1A34A

Satellite tobacco mosaic virus/rna complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
147
structure length
147
Chain Sequence
b'TGDNSNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGSLFSANFRTDSFTSVTVMSVRAWTQLTPPVNEYSFVRLKPLFKTGDSTEEFEGRASNINTRASVGYRIPTNLRQNTVAADNVCEVRSNCRQVALVISCCFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structure of satellite tobacco mosaic virus at 1.8 A resolution.
pubmed doi rcsb
molecule keywords PROTEIN (SATELLITE TOBACCO MOSAIC VIRUS)
source organism Satellite tobacco mosaic virus
molecule tags Virus/rna
total genus 24
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 1998-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.220 Mainly Beta Sandwich Jelly Rolls Satellite virus coat domain 1a34A00
1ZA7A 4OQ8A 1A34A 3J7NA 3J7LA 4OQ9A 4NIAA 1YC61 3J7MA 1JS9A 1CWPA 1STMA
chains in the Genus database with same CATH superfamily
4V2VA 3NV4A 2V73A 3H7JA 2XJTA 4GA9A 3M2MA 5JSPA 5JXIA 2DVBA 1ZBA3 3OCPA 1XQNA 3T2PA 2Y33A 1UMZA 4LOTA 5IUQA 4CXYA 3VDDC 1J58A 4LO5B 3ZMOA 3AZWA 4YZ5A 3MYXA 3RYRA 1UZYA 2HYKA 1U5YA 4PLOA 4XHBA 3MDPA 1CAXA 3KHCA 1R1ZA 4E4DX 1DGWA 4XJZA 3A22A 3WNNA 4O61A 1GYKA 5EYXA 2VZPA 4XFGA 3ROUA 3FMGA 2X29A 3AK0A 3QH6A 2WA4A 1OBNA 4Q4X2 3WQ7A 3MV11 1SFNA 1XYOA 2ETEA 3J9SA 2QCSB 4KU7A 4UFJA 3ZIXA 1UXZA 2FDIA 1YQCA 5EJ1B 4M00A 2CWMA 4QMAA 5C4WA 3S7IA 1SFYA 3J7MA 2XUEA 4Y4YA 5HCFA 2E7AA 4A6SA 4FFFA 3BTXA 4JGYC 4Z92B 2G19A 3WNKA 5CAZA 3SH5A 5GM0A 3RPQA 2P37A 1EAH1 4LLOA 1FMD2 1SPPA 1D7PM 2TEPA 5FXWA 5KXCA 1IS4A 1LRHA 4FPHA 2FDFA 2BRTA 4Q1PA 4IDZA 2RS51 3ACFA 4D69A 4M3CA 1G86A 3NL1A 4YW4A 2EIGA 4Q0QA 4FOVA 2D6NA 1ZA4A 2PHTA 3I2IA 3R05A 4XFHA 2VCCA 5GLTA 4FPJA 4FXKB 3I7DA 5KC5A 5KXDA 4CDXC 1RVF2 1BMV1 3ZYRA 3KSCA 1QJU3 3S7EA 3ZYPA 2E51A 1XYPA 2ZGRA 4BHPA 1GZ9A 1NZCA 4RD7A 4C8DA 3FE5A 1QJY3 4IGOA 1FOD3 4QDQA 4AEDC 1RL3A 2QZ3A 2CNAA 2WLPA 1XNBA 2PAEA 4N43A 3C7OA 3AZYA 4LHLA 1HJFA 1GP6A 2WNVC 5IWFA 4HVQA 1LAJA 2IFWA 1VLNA 2V4AA 4RHV1 1VALA 2VW1A 3AJZA 4LBKA 4TYSA 4YVSA 5LBEA 3RWKX 2F4PA 1DQ6A 3NJXA 3POJA 1NY72 4GKYA 3ZR5A 2Z69A 1LOCA 4BWOA 3HNBM 5H9SA 1HXS2 2WS93 4CXXA 1J1LA 1GZCA 2PHUA 3VBUC 2VH9A 2D6MA 2XVGA 1I3HA 3OUJA 1VBC1 4FFHA 4YG0A 3AMHA 5IJRA 1KS5A 2YXSA 5LASA 3JXSA 1XXNA 3MO4A 3VLBB 2X09A 1F8VA 1WW7A 2QNKA 3FBMA 1ULPA 1H4HA 4JTNA 2R16A 2DFCA 2VBPA 2W95A 2Q5TA 3I3EA 4CU6A 5A1FA 3UGGA 1ASJ3 2ZXQA 4IEWA 3WD5A 2RMU1 1C8M2 4EN8B 5FREA 2HYXA 1DP0A 3WDUA 2C9KA 2XG3A 4UW5A 4CCJA 1IS3A 2BDRA 3VKNA 4BIFA 1CAVB 5IFPA 4RGAA 1UYZA 2MNGA 1SLBA 1Q8QA 3CJIB 1WW4A 3RYKA 5DUWA 1GBGA 2Y60A 4OMCA 4HN0A 1H8VA 1GICA 1QJX1 2W1SA 5EZWA 2PFWA 5BYNA 4K8FA 4N53A 4UF0A 3PHMA 2ZTNA 2OQ6A 3WLUA 1S2KA 1S55A 2C26A 3THTA 4XYXA 1WMEA 2EA7A 4UFLA 5FBJA 4XTPA 5IAXA 5FZMA 1RUD2 2Y6JA 1MZ6A 1R091 4IE5A 4KU8A 2D97A 1AR83 2IC1A 2WFPA 1K5MA 2PN5A 4J1WA 3ECQA 4QB1A 1HQWA 1YQ5A 5FYYA 5FY8A 4CE8A 1HLCA 5A6ZA 2VPVA 2YROA 2BJSA 3LA2A 3VBRA 5BNPA 5IK7A 2LALA 5FZ7A 3B3QE 4ITCA 5CFCB 1H2NA 2WFF1 3MI8A 3VUOA 1VBD1 2J1SA 1QMJA 1XRUA 3TYJA 5LA9A 3W59A 5I8TA 1KQRA 1LCLA 1QQP3 1VBA3 4QDSA 3ITQA 4QT6A 1JI6A 3LA3A 1DYKA 1JOBA 2ZKNA 5JXJA 5DUXA 4Y5SA 1WCQA 3G6JB 1PK6A 1NUKA 4MLOA 1Z7S3 4KNCA 2Z79A 2WABA 4GKXA 4RR3A 3TEXA 1UKRA 5F3EA 3FLPA 5KHJA 1OLMA 1AYM1 1CZTA 3LSDA 5JI7A 2C6SA 1YNAA 5DDJ1 4MXVA 1MZ5A 3E6BA 2A3YA 3A23A 1OA3A 4K7JA 5JXHA 5LB6A 2RR11 2W47A 5J48A 2VMEA 2WNOA 1F4AA 4HT1T 3WCRA 4DXRA 3B9CA 3HVDA 4PIZA 3U37A 3WF3A 2LROA 4AGVA 1EAH2 1JMUB 1PVC3 1W2UA 3KLSA 4MGQA 5AC91 4YGEA 1UMHA 4NAOA 4LR4A 4AHYA 3WF0A 2RS52 3QCWA 2E63A 3PVOA 1NCQB 5FDBA 2JXAA 2R6QA 3CMGA 2VUCA 2C5DA 3USUA 2EIBA 1QNYA 1SDWA 2HWD1 5IK4A 1W28A 1BMV2 4K9SA 3JD71 4CDQA 1LOFC 4YARA 5FZ6A 4FPCA 2YBSA 3GBFA 2CGOA 4ORFA 2CDOA 1L3JA 1JZ8A 4IEXA 5D8AB 4K6BA 4DS0A 4LBQA 3LA7A 4YG6A 1YYNA 4BM8A 1LHOA 3K75B 1N3PA 2JG8B 1Y3TA 2Q0AA 1CONA 4A41A 3BIEA 2ARBA 2VTFA 4RHV2 4U36A 3THPA 1RUH1 4Y20B 5FZ4A 1SCRA 2WO1A 1YIFA 1JUIA 2BZDA 2WZR3 5LWBA 4NIHA 3ZFFB 1W6OB 2GP3A 5FZEA 3W5NA 3TAYA 3S6PA 1VR3A 3WNOA 3KV4A 2HWE2 1R1A1 2DU1A 1VMJA 1CIWA 1VBC2 1G7YA 2XOMA 5A7SA 4XETA 3WXPA 2Y34A 1DF0A 1RUE3 5DPNA 3O1TA 1XJAA 5HV0A 1KD7A 3IIAA 5JZGB 4LOSA 1JZ6A 3RI9A 1W6MA 5E6HA 3ZSMA 2J22A 4AAXA 2A3WA 2RMU2 1LNSA 2E31A 3SCHA 3S0MA 4I01A 1V00A 1CESA 5T5JA 2D5HA 3CJIC 4OI0A 4U2AA 1HRV3 1XBFA 2OPWA 5L19A 2WIIB 2WT2A 2XWJB 2OQ7A 3WNXA 5I91A 1VB4A 5LATA 1CAXB 2OXBA 1XC6A 3HJRA 4QGMA 4IEZA 4K20A 2NLRA 4HN1A 3ZYJB 2HBUA 3RFRA 1XPWA 3I54A 4MZUA 5DAPA 5ERLA 4Q4W3 3H8XA 2EXJA 3VDDA 1QJX2 2WNUB 1Q8VA 4C91A 3LQCA 3OOXA 5JWPA 1LU2A 5KHGA 2A7AA 1QIQA 4CXWA 1C1FA 3A21A 4HOOA 1PO23 1R092 3IDEA 4QKDA 5FY0A 4AI3A 4G3YC 2DCTA 1BBT3 3BOPA 3H3LA 1HB1A 4IV3C 5FBZA 4AQ2A 4CDWA 5G04L 5CFCC 1JODA 2K2SA 3WNLA 1EUUA 3FHIB 5FWEA 1QXJA 5FZOA 2QQPA 1SPPB 4UI9L 4NIIA 1ULOA 4XJAA 1SLIA 5H9QA 3MLKA 2WFF2 4RFRB 1VBD2 4IGPA 3ZN4A 1ZRCA 4M3CB 3WDYA 5F5AA 1CPMA 5C8WA 1VB2A 4UT5A 3KT7A 4JGYA 1E57A 5KXEA 2J1RA 3WEZA 2RS11 4A44A 5LK5A 1PZ8A 1LHVA 5L9BA 4Q4Y1 5CKNA 4AFBA 1HJGA 4AL9A 2D6LX 1R083 3PDQA 3ZFGA 2BYVE 3NV1A 4WZCA 5KHKA 1GKBA 5JIUA 5T50A 3RZKA 4O9GA 4BQ2A 3MLLA 1AYM2 4UW4A 2BBVA 1PO11 5DDJ2 5L9VA 1H9WA 1WMDA 1LEMA 2AACA 4ISRA 4N43B 5D2AA 5ACA3 4QXHA 1OF4A 5K0UA 2VECA 2RR12 3OEAA 5FP7A 1NCQC 1YLLA 4AYUA 5FRAA 4BQ1A 1DQ2A 4IETA 1YCIA 4HL0A 4AEDA 3G7DA 1NCRA 2HLEA 3WCSA 2OPKA 3GALA 1F31A 4LE4A 2UU8A 3M70A 3WF1A 1W2OA 5AC92 1UO9A 4Q0UA 4HK9A 3RYPA 3MF9A 5A3PA 3B02A 5I0TA 3SXWA 4XIOA 4QAWA 3AFKA 4DEVA 4IEPA 5D8AC 2VNGA 2BFUL 1XU1A 2ES3A 5B2GB 3JD72 4LIVA 5FKBA 4DMIA 3ZPYA 2JG8C 2HJIA 3MHZA 5HCAA 3VDBA 2VZQA 2VZSA 4B4QA 2JKXA 1OVSA 4GWMA 3TWIA 4AFDA 4YSFA 2BP6A 3ZFFC 1GLHA 5AVAA 5IVVA 4ZU4A 1ZNPA 1POV1 5IYYA 3NKGA 4XUTA 4YYOA 3KCCA 4XZPA 1WW5A 1ND2A 1C1LA 1RUH2 3VBOA 2K9ZA 2NPIA 4XUPA 4J25A 1I9RA 2RDQA 4XILA 4R8HA 1XYNA 1BEV1 2ZX2A 4OUSA 2Y6KA 5JZGC 4A4AA 1W2TA 4A2UA 4N53B 2XLAA 4UF0B 2VVFA 1SLAA 4CP1A 1R1A2 4Q8KA 4Q4V1 2HWC1 2CTVA 2Y6GA 3NJVA 4A3ZA 5JAXA 3AYDA 2P3YA 1H2MA 1X8EA 5FZLA 3BVCA 1RUOA 1K5MB 1QU0A 1Y9QA 3OGJA 4YWAA 1XE7A 3IDCB 2D7FA 2A6WA 3CL1A 3T4HB 3VKMA 3WF4A 3WNMA 4B7EA 1IZ3A 2WLQA 3VBRB 5BNPB 4NIDA 4NWWA 1NG0A 4Q5OA 2W3JA 3D4KA 3LIGA 1IS6A 4CCKA 5F2WA 3LEGA 1GP4A 4R9CA 4XHXA 5EHDA 1GNHA 1QHDA 1SBDA 1PGW2 4R9AA 4AHXA 2WNUC 3H1YA 2XKOA 4Y5Z0 3HQXA 2YB7A 4QM9A 2VVDA 5DAQA 2GC2A 3FWEA 1DLLA 1N1SA 5E8AA 5A3LA 1PK6B 3U4SA 1YJKA 4CCEA 4QX7A 3WUDA 1AR91 4RR3B 2VZ1A 1OHFA 5A7NA 2P1BA 3EYPA 3S5AA 4RSUA 1O3QA 3WV6A 4XFFA 4A6OA 1G6NA 4NPLA 4LXLA 4I3GA 1GOHA 2NM1A 4DO0A 3N7JA 5B4NA 5F32A 4F7ZA 5FFOC 4P14A 4DY5A 4D94A 1W9YA 2VQ0A 1XOYA 2VU9A 2R043 5HI0A 1AX2A 3ALQA 1Q3EA 4GAZA 4CU7A 4P5HA 5L73A 1X7NA 3UETA 2VOXA 1L7QA 4QHBA 1MS4A 1Q8OA 1Z0HA 4X6RB 2DVAA 1MZEA 2GNMA 3D3AA 4BCUA 1LHWA 2RS12 2R32A 4NE9A 2ILMA 3PJQA 4QKBA 4Q4Y2 2VW2A 1H1AA 4CDQB 3C7EA 4N43C 3M1HA 2BBAA 1MR5A 5F5QA 3SQOA 5IHRA 1D4M1 3ELNA 2ZZQA 5K7PA 1YI9A 4LA2A 3VZJA 1PO12 4LBQB 5FIXA 5A3OA 3HN1A 5IFTA 2I45A 3I2DA 3AJYA 3JB8A 4XQDA 2DUQA 2QJVA 3C7FA 4TN7A 2VNRA 2D44A 4I30A 2BVBA 4FQ4A 5FO8B 1WD3A 1AR71 1W04A 2NMNA 1QF3A 3JB4C 1BQPA 1RUJ1 2ZHMA 5FJKA 4XFCA 3MF6A 2VR4A 1G8WA 1HXS3 3Q8AA 5JMCA 4ZONA 1CD3G 4DNYA 3W5MA 1IS5A 1IPKA 1UU6A 4Q0PA 1CX1A 3CLPA 2A6XA 4YRDA 2VQAA 3IT8A 4GJZA 1PMHX 1GOFA 1ODNA 2PQSA 3MPPG 1K42A 1WLCA 4DOUA 3TN91 2NMOA 2VZRA 2IUWA 4B4PA 1UOJA 4AWDA 4MGKE 1UPIA 4J1XA 2QQVA 3ZYIB 5HBAA 2JWPA 1FPN1 1TQ5A 3IDBB 3VZKA 2ZMKA 4MXWA 3PIJA 1GMMA 2IXLA 3JBG1 1UZVA 3C8XA 3FX3A 3MW2A 5A3UA 1CAVA 4HVRA 4N53C 2FBEA 3T30A 2OW4A 1NE4A 1WZXA 2Y6LA 4LO8A 3OG2A 1SBEA 3LCPA 4HMZA 3Q8BA 1LESA 1BEV2 1ZRRA 4NOTA 5FZ8A 3ETQA 4YLZA 5FO7B 1K5MC 2VY0A 5FAXA 1IPSA 2DV9A 1RMU1 2H6CA 4YFZA 4Q4V2 2QQLA 3LFIA 4HG6B 3VBRC 1RUD3 5BNPC 1LHUA 2ZGQA 1WCUA 3IPVA 4O9EA 2ZPXA 2ZGMA 4KBZA 2W2IA 4CDWB 1MEC3 5LA1A 1RC6A 1QOOA 4E2QA 3L9JT 1W8HA 3CKHA 2B7YA 2P3IA 5JOXA 4QB6A 2UWBA 4X6QB 1OVPA 2Q8EA 3WW1A 3TB0A 1F4HA 3VKLA 3UJOA 4AVTA 2RDSA 4IUGA 2NYYA 1PK6C 4MGYE 5DUVA 3PUHA 1ZZ7A 4HPKA 3R4UA 2CAVA 5CIRA 5EJZB 1VBE1 2XWBB 4RR3C 1AL21 1GWKA 2JDKA 2W39A 4RS5A 3WHTA 2RS33 1DQ4A 4IEOA 4OVEA 2D93A 2JE7A 5LBCA 1Q43A 1FT9A 4I02A 3BTYA 2VCBA 1KDMA 1AR92 1TMF3 2BOJA 2D5FA 3GHNA 3IKWA 2A1XA 2XONA 4NHYA 2SLIA 4QKNA 3C7HA 3SCFA 4PT6A 1SFPA 1IPJA 3HMYA 3AYEA 4GZ9A 4CCOA 5CBLA 2JENA 1LGBA 1TNRA 3IBMA 5FZAA 1W8FA 2ZGPA 4SLIA 4ARXA 3OPTA 2W91A 