1A40A

Phosphate-binding protein with ala 197 replaced with trp
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
321
structure length
321
Chain Sequence
EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGTSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYWYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dominant role of local dipolar interactions in phosphate binding to a receptor cleft with an electronegative charge surface: equilibrium, kinetic, and crystallographic studies.
pubmed rcsb
source organism Escherichia coli
molecule tags Phosphate-binding protein
molecule keywords PHOSPHATE-BINDING PERIPLASMIC PROTEIN PRECURSOR
total genus 102
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 1998-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1a40A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1a40A02
3MJNA 4QRZA 2V25A 3C36A 1N76A 3MC2A 2AYSA 3LSFB 3CSBA 5FTHA 5H8HB 1Y9UA 3FVKA 3FVGA 4ELRA 2QS4A 2ZYMA 4GIZA 1B40A 2VGQA 1FTJA 2XHDA 1SI1A 4U1ZA 1B7ZA 3W15C 3S9EA 2PX1A 2F7BA 3VVDA 4U4SA 1Z7NE 4G77A 1JW1A 2DXYA 1B7UA 2REGA 1PDAA 1YPNA 4G68A 2PVUA 3HO7A 4HS7A 4GVOA 1ZJLA 1CB6A 1M5BA 3M3KA 3MVXA 5DEXA 3TMGA 5CBRA 2UVGA 3O66A 1AIVA 1D3KA 3PPOA 3VXCA 1ZIUA 4G2ZA 3K1NA 5H8NA 2O6AA 2XX7A 3FUZA 4THIA 3BKIB 1H44A 4QFOA 1Z7ME 2D21A 3Q29A 3K0VA 5M2VA 4N6PA 5CBSA 2I3VA 3OEMA 1IXCA 2NVUB 4RA1A 1MDP1 1MY1A 4ZEIA 4F29A 3IB2A 4QFNA 3JZJA 4IY6A 1B05A 1MRPA 5AA2B 4GFRA 1SBPA 4U21A 2Z23A 3K6WA 1VSOA 1P1UA 3IORA 1EZOA 1Q1KA 2F36A 4U4XA 3SEYA 1FTOA 4AQ4A 4FORA 5FHMA 2A5TA 3GZGA 2PMSA 4EQ9A 3MZ9A 5L9SA 4R9GA 1MY2A 4OYVA 2F78A 1QVSA 2VOZA 2I4CA 4I9DA 4Q0CA 1B52A 3KJ7A 4IO5A 2V3TA 5DVIA 2OJTA 5CRYA 1GR2A 2XX9A 1YCJA 1B1HA 3A09A 3GBAA 3TPAA 3TTKA 1MXXA 2D5WA 2DXRA 1I6BA 1DTZA 4LONB 3JV9A 4BDNA 2DQVA 1JW4A 3RLFE 4LZ5A 2KLFA 4F19A 3VLUA 1ZTYA 3O29A 4NF4A 3IX1A 4YB5A 5TP9A 1Y3NA 1J1NA 1MS7A 1PBPA 2GHBA 5ITPA 4F22A 3W9VA 5KZTA 1FQCA 1A40A 1NNFA 1Y1ZA 3IOVA 4H65A 4PETA 3PPPA 4DCXA 2ABHA 2XXYA 4JWOA 3S9NC 1BLFA 4HTGA 3EPEA 3V5AA 4O3AA 3DP6A 3MAMA 1N0TA 1MQHA 4NE4A 1B0HA 2X26A 1LSTA 3FIRA 3FXUA 3RNNA 1LFGA 4YMAA 2F6GA 2PBWA 2DE4A 3A3CA 1I6AA 3K6VA 2IA4A 3T9UA 2B3FA 2DWIA 2OWSA 4R6YA 1ZU0A 4TLMB 4FATA 4DCYA 1SD3A 1LLSA 3CVGA 3E13X 1EU8A 5FHNA 1GVCA 1P99A 5H8NB 4QSCA 2Y7RA 1DMBA 2I49A 1B32A 1JVYA 1TWYA 4QF9A 4Z0IA 1OVBA 1TFAA 2OWTA 4JWYA 4GF8A 4PFWA 2FYIA 4IO6A 4X1DA 1R9LA 4ND9A 4IO7A 2RINA 1N84A 3VE1B 4I8CA 5I84A 2O1LA 5DEXB 3QSLA 1B4ZA 3U72A 3CI8A 1UIVA 1O7TA 5I56B 4ONYA 1PB8A 4DE8A 4EF1A 1AMFA 2H25A 1WVJA 2QS3A 4ELPA 2RCBA 2O7IA 3H6UA 3VVEA 4R2BA 1AH5A 3KFMA 1Y4CA 1JEUA 3OEKA 3MZBA 3ZKLA 1QUIA 2WKYA 3K1PA 5JTYB 4QHQA 3LBSA 3M3LA 3WAEA 5LOMA 1PB7A 4Q8RA 3OELA 4XXUA 3G3KA 3K6XA 2Q8JA 2DWJA 1M5FA 2HCAA 4H5GA 2XD3A 2HZKA 3U92A 5DVJA 4U1OA 1II5A 3EQ1A 4MH5A 3UK4A 4ZE9A 2Q89A 3T22A 1FQBA 2GRVA 2ZNTA 3QAXA 3RTFB 5I2NB 1PBQA 1M5EA 2P2AA 3FD3A 5AA1A 2H9BA 1B58A 3L6GA 1S50A 1S9TA 3TCHA 3UA8A 2NXOA 3MQ9A 5ICQA 5CMCA 4EXLA 1IXHA 1ATGA 4I62A 1SI0A 3TZAA 