1A3YA

Odorant binding protein from nasal mucosa of pig
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
149
structure length
149
Chain Sequence
b'PFELSGKWITSYIGSSDLEKIGENAPFQVFMRSIEFDDKESKVYLNFFSKENGICEEFSLIGTKQEGNTYDVNYAGNNKFVVSYASETALIISNINVDEEGDKTIMTGLLGKGTDIEDQDLEKFKEVTRENGIPEENIVNIIERDDCPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ODORANT BINDING PROTEIN
publication title The structure of the monomeric porcine odorant binding protein sheds light on the domain swapping mechanism.
pubmed doi rcsb
molecule tags Lipocalin
total genus 32
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1a3yA00
3QKGA 5D47A 1NP1A 1X89A 4WBKA 4YBPA 4GE1A 1KZWA 1BSQA 3BDRA 2JU3A 1BRQA 4TQ2A 5IO7A 1IW2A 4D6AA 4ZH6A 4YH0A 1YWAA 5DG4A 1UREA 2CM4A 4Y0SA 2X46A 3RZYA 5IO6A 1ERXA 1CRBA 3EMMA 4M7MA 5D45A 1FEMA 2A3FX 2DM5A 4QAEA 4XMEA 3KZAA 1L6MA 4EEJA 4ARHA 1ERBA 5F1EA 2AL0X 5HZ9A 4YKMA 5KIDA 1JV4A 2FS7A 4YDBA 2QM9A 3VG2A 4HPDA 3B2IA 4I3BA 3ZUIA 1DF3A 3VG4A 3O2YA 2AKQA 1RBPA 2HLVA 3P6DA 5HCEC 1QABE 1KT4A 1EIOA 1CJ5A 2ACPX 3FA9A 1SXXA 1CBSA 2X45A 3S26A 5EDCA 4HPBA 2G79A 2G78A 1B8EA 5HTDA 1ZNHA 1HBPA 4I3CA 4ALBA 5LJKA 3STMX 2LKKA 2R74A 5KICA 1EQDA 4NNTA 5EEDA 1AELA 1MX7A 3WXQA 1HBQA 1E00A 4AZNA 5HZ8A 4ZJ0A 1JJXA 3UEUA 3APXA 3TGBA 1ALBA 3BS2A 4ZH9A 4TLJA 2GC9A 1KQWA 2L68A 3NQ9A 4PSQA 3UEWA 1E5PA 5BVQA 4AZRA 2QO6A 2A0AA 4QGXA 4ORWA 2BLGA 1YIVA 2AT3X 4QYPA 1YWBA 1DV9A 1JJJA 5F7GA 4MVLA 1DZMA 2OVDA 3U0DA 3P6GA 5LKFA 2RA6A 3PECA 1GT4A 5HZ5A 1LIEA 3RSWA 3FR4A 1IKJA 1OEEA 3NR3A 2W2AA 5H8TA 4Y0RA 3UEVA 1FENA 4HPCA 1B56A 3MBTA 1ADLA 3BX8A 1TOUA 2YG2A 4QZUA 3D95A 1O8VA 1CBRA 3C77X 3VG7A 4I9RA 4RUNA 2FRSA 1XKIA 3Q6LA 5FAZA 1OEKA 3B2JA 2POAA 5LJEA 3UEXA 3KFHA 4YGZA 1XCAA 3PH6A 4IBAA 1BSOA 3TZSA 1S44A 2HYSA 3STKA 4ZHDA 1X8UA 3TF6A 4YGGA 2FLJA 2K23A 1DZPA 4A60A 4IMNA 4GH7A 2AH7X 4EFGA 4HFOA 1O1UA 2EU7X 2CZUA 3PEDA 4OMXA 4ZFXA 4ZHHA 1SXUA 4EDEA 5HZ6A 2L67A 2NNEA 1T8VA 3HWGA 2NNDA 3KQ0A 3PP6A 3C78X 1T0VA 3BX7A 1ACDA 1IFCA 4YDAA 4LZVA 3APWA 3BLGA 2KT4B 1LNMA 1X8NA 2CZTA 3PH5A 2AMMX 4NLIA 1LIDA 3CQNA 3JSQA 5HBSA 4BVMA 1FTPA 1G85A 4ALOA 5KHPA 3KFGA 2RCQA 2CBRA 4IB9A 1OEJA 1S2PA 1BRPA 3ELXA 3VG5A 3WJCA 1GT5A 3NPOA 4AZMA 3NQ3A 2Q9SA 1KGLA 3FIQA 5D48A 4YCEA 1JYJA 4Y0QA 3WBGA 1SY2A 1BJ7A 1LIBA 3JS1A 1OPBA 1TOWA 1DC9A 2WWPA 1YWCA 2MJIA 1VYFA 5EZ2A 2ACOA 2WQAE 1YWDA 1YP6A 3EBKA 4HPAA 2G7BA 3K3LA 3WJEA 4QGVA 1PM1X 2HNXA 3HWFA 4N7CA 1OBPA 4TNNA 1QFTA 1ZNLA 2FWVA 2HZRA 4NYRA 4KIIA 3O22A 1GT3A 5LJGA 2WR6A 4TJZA 4GRJA 4IB8A 2F73A 4YKOA 2FR3A 3FLLA 4IB7A 4LZUA 3BRNA 1NGLA 2LBAA 3VG3A 4A8ZA 1EW3A 1U0XA 1VPRA 2AT6X 4I3DA 5H9LA 1AQBA 4IAXA 5F6BA 2NP1A 3O19A 4XMHA 1ZNDA 1GKAA 5L8NA 2W2BA 1TVQA 1X8QA 1AVGI 1KT3A 4M6SA 1GM6A 2IFBA 1G5WA 2OVEA 4ES7A 1G7NA 2WQ9A 5C0NA 1T68X 3WJBA 3EYCA 3EBWA 4BQUA 2RD7C 3WJFA 1KT5A 3FA6A 5LJHA 1LF7A 2FTBA 2HMBA 2QOSC 2Q39A 1ML7A 2JOZA 2MO5A 3MVFA 4TKBA 4MVKA 5D8JA 4Y0PA 4YCHA 4ZGUA 1TW4A 5JR8A 1GXAA 3BU1A 1X71A 2W2FA 1TXLA 3FR2A 2OZQA 5H9KA 4AZQA 3BSZE 1ICMA 1YP7A 5LKEA 1A3YA 4O9SA 1BM5A 5CE4A 3WVMA 2P8GA 1FDQA 2ANSA 3ELZA 5AQ6A 5F58A 3U9PC 1OPAA 5F6ZA 1AB0A 2XSTA 3HWEA 4IMOA 5L8IA 1DFVA 3FELA 4A1YA 3B2LA 3U03A 1DZKA 3CMPA 4GNYA 2JU8A 1ICNA 1JYDA 1PBOA 1E06A 3CBSA 4OS3A 3L4RA 4GETA 1B0OA 4QYNA 4I9SA 4YBUA 1A57A 4YFQA 1QFVA 3CQRA 5K06A 4DQ4A 4YMYA 1ZNKA 2OFMX 3ZQ3A 3B2KA 1YUPA 4ORRA 4IB6A 2JU7A 1GGLA 1B4MA 1LICA 1EUOA 1MX8A 3P6HA 4OS8A 1OBUA 5H9AA 3SAOA 1HMTA 1KOIA 1U17A 2LB6A 5FENA 1BEBA 4R0BA 1QWDA 5BVTA 4ORUA 5D4AA 2WEXA 1KT7A 3CBCA 1BSYA 2QO5A 4LKPA 2Q2MA 5LJCA 1R0UA 2AT8X 2KTDA 1EPAA 1HQPA 3CR6A 3C76X 1UZ2X 4OS0A 1A2DA 1MVGA 1SXWA 3STNA 1PMPA 5HA1A 4BOEA 5HAEA 3CWKA 3APVA 1OBQA 2N93A 5L8OA 1SY0A 3NP1A 3FEKA 4AZOA 2CBSA 2JN3A 5DPQA 5EPQA 1SA8A 4AW8A 5HCCC 1FELA 4TKHA 1BBPA 3F9DA 1LFOA 1EIIA 3FA7A 1S7DA 1ZNGA 3FR5A 2GTFX 1PEEA 1HMSA 3FENA 3VG6A 5HTEA 2MM3A 4NP1A 1ZNEA 1GX8A 2FR2A 3FA8A 1VYGA 1KT6A 3P6EA 1QY0A 2AT0X 1P6PA 4A1HA 5IO5A 1MUPA 2LBVA 3AKNA 2ASNX 2RCTA 2O62A 2AT5X 4NNSA 5BVSA 2A13A 3WJDA 1GT1A 2Q2PA 3OJYC 1BLRA 1SY1A 1QY2A 1QY1A 3TGAA 4N7DA 5H9NA 4IAWA 4ZHFA 1JZUA 4ZR2A 5B27A 4YFPA 3APUA 2RQ0A 3BY0A 5EDBA 3G7XA 5HCDC 3IFBA 4GKCA 3TGCA 5HA0A 5LJBA 1EALA 2OVAA 5HWZA 1D2UA 4XMFA 3WJGA 1KZXA 1QQSA 2GJ5A 4XMCA 4TKJA 1Z24A 1NP4A 3D96A 4NYQA 1EXSA 4ORSA 3FEPA 2A2UA 1MDCA 2FT9A 4WFUA 1JBHA 3AKMA 2L5PA 3DSZA 1DZJA 1U18A 4ODDA 3FW4A 2E4JA 2PY1A 1E02A 4DQ3A 2ALLX 4MVIA 3IA8A 3EM0A 3T1DA 2Q4NA 1SXYA 2WUTA 3HWDA 2WEWA 1CBIA 4UU3A 4LKTA 1KXOA 2K62A 4XMGA 4YGHA 3B2HA 3HK1A 1IIUA 2L9CA 2WSJA 3F8AA 4RUUA 4CK4A 4EXZA 1BWYA 1ZRYA 1X8PA 3NX1A 3NADA 1N0SA 3FW5A 4YFRA 1HN2A 3P6CA 1LIFA 3FMZA 4ZHCA 4AYHA 4ZCBA 1KQXA 2QO4A 2R73A 4WFVA 4AZPA 2CM9A 4ORYA 1HMRA 2A2GA 1RLBE 3BU9A 5LJDA 4K19A 5FFHA 1I05A 4ORXA 1I4UA 4OMWA 1EPBA 1SY3A 2LFOA 2XKLA 1O1VA 1LPJA 3GAQA 3P6FA 5EEEA 4GNWA 1I06A 1X8OA 4NLJA 3KFFA 4ZHGA 5HZQA 1A18A 4QGWA 1FE3A 1CBQA 1D3SA 2HZQA 2R56A 1IFBA 5B29A 4UU2A 1LKEA 4XMDA 2OFRX 1IKEA 2NNQA 3I0AA 3D97A 4QZTA 1GKAB 3I17A 3KFIA 1H91A 4D6BA 3PPTA 1QG5A 3DTQA 3NX2A 1GX9A 2FS6A 1G74A 3ZUOA 1I04A
chains in the Genus database with same CATH superfamily