4QM8A 1XU2A 5K0UB 2CWSA 5GLVA 1LR5A 3F95A 2GMPA 2BGCA 5A6XA 3GCWA 4BQ3A 2XLFA 1IQAA 1OKOA 2ERFA 3H3ZA 1T6GC 3IIIA 4P9JA 5FY1A 1WUVA 3WP6A 1IKPA 3WZ1A 1TME3 4TXWA 3FBYA 4FP2A 4CDQC 4KBBA 3POFA 3N9MA 3RWNA 3JCIA 1U5IA 5AVPA 1RUI3 2WSUA 1UY3A 5FZGA 4ZU7A 2EF6A 1OPMA 5GLUA 2R063 5C9AA 3GGLA 2RJLA 3A7QA 3HPNA 3POSA 2XJVA 3KVBA 4KG0A 1RUG3 3KV5A 4QB2A 1AXKA 3PLQA 4XJ8A 4NIAA 4H55A 2W1QA 4R4XA 3AVRA 5KR7A 1PIV3 1D4M2 1FX5A 1O8SA 1PHMA 1PNGA 3V64A 2RDRA 4TTGA 3D82A 3J7LA 1UOBA 3NV2A 3EMRA 4LK6A 1H2KA 5FMOS 4YGDA 3VHRA 2XQXA 3HBZA 5GZEA 3HWJA 4OI2A 3WHUA 2HWB3 5HV4A 1SQ4A 4BXSV 1RHI1 3KVAA 2I74A 1ND2B 3VBOB 3AVSA 3LPGA 5IATA 2YZ4A 1AR72 3KM5A 2FHRA 4Y20A 5A6YA 1HX6A 1RUJ2 2PA7A 5DN2A 1W2AX 3H9AA 1ZA7A 2JKBA 1AR61 3ZVXA 4BH9A 1SEFA 1H8TA 4QQPA 3AX4A 3H1MA 2HWE3 2WZ8A 3NKTA 1OH4A 1OPOA 4V1PA 2XBO1 2QQUA 2VJXA 5K9YA 3AKSA 5CVRA 2ZHKA 4JVAA 3TN92 4BA6A 3KWVA 3S30A 2W5FA 3ZFEA 3AYCA 1OC1A 3Q8EA 4MGTA 2QBXA 1BLZA 1FPN2 3B93A 4M4RA 5FP4A 5A1LA 1LGCA 3E5UA 3OPZA 3CF6E 3PUIA 4WV8A 3I2FA 5DZFA 4MH0E 1H4GA 3CQOA 4Q26A 2VW0A 1O3TA 1V6KA 3WW2A 2W94A 3JBG2 4E8CA 4LA3A 5JOYA 1DQ0A 2RM21 2PHRA 1ZM1A 2JDAA 1GP5A 1UU5A 5FK7A 3H42B 3T4VA 3IDAA 3AMQA 1XSQA 1PVXA 3ILNA 5HXMA 1MS0A 4RQPA 3R6SA 2PHFA 5LRSA 4CDWC 5CG8A 2O1QA 3CZJA 3ZM8A 2D98A 2WNUA 5CG9A 1RMU2 2B45X 2W68A 2YC4A 4JC1A 3KHBA 2CHHA 1K45A 4AEKA 3VZLA 2YBKA 1XE8A 1ZZ8A 1VRH1 4XBQA 4E8DA 4ES9A 1V9U1 4CU8A 5DG2A 1G9CA 2GZWA 1C8NA 1V6LA 3A4UA 3ZXJA 4KWJA 1SDDB 4AW7A 1UZZA 3M7AA 4AI0A 1W6NA 2PLV3 1N1YA 4JCKA 1Y4WA 2PHDA 3KZ4C 3MFCA 4LJHA 4OI4A 1ULEA 2XJSA 2VXRA 3AXDA 4B1LA 1I5ZA 5JOWA 3BALA 3GZTB 3LF7A 2BWCA 2ZEWA 5FZBA 1AYN1 3GF6A 1MPXA 4E2GA 2R0HA 4EN9B 2QKDA 5DAWA 2YC0A 5CA6A 3HAGA 3WQBA 1VBE2 5FZHA 3MV01 1VBB3 1AL22 5FYCA 2V5YA 5FZCA 1WWYA 5J7MA 1E5RA 1AX1A 4LNVA 5E16A 3THCA 4OUMA 3OUHA 4QPIA 2CGNA 5K0UC 4GB31 4HSLA 3WF2A 2DUPA 1V6JA 1A8DA 2Y8KA 5FY7A 3CDZB 1BVP1 2Q4SA 2ZAHA 1NCRC 3E6DA 1UYPA 3VD4A 1EV11 1LOBA 2BGPA 2RE9A 4I3PA 4C1XA 3WR0A 4AG4A 3FLRA 2W46A 3M3IA 1COV1 4HONA 3GHMA 1Y7BA 5FWJA 4NVPA 4Q29A 3PJYA 1FATA 2PMWB 4L0PA 5JVVA 1ALYA 1RJ8A 1WGPA 1K5JA 2QVSB 5LCWL 4FT8A 4C1WA 4XFAA 1HV1A 2TUNA 1S0FA 1JOPA 4GALA 1NT0A 3NNJA 5EQUA 4NIGA 2PHXA 3SISA 3MIDA 1UMIA 4CDUA 1YWKA 3AP4A 1A78A 1B09A 3L2YA 4OI1A 1ZZCA 1OD5A 4ZKTB 2G1MA 4P9IA 4RA0A 3BPZA 2VOVA 2Z4FA 4YW2A 2BV4A 5FYMA 1SMVA 4UOJA 5A32A 4YW1A 4WBBA 1QXPA 3K4DA 1N3OA 1EP0A 2IVIB 3HT2A 5C3QA 1SBFA 3O7OA 4HBNA 2PELA 3IMNA 3QOPA 4Q2FA 4D7YA 1JBCA 1ND2C 4UW6A 2GNBA 3VBOC 2QQJA 4E27A 1CAWA 4MXWB 1BJQA 3RZGA 3R0RA 3KD4A 2E26A 3E5QA 2J1AA 4CCNA 4IL7A 2ZGKA 4DFSA 4XVHA 5GZFA 1RHI2 4CCCA 2QUOA 3LIHA 5CADA 3I4IA 3MIGA 2VZUA 4BISA 2IXKA 2JDMA 2A6YA 5LK7B 1RYYA 3OBAA 5CZKA 1CVNA 1AR62 2VBDA 3OTFA 3J8F1 3HEIA 4YM2A 1R1A3 3HOBA 3PVBB 3UJQA 2XBO2 2CV6A 5A3MA 3N9QA 1JZ5A 4BDVB 2BNOA 5BY5A 3IPVB 2XL9A 1JYTA 2Q30A 4NWVA 1ZBA1 2GP5A 4ZZ5A 2DCYA 4Y1VA 4XUNA 4OHXA 1W8WA 2JIGA 4CP9A 4HANA 1YJLA 5CNAA 3TOJA 2ADEA 2LS6A 2ET1A 2WWSA 3AMNA 5GZDA 3UGHA 4F3JA 5ISLA 1M06G 2A75A 2ZZJA 4Y1XA 3SC7X 4CCLA 1TVGA 4I0AA 4LKSA 3O1SA 4HPKB 2P34A 3RRDA 4LPLA 3APBA 3PURA 2RM22 4RS5B 1W0NA 1ZRDA 2AREA 5CYYA 1J3PA 3POYA 1B35A 5FUNA 2VQUA 2B4KA 3VHNA 4KGGA 2E32A 3SH3A 5C3OA 1ONAA 3MZHA 4XF0A 1W90A 5F1RA 3K48A 4PBOA 1KITA 2Z2SB 1DGWX 3O1PA 1LENA 3NVCA 4OQ9A 4GD4A 4L97A 4YZ3A 2ZX4A 5J1XA 2A3XA 3T3YA 5F7UA 5DAXA 2KM2A 1VRH2 3FUQA 3W9AA 4PLNA 5FPUA 1V9U2 4XZUG 3AP9A 3FC0A 4CEWA 4OUEA 2Z42A 3RSJA 5A3TA 1ZVFA 3ACLA 4N9HA 1SLCA 2WQZC 4WM7A 4M0HA 3URFA 1EY2A 4H3WA 3PTYA 3LFMA 3NV3A 1YHFA 3J7NA 4ZS2A 3VKFC 1IGOA 1WBLA 1RUC3 2IZWA 4MYEA 3NWKA 1WLDA 2EAKA 4E4SA 1NX9A 1AYN2 1RGSA 1QDCA 1BXHA 3I97A 5C3PA 3W58A 1GV9A 1QJEA 4DXTA 3WG3A 3VBFB 3M4FA 1UYXA 2DU0A 1QJU1 5LRRA 4PF1A 1UIJA 3LEKA 1A3KA 3KV6A 4W6XA 4N7IA 5IVJA 1CJDA 1DQ1A 2L9LA 3TNPB 1DG6A 3WINE 5CEHA 2RS13 4NRQA 1QJY1 2G4IA 1YXWA 1O4ZA 2AGSA 2KXLA 4IE7A 3ZFGB 4ARYA 4COVA 5C9AB 5I0DA 1XNCA 1NLSA 4YFWA 3BCWA 5LY2A 4YPJA 3GZAA 4MHUA 4OULA 4WVZA 4A7ZA 3VD7A 1YQ2A 4PBPA 5FOBB 2IXJA 1PO13 1ZBE3 4CUBA 1EYBA 5GLZA 3ZXEA 5J3UA 3LDBA 1EV12 3K46A 2E9QA 4MUVA 1FYUA 2W08A 3KCYA 1LOAA 1D4VB 1H9PA 2XHNA 2W1WA 3U75A 1APNA 1F5JA 1UNBA 4XAEA 3RZZA 1AXYA 2WS91 2RJ2A 2WAAA 1BHGA 2WC2A 4GH4A 3RZJA 1STMA 4IE0A 5FZDA 5FCCA 5F8PA 1Q56A 4XDOA 1QY4A 1RUF3 3N7LA 1JW6A 1DLCA 4MG2A 3TRSB 1H8TB 2BOIA 3O0WA 5FYHA 4X8PA 3I2OA 1S2EA 2VNOA 2CU5A 3S5QA 3RZMA 1DGLA 3HIFA 1ASJ1 1DHKB 1NLRA 3B00A 4IW3A 4UFIA 4AAPA 4PI0A 3DCQA 4FQZA 2Y0IA 4BE3A 2P17A 3A0NA 4LIUA 1JYNA 3IM0A 4YNIA 3KQRA 3POIA 5T54A 2XJQA 3ZFEB 2AUYA 2AZ5A 2P3JA 5FUPA 4ET7A 4GMP3 2GSYA 5GLWA 3OYWA 1JHNA 3AP6A 2D40A 3RMXA 3I3BA 2BNMA 1EUTA 2JB4A 4B29A 3VGIA 2DTYA 3KQ4B 2BW8A 1ENRA 1J59A 4AGRA 4W8JA 2Y0OA 4N90A 4Y26A 1SHWB 5JOZA 1UW8A 3H0OA 4RQPB 1NXMA 2YU1A 2D3SA 3PUAA 4H2AA 5C71A 2O8OA 2YY1A 4EZHA 1AR81 3J8F2 4QHOA 1O6UA 4HZFA 3WSOA 4IV1B 1GFF2 3UNPA 2FCTA 4UFMA 1YQ6A 3GNEA 4AI8A 2V4VA 2XJUA 3O5SA 1H1MA 1CN1A 4INDA 2VOTA 1AZDA 1ZBA2 1W6NB 3WOGA 2W0XA 2JDHA 1VMHA 2VULA 4XBLA 4WZFA 3QBQA 1OMIA 2WWUA 4RS5C 1QQP1 1VBA1 3FN9A 4CPBA 3HR9A 1CAUA 3W20A 1NXD1 4DRRA 1W3XA 4QQ2A 3N7KA 1YFWA 2IXCA 3RZHA 3NO8A 2ZMNA 4S2HA 1NKGA 1Z7S1 3AC0A 4BQ4A 1JZ3A 3LD8A 3BPSA 5IVYA 3EQEA 1S0GA 1WCDJ 2O0OA 4QQLA 2VUAA 2DWRA 4XF9A 4Z82A 4CU9A 1FV3A 4EWAA 1CZSA 1K12A 3GXUA 2DCJA 4ASMB 4FBFA 4LTAA 2VMIA 5JXGA 4QPIB 1DZQA 3D0SA 2D6PA 4LO7A 4UWDA 4AFCA 3JZVA 4D6QA 4GQ7A 5FXVA 4LT5A 1FXZA 4PDWB 3FLTA 4TSVA 3VV1A 2K0GA 3VDCA 4H7MA 1VMFA 2WN3A 2X53S 3SKVA 2EVXA 5APAA 4YM3A 5HCBA 4EE2A 3PU8A 4C0HA 2BVVA 5LZ6A 1U0AA 3VBFC 4XJWA 2J1UA 4G4FA 1KRIA 2PAKA 4DRVA 3ZSEA 1VPHA 1G9DA 3WDTA 4BJ0A 4CYDA 2FZ2A 5C9AC 4R52A 4P9GA 2LM3A 3ZFGC 4IXLA 3E6CC 4CDUB 5BV6A 1QJU2 4A42A 5T5OA 3N4MA 1JTZX 1DGRA 4XF3A 2C1FA 3Q8CA 3O1OA 1I5PA 3I3MA 2ZMLA 2ZX1A 1OOPA 1QJY2 4ISQA 4HSJA 1G9AA 3ZPOA 1UCXA 5A32B 3SNMA 1V6MA 1H0BA 1DFQA 1VAKA 1PX3A 2HWD2 3SHRA 1E5SA 4L8QA 4ASLA 3LGRA 3KT1A 2GU9A 2YPJA 1S4CA 2G9ZA 3AXEA 5T5LA 3LEIA 4YVWA 4GWIA 3DUIA 3LSEA 3QD6A 5FZ9A 1YEWA 1CAWB 1ZZ9A 5T52A 1PZ7A 1UY0A 2VMDA 3ZN5A 1H2LA 3M8LA 3VHPA 3P3PA 2WZR1 2ZHNA 1LOEA 1DU3D 1H8TC 3J26N 2Q8CA 2WQ4A 4LHNA 1QKQA 3AKPA 4LKEA 2J1TA 3WP3A 3AB0A 4GJYA 3W21A 2ZGUA 4GMP0 4QXBA 3AP7A 3U4XA 1X9PA 1RUE1 5DQ0A 1MQTA 2P5BA 3L2HA 3ZFEC 2J1EA 3T0AA 1C3HA 1OA4A 5FMDA 3VKOA 1ASJ2 2YHJA 3RG0A 4XCBA 3AKTA 5EWSA 5IK5A 2XUMA 4K40A 1EPZA 3NJYA 2W52A 4NR1A 4XF1A 2GH8A 4EN6B 4XOGA 1HRV1 1L7RA 4CP9B 2B5HA 1FPN3 4MVTA 4A7KA 2VUDA 2X10A 3BIWE 3GCXA 2ATFA 4YGBA 1KFXL 3CO2A 2VVEA 1YQ8A 2WN2A 3MPBA 4RQPC 1CX4A 1LEDA 4LKFA 2D3RA 2UWAA 4Q4W1 5FY9A 2ZA9A 1BVVA 5H9RA 2WO7A 4Y24A 4P08A 4CP2A 3ACIA 1B35B 1KEXA 2TBVA 2XQRA 4OLLA 5K4LA 1UXXX 1UZWA 3ASIA 3P6BA 4ZZ8A 4M4PA 3RDIA 4P5YA 3UYJA 4ASKA 4XAAA 1PO21 3IB3A 2DCKA 3Q8FA 1OKQA 1AR82 1BBT1 1SZBA 3DXUA 4Q4X3 5FYSA 4JTOA 2C24A 2WO3A 1UKGA 2Q1MA 5L36A 4I09A 3H50A 3ACHA 5FMBA 1GWLA 2UYBA 5I0RA 5FXXA 3MW4A 4PI2A 2FCUA 4CEWB 2XVKA 4JGZA 4QX2A 2ARCA 2WQ8A 5CU1A 2YPDA 4WM7B 3WDXA 3I3QA 1QH6A 2DVGA 4DZGA 1O3RA 3VBSA 3VBHA 2VZVA 5A7OA 2QZ2A 1F9KA 1QQP2 1VBA2 3ENRA 2BGOA 2VM9A 3H8RA 1FMD3 1OT5A 4WM8B 4ZHNA 4XUQA 5FO9B 2BWAA 1JHJA 2XB6C 4QPIC 4FOYA 3MGUA 2EALA 3U78A 1X36A 1OI6A 4FPYA 2VQTA 2JJ6A 4JRLA 2DCZA 1HN1A 4XXAA 1IQDC 1BCXA 1R081 3AKQA 3SCGA 3SH4A 3PVEA 1IHMA 5AFEA 5JI9A 1GWMA 1RVF3 4AHZA 5JMOA 3THDA 4BMBA 2VXJA 4OHVA 3QLQA 3HNYM 2ZEYA 5F3GA 1REEA 4NUBA 2UWCA 5H9PA 4EN7B 5ACA1 2UY8A 2VCAA 4KWLA 3CZUA 4BQ5A 3IZOA 4BQXA 3N9PA 3POGA 1OA2A 1C57A 3UGFA 5EPAA 2JX9A 4YZ4A 2EXKA 1O91A 4FPGA 4CDUC 5ABJA 4MOAA 5FQ0A 4HETA 4S2FA 2YYOA 1X82A 3VZOA 2AH2A 4GH4B 1NLQA 3IN9A 5FP8A 1J1TA 3KGLA 4IESA 4Q0VA 2X5IA 4XFIA 2Q1FA 1L7LA 2HWF1 4XQ4A 5FP9A 2ZGTA 1CPNA 4EJRA 4AEMA 2FDKA 4DQAA 3R4DB 1GQPA 2OUJA 4Z8BA 1REDA 2RDNA 4FOQA 1BYHA 2PQQA 4CCMA 1O3SA 2D6OX 5BNOB 4FVVA 2VZTA 3U14A 3T2OA 5I8SA 1ACCA 2GALA 1C8M3 2OT7A 3CIHA 3OYWB 5BNNA 4OQ8A 2BTVC 3ZKYA 1PM4A 3ZKUA 1GQGA 2WZR2 2CAUA 3M3CA 4QU1A 3HBKA 3AL5A 2A71A 4IEVA 5ANQA 4YW5A 1ENQA 4IE6A 1TNFA 1S0DA 1U5XA 2P3KA 2WJSA 4QPGA 4UW3A 3U07A 4YGCA 3WX5A 4AQ6A 5FZ0A 4RYDA 3ZN6A 3ST7A 2GAUA 2PXJA 2BUKA 2UYAA 5KXBA 2BPA2 2XMLA 2R071 3JQXA 4COWA 2QQIA 1ENSA 1RUE2 5D21A 4BZ4A 5LEJA 5EJ3A 5CB7A 1SCSA 1XE0A 4Q8LA 4DUXA 1D2QA 2XDVA 1UYYA 1GANA 2ZABA 3T1MA 1XSRA 3ZDVA 3I49A 3V56A 1MVEA 4KMQA 1JZ7A 2ZX0A 2HWC2 1DZTA 4UFKA 5LBBA 