5I59A 1UIUA 4ZDMA 3H6WA 1VFEA 4OXVA 5FTIA 1GGGA 2I58A 3FATA 1A7LA 1DPEA 4OEUA 3T9HB 3CR9A 3PUYE 3LSWA 1BP5A 4H1XA 1MXZA 2RKMA 4YMBA 2OBGA 2R71A 4JSDA 1MH3A 3KSXA 1FTMA 1Y20A 2HZLA 4QSEA 3TQLA 4Q5TA 4ISUA 1YAEA 4R74A 4ESWA 4YU0A 2R6GE 2HAVA 1VR5A 3CFXA 2I4BA 3DP4A 3OO8A 1MG1A 3MBPA 1R6ZA 4KHZE 2F7AA 4EXKA 3MWBA 1N7XA 5EYFA 5I57A 1LB8A 2FNCA 4EUOA 4RY1A 4H67A 2GFEA 4U22A 3RT6B 2NUVA 1EH3A 3BFUA 3IOWA 1B3HA 3R7XA 2HAUA 5I58B 1USYE 1XT8A 3T96B 2D3IA 4HW8A 2PT1A 2QJEA 4NWCA 4G4PA 1UTHA 5TU0A 2XXUA 4RK9A 2X7PA 3JYRA 4NF5A 4F31B 1R1NA 5HM4B 4KYEA 5JEIA 1US5A 3S4UA 4NF4B 3Q26A 4GRKA 3O6HA 4C1UA 5B70A 3OMBA 4LQ5A 2Z22A 4GOTA 2I0CA 4R75A 4WEPA 2V84A 5CI5A 4DLDA 2VD3A 1MPCA 4AB6A 4F2OA 4R72A 3UORA 3U93A 4JXIA 3PD9A 1LAFE 3IJOB 3PPNA 3GXAA 5CMBA 1H3DA 5DTBA 3KOSA 1XVXA 2AL5A 4ZEBA 4F3GA 2Y7WA 4IB2A 1B5HA 4RYAA 1T0KA 4RK2A 4DIGA 1B51A 2Y7IA 5B7DA 5I2KA 1MH4A 3HPIA 3V8XB 2UYFA 3BBRA 3HSTA 2DYXA 3DELB 3ONMA 3MP8A 4L17A 1OVTA 2OCUA 2XXXA 5F7VA 2XXIA 4M1VA 4YZZA 2UVIA 4G8NA 4OETA 1M5DA 3UP9A 1PEBA 1SW4A 2NOOA 2V3UA 1JEVA 3C32A 3PUXE 4P11A 1NNKA 2F7CA 4OERA 1HSLA 4ZS9A 5K2XA 3V89B 4YICA 1VE4A 2OK2A 1KWHA 3FJGA 1PB9A 3T9VA 3K4UA 3MPKA 4FEDA 2UYEA 3IO6A 3KJTA 3EHUA 3U1OA 1MQGA 3KZGA 4WXJA 5K2YA 5ISUA 5BWJA 1URGA 2F5XA 1NL5A 3T93B 1F9BA 3CFLA 3Q25A 2PYYA 1MPBA 5FHOA 2LAOA 3QYTA 3TTMA 2UXAA 1A99A 1H45A 2E1SA 3IB1A 3RT8A 4C1TA 2GHAA 1LBBA 5AA4A 4XIGQ 2NWJA 1TFDA 1JW5A 2I3WA 3PUZE 1XC1A 3QUJA 4JWXA 4R2FA 3ECRA 5TP9B 1QW0A 2CMOA 2GH9A 1POTA 3K00A 1MPDA 3CRBA 3RGYA 1B5JA 1LCFA 2O7UA 2XD2A 3IJXB 3VLVA 5A5XA 2IEEA 1MXWA 4RNSA 2G93A 4F18A 3FJ7A 4IGRA 1SYIA 3SEXA 3OO9A 3QXMA 2DVCA 2UVJA 3KGCA 5ITOA 2DP8A 4G68C 4MFIA 4U23A 3GLBA 3TEPA 4NTLA 1NMUA 5IKBA 1MY3A 1JNFA 2ESNA 3Q28A 3OSRA 4KD5A 3MUQA 1XOCA 1IITA 3LR1A 1B3FA 3G3HA 4PQJA 4EF2A 1EZPA 4YB7A 1B5IA 3F11A 4F1VA 5IAIA 2ANJA 2RF1A 3USDA 2H98A 3K02A 4HCYA 3VLWA 4ECFA 4POXA 1IUDA 4LA9A 3MVYA 4XKRA 4DDDA 4JB7A 2O68A 1FTKA 1WDNA 1NKXA 1XVYA 2Y84A 3O9PA 3RTWB 4EQ7A 3H4ZA 1IIWA 3UN6A 3O97A 2O84X 3PPQA 3KEIA 2PT2A 2QS1A 3OSQA 4RXLA 2XX8A 4X9TA 4YKJA 5TPAB 1GV8A 3SEVA 3RQTA 3OXNA 2AL4A 3U8QA 2DS9A 3H6VA 2E0SA 3LSXA 2Z8FA 1LAXA 2ONSA 1QUKA 3I5OA 3S9LC 1LBCA 1YTVA 2V3QA 1IQ7A 3QIMA 2XXWA 1D4NA 1M5CA 4NEDA 1FQAA 2YJPA 3VFJA 4F2QA 1FQFA 3C34A 3MP1A 3M8UA 2P1SA 5CC2A 1ZKBA 1USYH 2V93A 1XHYA 4JDFA 3THIA 2ZYKA 3TODA 4DXUA 1TXFA 3G3FA 1MDQA 1UTHB 3N6TA 3I3VA 4OZ9A 4RPNA 3TKDA 3TQWA 3GBBA 1H43A 2O51A 1I6QA 2REJA 1MXVA 3C33A 3FASA 3IK6B 4LQ2A 3SDFA 4C0RA 3OO6A 1NNPA 1SQYA 4TOZA 1I69A 4H8JA 4OFOA 2DWAA 4MLVA 4POWA 2X7QA 4OEVA 5KCJB 1SYHA 4O3BA 2P0SA 4XTCQ 3UGWA 2QSXA 2AIXA 4EQBA 1Y1MA 4R73A 2ALUA 3TTNA 1IXIA 4ZEDA 1FQEA 1LGBC 1Y3PA 4O3CA 1OLAA 4Q30B 1SDXA 2OZZA 1QKAA 5BUUA 4ZECA 3KN3A 5CM6A 1LAHE 1MQJA 4LP2B 5I56A 3S2VA 4WKMA 4OFLA 2O1MA 4M4GA 4YKPA 3T9XB 3U94A 1SW2A 3PGFA 4KR5A 2QMWA 3C4MA 1FTLA 1US4A 3G3IA 2H5YA 3MZ1A 3SEUA 3ZKKA 2XXVA 1DPPA 2ZMBA 3I6VA 3DM0A 2VHAA 3H03A 1JETA 2YLNA 2Z8EA 1MQDA 2O69A 4P0IA 3HHGA 4KCCA 4PFUA 3FGSA 3IAZA 1B7HA 