3QKGA 5D47A 1NP1A 4GGTA 1MOYA 1X89A 4WBKA 4YBPA 4GE1A 1KZWA 1BSQA 3BDRA 2JU3A 1BRQA 3OD9A 4TQ2A 5IO7A 1IW2A 2X32A 4D6AA 4O4SA 4ZH6A 4YH0A 1YWAA 5DG4A 4CDCA 1UREA 3F6ZB 2CM4A 4Y0SA 2X46A 3RZYA 5IO6A 1ERXA 1CRBA 1K24A 4ON1A 3EMMA 4M7MA 5D45A 1FEMA 2A3FX 2DM5A 4QAEA 1LELA 4XMEA 3KZAA 3SZJA 1L6MA 3RBYA 5CSEA 4FBRA 4EEJA 2OYBO 1ERBA 5F1EA 1WBIA 2AL0X 4YKMA 4ARHA 5HZ9A 5KIDA 4MIRA 4BX5B 3FIDA 1JV4A 2FS7A 4CDEA 4YDBA 2QM9A 1FJ1E 3SLTA 4HPDA 1SWGA 3VG2A 3ZW2A 1RXJA 3B2IA 4I3BA 3ZUIA 1DF3A 2Y3EA 3VG4A 3AUMO 5FQ8E 3O2YA 5B11O 3KVNA 2AKQA 1RBPA 2HLVA 3P6DA 4BX7A 5HCEC 1QABE 1KT4A 1EIOA 1CJ5A 2JMBA 2ACPX 3FA9A 1OSPO 4Z2PA 1SXXA 3ZWEA 1CBSA 2X45A 2WPUA 3S26A 5EDCA 4HPBA 3WOVA 2G79A 2G78A 3ZI8A 1B8EA 3P24A 4KH8A 1JQPA 1ZNHA 3WZOA 4CV7A 5HTDA 1HBPA 4I3CA 4ALBA 5LJKA 3STMX 2MWHA 2LKKA 2R74A 5CYBA 5KICA 4GU8A 1EQDA 4NNTA 1VWFB 5EEDA 1AELA 1UYNX 2OFBA 1MX7A 3WXQA 1HBQA 1E00A 5JD2A 4AZNA 5HZ8A 2RTHB 4ZJ0A 1WUBA 1JJXA 3UEUA 4JNJA 4O4UA 1N43A 3APXA 3TGBA 4KC8A 1ALBA 4KT5A 3BS2A 4ZH9A 3VE1A 4PJ2A 2GC9A 1KQWA 2L68A 2RTLA 1RAVA 2QCBA 2X56A 3NQ9A 1E5PA 1VWNB 4PSQA 2QO6A 5BVQA 2A0AA 4O49A 4QGXA 3UEWA 4AZRA 4ORWA 3WYQA 2BLGA 4U9CA 3RDUA 1YIVA 2JGSA 2AT3X 2G8CO 3GE2A 1STSB 2HKDA 4QYPA 4BVMA 3E3CA 1YWBA 1DV9A 1JJJA 2ZAIA 5F7GA 3HOLA 3LHNA 2BC3A 2C4IA 2X55A 4MVLA 1DZMA 2FKJA 1VWJB 2OVDA 3U0DA 3P6GA 2BS5A 2Y32A 5LKFA 3FDCA 2RA6A 2IZIA 2QMIA 3PECA 1GT4A 5HZ5A 1LIEA 3RSWA 3S60A 3FR4A 1IKJA 1OEEA 2OY1O 3RKGA 3ZW1B 3RDXA 3NR3A 2W2AA 4MISA 2GTLN 4Y0RA 5H8TA 1FENA 2AF5A 1B56A 3MBTA 4HPCA 3UEVA 2VDFA 4NW4A 4I95A 1ADLA 2F01A 1TOUA 1N9MA 2YG2A 3BX8A 3D95A 1O8VA 2IZFB 2LA7A 4QZUA 1CBRA 2OY8A 4QRLA 5CHKA 3C77X 3VG7A 4I9RA 4RUNA 2FRSA 1XKIA 1SWJA 3Q6LA 5FAZA 5B3MO 1OEKA 3B2JA 4LQZA 2POAA 5LJEA 3UEXA 4QNIA 3KFHA 4YGZA 1XCAA 2BSZA 3PH6A 4IBAA 1BSOA 3TZSA 1S44A 2HYSA 3OE3A 4QQ1A 3STKA 3LTWA 2RTAA 4Z6JA 2MF6A 4ZHDA 1X8UA 3SOTA 3TF6A 1LCVA 1W5RA 3RDOA 4YGGA 2FLJA 2K23A 1DZPA 1SWKA 5AJBA 4A60A 4IMNA 1SWLA 4GH7A 2AH7X 4EFGA 2RN4A 1O1UA 2EU7X 2CZUA 3PEDA 1Y53X 4HFOA 4OMXA 1SXUA 4ZHHA 4EDEA 5HZ6A 2L67A 2NNEA 1T8VA 1KL3A 3HWGA 1I9HA 2NNDA 3KQ0A 3PP6A 3RE6A 3C78X 4OKAA 1T0VA 2A8GA 3BX7A 1ACDA 4ZFXA 1IFCA 4YDAA 4LZVA 3APWA 3BLGA 2KT4B 4GGRA 1LNMA 2RTBB 1X8NA 1SWNA 2CZTA 2AMMX 3PH5A 1LIDA 3CQNA 3JSQA 4L1NA 4NLIA 5HBSA 1FTPA 1G85A 3NBXX 4ALOA 5KHPA 1KL4A 2RCQA 3KFGA 2RTRB 2CBRA 4IB9A 4Z27A 1OEJA 1S2PA 3D4RA 1BRPA 3ELXA 3VG5A 3WJCA 1GT5A 3NPOA 4AZMA 3NQ3A 1VWAB 2Q9SA 1SLEB 1KGLA 3FIQA 3MG5A 3JQOA 5D48A 4YCEA 1JYJA 4Y0QA 3WBGA 3V8UA 1RXHA 1SY2A 1MK5A 1BJ7A 1LIBA 5IRAA 3JS1A 1RSUB 2Z4HA 1OPBA 1SRJA 1TOWA 1DC9A 2WWPA 1YWCA 2MJIA 1VYFA 5EZ2A 2ACOA 2WQAE 1SWOA 1YP6A 1YWDA 2RTCB 3EBKA 1SMPI 4HPAA 2G7BA 3K3LA 3MM0A 3WJEA 1SWHA 4QGVA 1PM1X 3RY1A 2HNXA 3HWFA 4I60A 4CPIA 2IZJA 5AEOA 4N7CA 1VYOA 1OBPA 4GDZA 4TNNA 3ZW0A 1QFTA 1ZNLA 2FWVA 2HZRA 4NYRA 3UAQA 4KIIA 3VHMA 2DJFA 3O22A 4DCBA 1GT3A 5LJGA 2WR6A 4TJZA 4GRJA 3SZIA 4IB8A 2F73A 3QQ2A 4YKOA 3WZQA 2FR3A 3FLLA 1SRIA 4IB7A 4FBOA 2VFBA 4LZUA 3BRNA 1NGLA 1MEPA 2LBAA 3VG3A 4A8ZA 3OBLA 5B10O 1EW3A 1U0XA 1VPRA 2AT6X 4GK9A 4I3DA 5H9LA 4CPHB 1AQBA 4IAXA 5F6BA 3S5XA 2NP1A 4FQBB 2OF9A 2OL6O 3O19A 3ZZVA 4XMHA 1ZNDA 4FBVA 3SLOA 1VWGB 1GKAA 5L8NA 2W2BA 1TVQA 1AVEA 1AVGI 1X8QA 4L3RA 2FKGA 1KT3A 1SLFB 4M6SA 4WHIA 4OELA 1GM6A 4Z2OA 2IFBA 3WZNA 1G5WA 4HWMA 4U8UM 2OVEA 1N4JA 4ES7A 1G7NA 2WQ9A 5C0NA 4JO6A 1T68X 4IRWA 3SZHA 3WJBA 3EYCA 2IZBA 3EBWA 2RD7C 4I6SA 3WJFA 4BBOA 4BJ8A 4BQUA 4BGFA 1SWRA 1KT5A 1N9YA 2IZCB 3FA6A 5LJHA 1LF7A 2FTBA 3H3IA 5FQ7E 2HMBA 2QOSC 1Y55X 1ML7A 2MO5A 2JOZA 2Q39A 3MVFA 2RTDB 1VWIB 4TKBA 4MVKA 5D8JA 4U8UO 4Y0PA 4YCHA 4ZGUA 1PTSA 1TW4A 5JR8A 1GXAA 4O3XB 3BU1A 1X71A 3S5VA 4BX5A 2W2FA 1TXLA 3FR2A 3T2WA 2OY7A 2OZQA 3PK2A 5H9KA 4AZQA 3BSZE 1ICMA 1YP7A 1SWTA 1NQNA 5LKEA 1A3YA 4O9SA 4INNA 1SWCA 1BM5A 5CE4A 3MX7A 3WVMA 2P8GA 1FDQA 3X00A 1VWPB 1SWPA 4EQAC 2ANSA 1STRB 3ELZA 1SWSA 5AQ6A 5F58A 2A5CA 3U9PC 1OPAA 4CDDA 4O3WA 4Z2VA 5F6ZA 4CPFA 1AB0A 2XSTA 2RTKA 2RTGB 4JGLA 3HWEA 2OL8O 4IMOA 5L8IA 1RXKA 2IZEB 1DFVA 3FELA 4A1YA 1VWLB 3B2LA 3U03A 1DZKA 3CMPA 4GNYA 1SWEA 4GJVA 1SWDA 2FHNX 1JJUA 2JU8A 1ICNA 1JYDA 2UZ2A 1PBOA 1E06A 3CBSA 4OS3A 1Y52X 1NC9A 2G5LA 3PQUA 3L4RA 4GETA 1B0OA 4QYNA 4I9SA 1JMXA 4YBUA 3RDQA 4BX6A 4YFQA 1LCWA 4CPEA 1QFVA 3CQRA 4COTA 1Y0GA 5K06A 4CSBA 4DQ4A 4YMYA 1ZNKA 2OFMX 3ZQ3A 1VWDB 5L3YA 3B2KA 1YUPA 1GX3A 4ORRA 4IB6A 1HQQA 3HPEA 1EI5A 4Z28A 3EW2A 4DNEA 1SREA 2OF8A 4NV8A 2RTPB 5K68A 2IZDB 1GGLA 2JU7A 3HTYA 1B4MA 1LICA 1EUOA 1MX8A 1VWKB 3P6HA 4OS8A 1OBUA 4U46A 2I5ZO 1HMTA 1KOIA 1U17A 2CAMA 2LB6A 1VWBB 5H9AA 3SAOA 4BX7B 5FENA 1BEBA 2KD2A 4R0BA 3ZW1A 5AJCA 1QWDA 2RTQB 4GDAA 1NDJA 1HXZA 5BVTA 1VWQB 4BX6B 2RTEB 1LDOA 1SRHA 4ORUA 5D4AA 1JMZA 2IZHB 2M4LA 1VWMB 2WEXA 1KT7A 3CBCA 1BSYA 1KFFA 2QO5A 4LKPA 2Q2MA 2RTOB 3EW1A 1SLGB 1R0UA 4NV7A 5LJCA 1SWQA 2AT8X 2DJGA 2KTDA 1EPAA 2I5VO 1HY2A 1HQPA 3CR6A 5IXGA 3C76X 1UZ2X 4OS0A 2X8FA 1A2DA 1MVGA 2UYWA 1SXWA 4O3YA 3VE2A 3STNA 1PMPA 5HA1A 1Y9LA 4GZVA 4BOEA 5HAEA 3CWKA 1MM9A 3APVA 1OBQA 2GTLM 2N93A 5L8OA 1N7YA 1SY0A 2VFCA 3FEKA 3NP1A 2CBSA 4GJSA 2X8SA 4O4XA 4AZOA 3WZPA 3RDSA 2JN3A 5DPQA 5EPQA 3T6LA 1SA8A 1W4TA 2BHVA 4AW8A 5HCCC 1FELA 4TKHA 4C5PA 1BBPA 3F9DA 4BCSA 1LFOA 1EIIA 3FA7A 1S7DA 1ZNGA 2QOMA 3FR5A 2GTFX 2MHDA 2KTSA 1PEEA 1HMSA 3FENA 3VG6A 5HTEA 2MM3A 4NP1A 1ZNEA 1GX8A 2FR2A 3FA8A 2GTLO 1VYGA 1KT6A 3P6EA 1QY0A 1W6FA 2AT0X 1P6PA 4GGZA 4Y59A 3RWXA 4FGIB 4MEEA 4A1HA 1SWBA 5IO5A 1MUPA 2LBVA 1SWAA 2IZAA 4MVEA 2X8TA 4Y5DA 3AKNA 1PBYA 2ASNX 2RCTA 2O62A 5IRWA 2AT5X 1HXLA 3PDFA 2RTJA 3VU1A 5K67A 4NNSA 5BVSA 2A13A 3VHHA 3WJDA 1GT1A 2Q2PA 3OJYC 1BLRA 2X34A 1SY1A 1QY2A 2C1SA 1QY1A 2C1QA 2Z4IA 3FYFA 3N91A 1LUQA 4IAWA 4N7DA 5H9NA 4OEMA 2A5BA 3TGAA 4ZHFA 1JZUA 4ZR2A 2FGSA 5B27A 5B5FA 1DF8A 1SWUA 4YFPA 3APUA 