2WZPP 2QDNA 1OLRA 2VZ3A 1LODA 1US3A 4Y1ZA 3T2TA 3VZNA 4AXOA 1HRV2 1UPSA 1WW6A 3VD3A 3ZDSA 3AFGA 1AUYA 3SMHA 2QQOA 1URXA 4Q1RA 4LITA 1CAUB 1B35C 1JN2P 1N3QA 3LAGA 5FPVA 1DBNA 3V0AB 1GZWA 2JB8A 2WA3A 3DPRA 2FQPA 4LE3A 5LY1A 3WY6A 2ID4A 4Q4W2 2RM23 3KV9A 4COZA 3N9NA 3D0JA 4ZXKA 5BUVA 3LWCA 4NJ4A 5A70A 5E88A 2ZACA 1RIRA 4AQSA 1AXZA 5GZCA 3O1UA 5F3IA 1GZTA 5CKMA 3P1IA 4YW6A 2DVFA 1PO22 3KMHA 4CEWC 1E5IA 4QQHA 1BBT2 3OGGA 4WM7C 3RGBA 5KHIA 3TEWA 2ZCWA 4LBOA 1N1TA 1CIYA 3IAQA 2EAAA 3NAPA 1W0OA 4MGIE 1QEXA 3UL2A 2R041 2GH2A 1JYIA 4E4ZA 4XCAA 1HB2A 3FFQA 2B46X 2O14A 3QACA 4FP3A 4CEYB 4WM8C 3O0VA 4O65A 5FZ1A 3U0ZA 2OZJA 3UESA 2OUHA 5EIYB 1W99A 2UY9A 3KT4A 2FDHA 2OA2A 2XVLA 5CFDA 3N35A 2VUJA 3FL7A 2LTNA 1A6CA 4FPKA 2PHWA 3DL3A 5A7PA 1EAH3 2F4LA 4RL7A 1W8OA 2BFUS 1AHSA 3DV8A 3K3NA 3EB7A 4KL1A 4DEQA 5JLVA 4DXSA 2OYZA 1O59A 2RS53 3LOIA 5FLJA 1ZYBA 2VTXA 5I0UA 4XDQA 3VBFA 4DXZA 4E2SA 3UK9A 5F5CA 2V5DA 1R082 4BQYA 1P8JA 1SG3A 1OOPB 2Q1ZB 3LPFA 2VMGA 1S2BA 1YI7A 2PAMA 4GWJA 2ZGNA 2GNDA 4CDXB 3E5XA 2X8KA 4QX0A 2VO5A 5C8CA 1CZVA 1QOSA 4N9IA 4QDRA 5ACA2 3O1MA 4W6WA 3OY8A 1O5UA 4EWEA 4QD2A 4YVWB 5J96B 1Q8SA 4GH4C 4ZU5A 4DIQA 1W8UA 5I8YA 1JXNA 1WD4A 3WQ1A 1DYPA 2G9GA 2WT0A 1TZOA 1FI2A 4CUAA 4AI1A 1K3IA 4LBJA 4RHV3 1G9BA 4WVVA 5E1RA 5FJHA 1V6NA 3AZVA 1ZRFA 1H6YA 4FTSA 2ZHLA 2XXZA 5BPXA 5C5UA 1W8NA 5K8SA 2IXIA 2HWF2 3OGSA 1HW5A 3DYOA 1MQTB 2DFBA 4JDOA 2R30A 4JKLA 5BNOC 4KG8A 4LUKA 4JX0A 1VBC3 2J1VA 3AMPA 4K21A 2R1BA 2WAOA 3P5BA 1T6BX 4WVMA 4O7XA 3UKNA 3WW3A 4FTBA 4XBNA 2I07B 3AMMA 4QQOA 3UV9A 5FY4A 2PYTA 1O4YA 3BYWA 3TNQA 4OZXA 1UD1A 2P2KA 2RMU3 1OSGA 1V6OA 5LEKA 2Y26A 3HD8B 3OBRA 1M4WA 4FPLA 3GZEA 2PHLA 1YFUA 5FPLA 4LQRA 1LHNA 1ST8A 3RS6A 1RUNA 1KJRA 1YC61 1Y9GA 1QNWA 2CYFA 1JS9A 3ACGA 5FP3A 3BTZA 3CJXA 2OZ6A 2TNFA 2VOWA 3DEMA 3NMBA 3NW4A 4P00B 4UFHA 5IVFA 3WG1A 2LRPA 1AX0A 1N47A 2W9XA 2R072 3WUCA 3ZXFA 3B01A 2FD8A 2ADDA 2NN8A 1QJX3 2VL4A 5FLIA 1MEC1 2YG0A 1LULA 2CSGA 2DF7A 3V0BA 3HNMA 4IV1A 1GUIA 2B8MA 1RJ7A 2BNNA 3AL6A 3FUOA 3KF3A 2ZEXA 4NPRA 2WO2A 4W65A 1R093 4JGZB 5C70A 1SLLA 2HKXA 5F39A 5GALA 2FMDA 3OGRA 3T2QA 1LB2A 2IVJA 1XNKA 3B9IA 3VBHB 3VBSB 3ZLIA 5DXDA 4C90A 4UBGA 5LW9A 4HKOA 1W6PB 2RS31 4IEYA 1H30A 3LE0A 1JU4A 2JDNA 2WFF3 1MS9A 1OQ1A 1VBD3 2VCMA 3GJBA 3VB9A 5IVEA 4RGGA 5D1IA 4EZ4A 3H8OA 3QH7A 1A34A 1TMF1 3V65A 2JDPA 5DABA 3J7HA 5A33B 2HEYF 3FFZA 2VMHA 1Q8PA 4CUCA 1DIWA 4CEYC 4Z2WA 4W4ZA 3HQUA 5AFBA 3OF1A 4FAHA 5A80A 3KCXA 1ZRIA 3B94A 3NSTA 2B42B 3BODA 1OF3A 4UAPA 4BK5A 2R042 1AYM3 4PDWA 1X50A 1ULCA 4HKLA 3EXUA 1NZIA 4FFGA 5DDJ3 1GNYA 1MS5A 2CY6A 1VAMA 4RFT0 1X9TA 2VD7A 3PU3A 2RR13 1KXGA 1TME1 5FQ0B 3RNSA 5ABJB 2DVDA 2PTMA 2Y64A 1PX4A 3BU7A 2VE1A 1HRI1 4CTEA 4AI9A 1OOPC 1RUI1 2X5IB 1D0GA 5AC93 2R061 2YUEA 1FAYA 1KFUL 1QGLA 1RUG1 2ZGSA 4L99A 2H0BA 4AGGA 3H3UA 4KWUA 3T0DA 2GC3A 3CBNA 1PIV1 4YVWC 1YFYA 4XW3A 4NHMA 1OUXA 3PVNA 2HWD3 4B7KA 4ZS3A 2WYFA 3JD73 1J3QA 2JD4A 3LEMA 3ES1A 1ND3A 3U10A 4EQVA 4K8RB 2YFUA 1W2NA 3PIGA 1S0EA 2HWB1 3O14A 5BNNB 2WZEA 1DZRA 3MEPA 3SITA 3GYDA 4LULA 2AENA 2V72A 1HN0A 2OX0A 3GM8A 4BYYA 3AZZA 3MW3A 4D8MA 1GOGA 1MQTC 3GZUC 2KR2A 2VZOA 4M3CF 1WLTA 2MEV1 4QPGB 2NZ9A 3NNGA 2HWE1 1RUH3 3JQWA 3LDKA 3OD0A 4MGZE 3I2JA 4TWTA 3ZN6B 5KBFA 4JV4A 2OIIA 4R4ZA 1W9TA 1UY1A 1PGL1 4I0WB 4XF4A 4CA9A 5B4XA 2AC1A 3K4AA 4GXLA 4IQPA 4LMFA 4PF5A 4D6SA 4JHTA 4YW3A 3WG2A 3M3OA 2ARXA 3MLJA 4EYUA 2DYCA 3MIFA 4XACA 5C6CA 4QU2A 2A70A 2Y6FA 1LTEA 3ILFA 3CHXA 1RXFA 2FZ1A 2UURA 3DGTA 3BUCA 4AFMA 1IKQA 3POEA 5HXVA 3H1WA 4JKKA 3SEPA 4F83A 3EO6A 1WA6X 3N7MA 3RQ0A 1OUSA 1QOTA 2GDFA 5JSRA 1WA4A 3ON7A 1C5IA 4I0BA 2C4XA 1GZWB 5L9RA 2C9AA 3DPRB 1ULDA 5A3WA 4D3WA 4FXGB 5EP9A 2J42A 4IEUA 4ATFA 1JH5A 1XNDA 3I2GA 4JKMA 4NHLA 2QTWB 2YU2A 3RMYA 3KS7A 1W8TA 4B4RA 2F6BA 4XEZA 4JGZC 4LORA 2D6KA 1NAEA 4ONUA 1BZWA 1MEC2 1I1EA 5DZGA 1QH7A 1S0BA 2V09A 2PLV1 3NAPB 3VBHC 3VBSC 4JQRA 2JDZA 1MS1A 2XLGA 2IFRA 3X29B 1EPWA 5FLHA 1W39A 5FZIA 4NROA 1S0CA 4JDMA 5BNQA 1HQLA 4Z2AA 4IV3B 2JIJA 4LO4B 3I59A 3WDVA 4TLGA 1PNFA 3ZXLA 1S0JA 3UT0A 3WVJA 5CFDB 3CU7A 3OPWA 4OYUA 1VBB1 4KI5M 2JG9A 1J84A 1A8MA 2RS32 4K1YA 4KGQA 3AZXA 4AVSA 4BPZA 2JEMA 3MFAA 4WM8A 1YUDA 2JDYA 3M3QA 1IG3A 1ZX5A 3GBGA 1DDLA 5FYIA 5L7OA 1TMF2 3FZ3A 4HKWA 1ZREA 1UWWA 5IAVA 5IT6A 1OH3A 4XMIA 1C4RA 1FOD1 2VAUA 2RG4A 4Q4Y3 4BOWA 5I0SA 1PZ9A 2GN3A 2HBTA 5C8CB 3ZSLA 1UX6A 1QXRA 2HEWF 1SACA 1DYOA 3LZZA 1DCSA 1POQA 3OY8B 3OGVA 4GB32 2RJKA 4K3UA 1F2NA 2YMZA 2W1UA 4LBMA 2I2SA 3MUZ1 4S2GA 5C33A 3JUUA 4JZRA 2X5IC 2P6CA 2P4EA 2MPFA 3WDWA 3ZXKA 4D6RA 1COV2 3O0XA 1TME2 4M3CE 3NNMA 4MX3A 4P9LA 2GC0A 3SLIA 3TBDA 3ZX7A 2XKPA 1HRI2 1W9SA 1X33A 1RUI2 3PTRB 4LEJA 3D6EA 3ZIWA 2R062 2EICA 3BN6A 5FPXA 5DMYA 3OEBA 1RUG2 1LKNA 4FOWA 4BIOA 2ENRA 2R7EB 4UBHA 1NA1B 2CGPA 5F9TA 1PIV2 1E5HA 1YFXA 2BERA 4YM0A 4AHWA 4CVUA 4CRQA 1JYXA 4WVMB 5BNNC 5EYYA 1JUHA 4P02B 4SBVA 1W6QA 4XTMA 4FTEA 4LUMA 4Q27A 2XL7A 2WWJA 4G9SB 4B1MA 1UY4A 4DUWA 4KQ7A 1ULGA 3BTAA 5BNOA 4QPGC 5C3SA 5FYVA 4ATEA 2HWB2 1W05A 4LBLA 5FK8A 4ZY9A 4M01A 4N7UA 5FR3A 1KDKA 4EROA 4BLJA 2VOKA 3NJZA 2WUHA 4AI2A 5C7GA 5HPOA 1JU3A 1POV3 3DECA 1U5ZA 1UIKA 1RXGA 1V70A 2MEV2 4Y3OA 1TG7A 4V2WA 3O12A 4FPOB 5J37A 2YDEA 3DYMA 4AVAA 2QE3A 4IERA 1I6XA 2Y38A 4QX1A 4COUA 1JOJA 2FMYA 1BEV3 4LHSA 1PGL2 5LA2A 3T0BA 2EIDA 1VP6A 4QX5A 3V0BB 3ZSJA 1O8PA 1BK0A 2VG9A 1ODMA 1UU4A 4Q4V3 4URAA 1C5HA 3IWZA 2HWC3 3VN4A 1GU3A 3PL0A 3NQHA 5CISA 4H14A 5FYTA 3VL9A 3DPRC 1ENXA 3ZXGA 4NAMA 4XUOA 5A7WA 4YZ2A 1PGW1 4IGQA 5KC6A 1NQJA 5BXXA 2AR6A 2JD9A 1MVQA 5FZFA 1W0PA 5KWRA 2MHFA 3HT1A 1XNAA 2YBPA 5FV3A 3RZLA 3MIBA 1KGYA 4P9YA 3V0AA 4HLTA 4FCAA 3FJSA 4XIKA 3VZMA 4AVBA 5C5TA 3ILRA 4D0QA 1W8ZA 3NAPC 1QDOA 4DPNA 1QJZA 1JZ2A 1UZ0A 5A7QA 5SV5A 1IG0A 1O5LA 1QWRA 5C4WB 3RVHA 1AR93 2B39A 2ZS6B 3NNFA 2DTWA 4AVCA 3MICA 2AYHA 2PLV2 5LA0A 2E6VA 4L92A 2GMMA 2F17A 4A45A 5CFDC 1LECA 5IK8A 1RUC1 1UF2C 4TLFA 4W50A 4XXPA 3UKTA 5F3CA 2R1DA 4CEYA 4L9BA 2FDJA 1PVC1 2WR9A 5FYBA 3ZXDA 5IW0A 2VBBA 4FAGA 3ME2A 1REFA 1VBB2 1MACA 2WYSA 2ET7A 2RVAA 3AYAA 5FPBA 2BEOA 4Z07A 4L2NA 2FCVA 5GZGA 4BK4A 2Q8OA 1XNTA 3TEYA 4LBQD 1OXCA 4NMIA 4AEJA 5C8CC 1V0AA 3OSDA 1TE1B 2QDRA 1OLME 2CDPA 5TSWA 4YZ1A 5IVCA 5A3NA 4R9DA 4X8NA 4FSJA 1ZBE1 1FOD2 3PMSA 4Y22A 2E7TA 3POBA 4ZPIA 5F5IA 1J83A 1WLWA 5JIAA 4CDXA 3INAA 2B9UA 5F37A 2JE9A 4YW7A 4FI9A 1ND3B 5DZEA 1D4M3 4META 3E1F1 4AE2A 5J36A 4YVSB 1BKZA 3AM2A 1O4TA 4C0BA 2YGMA 3LOBA 3MIEA 4AK3A 5F6KA 1OFSA 2ZGLA 3E97A 1PMJX 4LK7A 2GNTA 1RUF1 4TZDA 1U12A 2WNVA 4NPMA 1NA1C 3ABZA 2SBAA 2WS92 1CQ9A 4KH9A 1AR73 4XJUA 2JDUA 3T09A 3ZYHA 5M0TA 5IVBA 3OBTA 3N9OA 2EIEA 1RUJ3 3ETPA 1KS4A 3K51A 2HWF3 2WKKA 5DUUA 3VL8A 3BU0A 5I93A 4GWNA 5FOJB 3I2KA 1PM7A 2D3PA 5FMCA 1MZFA 3VBUA 1POV0 4GMP1 5FKCA 4PIYA 2H0VA 3TN93 4OFGA 5DG1A 1C28A 3B69A 4QKFA 1JYWA 4EV0A 4WVWA 4NN0A 1O7FA 1FNZA 2VGDA 2WNEA 2IXHA 1VIWB 2B9VA 1T2XA 4XFBA 5FMOL 3T08A 4QPYA 3JBG3 2EXIA 4Q0SA 4JDNA 5FYUA 3NRUA 4P9WA 1AJKA 2QFEA 3C7GA 1OFNA 1WMXA 2E33A 3N3HA 1H6XA 3DXTA 4IV1C 4EN0A 2N7GA 4XC9A 1F15A 2R073 4CPBD 2XGXA 1IOAA 1LJ7A 1GR3A 4BQWA 1RMU3 4LO6B 4LHKA 3DYPA 4BB3A 4GULA 5FZ3A 2G9FA 3TEZA 4XABA 3VDAA 1D2SA 1YO8A 2WL1A 1WCKA 1RB8G 5FZKA 5FXZA 5HCHA 4AR2A 4XJ9A 1UQXA 3I59B 1RITA 2QQWA 1HKDA 2WDBA 4AZZA 4FPEA 4XPVA 1JYVA 4J6GA 3Q9OA 3IAPA 4Z1VA 2JG9B 2QQKA 1CJPA 4HXCA 2JECA 1KJLA 2GC1A 3A0KA 3SKJE 4Y1UA 1W6PA 1NQDA 3RJ2X 4MGSA 1BK1A 3VHOA 3C3VA 5F6LB 2A73B 2XPJA 4NRMA 1N1VA 1VBE3 2ZBJA 5C4WC 1AL23 1S0IA 1Z7S2 4ZXEA 4BXFA 5L7OB 1JZ4A 2ORXA 5J98B 5T5PA 1ZZ6A 2D43A 2WRAA 2XHKA 3DN7A 4JHZA 4L11A 4PDWC 5A33A 3K4ZA 3U11A 3BGAA 4DB5A 2A6ZA 2Q8DA 2NQYA 4UXAA 3I2HA 3LB9A 1OLQA 2RV9A 3J4UH 2ARAA 3P3NA 2A5ZA 1PGSA 3MBWA 1RUC2 4IE4A 3GJAA 1W3VA 3OUIA 2ZJCA 1X8MA 1PVC2 5FYZA 2J7MA 1UAIA 3K77A 5EXOA 5T3NA 1H1IA 4MO3M 4I2OA 4PJYA 3OD4A 3WNPA 1DQ5A 1AF9A 5KHHA 3FHAA 4PHZA 3K3OA 3USUB 3VD5A 1CWPA 4B8EA 1VE0A 1HB3A 1XB9A 5ANNA 3H8UA 3D5OA 4JQTA 3ZYBA 1UY2A 3PUQA 4CZSA 1ND3C 3MUY1 4MV2A 1UL9A 1US2A 2WSVA 3HN3A 2H6BA 4YVSC 1ZBE2 4BLIA 2DURA 4N8MA 3DKQA 3ZYFA 1W6QB 4MADA 1DGRN 1AJOA 3I8TA 1LOFA 3B5LB 4RN5A 5E89A 2R0FA 3ZOIA 1UX7A 2VMCA 5CKQA 2OKXA 3U1XA 3WW4A 4OMDA 2W92A 1AVBA 2HH9A 2YV8A 1TEIA 3BB6A 1UOGA 1S1AA 4NO4A 1RUF2 3EJKA 5FY5A 4JRAA 5JR2A 5JSOA 1RHI3 1WBFA 1QJFA 2A6VA 2X05A 3M3EA 2DBNA 3ZSKA 3BI3A 2ZKLA 2W87A 2WT1A 1ULFA 2XH6A 4P9XA 2OS2A 1AR63 