4EDPA 1OQGA 1ANFA 3O6IA 2G29A 1BTJA 1ZMGA 4GWOA 4H0WA 1NH7A 3AXFA 4IO3A 5H8HA 4AB5A 3FV2A 4KYDA 1RKMA 1B3GA 2DSFA 5AA2D 5L8DA 3HHFA 3IB0A 1RYXA 3CIJA 4NMYA 2RC9A 3ILUB 4NF8A 2Q88A 3P7IA 3VV5A 4GQOA 1IZ1A 1OLCA 2YPNA 5H8FA 4TQUQ 3CG3A 2QRYA 2DE2A 3TCGA 4OENA 1QJMA 4U2RA 1UTBA 1NH8A 4IGTA 4YAHX 4OFJA 3EF7A 3N26A 4OVJA 5AE4A 3TTRA 2HFBA 1MM7A 2DOJA 1HSEA 3CSGA 1B0LA 1FCKA 4GL0A 3R26A 4LUBA 3SKPA 4ZEFA 2ZYNA 3PMWA 1DTGA 4FE8A 2XXTA 4UACA 3HCQA 4YKIA 1A8FA 3TUSA 2Y7KA 1H76A 3H6TA 1A8EA 4QSDA 2Q2CA 1BIYA 4F39A 4LATA 4OQOA 4R6HA 3KBRA 5EHMA 3L6HA 4F3SA 1B3LA 4FIMA 3SESA 3FXQA 1ELJA 3SERA 4F1YA 1UTBB 4MBPA 5DVFA 1GTKA 4GL8A 3QK6A 2F34A 3IOUA 2H4IA 3C35A 5ICTA 5A5XB 2M8CA 4JSOA 4UA8A 2RCAA 3OO7A 3ODBA 3PU5A 4R6KA 3MPLA 3EN3A 1Y4TA 4WEDA 4OESA 1L5TA 1HSJA 5H8QA 1SW5A 1UQWA 4KYSA 3SETA 4BDRA 5JTYA 2VP1A 1P1QA 4F1UA 3OOAA 1N3WA 5AA2A 2XXHA 3WAFA 2FA7A 1Q35A 3O2AA 4XKPA 5CMKA 1B9JA 3TCFA 4LZ7A 3FV1A 4IO2A 4N07A 4FAJA 4PE5B 3KSJA 2ZYOA 4OWDA 5J1DA 3RN8A 1DSNA 2W7YA 4NF6A 3LSLA 1R9QA 2QPQA 1P1NA 2ZNSA 4HCWA 3OD7A 4DXCA 4MF3A 5I58A 4Z7EA 3W9WA 1LFIA 3B6WA 2Y7PA 2F6PA 2HEUA 2ONKE 2RC7A 3G3JA 3M3FA 3K6UA 3KN8A 3O6GA 4G8MA 1DOTA 4KFQA 4QFKA 4BDOA 4E0XA 1JQFA 2OLBA 2B65A 3CG1A 2Q2AA 3TAJA 5L9MA 1P1OA 1MXYA 1RYOA 2BJJX 1S7YA 3K2DA 3KG2A 2I0BA 4YB6A 3IR1A 4X48A 1B6HA 2B3BA 3PUWE 4KI0E 2QS2A 1B2HA 3ILTB 3TTLA 3ZS6A 5HPQA 1BKAA 3PUVE 4FEBA 3C9HA 4FECA 1AL3A 1JVXA 3HN0A 4K3FA 3EHSA 3H7MA 3ZSFA 2QL3A 1LCTA 2HQ0A 5H8FB 1PC3A 3MVWA 2ZNUA 1N3XA 3C31A 3VVFA 1N7WA 5AA4B 1N04A 4NWDA 4LZ8A 1D9YA 1OQHA 4RPOA 2DE3A 3H3GA 3PV0E 3V83A 1QULA 4RJZA 3LC8A 2Q9TA 1A55A 2Z8DA 5DYHA 1MY4A 1FQDA 1NFTA 1SW1A 1XS5A 3DLNA 5I59B 4IY5A 2THIA 4OHNA 3EHTA 1ZLQA 4P0GA 4BDLA 5AA3A 3TFLA 5I2NA 4NF5B 3FZVA 1EZ9A 3IO4A 2DVZA 3UIFA 4PFTA 4YKKA 4H8IA 3E9XA 3TYHA 3MW0A 4GXSB 1O63A 2F8DA 1LAGE 2I48A 3E4RA 4DZ1A 4OTEA 2XXQA 4XKNA 4H5FA 4ZZAA 4GXAA 3B7DA 3K1MA 1Y3QA 1A54A 2ONRA 2A5TB 5HBCA 4BDQA 4ESXA 1B1XA 1B4HA 4NF6B 4QFLA 5I57B 5F1QA 3A3UA 4G8HA 1IEJA 3MVZA 3O28A 2R9JA 4PP0A 4ZEKA 2VD2A 3MP6A 4KPTA 5CMMA 3RUMA 4F3BA 1VFDA 3KOTA 3FJMA 3N5LA 4JBZA 5H8QB 4ZZEA 5KCJA 4F3PA 3SEWA 5EHSA 4LVQA 3N6UA 4H6DA 4FJPA 4ELQA 3PD8A 5TPAA 4GD5A 3G7WA 5KDTB 3PMVA 1MY0A 2UVHA 4XKQA 4BDMA 2F97A 2ZXTA 1LB9A 1IXGA 1POY1 2HXWA 2XXPA 3E3KA 3TELA 3Q27A 3FVOA 3N94A 4MLQA 4PFYA 3T66A 3VDFA 3FVNA 4QFPA 4G68B 1URSA 4DXBA 4BLAA 2F35A 2XXRA 3PMXA 3B6TA 3OENA 4R9FA 1NNTA 2I6EA 2QMXA 1SVXB 3K01A 3PPRA 3QUFA 4GLIA 1TT1A 4I1DA 5KDTA 1MM6A 3HV1A 3RPWA 1P1WA 4N13A 3D4GA 1CE2A 1O64A 3D4CA 1ZBMA 1B46A 4E0WA 1OMPA 3TDJA 4KCDA 3RY3A 1LFHA 2DWHA 4OMBA 3CFZA 1MQIA 5ELVA 5I2KB 4IO4A 3LUYA 2H99A 1B3EA 2RC8A 3G3GA 3IOTA 3R6UA 4KQPA 1QKBA 3FXRA 1URDA 3B6QA 1D9VA 3DP8A 4NF8B 4ZE8A 5JK4A 5DT6A 1WODA 4ELOA 3VXBA 4TLLB 1AOVA 3S9MC 3BFTA 4X1BA 1FW0A 5H8SA 5L9OA 2A5SA 3IL1B 3H06B 1QUJA 3KN7A 2CZLA 1OIBA 1MXUA
chains in the Genus database with same CATH superfamily