2ZSCA 2RQ0A 4B55A 3BY0A 5EDBA 4GD9A 3G7XA 5HCDC 3IFBA 4GKCA 3TGCA 5HA0A 1SRFA 5LJBA 4IABA 3RE5A 2OVAA 4CDFA 5HWZA 1EALA 1D2UA 1SWFA 4ID2A 4XMFA 2KW1A 3WJGA 1KZXA 1QQSA 2GJ5A 4TLJA 4XMCA 3SLJA 1JIWI 4TKJA 2BT9A 1Z24A 2PI3O 1NP4A 2JW1A 3D96A 1EXSA 4NYQA 4ORSA 2OY5O 2RTNB 2IZGB 3FEPA 2A2UA 1MDCA 3T2XA 1VWCB 1Y9TA 2FT9A 4WFUA 1JBHA 3AKMA 2L5PA 3DSZA 4YVBA 1DZJA 1U18A 4ODDA 3FW4A 2E4JA 2PY1A 1E02A 1LCZA 1RSTB 2IZKA 2RTIB 2RTMA 2ALLX 5B2AO 4DQ3A 4MVIA 3IA8A 3EM0A 3T1DA 1NQMA 2Q4NA 3WYPA 1SXYA 2OL7A 2WUTA 4CPHA 3HWDA 2WEWA 1CBIA 5F2BA 2FHLA 4UU3A 4LKTA 1KXOA 2K62A 4O4OA 4XMGA 4YGHA 1VWRB 3T6FA 3B2HA 1SLDB 1VWOB 3HK1A 1IIUA 2L9CA 1VWHB 2WSJA 3F8AA 4RUUA 4CK4A 2Y3FA 4EKVA 4EXZA 1BWYA 2IZLB 2RTFB 2BS6A 5FQ6E 1ZRYA 1X8PA 3NX1A 3AEHA 1K3BA 3NADA 1N0SA 3FW5A 4YFRA 1HN2A 3P6CA 1LIFA 2GH7A 3FMZA 3HOEA 4U3QA 4KCAA 4ZHCA 4AYHA 2AVIA 4ZCBA 1KQXA 3RDMA 3VHIA 2QO4A 3VPJE 4KC7A 2R73A 4WFVA 3VGWA 4AZPA 5B5GA 5BYPA 2CM9A 4ORYA 1HMRA 2A2GA 3CKGA 1RLBE 3D9WA 3NQKA 3BU9A 5LJDA 3EC5A 4K19A 5FFHA 1I05A 4JHQA 4ORXA 1I4UA 3LV4A 3P02A 1A57A 4OMWA 3ZW0B 1EPBA 1SY3A 1UYOX 2LFOA 2OFAA 2XKLA 1VWEB 1AVDA 1E2TA 1O1VA 1LPJA 3GAQA 3P6FA 5EEEA 3Q34A 4U8UN 4GNWA 1I06A 1X8OA 4NLJA 1I78A 3KFFA 5IRUA 5HZQA 1A18A 4ZHGA 4QGWA 1FE3A 3RY2A 1STPA 1SRGA 1CBQA 1D3SA 1KL5A 2HZQA 2R56A 3PQSA 1IFBA 3CKFA 2X4MA 4UU2A 5B29A 4GUZA 1LKEA 4XMDA 2OFRX 1IKEA 4ZGFA 2NNQA 3I0AA 4O3ZA 1IJ8A 4ML7B 3D97A 4QZTA 1GKAB 3I17A 3KFIA 1H91A 4D6BA 1NBXA 3PPTA 1QG5A 3DTQA 2F09A 1LDQA 3NX2A 1GX9A 2FS6A 1G74A 2ZAGA 3ZUOA 1I04A 2OVSA 2YMSA
chains in the Genus database with same CATH topology
3QKGA 5D47A 1NP1A 1X89A 4WBKA 4YBPA 4GE1A 1KZWA 1BSQA 3BDRA 2JU3A 1BRQA 3OD9A 4TQ2A 5IO7A 1IW2A 4D6AA 4O4SA 4ZH6A 4YH0A 1YWAA 5DG4A 1UREA 3F6ZB 2CM4A 4Y0SA 2X46A 3RZYA 5IO6A 1ERXA 1CRBA 4ON1A 3EMMA 4M7MA 5D45A 1FEMA 2A3FX 2DM5A 4QAEA 4XMEA 3KZAA 1L6MA 3RBYA 4FBRA 4EEJA 4ARHA 1ERBA 5F1EA 2AL0X 5HZ9A 4YKMA 5KIDA 4MIRA 1JV4A 2FS7A 4YDBA 2QM9A 3VG2A 4HPDA 3ZW2A 3B2IA 4I3BA 3ZUIA 1DF3A 3VG4A 5FQ8E 3O2YA 2AKQA 1RBPA 2HLVA 3P6DA 5HCEC 1QABE 1KT4A 1EIOA 1CJ5A 2JMBA 2ACPX 3FA9A 1SXXA 3ZWEA 1CBSA 2X45A 3S26A 5EDCA 4HPBA 3WOVA 2G79A 2G78A 3ZI8A 1B8EA 3P24A 4KH8A 1ZNHA 4CV7A 5HTDA 1HBPA 4I3CA 4ALBA 5LJKA 3STMX 2MWHA 2LKKA 2R74A 5CYBA 5KICA 4GU8A 1EQDA 4NNTA 5EEDA 1AELA 1MX7A 3WXQA 1HBQA 1E00A 4AZNA 5HZ8A 4ZJ0A 1JJXA 3UEUA 4O4UA 3APXA 3TGBA 4KC8A 1ALBA 4KT5A 3BS2A 4ZH9A 3VE1A 4PJ2A 2GC9A 1KQWA 2L68A 3NQ9A 4PSQA 4TLJA 3UEWA 1E5PA 5BVQA 4AZRA 2QO6A 2A0AA 4O49A 4QGXA 4ORWA 2BLGA 4U9CA 1YIVA 2AT3X 3GE2A 4QYPA 3E3CA 1YWBA 1DV9A 1JJJA 2ZAIA 5F7GA 3HOLA 3LHNA 4MVLA 1DZMA 2OVDA 3U0DA 3P6GA 2BS5A 5LKFA 2RA6A 3PECA 2QMIA 1GT4A 5HZ5A 1LIEA 3RSWA 3S60A 3FR4A 1IKJA 1OEEA 3RKGA 3ZW1B 3NR3A 2W2AA 4MISA 2GTLN 4Y0RA 5H8TA 1FENA 4HPCA 1B56A 3MBTA 3UEVA 4NW4A 4I95A 1ADLA 3BX8A 1TOUA 2YG2A 4QZUA 3D95A 1O8VA 2LA7A 1CBRA 4QRLA 3C77X 3VG7A 4I9RA 4RUNA 2FRSA 1XKIA 3Q6LA 5FAZA 1OEKA 3B2JA 4LQZA 2POAA 5LJEA 3UEXA 4QNIA 3KFHA 4YGZA 1XCAA 3PH6A 4IBAA 1BSOA 3TZSA 1S44A 2HYSA 3OE3A 4QQ1A 3STKA 4ZHDA 1X8UA 3SOTA 3TF6A 4YGGA 2FLJA 2K23A 1DZPA 5AJBA 4A60A 4IMNA 4GH7A 2AH7X 4EFGA 2RN4A 1O1UA 2EU7X 2CZUA 3PEDA 4HFOA 4OMXA 4ZFXA 1SXUA 4ZHHA 4EDEA 5HZ6A 2L67A 2NNEA 1T8VA 3HWGA 2NNDA 3KQ0A 3PP6A 3C78X 1T0VA 3BX7A 1ACDA 1IFCA 4YDAA 4LZVA 3APWA 3BLGA 2KT4B 1LNMA 1X8NA 2CZTA 3PH5A 2AMMX 4L1NA 1LIDA 3CQNA 3JSQA 4NLIA 5HBSA 4BVMA 1FTPA 1G85A 3NBXX 4ALOA 5KHPA 3KFGA 2RCQA 2CBRA 4IB9A 1OEJA 1S2PA 3D4RA 1BRPA 3ELXA 3VG5A 3WJCA 1GT5A 3NPOA 4AZMA 3NQ3A 2Q9SA 1KGLA 3FIQA 3JQOA 5D48A 4YCEA 1JYJA 4Y0QA 3WBGA 3V8UA 1SY2A 1BJ7A 1LIBA 3JS1A 2Z4HA 1OPBA 1TOWA 1DC9A 2WWPA 1YWCA 2MJIA 1VYFA 5EZ2A 2ACOA 2WQAE 1YWDA 1YP6A 3EBKA 1SMPI 4HPAA 2G7BA 3K3LA 3WJEA 4QGVA 1PM1X 2HNXA 3HWFA 5AEOA 4N7CA 1OBPA 4GDZA 4TNNA 3ZW0A 1QFTA 1ZNLA 2FWVA 2HZRA 4NYRA 3UAQA 4KIIA 3O22A 1GT3A 5LJGA 2WR6A 4TJZA 4GRJA 4IB8A 2F73A 4YKOA 2FR3A 3FLLA 4IB7A 4FBOA 4LZUA 3BRNA 1NGLA 2LBAA 3VG3A 4A8ZA 3OBLA 1EW3A 1U0XA 1VPRA 2AT6X 4GK9A 4I3DA 5H9LA 1AQBA 4IAXA 5F6BA 3S5XA 2NP1A 4FQBB 3O19A 3ZZVA 4XMHA 1ZNDA 4FBVA 1GKAA 5L8NA 2W2BA 1TVQA 1X8QA 1AVGI 4L3RA 1KT3A 4M6SA 4WHIA 1GM6A 2IFBA 1G5WA 4HWMA 4U8UM 2OVEA 4ES7A 1G7NA 2WQ9A 5C0NA 1T68X 3WJBA 3EYCA 3EBWA 4BQUA 2RD7C 4I6SA 3WJFA 1KT5A 3FA6A 5LJHA 1LF7A 2FTBA 3H3IA 5FQ7E 2HMBA 2QOSC 1ML7A 2MO5A 2JOZA 2Q39A 3MVFA 4TKBA 4MVKA 5D8JA 4U8UO 4Y0PA 4YCHA 4ZGUA 1TW4A 5JR8A 1GXAA 4O3XB 3BU1A 1X71A 3S5VA 2W2FA 1TXLA 3FR2A 2OZQA 5H9KA 4AZQA 3BSZE 1ICMA 1YP7A 5LKEA 1A3YA 4O9SA 4INNA 1BM5A 5CE4A 3MX7A 3WVMA 2P8GA 1FDQA 4EQAC 2ANSA 3ELZA 5AQ6A 5F58A 3U9PC 1OPAA 4O3WA 5F6ZA 1AB0A 2XSTA 4JGLA 3HWEA 4IMOA 5L8IA 1DFVA 3FELA 4A1YA 3B2LA 3U03A 1DZKA 3CMPA 4GNYA 2JU8A 1ICNA 1JYDA 1PBOA 1E06A 3CBSA 4OS3A 3PQUA 3L4RA 4GETA 1B0OA 4QYNA 4I9SA 4YBUA 1A57A 4YFQA 4COTA 1QFVA 3CQRA 5K06A 4CSBA 4DQ4A 4YMYA 1ZNKA 2OFMX 3ZQ3A 3B2KA 1YUPA 4ORRA 4IB6A 1EI5A 2JU7A 1GGLA 3HTYA 1B4MA 1LICA 1EUOA 1MX8A 3P6HA 4OS8A 1OBUA 5FQ6E 5H9AA 1HMTA 1KOIA 1U17A 2LB6A 3SAOA 5FENA 1BEBA 2KD2A 4R0BA 3ZW1A 5AJCA 1QWDA 5BVTA 4ORUA 5D4AA 2WEXA 2M4LA 1KT7A 3CBCA 1BSYA 2QO5A 4LKPA 2Q2MA 5LJCA 1R0UA 2AT8X 2KTDA 1EPAA 1HQPA 3CR6A 3C76X 1UZ2X 4OS0A 2X8FA 1A2DA 1MVGA 1SXWA 4O3YA 3VE2A 3STNA 1PMPA 5HA1A 1Y9LA 4GZVA 4BOEA 5HAEA 3CWKA 3APVA 1OBQA 2GTLM 2N93A 5L8OA 1SY0A 3NP1A 3FEKA 4O4XA 4AZOA 2CBSA 2X8SA 2JN3A 5DPQA 5EPQA 1SA8A 2BHVA 4AW8A 5HCCC 1FELA 4TKHA 1BBPA 3F9DA 1LFOA 1EIIA 3FA7A 1S7DA 1ZNGA 3FR5A 2GTFX 2MHDA 2KTSA 1PEEA 1HMSA 