A1A A;  3OSD A;  2GAU A;  1UCX A;  4M3C B;  1ULO A;  1UU5 A;  1ZRR A;  2YBP A;  4FPL A;  4XFI A;  4XFC A;  1YUD A;  2Y6F A;  4Y1Y A;  3T2P A;  2VBB A;  4M4R A;  5FXZ A;  1VB4 A;  3MUY 1;  3WDU A;  4HPK A;  2C26 A;  3C2U A;  2O8O A;  4HG6 B;  4XTM A;  3BTA A;  1TME 2;  5T5P A;  2ZA9 A;  3W58 A;  1JBC A;  5JOZ A;  4UBG A;  5IAV A;  5C8W A;  2CDP A;  3WXP A;  2XXZ A;  4WM7 A;  1N3Q A;  4XMI A;  2V5Y A;  3IIA A;  1W6M A;  5A3T A;  4BM8 A;  1URX A;  2WN2 A;  2IVJ A;  4CU7 A;  3T08 A;  4J25 A;  3TOJ A;  5T54 A;  5JPM B;  4MX3 A;  5IYY A;  4KWK A;  2P3I A;  3VD4 A;  4AHW A;  1OA3 A;  3WNK A;  4CEW B;  2D98 A;  4GMP 1;  3ZSE A;  3N7K A;  4KG8 A;  4LOR A;  4GB3 2;  2WFF 2;  2PQS A;  3MDP A;  3TEW A;  2VZP A;  3ZSJ A;  4EN7 B;  3GZA A;  1C8M 3;  1HX6 A;  1AR9 2;  2R1B A;  2WFP A;  2W95 A;  3E6D A;  3EYP A;  4MUV A;  4NN0 A;  3RWN A;  2IWG B;  1NE4 A;  4LEJ A;  4WVM A;  5FZI A;  5IK8 A;  1GP6 A;  1Y3T A;  1ZRI A;  2D43 A;  2DFB A;  1YIF A;  4KI5 M;  4YVW B;  2UYA A;  4OFG A;  1ND3 C;  4E8C A;  2QZ3 A;  1YI9 A;  1O5U A;  5FPL A;  4I2O A;  3ELN A; 
#chains in the Genus database with same CATH homology
 3J7M A;  3J7N A;  4OQ8 A;  1YC6 1;  4OQ9 A;  4NIA A;  1A34 A;  1CWP A;  1JS9 A;  1ZA7 A;  1STM A;  3J7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...