4QRZA 2V25A 3MC2A 2AYSA 4PAKA 3LSFB 1Y9UA 2XA5A 3FVKA 2QS4A 3S9EA 2F7BA 1Z7NE 4G77A 1JW1A 4HS7A 4F1UA 1M5BA 2UVGA 3O66A 3VXCA 4I40A 5AA4B 2XX7A 4THIA 3BKIB 3K0VA 1MY1A 2PFYA 4JVIA 3JZJA 5AA2B 5EQ8A 3IORA 4U4XA 4PF6A 4KXPA 2VOZA 2I4CA 4Q0CA 2OJTA 4GX6A 3A09A 3TTKA 2DXRA 1I6BA 1DTZA 4BDNA 4LZ5A 1QUJA 5TP9A 4MIJA 4F22A 3W9VA 4PFBA 1FQCA 1A40A 3IOVA 4H65A 4PETA 4DCXA 4JWOA 3S9NC 3MAMA 1LFGA 4PDHA 2DE4A 1I6AA 4DI3D 3K6VA 2IA4A 3T9UA 2DWIA 4FATA 1LLSA 3E13X 1EU8A 1DMBA 1JVYA 1TWYA 4JWYA 4GF8A 1FBCA 4N15A 4IO6A 1N84A 3VE1B 1O7TA 2QS3A 3VVEA 3KFMA 1QUIA 2CZIA 3OELA 1M5FA 4U1OA 4MH5A 3T22A 4LN5A 3RTFB 5AA1A 3FD3A 2H9BA 3B8BA 3UA8A 5ICQA 1FRPA 2ZZWA 1IXHA 1ATGA 4MAGA 4ZDMA 3H6WA 5FTIA 2R8TA 1MXZA 4FBPA 4JSDA 1FTMA 4QSEA 2QVRA 4ISUA 4R74A 4ESWA 2HAVA 3MWBA 4NF0A 4RY1A 2GFEA 4U22A 2HAUA 1USYE 3T96B 1FPFA 2PT1A 5HM4B 2DDKA 4KYEA 3Q26A 4GRKA 3O6HA 2XWKA 4LQ5A 5IZ3A 5CI5A 4P47A 4F2OA 4R72A 3PD9A 1FJ9A 3IJOB 3PPNA 5CMBA 3KOSA 2AL5A 1B5HA 4DIGA 5I2KA 3V8XB 2UYFA 2DYXA 3DELB 4L17A 5F7VA 4OETA 1M5DA 4XF5A 3UP9A 1SW4A 1PEBA 4P11A 3PUXE 5K2XA 1HSLA 1FSAA 1KWHA 1FBDA 4FEDA 3U1OA 1MQGA 1A99A 4XFEA 3PUZE 4JWXA 3S9LC 1XC1A 3K00A 5A5XA 1MXWA 4F18A 1FPLA 3QXMA 5ITOA 4G68C 1MY3A 3Q28A 3F11A 4F1VA 2WBDA 2ANJA 4GX4A 4ECFA 4POXA 1NKXA 2Y84A 3H4ZA 1IIWA 3UN6A 3KEIA 3OSQA 4RXLA 3U8QA 4NHBA 2DS9A 2Z8FA 2ONSA 2V3QA 3QIMA 1IQ7A 2XXWA 3C34A 2P1SA 1ZKBA 1TXFA 2P3VA 3I3VA 3TQWA 4OVSA 3FASA 3C33A 4C0RA 1I69A 3MYUA 2X7QA 2P0SA 4EQBA 4R73A 1FQEA 1LGBC 1QKAA 4ZECA 4YKPA 1SW2A 3PGFA 4KR5A 2QMWA 1US4A 2XXVA 1DPPA 4O7MA 2VHAA 3HHGA 4HXVA 4IR8A 4PFUA 4NN3A 3IAZA 4OVRA 1ANFA 3O6IA 2G29A 4GWOA 2GQ1A 4KYDA 4NMYA 1NV7A 1NV1A 3P7IA 4GQOA 1IZ1A 5H8FA 3CG3A 2XXKA 3TCGA 4YAHX 5AE4A 3TTRA 1MM7A 2DOJA 1HSEA 3SKPA 2ZYNA 4LATA 4P56A 3L6HA 4OA4A 3SESA 1UTBB 4GL8A 3C35A 4BDRA 1SW5A 3SETA 4KYSA 1N3WA 2XXHA 1B9JA 3TCFA 4LZ7A 4IO2A 4N07A 4PE5B 2HPGA 3RN8A 4NF6A 1R9QA 2ZNSA 4HCWA 3W9WA 3B6WA 4Q30B 1NUZA 2RC7A 4BDOA 1EYIA 1DOTA 2OLBA 3CHGA 3IR1A 2QS2A 1B2HA 3ZS6A 5HPQA 3PUVE 1JVXA 3HN0A 5ET7A 2PFZA 3MVWA 1FBPA 1N04A 4LZ8A 1D9YA 4RPOA 2L5VA 2DE3A 3PV0E 2Q9TA 5A5LA 1MY4A 3DLNA 2THIA 4P0GA 4BDLA 5AA3A 3FZVA 4GXSB 2F8DA 4XKNA 4OVQA 4ESXA 1B4HA 5LTCA 3A3UA 1IEJA 1IMDA 2VD2A 1VFDA 4JBZA 5H8QB 4F3PA 5EHSA 3PMVA 2F97A 3E3KA 4MLQA 3VDFA 3FVNA 4DXBA 1URSA 4BLAA 3PMXA 3OENA 4GLIA 1IMEA 1NNTA 2I6EA 2QMXA 1LBZA 4I1DA 1TT1A 1ZBMA 2OX3A 2DWHA 2V4CA 2H99A 1LBVA 1QKBA 4ZE8A 4NF8B 5JK4A 5DT6A 3S9MC 4ELOA 4PTKA 2HHMA 5L9OA 3IL1B 3I6VA 3KN7A 3MJNA 4NG7A 3CSBA 4GIZA 1FTJA 1DCUA 2QVUA 4N8YA 4N6KA 4N81A 2DXYA 1GVCA 2REGA 5IGAA 3HO7A 1ZJLA 5CBRA 3PPOA 4GBVA 1FPGA 4G2ZA 3FUZA 3UORA 2XWVA 4QFOA 5M2VA 1NUYA 3OEMA 4AS5A 1NV0A 4RA1A 4I3YA 1B05A 1MRPA 4GFRA 4U21A 2Z23A 1VSOA 4DI4B 1EZOA 3SEYA 4FORA 2A5TA 3GZGA 4OYVA 2F78A 1QVSA 3GYYA 2WEFA 4IO5A 2XX9A 3TPAA 3GBAA 3JV9A 4PBHA 4QBAA 2KLFA 3O29A 4NF4A 5ET6A 1J1NA 5ITPA 4HTGA 3EPEA 1MQHA 4NE4A 3BIGA 2X26A 3KC1A 3A3CA 2WBBA 4R6YA 1ZU0A 4TLMB 4DCYA 1SD3A 3CVGA 5H8NB 2Y7RA 4Z0IA 4QF9A 1TFAA 2OWTA 1R9LA 4IO7A 4I8CA 2O1LA 5DEXB 3QSLA 3CI8A 5I56B 4ELPA 1AH5A 3MZBA 3ZKLA 2WKYA 3K1PA 