3FENA 3VG6A 5HTEA 2MM3A 4NP1A 1ZNEA 1GX8A 2FR2A 3FA8A 2GTLO 1VYGA 1KT6A 3P6EA 1QY0A 3RWXA 2AT0X 1P6PA 4FGIB 4A1HA 5IO5A 1MUPA 2LBVA 4MVEA 2X8TA 3AKNA 2ASNX 2RCTA 2O62A 2AT5X 3VU1A 4NNSA 5BVSA 2A13A 3WJDA 1GT1A 2Q2PA 3OJYC 1BLRA 1SY1A 1QY2A 3N91A 1QY1A 2Z4IA 3FYFA 3TGAA 4N7DA 5H9NA 4IAWA 4ZHFA 1JZUA 4ZR2A 5B27A 4YFPA 3APUA 2RQ0A 3BY0A 5EDBA 3G7XA 5HCDC 3IFBA 4GKCA 3TGCA 5HA0A 5LJBA 4IABA 1EALA 2OVAA 5HWZA 1D2UA 4ID2A 4XMFA 2KW1A 3WJGA 1KZXA 1QQSA 2GJ5A 4XMCA 1JIWI 4TKJA 2BT9A 1Z24A 1NP4A 2JW1A 3D96A 1EXSA 4NYQA 4ORSA 3FEPA 2A2UA 1MDCA 1Y9TA 2FT9A 4WFUA 1JBHA 3AKMA 2L5PA 3DSZA 1DZJA 1U18A 4ODDA 3FW4A 2E4JA 2PY1A 1E02A 4DQ3A 2ALLX 4MVIA 3IA8A 3EM0A 3T1DA 2Q4NA 1SXYA 2WUTA 3HWDA 2WEWA 1CBIA 4UU3A 4LKTA 1KXOA 2K62A 4O4OA 4XMGA 4YGHA 3B2HA 3HK1A 1IIUA 2L9CA 2WSJA 3F8AA 4RUUA 4CK4A 4EXZA 1BWYA 2BS6A 1ZRYA 1X8PA 3NX1A 3NADA 1N0SA 3FW5A 4YFRA 1HN2A 3P6CA 1LIFA 3FMZA 3HOEA 4U3QA 4KCAA 4ZHCA 4AYHA 4ZCBA 1KQXA 2QO4A 3VPJE 4KC7A 2R73A 4WFVA 4AZPA 5BYPA 2CM9A 4ORYA 1HMRA 2A2GA 1RLBE 3NQKA 3BU9A 5LJDA 4K19A 5FFHA 1I05A 4ORXA 1I4UA 3LV4A 3P02A 4OMWA 3ZW0B 1EPBA 1SY3A 2LFOA 2XKLA 1O1VA 1LPJA 3GAQA 3P6FA 5EEEA 4U8UN 4GNWA 1I06A 1X8OA 4NLJA 3KFFA 4ZHGA 5HZQA 1A18A 4QGWA 1FE3A 1CBQA 1D3SA 2HZQA 3PQSA 2R56A 1IFBA 5B29A 4UU2A 1LKEA 4XMDA 2OFRX 1IKEA 4ZGFA 2NNQA 3I0AA 4O3ZA 4ML7B 3D97A 4QZTA 1GKAB 3I17A 3KFIA 1H91A 4D6BA 3PPTA 1QG5A 3DTQA 2F09A 3NX2A 1GX9A 2FS6A 1G74A 2ZAGA 3ZUOA 1I04A 2OVSA 2YMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QKG A;  5D47 A;  1NP1 A;  1X89 A;  4WBK A;  4YBP A;  4GE1 A;  1KZW A;  1BSQ A;  3BDR A;  2JU3 A;  1BRQ A;  4TQ2 A;  5IO7 A;  1IW2 A;  4D6A A;  4ZH6 A;  4YH0 A;  1YWA A;  5DG4 A;  1URE A;  2CM4 A;  4Y0S A;  2X46 A;  3RZY A;  5IO6 A;  1ERX A;  1CRB A;  3EMM A;  4M7M A;  5D45 A;  1FEM A;  2A3F X;  2DM5 A;  4QAE A;  4XME A;  3KZA A;  1L6M A;  4EEJ A;  4ARH A;  1ERB A;  5F1E A;  2AL0 X;  5HZ9 A;  4YKM A;  5KID A;  1JV4 A;  2FS7 A;  4YDB A;  2QM9 A;  3VG2 A;  4HPD A;  3B2I A;  4I3B A;  3ZUI A;  1DF3 A;  3VG4 A;  3O2Y A;  2AKQ A;  1RBP A;  2HLV A;  3P6D A;  5HCE C;  1QAB E;  1KT4 A;  1EIO A;  1CJ5 A;  2ACP X;  3FA9 A;  1SXX A;  1CBS A;  2X45 A;  3S26 A;  5EDC A;  4HPB A;  2G79 A;  2G78 A;  1B8E A;  5HTD A;  1ZNH A;  1HBP A;  4I3C A;  4ALB A;  5LJK A;  3STM X;  2LKK A;  2R74 A;  5KIC A;  1EQD A;  4NNT A;  5EED A;  1AEL A;  1MX7 A;  3WXQ A;  1HBQ A;  1E00 A;  4AZN A;  5HZ8 A;  4ZJ0 A;  1JJX A;  3UEU A;  3APX A;  3TGB A;  1ALB A;  3BS2 A;  4ZH9 A;  4TLJ A;  2GC9 A;  1KQW A;  2L68 A;  3NQ9 A;  4PSQ A;  3UEW A;  1E5P A;  5BVQ A;  4AZR A;  2QO6 A;  2A0A A;  4QGX A;  4ORW A;  2BLG A;  1YIV A;  2AT3 X;  4QYP A;  1YWB A;  1DV9 A;  1JJJ A;  5F7G A;  4MVL A;  1DZM A;  2OVD A;  3U0D A;  3P6G A;  5LKF A;  2RA6 A;  3PEC A;  1GT4 A;  5HZ5 A;  1LIE A;  3RSW A;  3FR4 A;  1IKJ A;  1OEE A;  3NR3 A;  2W2A A;  5H8T A;  4Y0R A;  3UEV A;  1FEN A;  4HPC A;  1B56 A;  3MBT A;  1ADL A;  3BX8 A;  1TOU A;  2YG2 A;  4QZU A;  3D95 A;  1O8V A;  1CBR A;  3C77 X;  3VG7 A;  4I9R A;  4RUN A;  2FRS A;  1XKI A;  3Q6L A;  5FAZ A;  1OEK A;  3B2J A;  2POA A;  5LJE A;  3UEX A;  3KFH A;  4YGZ A;  1XCA A;  3PH6 A;  4IBA A;  1BSO A;  3TZS A;  1S44 A;  2HYS A;  3STK A;  4ZHD A;  1X8U A;  3TF6 A;  4YGG A;  2FLJ A;  2K23 A;  1DZP A;  4A60 A;  4IMN A;  4GH7 A;  2AH7 X;  4EFG A;  4HFO A;  1O1U A;  2EU7 X;  2CZU A;  3PED A;  4OMX A;  4ZFX A;  4ZHH A;  1SXU A;  4EDE A;  5HZ6 A;  2L67 A;  2NNE A;  1T8V A;  3HWG A;  2NND A;  3KQ0 A;  3PP6 A;  3C78 X;  1T0V A;  3BX7 A;  1ACD A;  1IFC A;  4YDA A;  4LZV A;  3APW A;  3BLG A;  2KT4 B;  1LNM A;  1X8N A;  2CZT A;  3PH5 A;  2AMM X;  4NLI A;  1LID A;  3CQN A;  3JSQ A;  5HBS A;  4BVM A;  1FTP A;  1G85 A;  4ALO A;  5KHP A;  3KFG A;  2RCQ A;  2CBR A;  4IB9 A;  1OEJ A;  1S2P A;  1BRP A;  3ELX A;  3VG5 A;  3WJC A;  1GT5 A;  3NPO A;  4AZM A;  3NQ3 A;  2Q9S A;  1KGL A;  3FIQ A;  5D48 A;  4YCE A;  1JYJ A;  4Y0Q A;  3WBG A;  1SY2 A;  1BJ7 A;  1LIB A;  3JS1 A;  1OPB A;  1TOW A;  1DC9 A;  2WWP A;  1YWC A;  2MJI A;  1VYF A;  5EZ2 A;  2ACO A;  2WQA E;  1YWD A;  1YP6 A;  3EBK A;  4HPA A;  2G7B A;  3K3L A;  3WJE A;  4QGV A;  1PM1 X;  2HNX A;  3HWF A;  4N7C A;  1OBP A;  4TNN A;  1QFT A;  1ZNL A;  2FWV A;  2HZR A;  4NYR A;  4KII A;  3O22 A;  1GT3 A;  5LJG A;  2WR6 A;  4TJZ A;  4GRJ A;  4IB8 A;  2F73 A;  4YKO A;  2FR3 A;  3FLL A;  4IB7 A;  4LZU A;  3BRN A;  1NGL A;  2LBA A;  3VG3 A;  4A8Z A;  1EW3 A;  1U0X A;  1VPR A;  2AT6 X;  4I3D A;  5H9L A;  1AQB A;  4IAX A;  5F6B A;  2NP1 A;  3O19 A;  4XMH A;  1ZND A;  1GKA A;  5L8N A;  2W2B A;  1TVQ A;  1X8Q A;  1AVG I;  1KT3 A;  4M6S A;  1GM6 A;  2IFB A;  1G5W A;  2OVE A;  4ES7 A;  1G7N A;  2WQ9 A;  5C0N A;  1T68 X;  3WJB A;  3EYC A;  3EBW A;  4BQU A;  2RD7 C;  3WJF A;  1KT5 A;  3FA6 A;  5LJH A;  1LF7 A;  2FTB A;  2HMB A;  2QOS C;  2Q39 A;  1ML7 A;  2JOZ A;  2MO5 A;  3MVF A;  4TKB A;  4MVK A;  5D8J A;  4Y0P A;  4YCH A;  4ZGU A;  1TW4 A;  5JR8 A;  1GXA A;  3BU1 A;  1X71 A;  2W2F A;  1TXL A;  3FR2 A;  2OZQ A;  5H9K A;  4AZQ A;  3BSZ E;  1ICM A;  1YP7 A;  5LKE A;  1A3Y A;  4O9S A;  1BM5 A;  5CE4 A;  3WVM A;  2P8G A;  1FDQ A;  2ANS A;  3ELZ A;  5AQ6 A;  5F58 A;  3U9P C;  1OPA A;  5F6Z A;  1AB0 A;  2XST A;  3HWE A;  4IMO A;  5L8I A;  1DFV A;  3FEL A;  4A1Y A;  3B2L A;  3U03 A;  1DZK A;  3CMP A;  4GNY A;  2JU8 A;  1ICN A;  1JYD A;  1PBO A;  1E06 A;  3CBS A;  4OS3 A;  3L4R A;  4GET A;  1B0O A;  4QYN A;  4I9S