3DKWA 4LLFA 1W6MB 3AKRA 1D0HA 1Y9MA 5FUIA 5A1AA 4XURA 3BOWA 1SLTA 2XBO3 4YG3A 3SEEA 3WP5A 2LUWA 5EFUA 3DF0A 3OJBA 4H7LA 1W9FA 4LBNA 4JAAA 4M0NA 4PQ9A 4DUVA 5A7WB 4LKDA 5FPZA 1GSLA 3PMEA 5C3RA 3IMMA 2GN7A 2FDGA 1WMFA 5G05L 4W6YA 5LBFA 1VAVA 3O1VA 3CJIA 1F5FA 3FHQA 5T55A 2AEYA 3ZO0B 3VDDB 2XJRA 4F8AA 4A7YA 2ZX3A 3N9LA 5ABJC 4NRPA 4PCRA 2GMEA 3T1LA 4ES8A 4K1ZA 3LDRA 4Q4X1 4QX3A 2DBIA 1HIXA 4D7SA 1PMIA 5FTTC 3KB5A 4DINB 4DY3A 2VC9A 3WQ0A 2EXHA 3UKVA 4R9BA 4QGLA 4XDPA 4BU2A 2KD7A 5F2SA 1LGNA 4AFAA 1FNYA 2JG9C 2WBKA 4YM1A 1UN1A 1VRH3 1CR7A 1HQNA 1V9U3 3KF5A 4URTA 3HQRA 5EV7A 5FZOB 2JICA 4FFIA 4OHZA 1FMD1 4A3XA 3AP5A 1W06A 5JPMB 4E9KA 4IV3A 4D7TA 2ZAAA 3MIHA 5CFCA 1MS3A 1JYCA 1Q5OA 2O8QA 1OD3A 2QQMA 3NNLA 4HVOA 4JGYB 4EWDA 5L7OC 3C2UA 3PNAA 3H7YA 1RTVA 1AYN3 4XMAA 2DDUA 2LW8A 5JCTA 2NP0A 2AEZA 4PIXA 4XE9A 1VRBA 1RVF1 4S2DA 1RINA 2R49A 3BKZA 2VMFA 4MHRA 2Y6HA 1FV2A 5JDBA 4OZOA 4KWKA 3EHKA 3WP4A 1W03A 4QX8A 3O1RA 4NHKA 1W9WA 1V6IA 2K46A 4Y22B 3B7MA 5GKAC 4AOCA 1NE6A 2HEVF 3ATGA 3I3DA 1OQEA 3CNAA 5FPAA 4CCDA 4IEQA 3ORJA 4GB33 3S57A 2ORZA 3KGZA 4OHWA 1NYWA 3VD9A 3WT3A 1YRZA 4FPFA 3EBRA 1HB4A 1OURA 1F35A 2Z5WA 4AEDB 1NCRB 4Y1YA 1CGPA 1EV13 4XQWA 3RI8A 1NY71 2ZOEB 3D8CA 1WCSA 4CP0A 1YIPA 1COV3 4QWNA 4AVVA 3F2ZA 4QPWA 1NOVA 3RJRA 5J09A 2P6HA 2WNVB 5JUVA 4QXKA 1J3RA 4NHXA 2KA3A 1HV0A 1HDKA 1HXS1 1LOGA 1NCQA 1HRI3 2ZGOA 1ZZBA 3ZR6A 2YFZA 2BQPA 2VTXJ 3ZYGA 2YGLA 2JE8A 2C0ZA 3ES4A 4OHYA 2RHPA 2XR4A 3K2OA 1VJ2A 4B3NA 3ZMNA 4CUGA 4AQTA 4Y33A 2WINB 1NA1A 2XJPA 4BMEA 2DUOA 3VBUB 3GBWA 2E53A 1Y43B 1Z78A 4COYA 5D8AA 1C8M1 3WG4A 3N36A 4QGNA 3OBZA 4E4HA 1AL0G 1MS8A 4PLMA 2BU9A 3OB8A 2JG8A 3POWA 3R4SA 5A6QA 1LU1A 4HK8A 3LKJA 4GIQA 5SV8A 5DAVA 2E7QA 2YC2A 3USSA 4RGKA 1WKYA 1OQDA 3ZFFA 1UOFA 1W6OA 2CL2A 2VNVA 4MSVA 2MEV3 2OVUA 1GNZA 5GJ6A 4QXCA 3PUSA 4QHZA 2IWGB 2QQNA 3CEWA 4Y4RA 3ZXAC 2ZEZA 4Y5TA 4AF9A 4CSWA 1GQHA 3JU9A 4UYBA 1RUD1 5JR7B 1G9FA 1R64A 4HFSA 4OCTA 3J8F3 5JZGA 5JPNB 3GDBA 4PQQA 4FO9A
chains in the Genus database with same CATH topology
1ZA7A 4OQ8A 1A34A 3J7NA 3J7LA 4OQ9A 4NIAA 1YC61 3J7MA 1JS9A 1CWPA 1STMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZA7 A;  4OQ8 A;  1A34 A;  3J7N A;  3J7L A;  4OQ9 A;  4NIA A;  1YC6 1;  3J7M A;  1JS9 A;  1CWP A;  1STM A; 
#chains in the Genus database with same CATH topology
 4V2V A;  3NV4 A;  2V73 A;  3H7J A;  2XJT A;  4GA9 A;  3M2M A;  5JSP A;  5JXI A;  2DVB A;  1ZBA 3;  3OCP A;  1XQN A;  3T2P A;  2Y33 A;  1UMZ A;  4LOT A;  5IUQ A;  4CXY A;  3VDD C;  1J58 A;  4LO5 B;  3ZMO A;  3AZW A;  4YZ5 A;  3MYX A;  3RYR A;  1UZY A;  2HYK A;  1U5Y A;  4PLO A;  4XHB A;  3MDP A;  1CAX A;  3KHC A;  1R1Z A;  4E4D X;  1DGW A;  4XJZ A;  3A22 A;  3WNN A;  4O61 A;  1GYK A;  5EYX A;  2VZP A;  4XFG A;  3ROU A;  3FMG A;  2X29 A;  3AK0 A;  3QH6 A;  2WA4 A;  1OBN A;  4Q4X 2;  3WQ7 A;  3MV1 1;  1SFN A;  1XYO A;  2ETE A;  3J9S A;  2QCS B;  4KU7 A;  4UFJ A;  3ZIX A;  1UXZ A;  2FDI A;  1YQC A;  5EJ1 B;  4M00 A;  2CWM A;  4QMA A;  5C4W A;  3S7I A;  1SFY A;  3J7M A;  2XUE A;  4Y4Y A;  5HCF A;  2E7A A;  4A6S A;  4FFF A;  3BTX A;  4JGY C;  4Z92 B;  2G19 A;  3WNK A;  5CAZ A;  3SH5 A;  5GM0 A;  3RPQ A;  2P37 A;  1EAH 1;  4LLO A;  1FMD 2;  1SPP A;  1D7P M;  2TEP A;  5FXW A;  5KXC A;  1IS4 A;  1LRH A;  4FPH A;  2FDF A;  2BRT A;  4Q1P A;  4IDZ A;  2RS5 1;  3ACF A;  4D69 A;  4M3C A;  1G86 A;  3NL1 A;  4YW4 A;  2EIG A;  4Q0Q A;  4FOV A;  2D6N A;  1ZA4 A;  2PHT A;  3I2I A;  3R05 A;  4XFH A;  2VCC A;  5GLT A;  4FPJ A;  4FXK B;  3I7D A;  5KC5 A;  5KXD A;  4CDX C;  1RVF 2;  1BMV 1;  3ZYR A;  3KSC A;  1QJU 3;  3S7E A;  3ZYP A;  2E51 A;  1XYP A;  2ZGR A;  4BHP A;  1GZ9 A;  1NZC A;  4RD7 A;  4C8D A;  3FE5 A;  1QJY 3;  4IGO A;  1FOD 3;  4QDQ A;  4AED C;  1RL3 A;  2QZ3 A;  2CNA A;  2WLP A;  1XNB A;  2PAE A;  4N43 A;  3C7O A;  3AZY A;  4LHL A;  1HJF A;  1GP6 A;  2WNV C;  5IWF A;  4HVQ A;  1LAJ A;  2IFW A;  1VLN A;  2V4A A;  4RHV 1;  1VAL A;  2VW1 A;  3AJZ A;  4LBK A;  4TYS A;  4YVS A;  5LBE A;  3RWK X;  2F4P A;  1DQ6 A;  3NJX A;  3POJ A;  1NY7 2;  4GKY A;  3ZR5 A;  2Z69 A;  1LOC A;  4BWO A;  3HNB M;  5H9S A;  1HXS 2;  2WS9 3;  4CXX A;  1J1L A;  1GZC A;  2PHU A;  3VBU C;  2VH9 A;  2D6M A;  2XVG A;  1I3H A;  3OUJ A;  1VBC 1;  4FFH A;  4YG0 A;  3AMH A;  5IJR A;  1KS5 A;  2YXS A;  5LAS A;  3JXS A;  1XXN A;  3MO4 A;  3VLB B;  2X09 A;  1F8V A;  1WW7 A;  2QNK A;  3FBM A;  1ULP A;  1H4H A;  4JTN A;  2R16 A;  2DFC A;  2VBP A;  2W95 A;  2Q5T A;  3I3E A;  4CU6 A;  5A1F A;  3UGG A;  1ASJ 3;  2ZXQ A;  4IEW A;  3WD5 A;  2RMU 1;  1C8M 2;  4EN8 B;  5FRE A;  2HYX A;  1DP0 A;  3WDU A;  2C9K A;  2XG3 A;  4UW5 A;  4CCJ A;  1IS3 A;  2BDR A;  3VKN A;  4BIF A;  1CAV B;  5IFP A;  4RGA A;  1UYZ A;  2MNG A;  1SLB A;  1Q8Q A;  3CJI B;  1WW4 A;  3RYK A;  5DUW A;  1GBG A;  2Y60 A;  4OMC A;  4HN0 A;  1H8V A;  1GIC A;  1QJX 1;  2W1S A;  5EZW A;  2PFW A;  5BYN A;  4K8F A;  4N53 A;  4UF0 A;  3PHM A;  2ZTN A;  2OQ6 A;  3WLU A;  1S2K A;  1S55 A;  2C26 A;  3THT A;  4XYX A;  1WME A;  2EA7 A;  4UFL A;  5FBJ A;  4XTP A;  5IAX A;  5FZM A;  1RUD 2;  2Y6J A;  1MZ6 A;  1R09 1;  4IE5 A;  4KU8 A;  2D97 A;  1AR8 3;  2IC1 A;  2WFP A;  1K5M A;  2PN5 A;  4J1W A;  3ECQ A;  4QB1 A;  1HQW A;  1YQ5 A;  5FYY A;  5FY8 A;  4CE8 A;  1HLC A;  5A6Z A;  2VPV A;  2YRO A;  2BJS A;  3LA2 A;  3VBR A;  5BNP A;  5IK7 A;  2LAL A;  5FZ7 A;  3B3Q E;  4ITC A;  5CFC B;  1H2N A;  2WFF 1;  3MI8 A;  3VUO A;  1VBD 1;  2J1S A;  1QMJ A;  1XRU A;  3TYJ A;  5LA9 A;  3W59 A;  5I8T A;  1KQR A;  1LCL A;  1QQP 3;  1VBA 3;  4QDS A;  3ITQ A;  4QT6 A;  1JI6 A;  3LA3 A;  1DYK A;  1JOB A;  2ZKN A;  5JXJ A;  5DUX A;  4Y5S A;  1WCQ A;  3G6J B;  1PK6 A;  1NUK A;  4MLO A;  1Z7S 3;  4KNC A;  2Z79 A;  2WAB A;  4GKX A;  4RR3 A;  3TEX A;  1UKR A;  5F3E A;  3FLP A;  5KHJ A;  1OLM A;  1AYM 1;  1CZT A;  3LSD A;  5JI7 A;  2C6S A;  1YNA A;  5DDJ 1;  4MXV A;  1MZ5 A;  3E6B A;  2A3Y A;  3A23 A;  1OA3 A;  4K7J A;  5JXH A;  5LB6 A;  2RR1 1;  2W47 A;  5J48 A;  2VME A;  2WNO A;  1F4A A;  4HT1 T;  3WCR A;  4DXR A;  3B9C A;  3HVD A;  4PIZ A;  3U37 A;  3WF3 A;  2LRO A;  4AGV A;  1EAH 2;  1JMU B;  1PVC 3;  1W2U A;  3KLS A;  4MGQ A;  5AC9 1;  4YGE A;  1UMH A;  4NAO A;  4LR4 A;  4AHY A;  3WF0 A;  2RS5 2;  3QCW A;  2E63 A;  3PVO A;  1NCQ B;  5FDB A;  2JXA A;  2R6Q A;  3CMG A;  2VUC A;  2C5D A;  3USU A;  2EIB A;  1QNY A;  1SDW A;  2HWD 1;  5IK4 A;  1W28 A;  1BMV 2;  4K9S A;  3JD7 1;  4CDQ A;  1LOF C;  4YAR A;  5FZ6 A;  4FPC A;  2YBS A;  3GBF A;  2CGO A;  4ORF A;  2CDO A;  1L3J A;  1JZ8 A;  4IEX A;  5D8A B;  4K6B A;  4DS0 A;  4LBQ A;  3LA7 A;  4YG6 A;  1YYN A;  4BM8 A;  1LHO A;  3K75 B;  1N3P A;  2JG8 B;  1Y3T A;  2Q0A A;  1CON A;  4A41 A;  3BIE A;  2ARB A;  2VTF A;  4RHV 2;  4U36 A;  3THP A;  1RUH 1;  4Y20 B;  5FZ4 A;  1SCR A;  2WO1 A;  1YIF A;  1JUI A;  2BZD A;  2WZR 3;  5LWB A;  4NIH A;  3ZFF B;  1W6O B;  2GP3 A;  5FZE A;  3W5N A;  3TAY A;  3S6P A;  1VR3 A;  3WNO A;  3KV4 A;  2HWE 2;  1R1A 1;  2DU1 A;  1VMJ A;  1CIW A;  1VBC 2;  1G7Y A;  2XOM A;  5A7S A;  4XET A;  3WXP A;  2Y34 A;  1DF0 A;  1RUE 3;  5DPN A;  3O1T A;  1XJA A;  5HV0 A;  1KD7 A;  3IIA A;  5JZG B;  4LOS A;  1JZ6 A;  3RI9 A;  1W6M A;  5E6H A;  3ZSM A;  2J22 A;  4AAX A;  2A3W A;  2RMU 2;  1LNS A;  2E31 A;  3SCH A;  3S0M A;  4I01 A;  1V00 A;  1CES A;  5T5J A;  2D5H A;  3CJI C;  4OI0 A;  4U2A A;  1HRV 3;  1XBF A;  2OPW A;  5L19 A;  2WII B;  2WT2 A;  2XWJ B;  2OQ7 A;  3WNX A;  5I91 A;  1VB4 A;  5LAT A;  1CAX B;  2OXB A;  1XC6 A;  3HJR A;  4QGM A;  4IEZ A;  4K20 A;  2NLR A;  4HN1 A;  3ZYJ B;  2HBU A;  3RFR A;  1XPW A;  3I54 A;  4MZU A;  5DAP A;  5ERL A;  4Q4W 3;  3H8X A;  2EXJ A;  3VDD A;  1QJX 2;  2WNU B;  1Q8V A;  4C91 A;  3LQC A;  3OOX A;  5JWP A;  1LU2 A;  5KHG A;  2A7A A;  1QIQ A;  4CXW A;  1C1F A;  3A21 A;  4HOO A;  1PO2 3;  1R09 2;  3IDE A;  4QKD A;  5FY0 A;  4AI3 A;  4G3Y C;  2DCT A;  1BBT 3;  3BOP A;  3H3L A;  1HB1 A;  4IV3 C;  5FBZ A;  4AQ2 A;  4CDW A;  5G04 L;  5CFC C;  1JOD A;  2K2S A;  3WNL A;  1EUU A;  3FHI B;  5FWE A;  1QXJ A;  5FZO A;  2QQP A;  1SPP B;  4UI9 L;  4NII A;  1ULO A;  4XJA A;  1SLI A;  5H9Q A;  3MLK A;  2WFF 2;  4RFR B;  1VBD 2;  4IGP A;  3ZN4 A;  1ZRC A;  4M3C B;  3WDY A;  5F5A A;  1CPM A;  5C8W A;  1VB2 A;  4UT5 A;  3KT7 A;  4JGY