5JTYB 4QHQA 3LBSA 3M3LA 1KA1A 4N4UA 2HCAA 4H5GA 5DVJA 4ZE9A 1FQBA 4PE3A 2GRVA 2ZNTA 2P2AA 1S9TA 3TCHA 3MQ9A 4EXLA 1UIUA 3FATA 4OEUA 3LSWA 2CEYA 2OBGA 2R71A 4MCOA 3NOHA 1MH3A 2HZLA 1Y20A 3TQLA 1CNQA 2R6GE 1VR5A 3CFXA 3DP4A 2F7AA 1N7XA 3BFUA 1XT8A 2D3IA 2F3BA 4F31B 3JYRA 4NF5A 4MMPA 3S4UA 5B70A 4R75A 1BK4A 1MPCA 2XWOA 1NV5A 5DTBA 1XVXA 4F3GA 3RPLA 2Q8MA 4RK2A 2FBPA 3BBRA 3HSTA 3ONMA 3MP8A 2OCUA 3FXBA 4NX1A 5EQ9A 2XXXA 4M1VA 2UVIA 1NNKA 4OERA 4YICA 1VE4A 2UYEA 3KZGA 5K2YA 5ISUA 3Q25A 5FHOA 2LAOA 2E1SA 1H45A 3RT8A 1DBZA 4XIGQ 1TFDA 1JP4A 4R2FA 2GH9A 4OVTA 3IJXB 2IEEA 4IGRA 1SYIA 3T0JA 3OO9A 2UVJA 3KGCA 4MFIA 4NTLA 1NMUA 4MJOA 5IKBA 3MUQA 1XOCA 4EF2A 4PF8A 1EYKA 4X8RA 2JJKA 3VLWA 1IUDA 4DDDA 5IZ3B 4JB7A 2O68A 1XVYA 3RTWB 4JVDA 3O97A 4X9TA 5TPAB 3RQTA 1LAXA 3MP1A 3M8UA 5CC2A 4DXUA 1H43A 3IK6B 4TOZA 4MNCA 2FHYA 1SYHA 3UGWA 2AIXA 1Y1MA 1SDXA 5ET8A 2OZZA 4GBWA 3KN3A 5CM6A 4LP2B 5I56A 4WKMA 4M4GA 1FTLA 3ZKKA 2ZMBA 1FJ6A 4UABA 4P0IA 4GWWA 1FPJA 1OQGA 1BTJA 1ZMGA 4AB5A 1NH7A 3AXFA 5IZ1A 1NUXA 5AA2D 1FPEA 3IB0A 4P8BA 4GWYA 4NF8A 1OLCA 2QRYA 2DE2A 4GL0A 5EQ7A 3R26A 2FIEA 4ZEFA 3PMWA 1DTGA 4FE8A 2XXTA 4UACA 2Q2CA 4OQOA 5EHMA 5J16A 3KBRA 4F3SA 1QGXA 4FIMA 3FXQA 1ELJA 4G61A 1GTKA 2F34A 3EKIA 2H4IA 3PU5A 3MPLA 3EN3A 5H8QA 2VP1A 3OOAA 5EYGA 3KSJA 2ZYOA 1DSNA 2QPQA 1FBHA 2P3NA 5I58A 1LFIA 3M3FA 2VT5A 3K6UA 3O6GA 1P1OA 1S7YA 4X48A 3PUWE 3ILTB 1BKAA 4FEBA 4JVCA 2QL3A 5H8FB 1N3XA 3VVFA 1N7WA 3H3GA 1QULA 1A55A 5DYHA 1SW1A 1XS5A 3EHTA 5I2NA 3TFLA 1RDXA 4PFTA 4H8IA 4H5FA 4GXAA 3B7DA 4PFRA 1Y3QA 1A54A 4BDQA 5I57B 4NF6B 4QFLA 4G8HA 4F3BA 1KZ8A 4ZEKA 5L9SA 1KA0A 4ZZEA 5FBPA 4LVQA 5LDZA 4ELQA 3PD8A 5TPAA 3G7WA 5KDTB 1IXGA 1POY1 2HXWA 3TELA 3Q27A 4PFYA 3T66A 4QFPA 4G68B 2F35A 3QUFA 1MM6A 1P1WA 3D4GA 1O64A 3D4CA 4MNPA 1G0IA 3IFAA 1B3EA 4KQPA 4ONYA 2RC8A 3R6UA 3DP8A 1AOVA 1G0HA 4TLLB 3BFTA 1FW0A 4PGNA 5H8SA 1OIBA 4NEDA 1MXUA 2CEXA 3C36A 5FTHA 1B40A 1SI1A 1B7ZA 5I3SA 5ESYA 2PX1A 3VVDA 4U4SA 1YPNA 4LQ2A 2PVUA 4GVOA 1CB6A 1LEVA 4MX6A 3QMFA 1Q9DA 1ZIUA 1H44A 3Q29A 4N6PA 2NVUB 1MDP1 4F29A 4QFNA 4PBQA 1SBPA 3K6WA 4AQ4A 1FTOA 5FHMA 2PMSA 4EQ9A 1MY2A 1B52A 2V3TA 5DVIA 5CRYA 1GR2A 1MXXA 2DQVA 3RLFE 4F19A 1ZTYA 1MS7A 3PPPA 3V5AA 4O3AA 3DP6A 1B0HA 1LSTA 3FXUA 4YMAA 2PBWA 2B3FA 1D9QA 1P99A 4QSCA 1B32A 1OVBA 4PFWA 4HE2A 2RINA 4HE1A 1B4ZA 3U72A 1PB8A 4DE8A 4EF1A 1AMFA 2H25A 1WVJA 2RCBA 4R2BA 1Y4CA 3OEKA 2B4MA 1YZ0A 1PB7A 4GX3A 4Q8RA 4XXUA 2HZKA 3LUZA 3EQ1A 3UK4A 3FBPA 4OVPA 1B58A 2ZZXA 3TZAA 4OXVA 1GGGA 2I58A 1A7LA 3CR9A 3PUYE 4H1XA 2RKMA 1LBYA 1EYJA 2I4BA 3OO8A 3MBPA 1R6ZA 4KHZE 5F24A 4EXKA 5EYFA 5I57A 1LB8A 4H67A 3RT6B 1EH3A 3IOWA 1B3HA 4HW8A 2QJEA 1UTHA 4RK9A 1R1NA 4NF4B 3OMBA 3H06B 2Z22A 4GOTA 4DLDA 3U93A 4JXIA 1LAFE 3GXAA 4ZEBA 1B51A 1OVTA 2XXIA 2V3UA 3C32A 4ZS9A 2BJIA 4N8GA 1PB9A 4XEQA 3K4UA 3T9VA 3IO6A 3EHUA 4WXJA 5BWJA 3T93B 5J1DA 3CFLA 2PYYA 3TTMA 4C1TA 2GHAA 2NWJA 5I59B 1NV4A 2CMOA 3E78A 1MPDA 3RGYA 1LCFA 4RNSA 4PC9A 3FJ7A 3MSTA 2DP8A 4U23A 3TEPA 3OSRA 1IITA 1B3FA 3G3HA 4YB7A 1B5IA 