A;  4YBU A;  1A57 A;  4YFQ A;  1QFV A;  3CQR A;  5K06 A;  4DQ4 A;  4YMY A;  1ZNK A;  2OFM X;  3ZQ3 A;  3B2K A;  1YUP A;  4ORR A;  4IB6 A;  2JU7 A;  1GGL A;  1B4M A;  1LIC A;  1EUO A;  1MX8 A;  3P6H A;  4OS8 A;  1OBU A;  5H9A A;  3SAO A;  1HMT A;  1KOI A;  1U17 A;  2LB6 A;  5FEN A;  1BEB A;  4R0B A;  1QWD A;  5BVT A;  4ORU A;  5D4A A;  2WEX A;  1KT7 A;  3CBC A;  1BSY A;  2QO5 A;  4LKP A;  2Q2M A;  5LJC A;  1R0U A;  2AT8 X;  2KTD A;  1EPA A;  1HQP A;  3CR6 A;  3C76 X;  1UZ2 X;  4OS0 A;  1A2D A;  1MVG A;  1SXW A;  3STN A;  1PMP A;  5HA1 A;  4BOE A;  5HAE A;  3CWK A;  3APV A;  1OBQ A;  2N93 A;  5L8O A;  1SY0 A;  3NP1 A;  3FEK A;  4AZO A;  2CBS A;  2JN3 A;  5DPQ A;  5EPQ A;  1SA8 A;  4AW8 A;  5HCC C;  1FEL A;  4TKH A;  1BBP A;  3F9D A;  1LFO A;  1EII A;  3FA7 A;  1S7D A;  1ZNG A;  3FR5 A;  2GTF X;  1PEE A;  1HMS A;  3FEN A;  3VG6 A;  5HTE A;  2MM3 A;  4NP1 A;  1ZNE A;  1GX8 A;  2FR2 A;  3FA8 A;  1VYG A;  1KT6 A;  3P6E A;  1QY0 A;  2AT0 X;  1P6P A;  4A1H A;  5IO5 A;  1MUP A;  2LBV A;  3AKN A;  2ASN X;  2RCT A;  2O62 A;  2AT5 X;  4NNS A;  5BVS A;  2A13 A;  3WJD A;  1GT1 A;  2Q2P A;  3OJY C;  1BLR A;  1SY1 A;  1QY2 A;  1QY1 A;  3TGA A;  4N7D A;  5H9N A;  4IAW A;  4ZHF A;  1JZU A;  4ZR2 A;  5B27 A;  4YFP A;  3APU A;  2RQ0 A;  3BY0 A;  5EDB A;  3G7X A;  5HCD C;  3IFB A;  4GKC A;  3TGC A;  5HA0 A;  5LJB A;  1EAL A;  2OVA A;  5HWZ A;  1D2U A;  4XMF A;  3WJG A;  1KZX A;  1QQS A;  2GJ5 A;  4XMC A;  4TKJ A;  1Z24 A;  1NP4 A;  3D96 A;  4NYQ A;  1EXS A;  4ORS A;  3FEP A;  2A2U A;  1MDC A;  2FT9 A;  4WFU A;  1JBH A;  3AKM A;  2L5P A;  3DSZ A;  1DZJ A;  1U18 A;  4ODD A;  3FW4 A;  2E4J A;  2PY1 A;  1E02 A;  4DQ3 A;  2ALL X;  4MVI A;  3IA8 A;  3EM0 A;  3T1D A;  2Q4N A;  1SXY A;  2WUT A;  3HWD A;  2WEW A;  1CBI A;  4UU3 A;  4LKT A;  1KXO A;  2K62 A;  4XMG A;  4YGH A;  3B2H A;  3HK1 A;  1IIU A;  2L9C A;  2WSJ A;  3F8A A;  4RUU A;  4CK4 A;  4EXZ A;  1BWY A;  1ZRY A;  1X8P A;  3NX1 A;  3NAD A;  1N0S A;  3FW5 A;  4YFR A;  1HN2 A;  3P6C A;  1LIF A;  3FMZ A;  4ZHC A;  4AYH A;  4ZCB A;  1KQX A;  2QO4 A;  2R73 A;  4WFV A;  4AZP A;  2CM9 A;  4ORY A;  1HMR A;  2A2G A;  1RLB E;  3BU9 A;  5LJD A;  4K19 A;  5FFH A;  1I05 A;  4ORX A;  1I4U A;  4OMW A;  1EPB A;  1SY3 A;  2LFO A;  2XKL A;  1O1V A;  1LPJ A;  3GAQ A;  3P6F A;  5EEE A;  4GNW A;  1I06 A;  1X8O A;  4NLJ A;  3KFF A;  4ZHG A;  5HZQ A;  1A18 A;  4QGW A;  1FE3 A;  1CBQ A;  1D3S A;  2HZQ A;  2R56 A;  1IFB A;  5B29 A;  4UU2 A;  1LKE A;  4XMD A;  2OFR X;  1IKE A;  2NNQ A;  3I0A A;  3D97 A;  4QZT A;  1GKA B;  3I17 A;  3KFI A;  1H91 A;  4D6B A;  3PPT A;  1QG5 A;  3DTQ A;  3NX2 A;  1GX9 A;  2FS6 A;  1G74 A;  3ZUO A;  1I04 A; 
#chains in the Genus database with same CATH topology
 3QKG A;  5D47 A;  1NP1 A;  4GGT A;  1MOY A;  1X89 A;  4WBK A;  4YBP A;  4GE1 A;  1KZW A;  1BSQ A;  3BDR A;  2JU3 A;  1BRQ A;  3OD9 A;  4TQ2 A;  5IO7 A;  1IW2 A;  2X32 A;  4D6A A;  4O4S A;  4ZH6 A;  4YH0 A;  1YWA A;  5DG4 A;  4CDC A;  1URE A;  3F6Z B;  2CM4 A;  4Y0S A;  2X46 A;  3RZY A;  5IO6 A;  1ERX A;  1CRB A;  1K24 A;  4ON1 A;  3EMM A;  4M7M A;  5D45 A;  1FEM A;  2A3F X;  2DM5 A;  4QAE A;  1LEL A;  4XME A;  3KZA A;  3SZJ A;  1L6M A;  3RBY A;  5CSE A;  4FBR A;  4EEJ A;  2OYB O;  1ERB A;  5F1E A;  1WBI A;  2AL0 X;  4YKM A;  4ARH A;  5HZ9 A;  5KID A;  4MIR A;  4BX5 B;  3FID A;  1JV4 A;  2FS7 A;  4CDE A;  4YDB A;  2QM9 A;  1FJ1 E;  3SLT A;  4HPD A;  1SWG A;  3VG2 A;  3ZW2 A;  1RXJ A;  3B2I A;  4I3B A;  3ZUI A;  1DF3 A;  2Y3E A;  3VG4 A;  3AUM O;  5FQ8 E;  3O2Y A;  5B11 O;  3KVN A;  2AKQ A;  1RBP A;  2HLV A;  3P6D A;  4BX7 A;  5HCE C;  1QAB E;  1KT4 A;  1EIO A;  1CJ5 A;  2JMB A;  2ACP X;  3FA9 A;  1OSP O;  4Z2P A;  1SXX A;  3ZWE A;  1CBS A;  2X45 A;  2WPU A;  3S26 A;  5EDC A;  4HPB A;  3WOV A;  2G79 A;  2G78 A;  3ZI8 A;  1B8E A;  3P24 A;  4KH8 A;  1JQP A;  1ZNH A;  3WZO A;  4CV7 A;  5HTD A;  1HBP A;  4I3C A;  4ALB A;  5LJK A;  3STM X;  2MWH A;  2LKK A;  2R74 A;  5CYB A;  5KIC A;  4GU8 A;  1EQD A;  4NNT A;  1VWF B;  5EED A;  1AEL A;  1UYN X;  2OFB A;  1MX7 A;  3WXQ A;  1HBQ A;  1E00 A;  5JD2 A;  4AZN A;  5HZ8 A;  2RTH B;  4ZJ0 A;  1WUB A;  1JJX A;  3UEU A;  4JNJ A;  4O4U A;  1N43 A;  3APX A;  3TGB A;  4KC8 A;  1ALB A;  4KT5 A;  3BS2 A;  4ZH9 A;  3VE1 A;  4PJ2 A;  2GC9 A;  1KQW A;  2L68 A;  2RTL A;  1RAV A;  2QCB A;  2X56 A;  3NQ9 A;  1E5P A;  1VWN B;  4PSQ A;  2QO6 A;  5BVQ A;  2A0A A;  4O49 A;  4QGX A;  3UEW A;  4AZR A;  4ORW A;  3WYQ A;  2BLG A;  4U9C A;  3RDU A;  1YIV A;  2JGS A;  2AT3 X;  2G8C O;  3GE2 A;  1STS B;  2HKD A;  4QYP A;  4BVM A;  3E3C A;  1YWB A;  1DV9 A;  1JJJ A;  2ZAI A;  5F7G A;  3HOL A;  3LHN A;  2BC3 A;  2C4I A;  2X55 A;  4MVL A;  1DZM A;  2FKJ A;  1VWJ B;  2OVD A;  3U0D A;  3P6G A;  2BS5 A;  2Y32 A;  5LKF A;  3FDC A;  2RA6 A;  2IZI A;  2QMI A;  3PEC A;  1GT4 A;  5HZ5 A;  1LIE A;  3RSW A;  3S60 A;  3FR4 A;  1IKJ A;  1OEE A;  2OY1 O;  3RKG A;  3ZW1 B;  3RDX A;  3NR3 A;  2W2A A;  4MIS A;  2GTL N;  4Y0R A;  5H8T A;  1FEN A;  2AF5 A;  1B56 A;  3MBT A;  4HPC A;  3UEV A;  2VDF A;  4NW4 A;  4I95 A;  1ADL A;  2F01 A;  1TOU A;  1N9M A;  2YG2 A;  3BX8 A;  3D95 A;  1O8V A;  2IZF B;  2LA7 A;  4QZU A;  1CBR A;  2OY8 A;  4QRL A;  5CHK A;  3C77 X;  3VG7 A;  4I9R A;  4RUN A;  2FRS A;  1XKI A;  1SWJ A;  3Q6L A;  5FAZ A;  5B3M O;  1OEK A;  3B2J A;  4LQZ A;  2POA A;  5LJE A;  3UEX A;  4QNI A;  3KFH A;  4YGZ A;  1XCA A;  2BSZ A;  3PH6 