A;  1E57 A;  5KXE A;  2J1R A;  3WEZ A;  2RS1 1;  4A44 A;  5LK5 A;  1PZ8 A;  1LHV A;  5L9B A;  4Q4Y 1;  5CKN A;  4AFB A;  1HJG A;  4AL9 A;  2D6L X;  1R08 3;  3PDQ A;  3ZFG A;  2BYV E;  3NV1 A;  4WZC A;  5KHK A;  1GKB A;  5JIU A;  5T50 A;  3RZK A;  4O9G A;  4BQ2 A;  3MLL A;  1AYM 2;  4UW4 A;  2BBV A;  1PO1 1;  5DDJ 2;  5L9V A;  1H9W A;  1WMD A;  1LEM A;  2AAC A;  4ISR A;  4N43 B;  5D2A A;  5ACA 3;  4QXH A;  1OF4 A;  5K0U A;  2VEC A;  2RR1 2;  3OEA A;  5FP7 A;  1NCQ C;  1YLL A;  4AYU A;  5FRA A;  4BQ1 A;  1DQ2 A;  4IET A;  1YCI A;  4HL0 A;  4AED A;  3G7D A;  1NCR A;  2HLE A;  3WCS A;  2OPK A;  3GAL A;  1F31 A;  4LE4 A;  2UU8 A;  3M70 A;  3WF1 A;  1W2O A;  5AC9 2;  1UO9 A;  4Q0U A;  4HK9 A;  3RYP A;  3MF9 A;  5A3P A;  3B02 A;  5I0T A;  3SXW A;  4XIO A;  4QAW A;  3AFK A;  4DEV A;  4IEP A;  5D8A C;  2VNG A;  2BFU L;  1XU1 A;  2ES3 A;  5B2G B;  3JD7 2;  4LIV A;  5FKB A;  4DMI A;  3ZPY A;  2JG8 C;  2HJI A;  3MHZ A;  5HCA A;  3VDB A;  2VZQ A;  2VZS A;  4B4Q A;  2JKX A;  1OVS A;  4GWM A;  3TWI A;  4AFD A;  4YSF A;  2BP6 A;  3ZFF C;  1GLH A;  5AVA A;  5IVV A;  4ZU4 A;  1ZNP A;  1POV 1;  5IYY A;  3NKG A;  4XUT A;  4YYO A;  3KCC A;  4XZP A;  1WW5 A;  1ND2 A;  1C1L A;  1RUH 2;  3VBO A;  2K9Z A;  2NPI A;  4XUP A;  4J25 A;  1I9R A;  2RDQ A;  4XIL A;  4R8H A;  1XYN A;  1BEV 1;  2ZX2 A;  4OUS A;  2Y6K A;  5JZG C;  4A4A A;  1W2T A;  4A2U A;  4N53 B;  2XLA A;  4UF0 B;  2VVF A;  1SLA A;  4CP1 A;  1R1A 2;  4Q8K A;  4Q4V 1;  2HWC 1;  2CTV A;  2Y6G A;  3NJV A;  4A3Z A;  5JAX A;  3AYD A;  2P3Y A;  1H2M A;  1X8E A;  5FZL A;  3BVC A;  1RUO A;  1K5M B;  1QU0 A;  1Y9Q A;  3OGJ A;  4YWA A;  1XE7 A;  3IDC B;  2D7F A;  2A6W A;  3CL1 A;  3T4H B;  3VKM A;  3WF4 A;  3WNM A;  4B7E A;  1IZ3 A;  2WLQ A;  3VBR B;  5BNP B;  4NID A;  4NWW A;  1NG0 A;  4Q5O A;  2W3J A;  3D4K A;  3LIG A;  1IS6 A;  4CCK A;  5F2W A;  3LEG A;  1GP4 A;  4R9C A;  4XHX A;  5EHD A;  1GNH A;  1QHD A;  1SBD A;  1PGW 2;  4R9A A;  4AHX A;  2WNU C;  3H1Y A;  2XKO A;  4Y5Z 0;  3HQX A;  2YB7 A;  4QM9 A;  2VVD A;  5DAQ A;  2GC2 A;  3FWE A;  1DLL A;  1N1S A;  5E8A A;  5A3L A;  1PK6 B;  3U4S A;  1YJK A;  4CCE A;  4QX7 A;  3WUD A;  1AR9 1;  4RR3 B;  2VZ1 A;  1OHF A;  5A7N A;  2P1B A;  3EYP A;  3S5A A;  4RSU A;  1O3Q A;  3WV6 A;  4XFF A;  4A6O A;  1G6N A;  4NPL A;  4LXL A;  4I3G A;  1GOH A;  2NM1 A;  4DO0 A;  3N7J A;  5B4N A;  5F32 A;  4F7Z A;  5FFO C;  4P14 A;  4DY5 A;  4D94 A;  1W9Y A;  2VQ0 A;  1XOY A;  2VU9 A;  2R04 3;  5HI0 A;  1AX2 A;  3ALQ A;  1Q3E A;  4GAZ A;  4CU7 A;  4P5H A;  5L73 A;  1X7N A;  3UET A;  2VOX A;  1L7Q A;  4QHB A;  1MS4 A;  1Q8O A;  1Z0H A;  4X6R B;  2DVA A;  1MZE A;  2GNM A;  3D3A A;  4BCU A;  1LHW A;  2RS1 2;  2R32 A;  4NE9 A;  2ILM A;  3PJQ A;  4QKB A;  4Q4Y 2;  2VW2 A;  1H1A A;  4CDQ B;  3C7E A;  4N43 C;  3M1H A;  2BBA A;  1MR5 A;  5F5Q A;  3SQO A;  5IHR A;  1D4M 1;  3ELN A;  2ZZQ A;  5K7P A;  1YI9 A;  4LA2 A;  3VZJ A;  1PO1 2;  4LBQ B;  5FIX A;  5A3O A;  3HN1 A;  5IFT A;  2I45 A;  3I2D A;  3AJY A;  3JB8 A;  4XQD A;  2DUQ A;  2QJV A;  3C7F A;  4TN7 A;  2VNR A;  2D44 A;  4I30 A;  2BVB A;  4FQ4 A;  5FO8 B;  1WD3 A;  1AR7 1;  1W04 A;  2NMN A;  1QF3 A;  3JB4 C;  1BQP A;  1RUJ 1;  2ZHM A;  5FJK A;  4XFC A;  3MF6 A;  2VR4 A;  1G8W A;  1HXS 3;  3Q8A A;  5JMC A;  4ZON A;  1CD3 G;  4DNY A;  3W5M A;  1IS5 A;  1IPK A;  1UU6 A;  4Q0P A;  1CX1 A;  3CLP A;  2A6X A;  4YRD A;  2VQA A;  3IT8 A;  4GJZ A;  1PMH X;  1GOF A;  1ODN A;  2PQS A;  3MPP G;  1K42 A;  1WLC A;  4DOU A;  3TN9 1;  2NMO A;  2VZR A;  2IUW A;  4B4P A;  1UOJ A;  4AWD A;  4MGK E;  1UPI A;  4J1X A;  2QQV A;  3ZYI B;  5HBA A;  2JWP A;  1FPN 1;  1TQ5 A;  3IDB B;  3VZK A;  2ZMK A;  4MXW A;  3PIJ A;  1GMM A;  2IXL A;  3JBG 1;  1UZV A;  3C8X A;  3FX3 A;  3MW2 A;  5A3U A;  1CAV A;  4HVR A;  4N53 C;  2FBE A;  3T30 A;  2OW4 A;  1NE4 A;  1WZX A;  2Y6L A;  4LO8 A;  3OG2 A;  1SBE A;  3LCP A;  4HMZ A;  3Q8B A;  1LES A;  1BEV 2;  1ZRR A;  4NOT A;  5FZ8 A;  3ETQ A;  4YLZ A;  5FO7 B;  1K5M C;  2VY0 A;  5FAX A;  1IPS A;  2DV9 A;  1RMU 1;  2H6C A;  4YFZ A;  4Q4V 2;  2QQL A;  3LFI A;  4HG6 B;  3VBR C;  1RUD 3;  5BNP C;  1LHU A;  2ZGQ A;  1WCU A;  3IPV A;  4O9E A;  2ZPX A;  2ZGM A;  4KBZ A;  2W2I A;  4CDW B;  1MEC 3;  5LA1 A;  1RC6 A;  1QOO A;  4E2Q A;  3L9J T;  1W8H A;  3CKH A;  2B7Y A;  2P3I A;  5JOX A;  4QB6 A;  2UWB A;  4X6Q B;  1OVP A;  2Q8E A;  3WW1 A;  3TB0 A;  1F4H A;  3VKL A;  3UJO A;  4AVT A;  2RDS A;  4IUG A;  2NYY A;  1PK6 C;  4MGY E;  5DUV A;  3PUH A;  1ZZ7 A;  4HPK A;  3R4U A;  2CAV A;  5CIR A;  5EJZ B;  1VBE 1;  2XWB B;  4RR3 C;  1AL2 1;  1GWK A;  2JDK A;  2W39 A;  4RS5 A;  3WHT A;  2RS3 3;  1DQ4 A;  4IEO A;  4OVE A;  2D93 A;  2JE7 A;  5LBC A;  1Q43 A;  1FT9 A;  4I02 A;  3BTY A;  2VCB A;  1KDM A;  1AR9 2;  1TMF 3;  2BOJ A;  2D5F A;  3GHN A;  3IKW A;  2A1X A;  2XON A;  4NHY A;  2SLI A;  4QKN A;  3C7H A;  3SCF A;  4PT6 A;  1SFP A;  1IPJ A;  3HMY A;  3AYE A;  4GZ9 A;  4CCO A;  5CBL A;  2JEN A;  1LGB A;  1TNR A;  3IBM A;  5FZA A;  1W8F A;  2ZGP A;  4SLI A;  4ARX A;  3OPT A;  2W91 A;  4QM8 A;  1XU2 A;  5K0U B;  2CWS A;  5GLV A;  1LR5 A;  3F95 A;  2GMP A;  2BGC A;  5A6X A;  3GCW A;  4BQ3 A;  2XLF A;  1IQA A;  1OKO A;  2ERF A;  3H3Z A;  1T6G C;  3III A;  4P9J A;  5FY1 A;  1WUV A;  3WP6 A;  1IKP A;  3WZ1 A;  1TME 3;  4TXW A;  3FBY A;  4FP2 A;  4CDQ C;  4KBB A;  3POF A;  3N9M A;  3RWN A;  3JCI A;  1U5I A;  5AVP A;  1RUI 3;  2WSU A;  1UY3 A;  5FZG A;  4ZU7 A;  2EF6 A;  1OPM A;  5GLU A;  2R06 3;  5C9A A;  3GGL A;  2RJL A;  3A7Q A;  3HPN A;  3POS A;  2XJV A;  3KVB A;  4KG0 A;  1RUG 3;  3KV5 A;  4QB2 A;  1AXK A;  3PLQ A;  4XJ8 A;  4NIA A;  4H55 A;  2W1Q A;  4R4X A;  3AVR A;  5KR7 A;  1PIV 3;  1D4M 2;  1FX5 A;  1O8S A;  1PHM A;  1PNG A;  3V64 A;  2RDR A;  4TTG A;  3D82 A;  3J7L A;  1UOB A;  3NV2 A;  3EMR A;  4LK6 A;  1H2K A;  5FMO S;  4YGD A;  3VHR A;  2XQX A;  3HBZ A;  5GZE A;  3HWJ A;  4OI2 A;  3WHU A;  2HWB 3;  5HV4 A;  1SQ4 A;  4BXS V;  1RHI 1;  3KVA A;  2I74 A;  1ND2 B;  3VBO B;  3AVS A;  3LPG A;  5IAT A;  2YZ4 A;  1AR7 2;  3KM5 A;  2FHR A;  4Y20 A;  5A6Y A;  1HX6 A;  1RUJ 2;  2PA7 A;  5DN2 A;  1W2A X;  3H9A A;  1ZA7 A;  2JKB A;  1AR6 1;  3ZVX A;  4BH9 A;  1SEF A;  1H8T A;  4QQP A;  3AX4 A;  3H1M A;  2HWE 3;  2WZ8 A;  3NKT A;  1OH4 A;  1OPO A;  4V1P A;  2XBO 1;  2QQU A;  2VJX A;  5K9Y A;  3AKS A;  5CVR A;  2ZHK A;  4JVA A;  3TN9 2;  4BA6 A;  3KWV A;  3S30 A;  2W5F A;  3ZFE A;  3AYC A;  1OC1 A;  3Q8E A;  4MGT A;  2QBX A;  1BLZ A;  1FPN 2;  3B93 A;  4M4R A;  5FP4 A;  5A1L A;  1LGC A;  3E5U A;  3OPZ A;  3CF6 E;  3PUI A;  4WV8 A;  3I2F A;  5DZF A;  4MH0 E;  1H4G A;  3CQO A;  4Q26 A;  2VW0 A;  1O3T A;  1V6K A;  3WW2 A;  2W94 A;  3JBG 2;  4E8C A;  4LA3 A;  5JOY A;  1DQ0 A;  2RM2 1;  2PHR A;  1ZM1 A;  2JDA A;  1GP5 A;  1UU5 A;  5FK7 A;  3H42 B;  3T4V A;  3IDA A;  3AMQ A;  1XSQ A;  1PVX A;  3ILN A;  5HXM A;  1MS0 A;  4RQP A;  3R6S A;  2PHF A;  5LRS A;  4CDW C;  5CG8 A;  2O1Q A;  3CZJ A;  3ZM8 A;  2D98 A;  2WNU A;  5CG9 A;  1RMU 2;  2B45 X;  2W68 A;  2YC4 A;  4JC1 A;  3KHB A;  2CHH A;  1K45 A;  4AEK A;  3VZL A;  2YBK A;  1XE8 A;  1ZZ8 A;  1VRH 1;  4XBQ A;  4E8D A;  4ES9 A;  1V9U 1;  4CU8 A;  5DG2 A;  1G9C A;  2GZW A;  1C8N A;  1V6L A;  3A4U A;  3ZXJ A;  4KWJ A;  1SDD B;  4AW7 A;  1UZZ A;  3M7A A;  4AI0 A;  1W6N A;  2PLV 3;  1N1Y A;  4JCK A;  1Y4W A;  2PHD A;  3KZ4 C;  3MFC A;  4LJH A;  4OI4 A;  1ULE A;  2XJS A;  2VXR A;  3AXD A;  4B1L A;  1I5Z A;  5JOW A;  3BAL A;  3GZT B;  3LF7 A;  2BWC A;  2ZEW A;  5FZB A;  1AYN 1;  3GF6 A;  1MPX A;  4E2G A;  2R0H A;  4EN9 B;  2QKD A;  5DAW A;  2YC0 A;  5CA6 A;  3HAG A;  3WQB A;  1VBE 2;  5FZH A;  3MV0 1;  1VBB 3;  1AL2 2;  5FYC A;  2V5Y A;  5FZC A;  1WWY A;  5J7M A;  1E5R A;  1AX1 A;  4LNV A;  5E16 A;  3THC A;  4OUM A;  3OUH A;  4QPI A;  2CGN A;  5K0U C;  4GB3 1;  4HSL A;  3WF2 A;  2DUP A;  1V6J A;  1A8D A;  2Y8K A;  5FY7 A;  3CDZ B;  1BVP 1;  2Q4S A;  2ZAH A;  1NCR C;  3E6D A;  1UYP A;  3VD4 A;  1EV1 1;  1LOB A;  2BGP A;  2RE9 A;  4I3P A;  4C1X A;  3WR0 A;  4AG4 A;  3FLR A;  2W46 A;  3M3I A;  1COV 1;  4HON A;  3GHM A;  1Y7B A;  5FWJ A;  4NVP A;  4Q29 A;  3PJY A;  1FAT A;  2PMW B;  4L0P A;  5JVV A;  1ALY A;  1RJ8 A;  1WGP A;  1K5J A;  2QVS B;  5LCW L;  4FT8 A;  4C1W A;  