1NV6A 2RF1A 3USDA 4HCYA 3MVYA 4XKRA 3KBZA 1WDNA 3RYDA 4EQ7A 2O84X 1IMAA 4HE0A 1T0KA 2XX8A 1GV8A 3SEVA 3OXNA 2AL4A 2E0SA 3I5OA 4P9KA 1LBCA 1YTVA 1M5CA 1FQAA 2YJPA 4F2QA 1K9ZA 1USYH 2V93A 4JDFA 2ZYKA 3G3FA 1MDQA 3TKDA 2O51A 2REJA 3SDFA 3OO6A 1NNPA 1SQYA 1K9YA 2DWAA 2QSXA 4H45A 1Y3PA 4H46A 4O3CA 1LAHE 1MQJA 3A29A 3S2VA 2O1MA 3U94A 3G3IA 3HFUA 4AS4A 1JETA 2Z8EA 1MQDA 4KCCA 4GWSA 1FBFA 2ZZVA 4H0WA 4IO3A 2HXRA 1B3GA 2DSFA 1NUWA 5L8DA 4GWXA 3CIJA 2Q88A 2YPNA 1FPIA 1QJMA 4U2RA 1UTBA 4IGTA 1FTAA 3N26A 1YXIA 2HFBA 3CSGA 1B0LA 1FCKA 1VDWA 4YKIA 3TUSA 4QSDA 1B3LA 3SERA 4F1YA 4MNIA 3QK6A 3IOUA 2MKZA 2OWZA 2Y5LA 4JSOA 2RCAA 4UA8A 3ODBA 4OESA 1HSJA 1UQWA 1P1QA 5AA2A 2FIXA 4QXDA 2FA7A 1Q35A 3O2AA 5CMKA 3LV0A 1NV2A 4OWDA 3LSLA 4P3LA 4DXCA 4MF3A 4NAPA 2F6PA 1IMFA 4G8MA 4KFQA 4QFKA 1DK4A 3CG1A 5L9MA 3B50A 1RYOA 2BJJX 4YB6A 2I0BA 3KG2A 1B6HA 5EQAA 2XWIA 5I5PA 1AL3A 4K3FA 1YYZA 3ZSFA 1LCTA 1PC3A 3C31A 1RDZA 2QFLA 3LC8A 2Z8DA 1FQDA 1NFTA 4OHNA 1ZLQA 4NF5B 1EZ9A 3TYHA 3MW0A 1O63A 3E4RA 4OTEA 4P1LA 3K1MA 5HBCA 2ONRA 3RUMA 2R9JA 3MP6A 4KPTA 5CMMA 3KOTA 3FJMA 1FPBA 3E79A 5KCJA 1MY0A 2UVHA 4N6DA 1LB9A 2XXPA 3FVOA 1SVXB 3HV1A 3RPWA 4E0WA 1CE2A 1B46A 1OMPA 5T3JA 1LFHA 4OMBA 1MQIA 4O7IA 3G3GA 3FXRA 3B6QA 1WODA 3VXBA 3K01A 2QVVA 1N76A 5H8HB 4ELRA 3FVGA 2ZYMA 2VGQA 2XHDA 4U1ZA 1INPA 3W15C 5IZZA 2WYPA 1B7UA 4G68A 1PDAA 5DEXA 3TMGA 1AIVA 3M3KA 3MVXA 1D3KA 3K1NA 5H8NA 2O6AA 5CBSA 1Z7ME 2D21A 2I3VA 1IXCA 4ZEIA 3IB2A 4IY6A 1IMBA 1P1UA 1Q1KA 2F36A 3MZ9A 4R9GA 4OANA 4I9DA 3KJ7A 1YCJA 1B1HA 2D5WA 4LONB 1JW4A 3VLUA 4YB5A 3IX1A 2KQZA 1Y3NA 1PBPA 4NQ8A 4PFIA 5KZTA 1FPDA 1NNFA 1Y1ZA 2ABHA 2XXYA 1BLFA 1N0TA 4PDDA 3FIRA 3RNNA 2F6GA 2OWSA 5FHNA 2B4LA 2I49A 2FVZA 3KC0A 4O8MA 4P1EA 2FYIA 4X1DA 4ND9A 5I84A 4I3EA 1UIVA 3H6UA 1FPKA 2O7IA 1LBXA 1JEUA 3BIHA 3WAEA 5LOMA 2Y5KA 3G3KA 3K6XA 4O94A 2Q8JA 2DWJA 2XD3A 2WYKA 3U92A 5EYHA 1II5A 2Q89A 3QAXA 5I2NB 1PBQA 1M5EA 3L6GA 1S50A 2NXOA 5CMCA 4I62A 1SI0A 1VFEA 1DPEA 3T9HB 1BP5A 4YMBA 3SZPA 3KSXA 4Q5TA 1YAEA 3ROJA 4GWUA 4YU0A 2KR0A 1FBGA 1MG1A 4NGUA 2FNCA 4EUOA 1IMCA 2NUVA 3R7XA 5I58B 4NWCA 4G4PA 5TU0A 2XXUA 5JEIA 2X7PA 1US5A 4C1UA 5DW8A 2VPOA 4WEPA 2V84A 2CZLA 2VD3A 4AB6A 2WX9A 1H3DA 2Y7WA 4IB2A 4RYAA 5B7DA 2Y7IA 1MH4A 3HPIA 4YZZA 4G8NA 2NOOA 5AA4A 4N17A 1JEVA 2F7CA 3V89B 2OK2A 3FJGA 3MPKA 3KJTA 1URGA 2F5XA 1NL5A 3VV5A 1F9BA 1MPBA 3QYTA 2UXAA 3IB1A 1LBBA 2I3WA 1JW5A 3QUJA 5I59A 5TP9B 3ECRA 1QW0A 1POTA 3CRBA 3VLVA 1B5JA 2O7UA 3ISPA 2XD2A 2G93A 3T1BA 3SEXA 2DVCA 3GLBA 1JNFA 3D1RA 2ESNA 4KD5A 4PQJA 3LR1A 1NI9A 5IAIA 2H98A 3K02A 4LA9A 1FTKA 3O9PA 3PPQA 2PT2A 2QS1A 4YKJA 3H6VA 3LSXA 1RDYA 1QUKA 3VFJA 1D4NA 1FQFA 1NV3A 3TODA 1XHYA 3THIA 4MHFA 4OZ9A 1UTHB 3N6TA 4RPNA 5IM2A 2Q74A 3GBBA 1I6QA 1MXVA 4H8JA 1XI6A 4OFOA 4MLVA 4POWA 4OEVA 5KCJB 4O3BA 4XTCQ 2PCRA 3TTNA 2ALUA 4ZEDA 1IXIA 1AWBA 1OLAA 5BUUA 2CZKA 4OFLA 3T9XB 3C4MA 4GWZA 4PAFA 2H5YA 3MZ1A 4N91A 3SEUA 3DM0A 3H03A 2YLNA 2O69A 3FGSA 1B7HA 4EDPA 5H8HA 3FV2A 1RKMA 3PTYA 2CZHA 3HHFA 1RYXA 2RC9A 3ILUB 4TQUQ 