A;  4IBA A;  1BSO A;  3TZS A;  1S44 A;  2HYS A;  3OE3 A;  4QQ1 A;  3STK A;  3LTW A;  2RTA A;  4Z6J A;  2MF6 A;  4ZHD A;  1X8U A;  3SOT A;  3TF6 A;  1LCV A;  1W5R A;  3RDO A;  4YGG A;  2FLJ A;  2K23 A;  1DZP A;  1SWK A;  5AJB A;  4A60 A;  4IMN A;  1SWL A;  4GH7 A;  2AH7 X;  4EFG A;  2RN4 A;  1O1U A;  2EU7 X;  2CZU A;  3PED A;  1Y53 X;  4HFO A;  4OMX A;  1SXU A;  4ZHH A;  4EDE A;  5HZ6 A;  2L67 A;  2NNE A;  1T8V A;  1KL3 A;  3HWG A;  1I9H A;  2NND A;  3KQ0 A;  3PP6 A;  3RE6 A;  3C78 X;  4OKA A;  1T0V A;  2A8G A;  3BX7 A;  1ACD A;  4ZFX A;  1IFC A;  4YDA A;  4LZV A;  3APW A;  3BLG A;  2KT4 B;  4GGR A;  1LNM A;  2RTB B;  1X8N A;  1SWN A;  2CZT A;  2AMM X;  3PH5 A;  1LID A;  3CQN A;  3JSQ A;  4L1N A;  4NLI A;  5HBS A;  1FTP A;  1G85 A;  3NBX X;  4ALO A;  5KHP A;  1KL4 A;  2RCQ A;  3KFG A;  2RTR B;  2CBR A;  4IB9 A;  4Z27 A;  1OEJ A;  1S2P A;  3D4R A;  1BRP A;  3ELX A;  3VG5 A;  3WJC A;  1GT5 A;  3NPO A;  4AZM A;  3NQ3 A;  1VWA B;  2Q9S A;  1SLE B;  1KGL A;  3FIQ A;  3MG5 A;  3JQO A;  5D48 A;  4YCE A;  1JYJ A;  4Y0Q A;  3WBG A;  3V8U A;  1RXH A;  1SY2 A;  1MK5 A;  1BJ7 A;  1LIB A;  5IRA A;  3JS1 A;  1RSU B;  2Z4H A;  1OPB A;  1SRJ A;  1TOW A;  1DC9 A;  2WWP A;  1YWC A;  2MJI A;  1VYF A;  5EZ2 A;  2ACO A;  2WQA E;  1SWO A;  1YP6 A;  1YWD A;  2RTC B;  3EBK A;  1SMP I;  4HPA A;  2G7B A;  3K3L A;  3MM0 A;  3WJE A;  1SWH A;  4QGV A;  1PM1 X;  3RY1 A;  2HNX A;  3HWF A;  4I60 A;  4CPI A;  2IZJ A;  5AEO A;  4N7C A;  1VYO A;  1OBP A;  4GDZ A;  4TNN A;  3ZW0 A;  1QFT A;  1ZNL A;  2FWV A;  2HZR A;  4NYR A;  3UAQ A;  4KII A;  3VHM A;  2DJF A;  3O22 A;  4DCB A;  1GT3 A;  5LJG A;  2WR6 A;  4TJZ A;  4GRJ A;  3SZI A;  4IB8 A;  2F73 A;  3QQ2 A;  4YKO A;  3WZQ A;  2FR3 A;  3FLL A;  1SRI A;  4IB7 A;  4FBO A;  2VFB A;  4LZU A;  3BRN A;  1NGL A;  1MEP A;  2LBA A;  3VG3 A;  4A8Z A;  3OBL A;  5B10 O;  1EW3 A;  1U0X A;  1VPR A;  2AT6 X;  4GK9 A;  4I3D A;  5H9L A;  4CPH B;  1AQB A;  4IAX A;  5F6B A;  3S5X A;  2NP1 A;  4FQB B;  2OF9 A;  2OL6 O;  3O19 A;  3ZZV A;  4XMH A;  1ZND A;  4FBV A;  3SLO A;  1VWG B;  1GKA A;  5L8N A;  2W2B A;  1TVQ A;  1AVE A;  1AVG I;  1X8Q A;  4L3R A;  2FKG A;  1KT3 A;  1SLF B;  4M6S A;  4WHI A;  4OEL A;  1GM6 A;  4Z2O A;  2IFB A;  3WZN A;  1G5W A;  4HWM A;  4U8U M;  2OVE A;  1N4J A;  4ES7 A;  1G7N A;  2WQ9 A;  5C0N A;  4JO6 A;  1T68 X;  4IRW A;  3SZH A;  3WJB A;  3EYC A;  2IZB A;  3EBW A;  2RD7 C;  4I6S A;  3WJF A;  4BBO A;  4BJ8 A;  4BQU A;  4BGF A;  1SWR A;  1KT5 A;  1N9Y A;  2IZC B;  3FA6 A;  5LJH A;  1LF7 A;  2FTB A;  3H3I A;  5FQ7 E;  2HMB A;  2QOS C;  1Y55 X;  1ML7 A;  2MO5 A;  2JOZ A;  2Q39 A;  3MVF A;  2RTD B;  1VWI B;  4TKB A;  4MVK A;  5D8J A;  4U8U O;  4Y0P A;  4YCH A;  4ZGU A;  1PTS A;  1TW4 A;  5JR8 A;  1GXA A;  4O3X B;  3BU1 A;  1X71 A;  3S5V A;  4BX5 A;  2W2F A;  1TXL A;  3FR2 A;  3T2W A;  2OY7 A;  2OZQ A;  3PK2 A;  5H9K A;  4AZQ A;  3BSZ E;  1ICM A;  1YP7 A;  1SWT A;  1NQN A;  5LKE A;  1A3Y A;  4O9S A;  4INN A;  1SWC A;  1BM5 A;  5CE4 A;  3MX7 A;  3WVM A;  2P8G A;  1FDQ A;  3X00 A;  1VWP B;  1SWP A;  4EQA C;  2ANS A;  1STR B;  3ELZ A;  1SWS A;  5AQ6 A;  5F58 A;  2A5C A;  3U9P C;  1OPA A;  4CDD A;  4O3W A;  4Z2V A;  5F6Z A;  4CPF A;  1AB0 A;  2XST A;  2RTK A;  2RTG B;  4JGL A;  3HWE A;  2OL8 O;  4IMO A;  5L8I A;  1RXK A;  2IZE B;  1DFV A;  3FEL A;  4A1Y A;  1VWL B;  3B2L A;  3U03 A;  1DZK A;  3CMP A;  4GNY A;  1SWE A;  4GJV A;  1SWD A;  2FHN X;  1JJU A;  2JU8 A;  1ICN A;  1JYD A;  2UZ2 A;  1PBO A;  1E06 A;  3CBS A;  4OS3 A;  1Y52 X;  1NC9 A;  2G5L A;  3PQU A;  3L4R A;  4GET A;  1B0O A;  4QYN A;  4I9S A;  1JMX A;  4YBU A;  3RDQ A;  4BX6 A;  4YFQ A;  1LCW A;  4CPE A;  1QFV A;  3CQR A;  4COT A;  1Y0G A;  5K06 A;  4CSB A;  4DQ4 A;  4YMY A;  1ZNK A;  2OFM X;  3ZQ3 A;  1VWD B;  5L3Y A;  3B2K A;  1YUP A;  1GX3 A;  4ORR A;  4IB6 A;  1HQQ A;  3HPE A;  1EI5 A;  4Z28 A;  3EW2 A;  4DNE A;  1SRE A;  2OF8 A;  4NV8 A;  2RTP B;  5K68 A;  2IZD B;  1GGL A;  2JU7 A;  3HTY A;  1B4M A;  1LIC A;  1EUO A;  1MX8 A;  1VWK B;  3P6H A;  4OS8 A;  1OBU A;  4U46 A;  2I5Z O;  1HMT A;  1KOI A;  1U17 A;  2CAM A;  2LB6 A;  1VWB B;  5H9A A;  3SAO A;  4BX7 B;  5FEN A;  1BEB A;  2KD2 A;  4R0B A;  3ZW1 A;  5AJC A;  1QWD A;  2RTQ B;  4GDA A;  1NDJ A;  1HXZ A;  5BVT A;  1VWQ B;  4BX6 B;  2RTE B;  1LDO A;  1SRH A;  4ORU A;  5D4A A;  1JMZ A;  2IZH B;  2M4L A;  1VWM B;  2WEX A;  1KT7 A;  3CBC A;  1BSY A;  1KFF A;  2QO5 A;  4LKP A;  2Q2M A;  2RTO B;  3EW1 A;  1SLG B;  1R0U A;  4NV7 A;  5LJC A;  1SWQ A;  2AT8 X;  2DJG A;  2KTD A;  1EPA A;  2I5V O;  1HY2 A;  1HQP A;  3CR6 A;  5IXG A;  3C76 X;  1UZ2 X;  4OS0 A;  2X8F A;  1A2D A;  1MVG A;  2UYW A;  1SXW A;  4O3Y A;  3VE2 A;  3STN A;  1PMP A;  5HA1 A;  1Y9L A;  4GZV A;  4BOE A;  5HAE A;  3CWK A;  1MM9 A;  3APV A;  1OBQ A;  2GTL M;  2N93 A;  5L8O A;  1N7Y A;  1SY0 A;  2VFC A;  3FEK A;  3NP1 A;  2CBS A;  4GJS A;  2X8S A;  4O4X A;  4AZO A;  3WZP A;  3RDS A;  2JN3 A;  5DPQ A;  5EPQ A;  3T6L A;  1SA8 A;  1W4T A;  2BHV A;  4AW8 A;  5HCC C;  1FEL A;  4TKH A;  4C5P A;  1BBP A;  3F9D A;  4BCS A;  1LFO A;  1EII A;  3FA7 A;  1S7D A;  1ZNG A;  2QOM A;  3FR5 A;  2GTF X;  2MHD A;  2KTS A;  1PEE A;  1HMS A;  3FEN A;  3VG6 A;  5HTE A;  2MM3 A;  4NP1 A;  1ZNE A;  1GX8 A;  2FR2 A;  3FA8 A;  2GTL O;  1VYG A;  1KT6 A;  3P6E A;  1QY0 A;  1W6F A;  2AT0 X;  1P6P A;  4GGZ A;  4Y59 A;  3RWX A;  4FGI B;  4MEE A;  4A1H A;  1SWB A;  5IO5 A;  