4XFA A;  1HV1 A;  2TUN A;  1S0F A;  1JOP A;  4GAL A;  1NT0 A;  3NNJ A;  5EQU A;  4NIG A;  2PHX A;  3SIS A;  3MID A;  1UMI A;  4CDU A;  1YWK A;  3AP4 A;  1A78 A;  1B09 A;  3L2Y A;  4OI1 A;  1ZZC A;  1OD5 A;  4ZKT B;  2G1M A;  4P9I A;  4RA0 A;  3BPZ A;  2VOV A;  2Z4F A;  4YW2 A;  2BV4 A;  5FYM A;  1SMV A;  4UOJ A;  5A32 A;  4YW1 A;  4WBB A;  1QXP A;  3K4D A;  1N3O A;  1EP0 A;  2IVI B;  3HT2 A;  5C3Q A;  1SBF A;  3O7O A;  4HBN A;  2PEL A;  3IMN A;  3QOP A;  4Q2F A;  4D7Y A;  1JBC A;  1ND2 C;  4UW6 A;  2GNB A;  3VBO C;  2QQJ A;  4E27 A;  1CAW A;  4MXW B;  1BJQ A;  3RZG A;  3R0R A;  3KD4 A;  2E26 A;  3E5Q A;  2J1A A;  4CCN A;  4IL7 A;  2ZGK A;  4DFS A;  4XVH A;  5GZF A;  1RHI 2;  4CCC A;  2QUO A;  3LIH A;  5CAD A;  3I4I A;  3MIG A;  2VZU A;  4BIS A;  2IXK A;  2JDM A;  2A6Y A;  5LK7 B;  1RYY A;  3OBA A;  5CZK A;  1CVN A;  1AR6 2;  2VBD A;  3OTF A;  3J8F 1;  3HEI A;  4YM2 A;  1R1A 3;  3HOB A;  3PVB B;  3UJQ A;  2XBO 2;  2CV6 A;  5A3M A;  3N9Q A;  1JZ5 A;  4BDV B;  2BNO A;  5BY5 A;  3IPV B;  2XL9 A;  1JYT A;  2Q30 A;  4NWV A;  1ZBA 1;  2GP5 A;  4ZZ5 A;  2DCY A;  4Y1V A;  4XUN A;  4OHX A;  1W8W A;  2JIG A;  4CP9 A;  4HAN A;  1YJL A;  5CNA A;  3TOJ A;  2ADE A;  2LS6 A;  2ET1 A;  2WWS A;  3AMN A;  5GZD A;  3UGH A;  4F3J A;  5ISL A;  1M06 G;  2A75 A;  2ZZJ A;  4Y1X A;  3SC7 X;  4CCL A;  1TVG A;  4I0A A;  4LKS A;  3O1S A;  4HPK B;  2P34 A;  3RRD A;  4LPL A;  3APB A;  3PUR A;  2RM2 2;  4RS5 B;  1W0N A;  1ZRD A;  2ARE A;  5CYY A;  1J3P A;  3POY A;  1B35 A;  5FUN A;  2VQU A;  2B4K A;  3VHN A;  4KGG A;  2E32 A;  3SH3 A;  5C3O A;  1ONA A;  3MZH A;  4XF0 A;  1W90 A;  5F1R A;  3K48 A;  4PBO A;  1KIT A;  2Z2S B;  1DGW X;  3O1P A;  1LEN A;  3NVC A;  4OQ9 A;  4GD4 A;  4L97 A;  4YZ3 A;  2ZX4 A;  5J1X A;  2A3X A;  3T3Y A;  5F7U A;  5DAX A;  2KM2 A;  1VRH 2;  3FUQ A;  3W9A A;  4PLN A;  5FPU A;  1V9U 2;  4XZU G;  3AP9 A;  3FC0 A;  4CEW A;  4OUE A;  2Z42 A;  3RSJ A;  5A3T A;  1ZVF A;  3ACL A;  4N9H A;  1SLC A;  2WQZ C;  4WM7 A;  4M0H A;  3URF A;  1EY2 A;  4H3W A;  3PTY A;  3LFM A;  3NV3 A;  1YHF A;  3J7N A;  4ZS2 A;  3VKF C;  1IGO A;  1WBL A;  1RUC 3;  2IZW A;  4MYE A;  3NWK A;  1WLD A;  2EAK A;  4E4S A;  1NX9 A;  1AYN 2;  1RGS A;  1QDC A;  1BXH A;  3I97 A;  5C3P A;  3W58 A;  1GV9 A;  1QJE A;  4DXT A;  3WG3 A;  3VBF B;  3M4F A;  1UYX A;  2DU0 A;  1QJU 1;  5LRR A;  4PF1 A;  1UIJ A;  3LEK A;  1A3K A;  3KV6 A;  4W6X A;  4N7I A;  5IVJ A;  1CJD A;  1DQ1 A;  2L9L A;  3TNP B;  1DG6 A;  3WIN E;  5CEH A;  2RS1 3;  4NRQ A;  1QJY 1;  2G4I A;  1YXW A;  1O4Z A;  2AGS A;  2KXL A;  4IE7 A;  3ZFG B;  4ARY A;  4COV A;  5C9A B;  5I0D A;  1XNC A;  1NLS A;  4YFW A;  3BCW A;  5LY2 A;  4YPJ A;  3GZA A;  4MHU A;  4OUL A;  4WVZ A;  4A7Z A;  3VD7 A;  1YQ2 A;  4PBP A;  5FOB B;  2IXJ A;  1PO1 3;  1ZBE 3;  4CUB A;  1EYB A;  5GLZ A;  3ZXE A;  5J3U A;  3LDB A;  1EV1 2;  3K46 A;  2E9Q A;  4MUV A;  1FYU A;  2W08 A;  3KCY A;  1LOA A;  1D4V B;  1H9P A;  2XHN A;  2W1W A;  3U75 A;  1APN A;  1F5J A;  1UNB A;  4XAE A;  3RZZ A;  1AXY A;  2WS9 1;  2RJ2 A;  2WAA A;  1BHG A;  2WC2 A;  4GH4 A;  3RZJ A;  1STM A;  4IE0 A;  5FZD A;  5FCC A;  5F8P A;  1Q56 A;  4XDO A;  1QY4 A;  1RUF 3;  3N7L A;  1JW6 A;  1DLC A;  4MG2 A;  3TRS B;  1H8T B;  2BOI A;  3O0W A;  5FYH A;  4X8P A;  3I2O A;  1S2E A;  2VNO A;  2CU5 A;  3S5Q A;  3RZM A;  1DGL A;  3HIF A;  1ASJ 1;  1DHK B;  1NLR A;  3B00 A;  4IW3 A;  4UFI A;  4AAP A;  4PI0 A;  3DCQ A;  4FQZ A;  2Y0I A;  4BE3 A;  2P17 A;  3A0N A;  4LIU A;  1JYN A;  3IM0 A;  4YNI A;  3KQR A;  3POI A;  5T54 A;  2XJQ A;  3ZFE B;  2AUY A;  2AZ5 A;  2P3J A;  5FUP A;  4ET7 A;  4GMP 3;  2GSY A;  5GLW A;  3OYW A;  1JHN A;  3AP6 A;  2D40 A;  3RMX A;  3I3B A;  2BNM A;  1EUT A;  2JB4 A;  4B29 A;  3VGI A;  2DTY A;  3KQ4 B;  2BW8 A;  1ENR A;  1J59 A;  4AGR A;  4W8J A;  2Y0O A;  4N90 A;  4Y26 A;  1SHW B;  5JOZ A;  1UW8 A;  3H0O A;  4RQP B;  1NXM A;  2YU1 A;  2D3S A;  3PUA A;  4H2A A;  5C71 A;  2O8O A;  2YY1 A;  4EZH A;  1AR8 1;  3J8F 2;  4QHO A;  1O6U A;  4HZF A;  3WSO A;  4IV1 B;  1GFF 2;  3UNP A;  2FCT A;  4UFM A;  1YQ6 A;  3GNE A;  4AI8 A;  2V4V A;  2XJU A;  3O5S A;  1H1M A;  1CN1 A;  4IND A;  2VOT A;  1AZD A;  1ZBA 2;  1W6N B;  3WOG A;  2W0X A;  2JDH A;  1VMH A;  2VUL A;  4XBL A;  4WZF A;  3QBQ A;  1OMI A;  2WWU A;  4RS5 C;  1QQP 1;  1VBA 1;  3FN9 A;  4CPB A;  3HR9 A;  1CAU A;  3W20 A;  1NXD 1;  4DRR A;  1W3X A;  4QQ2 A;  3N7K A;  1YFW A;  2IXC A;  3RZH A;  3NO8 A;  2ZMN A;  4S2H A;  1NKG A;  1Z7S 1;  3AC0 A;  4BQ4 A;  1JZ3 A;  3LD8 A;  3BPS A;  5IVY A;  3EQE A;  1S0G A;  1WCD J;  2O0O A;  4QQL A;  2VUA A;  2DWR A;  4XF9 A;  4Z82 A;  4CU9 A;  1FV3 A;  4EWA A;  1CZS A;  1K12 A;  3GXU A;  2DCJ A;  4ASM B;  4FBF A;  4LTA A;  2VMI A;  5JXG A;  4QPI B;  1DZQ A;  3D0S A;  2D6P A;  4LO7 A;  4UWD A;  4AFC A;  3JZV A;  4D6Q A;  4GQ7 A;  5FXV A;  4LT5 A;  1FXZ A;  4PDW B;  3FLT A;  4TSV A;  3VV1 A;  2K0G A;  3VDC A;  4H7M A;  1VMF A;  2WN3 A;  2X53 S;  3SKV A;  2EVX A;  5APA A;  4YM3 A;  5HCB A;  4EE2 A;  3PU8 A;  4C0H A;  2BVV A;  5LZ6 A;  1U0A A;  3VBF C;  4XJW A;  2J1U A;  4G4F A;  1KRI A;  2PAK A;  4DRV A;  3ZSE A;  1VPH A;  1G9D A;  3WDT A;  4BJ0 A;  4CYD A;  2FZ2 A;  5C9A C;  4R52 A;  4P9G A;  2LM3 A;  3ZFG C;  4IXL A;  3E6C C;  4CDU B;  5BV6 A;  1QJU 2;  4A42 A;  5T5O A;  3N4M A;  1JTZ X;  1DGR A;  4XF3 A;  2C1F A;  3Q8C A;  3O1O A;  1I5P A;  3I3M A;  2ZML A;  2ZX1 A;  1OOP A;  1QJY 2;  4ISQ A;  4HSJ A;  1G9A A;  3ZPO A;  1UCX A;  5A32 B;  3SNM A;  1V6M A;  1H0B A;  1DFQ A;  1VAK A;  1PX3 A;  2HWD 2;  3SHR A;  1E5S A;  4L8Q A;  4ASL A;  3LGR A;  3KT1 A;  2GU9 A;  2YPJ A;  1S4C A;  2G9Z A;  3AXE A;  5T5L A;  3LEI A;  4YVW A;  4GWI A;  3DUI A;  3LSE A;  3QD6 A;  5FZ9 A;  1YEW A;  1CAW B;  1ZZ9 A;  5T52 A;  1PZ7 A;  1UY0 A;  2VMD A;  3ZN5 A;  1H2L A;  3M8L A;  3VHP A;  3P3P A;  2WZR 1;  2ZHN A;  1LOE A;  1DU3 D;  1H8T C;  3J26 N;  2Q8C A;  2WQ4 A;  4LHN A;  1QKQ A;  3AKP A;  4LKE A;  2J1T A;  3WP3 A;  3AB0 A;  4GJY A;  3W21 A;  2ZGU A;  4GMP 0;  4QXB A;  3AP7 A;  3U4X A;  1X9P A;  1RUE 1;  5DQ0 A;  1MQT A;  2P5B A;  3L2H A;  3ZFE C;  2J1E A;  3T0A A;  1C3H A;  1OA4 A;  5FMD A;  3VKO A;  1ASJ 2;  2YHJ A;  3RG0 A;  4XCB A;  3AKT A;  5EWS A;  5IK5 A;  2XUM A;  4K40 A;  1EPZ A;  3NJY A;  2W52 A;  4NR1 A;  4XF1 A;  2GH8 A;  4EN6 B;  4XOG A;  1HRV 1;  1L7R A;  4CP9 B;  2B5H A;  1FPN 3;  4MVT A;  4A7K A;  2VUD A;  2X10 A;  3BIW E;  3GCX A;  2ATF A;  4YGB A;  1KFX L;  3CO2 A;  2VVE A;  1YQ8 A;  2WN2 A;  3MPB A;  4RQP C;  1CX4 A;  1LED A;  4LKF A;  2D3R A;  2UWA A;  4Q4W 1;  5FY9 A;  2ZA9 A;  1BVV A;  5H9R A;  2WO7 A;  4Y24 A;  4P08 A;  4CP2 A;  3ACI A;  1B35 B;  1KEX A;  2TBV A;  2XQR A;  4OLL A;  5K4L A;  1UXX X;  1UZW A;  3ASI A;  3P6B A;  4ZZ8 A;  4M4P A;  3RDI A;  4P5Y A;  3UYJ A;  4ASK A;  4XAA A;  1PO2 1;  3IB3 A;  2DCK A;  3Q8F A;  1OKQ A;  1AR8 2;  1BBT 1;  1SZB A;  3DXU A;  4Q4X 3;  5FYS A;  4JTO A;  2C24 A;  2WO3 A;  1UKG A;  2Q1M A;  5L36 A;  4I09 A;  3H50 A;  3ACH A;  5FMB A;  1GWL A;  2UYB A;  5I0R A;  5FXX A;  3MW4 A;  4PI2 A;  2FCU A;  4CEW B;  2XVK A;  4JGZ A;  4QX2 A;  2ARC A;  2WQ8 A;  5CU1 A;  2YPD A;  4WM7 B;  3WDX A;  3I3Q A;  1QH6 A;  2DVG A;  4DZG A;  1O3R A;  3VBS A;  3VBH A;  2VZV A;  5A7O A;  2QZ2 A;  1F9K A;  1QQP 2;  1VBA 2;  3ENR A;  2BGO A;  2VM9 A;  3H8R A;  1FMD 3;  1OT5 A;  4WM8 B;  4ZHN A;  4XUQ A;  5FO9 B;  2BWA A;  1JHJ A;  2XB6 C;  4QPI C;  4FOY A;  3MGU A;  2EAL A;  3U78 A;  1X36 A;  1OI6 A;  4FPY A;  2VQT A;  2JJ6 A;  4JRL A;  2DCZ A;  1HN1 A;  4XXA A;  1IQD C;  1BCX A;  1R08 1;  3AKQ A;  3SCG A;  3SH4 A;  3PVE A;  1IHM A;  5AFE A;  5JI9 A;  1GWM A;  1RVF 3;  4AHZ A;  5JMO A;  3THD A;  4BMB A;  2VXJ A;  4OHV A;  3QLQ A;  3HNY M;  2ZEY A;  5F3G A;  1REE A;  4NUB A;  2UWC A;  5H9P A;  4EN7 B;  5ACA 1;  2UY8 A;  2VCA A;  4KWL A;  3CZU A;  4BQ5 A;  3IZO A;  4BQX A;  3N9P A;  3POG A;  1OA2 A;  1C57 A;  3UGF A;  5EPA A;  2JX9 A;  4YZ4 A;  2EXK A;  1O91 A;  4FPG A;  4CDU C;  5ABJ A;  4MOA A;  5FQ0 A;  4HET A;  4S2F A;  2YYO A;  1X82 A;  3VZO A;  2AH2 A;  4GH4 B;  1NLQ A;  3IN9 A;  5FP8 A;  1J1T A;  3KGL A;  4IES A;  4Q0V A;  2X5I A;  4XFI A;  2Q1F A;  1L7L A;  2HWF 1;  4XQ4 A;  5FP9 A;  2ZGT A;  1CPN A;  4EJR A;  4AEM A;  2FDK