4OENA 1NH8A 4OFJA 3EF7A 4OVJA 4LUBA 3HCQA 1A8FA 2Y7KA 1H76A 3H6TA 1A8EA 4X04A 1BIYA 4F39A 4R6HA 3RPLB 4MBPA 5DVFA 5ICTA 5A5XB 2M8CA 3OO7A 4R6KA 1L5TA 1Y4TA 5JTYA 3WAFA 4XKPA 2F3DA 3FV1A 4FAJA 2W7YA 1P1NA 3OD7A 1FBEA 2VPNA 4Z7EA 4PGPA 3G3JA 2Y7PA 2HEUA 2ONKE 4KCDA 3KN8A 4E0XA 1JQFA 4PCDA 2B65A 3TAJA 2Q2AA 1MXYA 3K2DA 5ET5A 2B3BA 4KI0E 3TTLA 3C9HA 4FECA 3EHSA 3H7MA 2HQ0A 2ZNUA 3IFCA 4PAIA 5I7IA 4NWDA 1OQHA 3V83A 4RJZA 3UIFA 2DVZA 3E9XA 2I48A 1LAGE 4DZ1A 2XXQA 4ZZAA 2A5TB 1B1XA 5F1QA 3MVZA 3O28A 4PP0A 3N5LA 3SEWA 1SPIA 3N6UA 4H6DA 4FJPA 4GD5A 1LBWA 4XKQA 4BDMA 2ZXTA 3N94A 2XXRA 3U65A 3B6TA 4R9FA 4WEDA 4YKKA 3PPRA 5KDTA 4N13A 3TDJA 3RY3A 3CFZA 5ELVA 5I2KB 4IO4A 3LUYA 1EZPA 3IOTA 1URDA 1D9VA 4X1BA 2A5SA 4MEVA 2I0CA 4IY5A 2GHBA 3IO4A
chains in the Genus database with same CATH topology
3MJNA 4QRZA 2V25A 3C36A 1N76A 3MC2A 2AYSA 3LSFB 3CSBA 5FTHA 5H8HB 1Y9UA 3FVKA 3FVGA 4ELRA 2QS4A 2ZYMA 4GIZA 1B40A 2VGQA 1FTJA 2XHDA 1SI1A 4U1ZA 1B7ZA 3W15C 3S9EA 2PX1A 2F7BA 3VVDA 4U4SA 1Z7NE 4G77A 1JW1A 2DXYA 1B7UA 2REGA 1PDAA 1YPNA 4G68A 2PVUA 3HO7A 4HS7A 4GVOA 1ZJLA 1CB6A 1M5BA 3M3KA 3MVXA 5DEXA 3TMGA 5CBRA 2UVGA 3O66A 1AIVA 1D3KA 3PPOA 3VXCA 1ZIUA 4G2ZA 3K1NA 5H8NA 2O6AA 2XX7A 3FUZA 4THIA 3BKIB 1H44A 4QFOA 1Z7ME 2D21A 3Q29A 3K0VA 5M2VA 4N6PA 5CBSA 2I3VA 3OEMA 1IXCA 2NVUB 4RA1A 1MDP1 1MY1A 4ZEIA 4F29A 3IB2A 4QFNA 3JZJA 4IY6A 1B05A 1MRPA 5AA2B 4GFRA 1SBPA 4U21A 2Z23A 3K6WA 1VSOA 1P1UA 3IORA 1EZOA 1Q1KA 2F36A 4U4XA 3SEYA 1FTOA 4AQ4A 4FORA 5FHMA 2A5TA 3GZGA 2PMSA 4EQ9A 3MZ9A 5L9SA 4R9GA 1MY2A 4OYVA 2F78A 1QVSA 2VOZA 2I4CA 4I9DA 4Q0CA 1B52A 3KJ7A 4IO5A 2V3TA 5DVIA 2OJTA 5CRYA 1GR2A 2XX9A 1YCJA 1B1HA 3A09A 3GBAA 3TPAA 3TTKA 1MXXA 2D5WA 2DXRA 1I6BA 1DTZA 4LONB 3JV9A 4BDNA 2DQVA 1JW4A 3RLFE 4LZ5A 2KLFA 4F19A 3VLUA 1ZTYA 3O29A 4NF4A 3IX1A 4YB5A 5TP9A 1Y3NA 1J1NA 1MS7A 1PBPA 2GHBA 5ITPA 4F22A 3W9VA 5KZTA 1FQCA 1A40A 1NNFA 1Y1ZA 3IOVA 4H65A 4PETA 3PPPA 4DCXA 2ABHA 2XXYA 4JWOA 3S9NC 1BLFA 4HTGA 3EPEA 3V5AA 4O3AA 3DP6A 3MAMA 1N0TA 1MQHA 4NE4A 1B0HA 2X26A 1LSTA 3FIRA 3FXUA 3RNNA 1LFGA 4YMAA 2F6GA 2PBWA 2DE4A 3A3CA 1I6AA 3K6VA 2IA4A 3T9UA 2B3FA 2DWIA 2OWSA 4R6YA 1ZU0A 4TLMB 4FATA 4DCYA 1SD3A 1LLSA 3CVGA 3E13X 1EU8A 5FHNA 1GVCA 1P99A 5H8NB 4QSCA 2Y7RA 1DMBA 2I49A 1B32A 1JVYA 1TWYA 4QF9A 4Z0IA 1OVBA 1TFAA 2OWTA 4JWYA 4GF8A 4PFWA 2FYIA 4IO6A 4X1DA 1R9LA 4ND9A 4IO7A 2RINA 1N84A 3VE1B 4I8CA 5I84A 2O1LA 5DEXB 3QSLA 1B4ZA 3U72A 3CI8A 1UIVA 1O7TA 5I56B 4ONYA 1PB8A 4DE8A 4EF1A 1AMFA 2H25A 1WVJA 2QS3A 4ELPA 2RCBA 2O7IA 3H6UA 3VVEA 4R2BA 1AH5A 3KFMA 1Y4CA 1JEUA 3OEKA 3MZBA 3ZKLA 1QUIA 2WKYA 3K1PA 5JTYB 4QHQA 3LBSA 3M3LA 3WAEA 5LOMA 1PB7A 4Q8RA 3OELA 4XXUA 3G3KA 3K6XA 2Q8JA 2DWJA 1M5FA 2HCAA 4H5GA 2XD3A 2HZKA 3U92A 5DVJA 4U1OA 1II5A 3EQ1A 4MH5A 3UK4A 4ZE9A 2Q89A 3T22A 1FQBA 2GRVA 2ZNTA 3QAXA 3RTFB 5I2NB 1PBQA 1M5EA 2P2AA 3FD3A 5AA1A 2H9BA 1B58A 3L6GA 1S50A 1S9TA 3TCHA 3UA8A 2NXOA 3MQ9A 5ICQA 5CMCA 4EXLA 1IXHA 1ATGA 4I62A 1SI0A 3TZAA 5I59A 1UIUA 4ZDMA 3H6WA 1VFEA 4OXVA 5FTIA 1GGGA 2I58A 3FATA 