1MUP A;  2LBV A;  1SWA A;  2IZA A;  4MVE A;  2X8T A;  4Y5D A;  3AKN A;  1PBY A;  2ASN X;  2RCT A;  2O62 A;  5IRW A;  2AT5 X;  1HXL A;  3PDF A;  2RTJ A;  3VU1 A;  5K67 A;  4NNS A;  5BVS A;  2A13 A;  3VHH A;  3WJD A;  1GT1 A;  2Q2P A;  3OJY C;  1BLR A;  2X34 A;  1SY1 A;  1QY2 A;  2C1S A;  1QY1 A;  2C1Q A;  2Z4I A;  3FYF A;  3N91 A;  1LUQ A;  4IAW A;  4N7D A;  5H9N A;  4OEM A;  2A5B A;  3TGA A;  4ZHF A;  1JZU A;  4ZR2 A;  2FGS A;  5B27 A;  5B5F A;  1DF8 A;  1SWU A;  4YFP A;  3APU A;  2ZSC A;  2RQ0 A;  4B55 A;  3BY0 A;  5EDB A;  4GD9 A;  3G7X A;  5HCD C;  3IFB A;  4GKC A;  3TGC A;  5HA0 A;  1SRF A;  5LJB A;  4IAB A;  3RE5 A;  2OVA A;  4CDF A;  5HWZ A;  1EAL A;  1D2U A;  1SWF A;  4ID2 A;  4XMF A;  2KW1 A;  3WJG A;  1KZX A;  1QQS A;  2GJ5 A;  4TLJ A;  4XMC A;  3SLJ A;  1JIW I;  4TKJ A;  2BT9 A;  1Z24 A;  2PI3 O;  1NP4 A;  2JW1 A;  3D96 A;  1EXS A;  4NYQ A;  4ORS A;  2OY5 O;  2RTN B;  2IZG B;  3FEP A;  2A2U A;  1MDC A;  3T2X A;  1VWC B;  1Y9T A;  2FT9 A;  4WFU A;  1JBH A;  3AKM A;  2L5P A;  3DSZ A;  4YVB A;  1DZJ A;  1U18 A;  4ODD A;  3FW4 A;  2E4J A;  2PY1 A;  1E02 A;  1LCZ A;  1RST B;  2IZK A;  2RTI B;  2RTM A;  2ALL X;  5B2A O;  4DQ3 A;  4MVI A;  3IA8 A;  3EM0 A;  3T1D A;  1NQM A;  2Q4N A;  3WYP A;  1SXY A;  2OL7 A;  2WUT A;  4CPH A;  3HWD A;  2WEW A;  1CBI A;  5F2B A;  2FHL A;  4UU3 A;  4LKT A;  1KXO A;  2K62 A;  4O4O A;  4XMG A;  4YGH A;  1VWR B;  3T6F A;  3B2H A;  1SLD B;  1VWO B;  3HK1 A;  1IIU A;  2L9C A;  1VWH B;  2WSJ A;  3F8A A;  4RUU A;  4CK4 A;  2Y3F A;  4EKV A;  4EXZ A;  1BWY A;  2IZL B;  2RTF B;  2BS6 A;  5FQ6 E;  1ZRY A;  1X8P A;  3NX1 A;  3AEH A;  1K3B A;  3NAD A;  1N0S A;  3FW5 A;  4YFR A;  1HN2 A;  3P6C A;  1LIF A;  2GH7 A;  3FMZ A;  3HOE A;  4U3Q A;  4KCA A;  4ZHC A;  4AYH A;  2AVI A;  4ZCB A;  1KQX A;  3RDM A;  3VHI A;  2QO4 A;  3VPJ E;  4KC7 A;  2R73 A;  4WFV A;  3VGW A;  4AZP A;  5B5G A;  5BYP A;  2CM9 A;  4ORY A;  1HMR A;  2A2G A;  3CKG A;  1RLB E;  3D9W A;  3NQK A;  3BU9 A;  5LJD A;  3EC5 A;  4K19 A;  5FFH A;  1I05 A;  4JHQ A;  4ORX A;  1I4U A;  3LV4 A;  3P02 A;  1A57 A;  4OMW A;  3ZW0 B;  1EPB A;  1SY3 A;  1UYO X;  2LFO A;  2OFA A;  2XKL A;  1VWE B;  1AVD A;  1E2T A;  1O1V A;  1LPJ A;  3GAQ A;  3P6F A;  5EEE A;  3Q34 A;  4U8U N;  4GNW A;  1I06 A;  1X8O A;  4NLJ A;  1I78 A;  3KFF A;  5IRU A;  5HZQ A;  1A18 A;  4ZHG A;  4QGW A;  1FE3 A;  3RY2 A;  1STP A;  1SRG A;  1CBQ A;  1D3S A;  1KL5 A;  2HZQ A;  2R56 A;  3PQS A;  1IFB A;  3CKF A;  2X4M A;  4UU2 A;  5B29 A;  4GUZ A;  1LKE A;  4XMD A;  2OFR X;  1IKE A;  4ZGF A;  2NNQ A;  3I0A A;  4O3Z A;  1IJ8 A;  4ML7 B;  3D97 A;  4QZT A;  1GKA B;  3I17 A;  3KFI A;  1H91 A;  4D6B A;  1NBX A;  3PPT A;  1QG5 A;  3DTQ A;  2F09 A;  1LDQ A;  3NX2 A;  1GX9 A;  2FS6 A;  1G74 A;  2ZAG A;  3ZUO A;  1I04 A;  2OVS A;  2YMS A; 
#chains in the Genus database with same CATH homology
 3QKG A;  5D47 A;  1NP1 A;  1X89 A;  4WBK A;  4YBP A;  4GE1 A;  1KZW A;  1BSQ A;  3BDR A;  2JU3 A;  1BRQ A;  3OD9 A;  4TQ2 A;  5IO7 A;  1IW2 A;  4D6A A;  4O4S A;  4ZH6 A;  4YH0 A;  1YWA A;  5DG4 A;  1URE A;  3F6Z B;  2CM4 A;  4Y0S A;  2X46 A;  3RZY A;  5IO6 A;  1ERX A;  1CRB A;  4ON1 A;  3EMM A;  4M7M A;  5D45 A;  1FEM A;  2A3F X;  2DM5 A;  4QAE A;  4XME A;  3KZA A;  1L6M A;  3RBY A;  4FBR A;  4EEJ A;  4ARH A;  1ERB A;  5F1E A;  2AL0 X;  5HZ9 A;  4YKM A;  5KID A;  4MIR A;  1JV4 A;  2FS7 A;  4YDB A;  2QM9 A;  3VG2 A;  4HPD A;  3ZW2 A;  3B2I A;  4I3B A;  3ZUI A;  1DF3 A;  3VG4 A;  5FQ8 E;  3O2Y A;  2AKQ A;  1RBP A;  2HLV A;  3P6D A;  5HCE C;  1QAB E;  1KT4 A;  1EIO A;  1CJ5 A;  2JMB A;  2ACP X;  3FA9 A;  1SXX A;  3ZWE A;  1CBS A;  2X45 A;  3S26 A;  5EDC A;  4HPB A;  3WOV A;  2G79 A;  2G78 A;  3ZI8 A;  1B8E A;  3P24 A;  4KH8 A;  1ZNH A;  4CV7 A;  5HTD A;  1HBP A;  4I3C A;  4ALB A;  5LJK A;  3STM X;  2MWH A;  2LKK A;  2R74 A;  5CYB A;  5KIC A;  4GU8 A;  1EQD A;  4NNT A;  5EED A;  1AEL A;  1MX7 A;  3WXQ A;  1HBQ A;  1E00 A;  4AZN A;  5HZ8 A;  4ZJ0 A;  1JJX A;  3UEU A;  4O4U A;  3APX A;  3TGB A;  4KC8 A;  1ALB A;  4KT5 A;  3BS2 A;  4ZH9 A;  3VE1 A;  4PJ2 A;  2GC9 A;  1KQW A;  2L68 A;  3NQ9 A;  4PSQ A;  4TLJ A;  3UEW A;  1E5P A;  5BVQ A;  4AZR A;  2QO6 A;  2A0A A;  4O49 A;  4QGX A;  4ORW A;  2BLG A;  4U9C A;  1YIV A;  2AT3 X;  3GE2 A;  4QYP A;  3E3C A;  1YWB A;  1DV9 A;  1JJJ A;  2ZAI A;  5F7G A;  3HOL A;  3LHN A;  4MVL A;  1DZM A;  2OVD A;  3U0D A;  3P6G A;  2BS5 A;  5LKF A;  2RA6 A;  3PEC A;  2QMI A;  1GT4 A;  5HZ5 A;  1LIE A;  3RSW A;  3S60 A;  3FR4 A;  1IKJ A;  1OEE A;  3RKG A;  3ZW1 B;  3NR3 A;  2W2A A;  4MIS A;  2GTL N;  4Y0R A;  5H8T A;  1FEN A;  4HPC A;  1B56 A;  3MBT A;  3UEV A;  4NW4 A;  4I95 A;  1ADL A;  3BX8 A;  1TOU A;  2YG2 A;  4QZU A;  3D95 A;  1O8V A;  2LA7 A;  1CBR A;  4QRL A;  3C77 X;  3VG7 A;  4I9R A;  4RUN A;  2FRS A;  1XKI A;  3Q6L A;  5FAZ A;  1OEK A;  3B2J A;  4LQZ A;  2POA A;  5LJE A;  3UEX A;  4QNI A;  3KFH A;  4YGZ A;  1XCA A;  3PH6 A;  4IBA A;  1BSO A;  3TZS A;  1S44 A;  2HYS A;  3OE3 A;  4QQ1 A;  3STK A;  4ZHD A;  1X8U A;  3SOT A;  3TF6 A;  4YGG A;  2FLJ A;  2K23 A;  1DZP A;  5AJB A;  4A60 A;  4IMN A;  4GH7 A;  2AH7 X;  4EFG A;  2RN4 A;  1O1U A;  2EU7 X;  2CZU A;  3PED A;  4HFO A;  4OMX A;  4ZFX A;  1SXU A;  4ZHH A;  4EDE A;  5HZ6 A;  2L67 A;  2NNE A;  1T8V A;  3HWG A;  2NND A;  3KQ0 A;  3PP6 A;  3C78 X;  1T0V A;  3BX7 A;  1ACD A;  1IFC A;  4YDA A;  4LZV A;  3APW A;  3BLG A;  2KT4 B;  