A;  4DQA A;  3R4D B;  1GQP A;  2OUJ A;  4Z8B A;  1RED A;  2RDN A;  4FOQ A;  1BYH A;  2PQQ A;  4CCM A;  1O3S A;  2D6O X;  5BNO B;  4FVV A;  2VZT A;  3U14 A;  3T2O A;  5I8S A;  1ACC A;  2GAL A;  1C8M 3;  2OT7 A;  3CIH A;  3OYW B;  5BNN A;  4OQ8 A;  2BTV C;  3ZKY A;  1PM4 A;  3ZKU A;  1GQG A;  2WZR 2;  2CAU A;  3M3C A;  4QU1 A;  3HBK A;  3AL5 A;  2A71 A;  4IEV A;  5ANQ A;  4YW5 A;  1ENQ A;  4IE6 A;  1TNF A;  1S0D A;  1U5X A;  2P3K A;  2WJS A;  4QPG A;  4UW3 A;  3U07 A;  4YGC A;  3WX5 A;  4AQ6 A;  5FZ0 A;  4RYD A;  3ZN6 A;  3ST7 A;  2GAU A;  2PXJ A;  2BUK A;  2UYA A;  5KXB A;  2BPA 2;  2XML A;  2R07 1;  3JQX A;  4COW A;  2QQI A;  1ENS A;  1RUE 2;  5D21 A;  4BZ4 A;  5LEJ A;  5EJ3 A;  5CB7 A;  1SCS A;  1XE0 A;  4Q8L A;  4DUX A;  1D2Q A;  2XDV A;  1UYY A;  1GAN A;  2ZAB A;  3T1M A;  1XSR A;  3ZDV A;  3I49 A;  3V56 A;  1MVE A;  4KMQ A;  1JZ7 A;  2ZX0 A;  2HWC 2;  1DZT A;  4UFK A;  5LBB A;  2WZP P;  2QDN A;  1OLR A;  2VZ3 A;  1LOD A;  1US3 A;  4Y1Z A;  3T2T A;  3VZN A;  4AXO A;  1HRV 2;  1UPS A;  1WW6 A;  3VD3 A;  3ZDS A;  3AFG A;  1AUY A;  3SMH A;  2QQO A;  1URX A;  4Q1R A;  4LIT A;  1CAU B;  1B35 C;  1JN2 P;  1N3Q A;  3LAG A;  5FPV A;  1DBN A;  3V0A B;  1GZW A;  2JB8 A;  2WA3 A;  3DPR A;  2FQP A;  4LE3 A;  5LY1 A;  3WY6 A;  2ID4 A;  4Q4W 2;  2RM2 3;  3KV9 A;  4COZ A;  3N9N A;  3D0J A;  4ZXK A;  5BUV A;  3LWC A;  4NJ4 A;  5A70 A;  5E88 A;  2ZAC A;  1RIR A;  4AQS A;  1AXZ A;  5GZC A;  3O1U A;  5F3I A;  1GZT A;  5CKM A;  3P1I A;  4YW6 A;  2DVF A;  1PO2 2;  3KMH A;  4CEW C;  1E5I A;  4QQH A;  1BBT 2;  3OGG A;  4WM7 C;  3RGB A;  5KHI A;  3TEW A;  2ZCW A;  4LBO A;  1N1T A;  1CIY A;  3IAQ A;  2EAA A;  3NAP A;  1W0O A;  4MGI E;  1QEX A;  3UL2 A;  2R04 1;  2GH2 A;  1JYI A;  4E4Z A;  4XCA A;  1HB2 A;  3FFQ A;  2B46 X;  2O14 A;  3QAC A;  4FP3 A;  4CEY B;  4WM8 C;  3O0V A;  4O65 A;  5FZ1 A;  3U0Z A;  2OZJ A;  3UES A;  2OUH A;  5EIY B;  1W99 A;  2UY9 A;  3KT4 A;  2FDH A;  2OA2 A;  2XVL A;  5CFD A;  3N35 A;  2VUJ A;  3FL7 A;  2LTN A;  1A6C A;  4FPK A;  2PHW A;  3DL3 A;  5A7P A;  1EAH 3;  2F4L A;  4RL7 A;  1W8O A;  2BFU S;  1AHS A;  3DV8 A;  3K3N A;  3EB7 A;  4KL1 A;  4DEQ A;  5JLV A;  4DXS A;  2OYZ A;  1O59 A;  2RS5 3;  3LOI A;  5FLJ A;  1ZYB A;  2VTX A;  5I0U A;  4XDQ A;  3VBF A;  4DXZ A;  4E2S A;  3UK9 A;  5F5C A;  2V5D A;  1R08 2;  4BQY A;  1P8J A;  1SG3 A;  1OOP B;  2Q1Z B;  3LPF A;  2VMG A;  1S2B A;  1YI7 A;  2PAM A;  4GWJ A;  2ZGN A;  2GND A;  4CDX B;  3E5X A;  2X8K A;  4QX0 A;  2VO5 A;  5C8C A;  1CZV A;  1QOS A;  4N9I A;  4QDR A;  5ACA 2;  3O1M A;  4W6W A;  3OY8 A;  1O5U A;  4EWE A;  4QD2 A;  4YVW B;  5J96 B;  1Q8S A;  4GH4 C;  4ZU5 A;  4DIQ A;  1W8U A;  5I8Y A;  1JXN A;  1WD4 A;  3WQ1 A;  1DYP A;  2G9G A;  2WT0 A;  1TZO A;  1FI2 A;  4CUA A;  4AI1 A;  1K3I A;  4LBJ A;  4RHV 3;  1G9B A;  4WVV A;  5E1R A;  5FJH A;  1V6N A;  3AZV A;  1ZRF A;  1H6Y A;  4FTS A;  2ZHL A;  2XXZ A;  5BPX A;  5C5U A;  1W8N A;  5K8S A;  2IXI A;  2HWF 2;  3OGS A;  1HW5 A;  3DYO A;  1MQT B;  2DFB A;  4JDO A;  2R30 A;  4JKL A;  5BNO C;  4KG8 A;  4LUK A;  4JX0 A;  1VBC 3;  2J1V A;  3AMP A;  4K21 A;  2R1B A;  2WAO A;  3P5B A;  1T6B X;  4WVM A;  4O7X A;  3UKN A;  3WW3 A;  4FTB A;  4XBN A;  2I07 B;  3AMM A;  4QQO A;  3UV9 A;  5FY4 A;  2PYT A;  1O4Y A;  3BYW A;  3TNQ A;  4OZX A;  1UD1 A;  2P2K A;  2RMU 3;  1OSG A;  1V6O A;  5LEK A;  2Y26 A;  3HD8 B;  3OBR A;  1M4W A;  4FPL A;  3GZE A;  2PHL A;  1YFU A;  5FPL A;  4LQR A;  1LHN A;  1ST8 A;  3RS6 A;  1RUN A;  1KJR A;  1YC6 1;  1Y9G A;  1QNW A;  2CYF A;  1JS9 A;  3ACG A;  5FP3 A;  3BTZ A;  3CJX A;  2OZ6 A;  2TNF A;  2VOW A;  3DEM A;  3NMB A;  3NW4 A;  4P00 B;  4UFH A;  5IVF A;  3WG1 A;  2LRP A;  1AX0 A;  1N47 A;  2W9X A;  2R07 2;  3WUC A;  3ZXF A;  3B01 A;  2FD8 A;  2ADD A;  2NN8 A;  1QJX 3;  2VL4 A;  5FLI A;  1MEC 1;  2YG0 A;  1LUL A;  2CSG A;  2DF7 A;  3V0B A;  3HNM A;  4IV1 A;  1GUI A;  2B8M A;  1RJ7 A;  2BNN A;  3AL6 A;  3FUO A;  3KF3 A;  2ZEX A;  4NPR A;  2WO2 A;  4W65 A;  1R09 3;  4JGZ B;  5C70 A;  1SLL A;  2HKX A;  5F39 A;  5GAL A;  2FMD A;  3OGR A;  3T2Q A;  1LB2 A;  2IVJ A;  1XNK A;  3B9I A;  3VBH B;  3VBS B;  3ZLI A;  5DXD A;  4C90 A;  4UBG A;  5LW9 A;  4HKO A;  1W6P B;  2RS3 1;  4IEY A;  1H30 A;  3LE0 A;  1JU4 A;  2JDN A;  2WFF 3;  1MS9 A;  1OQ1 A;  1VBD 3;  2VCM A;  3GJB A;  3VB9 A;  5IVE A;  4RGG A;  5D1I A;  4EZ4 A;  3H8O A;  3QH7 A;  1A34 A;  1TMF 1;  3V65 A;  2JDP A;  5DAB A;  3J7H A;  5A33 B;  2HEY F;  3FFZ A;  2VMH A;  1Q8P A;  4CUC A;  1DIW A;  4CEY C;  4Z2W A;  4W4Z A;  3HQU A;  5AFB A;  3OF1 A;  4FAH A;  5A80 A;  3KCX A;  1ZRI A;  3B94 A;  3NST A;  2B42 B;  3BOD A;  1OF3 A;  4UAP A;  4BK5 A;  2R04 2;  1AYM 3;  4PDW A;  1X50 A;  1ULC A;  4HKL A;  3EXU A;  1NZI A;  4FFG A;  5DDJ 3;  1GNY A;  1MS5 A;  2CY6 A;  1VAM A;  4RFT 0;  1X9T A;  2VD7 A;  3PU3 A;  2RR1 3;  1KXG A;  1TME 1;  5FQ0 B;  3RNS A;  5ABJ B;  2DVD A;  2PTM A;  2Y64 A;  1PX4 A;  3BU7 A;  2VE1 A;  1HRI 1;  4CTE A;  4AI9 A;  1OOP C;  1RUI 1;  2X5I B;  1D0G A;  5AC9 3;  2R06 1;  2YUE A;  1FAY A;  1KFU L;  1QGL A;  1RUG 1;  2ZGS A;  4L99 A;  2H0B A;  4AGG A;  3H3U A;  4KWU A;  3T0D A;  2GC3 A;  3CBN A;  1PIV 1;  4YVW C;  1YFY A;  4XW3 A;  4NHM A;  1OUX A;  3PVN A;  2HWD 3;  4B7K A;  4ZS3 A;  2WYF A;  3JD7 3;  1J3Q A;  2JD4 A;  3LEM A;  3ES1 A;  1ND3 A;  3U10 A;  4EQV A;  4K8R B;  2YFU A;  1W2N A;  3PIG A;  1S0E A;  2HWB 1;  3O14 A;  5BNN B;  2WZE A;  1DZR A;  3MEP A;  3SIT A;  3GYD A;  4LUL A;  2AEN A;  2V72 A;  1HN0 A;  2OX0 A;  3GM8 A;  4BYY A;  3AZZ A;  3MW3 A;  4D8M A;  1GOG A;  1MQT C;  3GZU C;  2KR2 A;  2VZO A;  4M3C F;  1WLT A;  2MEV 1;  4QPG B;  2NZ9 A;  3NNG A;  2HWE 1;  1RUH 3;  3JQW A;  3LDK A;  3OD0 A;  4MGZ E;  3I2J A;  4TWT A;  3ZN6 B;  5KBF A;  4JV4 A;  2OII A;  4R4Z A;  1W9T A;  1UY1 A;  1PGL 1;  4I0W B;  4XF4 A;  4CA9 A;  5B4X A;  2AC1 A;  3K4A A;  4GXL A;  4IQP A;  4LMF A;  4PF5 A;  4D6S A;  4JHT A;  4YW3 A;  3WG2 A;  3M3O A;  2ARX A;  3MLJ A;  4EYU A;  2DYC A;  3MIF A;  4XAC A;  5C6C A;  4QU2 A;  2A70 A;  2Y6F A;  1LTE A;  3ILF A;  3CHX A;  1RXF A;  2FZ1 A;  2UUR A;  3DGT A;  3BUC A;  4AFM A;  1IKQ A;  3POE A;  5HXV A;  3H1W A;  4JKK A;  3SEP A;  4F83 A;  3EO6 A;  1WA6 X;  3N7M A;  3RQ0 A;  1OUS A;  1QOT A;  2GDF A;  5JSR A;  1WA4 A;  3ON7 A;  1C5I A;  4I0B A;  2C4X A;  1GZW B;  5L9R A;  2C9A A;  3DPR B;  1ULD A;  5A3W A;  4D3W A;  4FXG B;  5EP9 A;  2J42 A;  4IEU A;  4ATF A;  1JH5 A;  1XND A;  3I2G A;  4JKM A;  4NHL A;  2QTW B;  2YU2 A;  3RMY A;  3KS7 A;  1W8T A;  4B4R A;  2F6B A;  4XEZ A;  4JGZ C;  4LOR A;  2D6K A;  1NAE A;  4ONU A;  1BZW A;  1MEC 2;  1I1E A;  5DZG A;  1QH7 A;  1S0B A;  2V09 A;  2PLV 1;  3NAP B;  3VBH C;  3VBS C;  4JQR A;  2JDZ A;  1MS1 A;  2XLG A;  2IFR A;  3X29 B;  1EPW A;  5FLH A;  1W39 A;  5FZI A;  4NRO A;  1S0C A;  4JDM A;  5BNQ A;  1HQL A;  4Z2A A;  4IV3 B;  2JIJ A;  4LO4 B;  3I59 A;  3WDV A;  4TLG A;  1PNF A;  3ZXL A;  1S0J A;  3UT0 A;  3WVJ A;  5CFD B;  3CU7 A;  3OPW A;  4OYU A;  1VBB 1;  4KI5 M;  2JG9 A;  1J84 A;  1A8M A;  2RS3 2;  4K1Y A;  4KGQ A;  3AZX A;  4AVS A;  4BPZ A;  2JEM A;  3MFA A;  4WM8 A;  1YUD A;  2JDY A;  3M3Q A;  1IG3 A;  1ZX5 A;  3GBG A;  1DDL A;  5FYI A;  5L7O A;  1TMF 2;  3FZ3 A;  4HKW A;  1ZRE A;  1UWW A;  5IAV A;  5IT6 A;  1OH3 A;  4XMI A;  1C4R A;  1FOD 1;  2VAU A;  2RG4 A;  4Q4Y 3;  4BOW A;  5I0S A;  1PZ9 A;  2GN3 A;  2HBT A;  5C8C B;  3ZSL A;  1UX6 A;  1QXR A;  2HEW F;  1SAC A;  1DYO A;  3LZZ A;  1DCS A;  1POQ A;  3OY8 B;  3OGV A;  4GB3 2;  2RJK A;  4K3U A;  1F2N A;  2YMZ A;  2W1U A;  4LBM A;  2I2S A;  3MUZ 1;  4S2G A;  5C33 A;  3JUU A;  4JZR A;  2X5I C;  2P6C A;  2P4E A;  2MPF A;  3WDW A;  3ZXK A;  4D6R A;  1COV 2;  3O0X A;  1TME 2;  4M3C E;  3NNM A;  4MX3 A;  4P9L A;  2GC0 A;  3SLI A;  3TBD A;  3ZX7 A;  2XKP A;  1HRI 2;  1W9S A;  1X33 A;  1RUI 2;  3PTR B;  4LEJ A;  3D6E A;  3ZIW A;  2R06 2;  2EIC A;  3BN6 A;  5FPX A;  5DMY A;  3OEB A;  1RUG 2;  1LKN A;  4FOW A;  4BIO A;  2ENR A;  2R7E B;  4UBH A;  1NA1 B;  2CGP A;  5F9T A;  1PIV 2;  1E5H A;  1YFX A;  2BER A;  4YM0 A;  4AHW A;  4CVU A;  4CRQ A;  1JYX A;  4WVM B;  5BNN C;  5EYY A;  1JUH A;  4P02 B;  4SBV A;  1W6Q A;  4XTM A;  4FTE A;  4LUM A;  4Q27 A;  2XL7 A;  2WWJ A;  4G9S B;  4B1M A;  1UY4 A;  4DUW A;  4KQ7 A;  1ULG A;  3BTA A;  5BNO A;  4QPG C;  5C3S A;  5FYV A;  4ATE A;  2HWB 2;  1W05 A;  4LBL A;  5FK8 A;  4ZY9 A;  4M01 A;  4N7U A;  5FR3 A;  1KDK A;  4ERO A;  4BLJ A;  2VOK A;  3NJZ A;  2WUH A;  4AI2 A;  5C7G A;  5HPO A;  1JU3 A;  1POV 3;  3DEC A;  1U5Z A;  1UIK A;  1RXG A;  1V70 A;  2MEV 2;  4Y3O A;  1TG7 A;  4V2W A;  3O12 A;  4FPO B;  5J37 A;  2YDE A;  3DYM A;  4AVA A;  2QE3 A;  4IER A;  1I6X A;  2Y38 A;  4QX1 A;  4COU A;  1JOJ A;  2FMY A;  1BEV 3;  4LHS A;  1PGL 2;  5LA2 A;  3T0B A;  2EID A;  1VP6 A;  4QX5 A;  3V0B B;  3ZSJ A;  1O8P A;  1BK0 A;  2VG9 A;  1ODM A;  1UU4 A;  4Q4V 3;  4URA A;  1C5H A;  3IWZ A;  2HWC 3;  3VN4 A;  1GU3 A;  3PL0 A;  3NQH A;  5CIS A;  4H14 A;  5FYT A;  3VL9 A;  3DPR C;  1ENX A;  3ZXG A;  4NAM A;  4XUO A;  5A7W A;  4YZ2 A;  1PGW 1;  4IGQ A;  5KC6 A;  1NQJ A;  5BXX A;  2AR6 A;  2JD9 A;  1MVQ A;  5FZF A;  1W0P A;  5KWR A;  2MHF A;  3HT1 A;  1XNA A;  2YBP A;  5FV3 A;  3RZL A;  3MIB A;  1KGY A;  4P9Y A;  3V0A A;  4HLT A;  4FCA A;  3FJS A;  4XIK A;  3VZM A;  4AVB A;  5C5T A;  3ILR A;  4D0Q A;  1W8Z A;  3NAP C;  1QDO A;  4DPN A;  1QJZ A;  1JZ2 A;  1UZ0 A;  5A7Q A;  5SV5 A;  1IG0 A;  1O5L A;  1QWR A;  5C4W B;  3RVH A;  1AR9 3;  2B39 A;  2ZS6 B;  3NNF A;  2DTW A;  4AVC A;  3MIC A;  2AYH A;  2PLV 2;  5LA0 A;  2E6V A;  4L92 A;  2GMM A;  2F17 A;  4A45 A;  5CFD C;  1LEC A;  5IK8 A;  1RUC 1;  1UF2 C;  4TLF A;  4W50 A;  4XXP A;  3UKT A;  5F3C A;  2R1D A;  4CEY A;  4L9B A;  2FDJ A;  1PVC 1;  2WR9 A;  5FYB A;  3ZXD A;  5IW0 A;  2VBB A;  4FAG A;  3ME2 A;  1REF A;  1VBB 2;  1MAC A;  2WYS A;  2ET7 A;  2RVA A;  3AYA A;  5FPB A;  2BEO A;  4Z07 A;  4L2N A;  2FCV A;  5GZG A;  4BK4 A;  2Q8O A;  1XNT A;  3TEY A;  4LBQ D;  1OXC A;  4NMI A;  4AEJ A;  5C8C C;  1V0A A;  3OSD A;  1TE1 B;  2QDR A;  1OLM E;  2CDP A;  5TSW A;  4YZ1 A;  5IVC A;  5A3N A;  4R9D A;  4X8N A;  4FSJ A;  1ZBE 1;  1FOD 2;  3PMS A;  4Y22 A;  2E7T A;  3POB A;  4ZPI A;  5F5I A;  1J83 A;  1WLW A;  5JIA A;  4CDX A;  3INA A;  2B9U A;  5F37 A;  2JE9 A;  4YW7 A;  4FI9 A;  1ND3 B;  5DZE A;  1D4M 3;  4MET A;  3E1F 1;  4AE2 A;  5J36 A;  4YVS B;  1BKZ A;  3AM2 A;  1O4T A;  4C0B A;  2YGM A;  3LOB A;  3MIE A;  4AK3 A;  5F6K A;  1OFS A;  2ZGL A;  3E97 A;  1PMJ X;  4LK7 A;  2GNT A;  1RUF 1;  4TZD A;  1U12 A;  2WNV A;  4NPM A;  1NA1 C;  3ABZ A;  2SBA A;  2WS9 2;  1CQ9 A;  4KH9 A;  1AR7 3;  4XJU A;  2JDU A;  3T09 A;  3ZYH A;  5M0T A;  5IVB A;  3OBT A;  3N9O A;  2EIE A;  1RUJ 3;  3ETP A;  1KS4 A;  3K51 A;  2HWF 3;  2WKK A;  5DUU A;  3VL8 A;  3BU0 A;  5I93 A;  4GWN A;  5FOJ B;  3I2K A;  1PM7 A;  2D3P A;  5FMC A;  1MZF A;  3VBU A;  1POV 0;  4GMP 1;  5FKC A;  4PIY A;  2H0V A;  3TN9 3;  4OFG A;  5DG1 A;  1C28 A;  3B69 A;  4QKF A;  1JYW A;  4EV0 A;  4WVW A;  4NN0 A;  1O7F A;  1FNZ A;  2VGD A;  2WNE A;  2IXH A;  1VIW B;  2B9V A;  1T2X A;  4XFB A;  5FMO L;  3T08 A;  4QPY A;  3JBG 3;  2EXI A;  4Q0S A;  4JDN A;  5FYU A;  3NRU A;  4P9W A;  1AJK A;  2QFE A;  3C7G A;  1OFN A;  1WMX A;  2E33 A;  3N3H A;  1H6X A;  3DXT A;  4IV1 C;  4EN0 A;  2N7G A;  4XC9 A;  1F15 A;  2R07 3;  4CPB D;  2XGX A;  1IOA A;  1LJ7 A;  1GR3 A;  4BQW A;  1RMU 3;  4LO6 B;  4LHK A;  3DYP A;  4BB3 A;  4GUL A;  5FZ3 A;  2G9F A;  3TEZ A;  4XAB A;  3VDA A;  1D2S A;  1YO8 A;  2WL1 A;  1WCK A;  1RB8 G;  5FZK A;  5FXZ A;  5HCH A;  4AR2 A;  4XJ9 A;  1UQX A;  3I59 B;  1RIT A;  2QQW A;  1HKD A;  2WDB A;  4AZZ A;  4FPE A;  4XPV A;  1JYV A;  4J6G A;  3Q9O A;  3IAP A;  4Z1V A;  2JG9 B;  2QQK A;  1CJP A;  4HXC A;  2JEC A;  1KJL A;  2GC1 A;  3A0K A;  3SKJ E;  4Y1U A;  1W6P A;  1NQD A;  3RJ2 X;  4MGS A;  1BK1 A;  3VHO A;  3C3V A;  5F6L B;  2A73 B;  2XPJ A;  4NRM A;  1N1V A;  1VBE 3;  2ZBJ A;  5C4W C;  1AL2 3;  1S0I A;  1Z7S 2;  4ZXE A;  4BXF A;  5L7O B;  1JZ4 A;  2ORX A;  5J98 B;  5T5P A;  1ZZ6 A;  2D43 A;  2WRA A;  2XHK A;  3DN7 A;  4JHZ A;  4L11 A;  4PDW C;  5A33 A;  3K4Z A;  3U11 A;  3BGA A;  4DB5 A;  2A6Z A;  2Q8D A;  2NQY A;  4UXA A;  3I2H A;  3LB9 A;  1OLQ A;  2RV9 A;  3J4U H;  2ARA A;  3P3N A;  2A5Z A;  1PGS A;  3MBW A;  1RUC 2;  4IE4 A;  3GJA A;  1W3V A;  3OUI A;  2ZJC A;  1X8M A;  1PVC 2;  5FYZ A;  2J7M A;  1UAI A;  3K77 A;  5EXO A;  5T3N A;  1H1I A;  4MO3 M;  4I2O A;  4PJY A;  3OD4 A;  3WNP A;  1DQ5 A;  1AF9 A;  5KHH A;  3FHA A;  4PHZ A;  3K3O A;  3USU B;  3VD5 A;  1CWP A;  4B8E A;  1VE0 A;  1HB3 A;  1XB9 A;  5ANN A;  3H8U A;  3D5O A;  4JQT A;  3ZYB A;  1UY2 A;  3PUQ A;  4CZS A;  1ND3 C;  3MUY 1;  4MV2 A;  1UL9 A;  1US2 A;  2WSV A;  3HN3 A;  2H6B A;  4YVS C;  1ZBE 2;  4BLI A;  2DUR A;  4N8M A;  3DKQ A;  3ZYF A;  1W6Q B;  4MAD A;  1DGR N;  1AJO A;  3I8T A;  1LOF A;  3B5L B;  4RN5 A;  5E89 A;  2R0F A;  3ZOI A;  1UX7 A;  2VMC A;  5CKQ A;  2OKX A;  3U1X A;  3WW4 A;  4OMD A;  2W92 A;  1AVB A;  2HH9 A;  2YV8 A;  1TEI A;  3BB6 A;  1UOG A;  1S1A A;  4NO4 A;  1RUF 2;  3EJK A;  5FY5 A;  4JRA A;  5JR2 A;  5JSO A;  1RHI 3;  1WBF A;  1QJF A;  2A6V A;  2X05 A;  3M3E A;  2DBN A;  3ZSK A;  3BI3 A;  2ZKL A;  2W87 A;  2WT1 A;  1ULF A;  2XH6 A;  4P9X A;  2OS2 A;  1AR6 3;  3DKW A;  4LLF A;  1W6M B;  3AKR A;  1D0H A;  1Y9M A;  5FUI A;  5A1A A;  4XUR A;  3BOW A;  1SLT A;  2XBO 3;  4YG3 A;  3SEE A;  3WP5 A;  2LUW A;  5EFU A;  3DF0 A;  3OJB A;  4H7L A;  1W9F A;  4LBN A;  4JAA A;  4M0N A;  4PQ9 A;  4DUV A;  5A7W B;  4LKD A;  5FPZ A;  1GSL A;  3PME A;  5C3R A;  3IMM A;  2GN7 A;  2FDG A;  1WMF A;  5G05 L;  4W6Y A;  5LBF A;  1VAV A;  3O1V A;  3CJI A;  1F5F A;  3FHQ A;  5T55 A;  2AEY A;  3ZO0 B;  3VDD B;  2XJR A;  4F8A A;  4A7Y A;  2ZX3 A;  3N9L A;  5ABJ C;  4NRP A;  4PCR A;  2GME A;  3T1L A;  4ES8 A;  4K1Z A;  3LDR A;  4Q4X 1;  4QX3 A;  2DBI A;  1HIX A;  4D7S A;  1PMI A;  5FTT C;  3KB5 A;  4DIN B;  4DY3 A;  2VC9 A;  3WQ0 A;  2EXH A;  3UKV A;  4R9B A;  4QGL A;  4XDP A;  4BU2 A;  2KD7 A;  5F2S A;  1LGN A;  4AFA A;  1FNY A;  2JG9 C;  2WBK A;  4YM1 A;  1UN1 A;  1VRH 3;  1CR7 A;  1HQN A;  1V9U 3;  3KF5 A;  4URT A;  3HQR A;  5EV7 A;  5FZO B;  2JIC A;  4FFI A;  4OHZ A;  1FMD 1;  4A3X A;  3AP5 A;  1W06 A;  5JPM B;  4E9K A;  4IV3 A;  4D7T A;  2ZAA A;  3MIH A;  5CFC A;  1MS3 A;  1JYC A;  1Q5O A;  2O8Q A;  1OD3 A;  2QQM A;  3NNL A;  4HVO A;  4JGY B;  4EWD A;  5L7O C;  3C2U A;  3PNA A;  3H7Y A;  1RTV A;  1AYN 3;  4XMA A;  2DDU A;  2LW8 A;  5JCT A;  2NP0 A;  2AEZ A;  4PIX A;  4XE9 A;  1VRB A;  1RVF 1;  4S2D A;  1RIN A;  2R49 A;  3BKZ A;  2VMF A;  4MHR A;  2Y6H A;  1FV2 A;  5JDB A;  4OZO A;  4KWK A;  3EHK A;  3WP4 A;  1W03 A;  4QX8 A;  3O1R A;  4NHK A;  1W9W A;  1V6I A;  2K46 A;  4Y22 B;  3B7M A;  5GKA C;  4AOC A;  1NE6 A;  2HEV F;  3ATG A;  3I3D A;  1OQE A;  3CNA A;  5FPA A;  4CCD A;  4IEQ A;  3ORJ A;  4GB3 3;  3S57 A;  2ORZ A;  3KGZ A;  4OHW A;  1NYW A;  3VD9 A;  3WT3 A;  1YRZ A;  4FPF A;  3EBR A;  1HB4 A;  1OUR A;  1F35 A;  2Z5W A;  4AED B;  1NCR B;  4Y1Y A;  1CGP A;  1EV1 3;  4XQW A;  3RI8 A;  1NY7 1;  2ZOE B;  3D8C A;  1WCS A;  4CP0 A;  1YIP A;  1COV 3;  4QWN A;  4AVV A;  3F2Z A;  4QPW A;  1NOV A;  3RJR A;  5J09 A;  2P6H A;  2WNV B;  5JUV A;  4QXK A;  1J3R A;  4NHX A;  2KA3 A;  1HV0 A;  1HDK A;  1HXS 1;  1LOG A;  1NCQ A;  1HRI 3;  2ZGO A;  1ZZB A;  3ZR6 A;  2YFZ A;  2BQP A;  2VTX J;  3ZYG A;  2YGL A;  2JE8 A;  2C0Z A;  3ES4 A;  4OHY A;  2RHP A;  2XR4 A;  3K2O A;  1VJ2 A;  4B3N A;  3ZMN A;  4CUG A;  4AQT A;  4Y33 A;  2WIN B;  1NA1 A;  2XJP A;  4BME A;  2DUO A;  3VBU B;  3GBW A;  2E53 A;  1Y43 B;  1Z78 A;  4COY A;  5D8A A;  1C8M 1;  3WG4 A;  3N36 A;  4QGN A;  3OBZ A;  4E4H A;  1AL0 G;  1MS8 A;  4PLM A;  2BU9 A;  3OB8 A;  2JG8 A;  3POW A;  3R4S A;  5A6Q A;  1LU1 A;  4HK8 A;  3LKJ A;  4GIQ A;  5SV8 A;  5DAV A;  2E7Q A;  2YC2 A;  3USS A;  4RGK A;  1WKY A;  1OQD A;  3ZFF A;  1UOF A;  1W6O A;  2CL2 A;  2VNV A;  4MSV A;  2MEV 3;  2OVU A;  1GNZ A;  5GJ6 A;  4QXC A;  3PUS A;  4QHZ A;  2IWG B;  2QQN A;  3CEW A;  4Y4R A;  3ZXA C;  2ZEZ A;  4Y5T A;  4AF9 A;  4CSW A;  1GQH A;  3JU9 A;  4UYB A;  1RUD 1;  5JR7 B;  1G9F A;  1R64 A;  4HFS A;  4OCT A;  3J8F 3;  5JZG A;  5JPN B;  3GDB A;  4PQQ A;  4FO9 A; 
#chains in the Genus database with same CATH homology
 1ZA7 A;  4OQ8 A;  1A34 A;  3J7N A;  3J7L A;  4OQ9 A;  4NIA A;  1YC6 1;  3J7M A;  1JS9 A;  1CWP A;  1STM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...