1LNM A;  1X8N A;  2CZT A;  3PH5 A;  2AMM X;  4L1N A;  1LID A;  3CQN A;  3JSQ A;  4NLI A;  5HBS A;  4BVM A;  1FTP A;  1G85 A;  3NBX X;  4ALO A;  5KHP A;  3KFG A;  2RCQ A;  2CBR A;  4IB9 A;  1OEJ A;  1S2P A;  3D4R A;  1BRP A;  3ELX A;  3VG5 A;  3WJC A;  1GT5 A;  3NPO A;  4AZM A;  3NQ3 A;  2Q9S A;  1KGL A;  3FIQ A;  3JQO A;  5D48 A;  4YCE A;  1JYJ A;  4Y0Q A;  3WBG A;  3V8U A;  1SY2 A;  1BJ7 A;  1LIB A;  3JS1 A;  2Z4H A;  1OPB A;  1TOW A;  1DC9 A;  2WWP A;  1YWC A;  2MJI A;  1VYF A;  5EZ2 A;  2ACO A;  2WQA E;  1YWD A;  1YP6 A;  3EBK A;  1SMP I;  4HPA A;  2G7B A;  3K3L A;  3WJE A;  4QGV A;  1PM1 X;  2HNX A;  3HWF A;  5AEO A;  4N7C A;  1OBP A;  4GDZ A;  4TNN A;  3ZW0 A;  1QFT A;  1ZNL A;  2FWV A;  2HZR A;  4NYR A;  3UAQ A;  4KII A;  3O22 A;  1GT3 A;  5LJG A;  2WR6 A;  4TJZ A;  4GRJ A;  4IB8 A;  2F73 A;  4YKO A;  2FR3 A;  3FLL A;  4IB7 A;  4FBO A;  4LZU A;  3BRN A;  1NGL A;  2LBA A;  3VG3 A;  4A8Z A;  3OBL A;  1EW3 A;  1U0X A;  1VPR A;  2AT6 X;  4GK9 A;  4I3D A;  5H9L A;  1AQB A;  4IAX A;  5F6B A;  3S5X A;  2NP1 A;  4FQB B;  3O19 A;  3ZZV A;  4XMH A;  1ZND A;  4FBV A;  1GKA A;  5L8N A;  2W2B A;  1TVQ A;  1X8Q A;  1AVG I;  4L3R A;  1KT3 A;  4M6S A;  4WHI A;  1GM6 A;  2IFB A;  1G5W A;  4HWM A;  4U8U M;  2OVE A;  4ES7 A;  1G7N A;  2WQ9 A;  5C0N A;  1T68 X;  3WJB A;  3EYC A;  3EBW A;  4BQU A;  2RD7 C;  4I6S A;  3WJF A;  1KT5 A;  3FA6 A;  5LJH A;  1LF7 A;  2FTB A;  3H3I A;  5FQ7 E;  2HMB A;  2QOS C;  1ML7 A;  2MO5 A;  2JOZ A;  2Q39 A;  3MVF A;  4TKB A;  4MVK A;  5D8J A;  4U8U O;  4Y0P A;  4YCH A;  4ZGU A;  1TW4 A;  5JR8 A;  1GXA A;  4O3X B;  3BU1 A;  1X71 A;  3S5V A;  2W2F A;  1TXL A;  3FR2 A;  2OZQ A;  5H9K A;  4AZQ A;  3BSZ E;  1ICM A;  1YP7 A;  5LKE A;  1A3Y A;  4O9S A;  4INN A;  1BM5 A;  5CE4 A;  3MX7 A;  3WVM A;  2P8G A;  1FDQ A;  4EQA C;  2ANS A;  3ELZ A;  5AQ6 A;  5F58 A;  3U9P C;  1OPA A;  4O3W A;  5F6Z A;  1AB0 A;  2XST A;  4JGL A;  3HWE A;  4IMO A;  5L8I A;  1DFV A;  3FEL A;  4A1Y A;  3B2L A;  3U03 A;  1DZK A;  3CMP A;  4GNY A;  2JU8 A;  1ICN A;  1JYD A;  1PBO A;  1E06 A;  3CBS A;  4OS3 A;  3PQU A;  3L4R A;  4GET A;  1B0O A;  4QYN A;  4I9S A;  4YBU A;  1A57 A;  4YFQ A;  4COT A;  1QFV A;  3CQR A;  5K06 A;  4CSB A;  4DQ4 A;  4YMY A;  1ZNK A;  2OFM X;  3ZQ3 A;  3B2K A;  1YUP A;  4ORR A;  4IB6 A;  1EI5 A;  2JU7 A;  1GGL A;  3HTY A;  1B4M A;  1LIC A;  1EUO A;  1MX8 A;  3P6H A;  4OS8 A;  1OBU A;  5FQ6 E;  5H9A A;  1HMT A;  1KOI A;  1U17 A;  2LB6 A;  3SAO A;  5FEN A;  1BEB A;  2KD2 A;  4R0B A;  3ZW1 A;  5AJC A;  1QWD A;  5BVT A;  4ORU A;  5D4A A;  2WEX A;  2M4L A;  1KT7 A;  3CBC A;  1BSY A;  2QO5 A;  4LKP A;  2Q2M A;  5LJC A;  1R0U A;  2AT8 X;  2KTD A;  1EPA A;  1HQP A;  3CR6 A;  3C76 X;  1UZ2 X;  4OS0 A;  2X8F A;  1A2D A;  1MVG A;  1SXW A;  4O3Y A;  3VE2 A;  3STN A;  1PMP A;  5HA1 A;  1Y9L A;  4GZV A;  4BOE A;  5HAE A;  3CWK A;  3APV A;  1OBQ A;  2GTL M;  2N93 A;  5L8O A;  1SY0 A;  3NP1 A;  3FEK A;  4O4X A;  4AZO A;  2CBS A;  2X8S A;  2JN3 A;  5DPQ A;  5EPQ A;  1SA8 A;  2BHV A;  4AW8 A;  5HCC C;  1FEL A;  4TKH A;  1BBP A;  3F9D A;  1LFO A;  1EII A;  3FA7 A;  1S7D A;  1ZNG A;  3FR5 A;  2GTF X;  2MHD A;  2KTS A;  1PEE A;  1HMS A;  3FEN A;  3VG6 A;  5HTE A;  2MM3 A;  4NP1 A;  1ZNE A;  1GX8 A;  2FR2 A;  3FA8 A;  2GTL O;  1VYG A;  1KT6 A;  3P6E A;  1QY0 A;  3RWX A;  2AT0 X;  1P6P A;  4FGI B;  4A1H A;  5IO5 A;  1MUP A;  2LBV A;  4MVE A;  2X8T A;  3AKN A;  2ASN X;  2RCT A;  2O62 A;  2AT5 X;  3VU1 A;  4NNS A;  5BVS A;  2A13 A;  3WJD A;  1GT1 A;  2Q2P A;  3OJY C;  1BLR A;  1SY1 A;  1QY2 A;  3N91 A;  1QY1 A;  2Z4I A;  3FYF A;  3TGA A;  4N7D A;  5H9N A;  4IAW A;  4ZHF A;  1JZU A;  4ZR2 A;  5B27 A;  4YFP A;  3APU A;  2RQ0 A;  3BY0 A;  5EDB A;  3G7X A;  5HCD C;  3IFB A;  4GKC A;  3TGC A;  5HA0 A;  5LJB A;  4IAB A;  1EAL A;  2OVA A;  5HWZ A;  1D2U A;  4ID2 A;  4XMF A;  2KW1 A;  3WJG A;  1KZX A;  1QQS A;  2GJ5 A;  4XMC A;  1JIW I;  4TKJ A;  2BT9 A;  1Z24 A;  1NP4 A;  2JW1 A;  3D96 A;  1EXS A;  4NYQ A;  4ORS A;  3FEP A;  2A2U A;  1MDC A;  1Y9T A;  2FT9 A;  4WFU A;  1JBH A;  3AKM A;  2L5P A;  3DSZ A;  1DZJ A;  1U18 A;  4ODD A;  3FW4 A;  2E4J A;  2PY1 A;  1E02 A;  4DQ3 A;  2ALL X;  4MVI A;  3IA8 A;  3EM0 A;  3T1D A;  2Q4N A;  1SXY A;  2WUT A;  3HWD A;  2WEW A;  1CBI A;  4UU3 A;  4LKT A;  1KXO A;  2K62 A;  4O4O A;  4XMG A;  4YGH A;  3B2H A;  3HK1 A;  1IIU A;  2L9C A;  2WSJ A;  3F8A A;  4RUU A;  4CK4 A;  4EXZ A;  1BWY A;  2BS6 A;  1ZRY A;  1X8P A;  3NX1 A;  3NAD A;  1N0S A;  3FW5 A;  4YFR A;  1HN2 A;  3P6C A;  1LIF A;  3FMZ A;  3HOE A;  4U3Q A;  4KCA A;  4ZHC A;  4AYH A;  4ZCB A;  1KQX A;  2QO4 A;  3VPJ E;  4KC7 A;  2R73 A;  4WFV A;  4AZP A;  5BYP A;  2CM9 A;  4ORY A;  1HMR A;  2A2G A;  1RLB E;  3NQK A;  3BU9 A;  5LJD A;  4K19 A;  5FFH A;  1I05 A;  4ORX A;  1I4U A;  3LV4 A;  3P02 A;  4OMW A;  3ZW0 B;  1EPB A;  1SY3 A;  2LFO A;  2XKL A;  1O1V A;  1LPJ A;  3GAQ A;  3P6F A;  5EEE A;  4U8U N;  4GNW A;  1I06 A;  1X8O A;  4NLJ A;  3KFF A;  4ZHG A;  5HZQ A;  1A18 A;  4QGW A;  1FE3 A;  1CBQ A;  1D3S A;  2HZQ A;  3PQS A;  2R56 A;  1IFB A;  5B29 A;  4UU2 A;  1LKE A;  4XMD A;  2OFR X;  1IKE A;  4ZGF A;  2NNQ A;  3I0A A;  4O3Z A;  4ML7 B;  3D97 A;  4QZT A;  1GKA B;  3I17 A;  3KFI A;  1H91 A;  4D6B A;  3PPT A;  1QG5 A;  3DTQ A;  2F09 A;  3NX2 A;  1GX9 A;  2FS6 A;  1G74 A;  2ZAG A;  3ZUO A;  1I04 A;  2OVS A;  2YMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...