1A7LA 1DPEA 4OEUA 3T9HB 3CR9A 3PUYE 3LSWA 1BP5A 4H1XA 1MXZA 2RKMA 4YMBA 2OBGA 2R71A 4JSDA 1MH3A 3KSXA 1FTMA 1Y20A 2HZLA 4QSEA 3TQLA 4Q5TA 4ISUA 1YAEA 4R74A 4ESWA 4YU0A 2R6GE 2HAVA 1VR5A 3CFXA 2I4BA 3DP4A 3OO8A 1MG1A 3MBPA 1R6ZA 4KHZE 2F7AA 4EXKA 3MWBA 1N7XA 5EYFA 5I57A 1LB8A 2FNCA 4EUOA 4RY1A 4H67A 2GFEA 4U22A 3RT6B 2NUVA 1EH3A 3BFUA 3IOWA 1B3HA 3R7XA 2HAUA 5I58B 1USYE 1XT8A 3T96B 2D3IA 4HW8A 2PT1A 2QJEA 4NWCA 4G4PA 1UTHA 5TU0A 2XXUA 4RK9A 2X7PA 3JYRA 4NF5A 4F31B 1R1NA 5HM4B 4KYEA 5JEIA 1US5A 3S4UA 4NF4B 3Q26A 4GRKA 3O6HA 4C1UA 5B70A 3OMBA 4LQ5A 2Z22A 4GOTA 2I0CA 4R75A 4WEPA 2V84A 5CI5A 4DLDA 2VD3A 1MPCA 4AB6A 4F2OA 4R72A 3UORA 3U93A 4JXIA 3PD9A 1LAFE 3IJOB 3PPNA 3GXAA 5CMBA 1H3DA 5DTBA 3KOSA 1XVXA 2AL5A 4ZEBA 4F3GA 2Y7WA 4IB2A 1B5HA 4RYAA 1T0KA 4RK2A 4DIGA 1B51A 2Y7IA 5B7DA 5I2KA 1MH4A 3HPIA 3V8XB 2UYFA 3BBRA 3HSTA 2DYXA 3DELB 3ONMA 3MP8A 4L17A 1OVTA 2OCUA 2XXXA 5F7VA 2XXIA 4M1VA 4YZZA 2UVIA 4G8NA 4OETA 1M5DA 3UP9A 1PEBA 1SW4A 2NOOA 2V3UA 1JEVA 3C32A 3PUXE 4P11A 1NNKA 2F7CA 4OERA 1HSLA 4ZS9A 5K2XA 3V89B 4YICA 1VE4A 2OK2A 1KWHA 3FJGA 1PB9A 3T9VA 3K4UA 3MPKA 4FEDA 2UYEA 3IO6A 3KJTA 3EHUA 3U1OA 1MQGA 3KZGA 4WXJA 5K2YA 5ISUA 5BWJA 1URGA 2F5XA 1NL5A 3T93B 1F9BA 3CFLA 3Q25A 2PYYA 1MPBA 5FHOA 2LAOA 3QYTA 3TTMA 2UXAA 1A99A 1H45A 2E1SA 3IB1A 3RT8A 4C1TA 2GHAA 1LBBA 5AA4A 4XIGQ 2NWJA 1TFDA 1JW5A 2I3WA 3PUZE 1XC1A 3QUJA 4JWXA 4R2FA 3ECRA 5TP9B 1QW0A 2CMOA 2GH9A 1POTA 3K00A 1MPDA 3CRBA 3RGYA 1B5JA 1LCFA 2O7UA 2XD2A 3IJXB 3VLVA 5A5XA 2IEEA 1MXWA 4RNSA 2G93A 4F18A 3FJ7A 4IGRA 1SYIA 3SEXA 3OO9A 3QXMA 2DVCA 2UVJA 3KGCA 5ITOA 2DP8A 4G68C 4MFIA 4U23A 3GLBA 3TEPA 4NTLA 1NMUA 5IKBA 1MY3A 1JNFA 2ESNA 3Q28A 3OSRA 4KD5A 3MUQA 1XOCA 1IITA 3LR1A 1B3FA 3G3HA 4PQJA 4EF2A 1EZPA 4YB7A 1B5IA 3F11A 4F1VA 5IAIA 2ANJA 2RF1A 3USDA 2H98A 3K02A 4HCYA 3VLWA 4ECFA 4POXA 1IUDA 4LA9A 3MVYA 4XKRA 4DDDA 4JB7A 2O68A 1FTKA 1WDNA 1NKXA 1XVYA 2Y84A 3O9PA 3RTWB 4EQ7A 3H4ZA 1IIWA 3UN6A 3O97A 2O84X 3PPQA 3KEIA 2PT2A 2QS1A 3OSQA 4RXLA 2XX8A 4X9TA 4YKJA 5TPAB 1GV8A 3SEVA 3RQTA 3OXNA 2AL4A 3U8QA 2DS9A 3H6VA 2E0SA 3LSXA 2Z8FA 1LAXA 2ONSA 1QUKA 3I5OA 3S9LC 1LBCA 1YTVA 2V3QA 1IQ7A 3QIMA 2XXWA 1D4NA 1M5CA 4NEDA 1FQAA 2YJPA 3VFJA 4F2QA 1FQFA 3C34A 3MP1A 3M8UA 2P1SA 5CC2A 1ZKBA 1USYH 2V93A 1XHYA 4JDFA 3THIA 2ZYKA 3TODA 4DXUA 1TXFA 3G3FA 1MDQA 1UTHB 3N6TA 3I3VA 4OZ9A 4RPNA 3TKDA 3TQWA 3GBBA 1H43A 2O51A 1I6QA 2REJA 1MXVA 3C33A 3FASA 3IK6B 4LQ2A 3SDFA 4C0RA 3OO6A 1NNPA 1SQYA 4TOZA 1I69A 4H8JA 4OFOA 2DWAA 4MLVA 4POWA 2X7QA 4OEVA 5KCJB 1SYHA 4O3BA 2P0SA 4XTCQ 3UGWA 2QSXA 2AIXA 4EQBA 1Y1MA 4R73A 2ALUA 3TTNA 1IXIA 4ZEDA 1FQEA 1LGBC 1Y3PA 4O3CA 1OLAA 4Q30B 1SDXA 2OZZA 1QKAA 5BUUA 4ZECA 3KN3A 5CM6A 1LAHE 1MQJA 4LP2B 5I56A 3S2VA 4WKMA 4OFLA 2O1MA 4M4GA 4YKPA 3T9XB 3U94A 1SW2A 3PGFA 4KR5A 2QMWA 3C4MA 1FTLA 1US4A 3G3IA 2H5YA 3MZ1A 3SEUA 3ZKKA 2XXVA 1DPPA 2ZMBA 3I6VA 3DM0A 2VHAA 3H03A 1JETA 2YLNA 2Z8EA 1MQDA 2O69A 4P0IA 3HHGA 4KCCA 4PFUA 3FGSA 3IAZA 1B7HA 4EDPA 1OQGA 1ANFA 3O6IA 2G29A 1BTJA 1ZMGA 4GWOA 4H0WA 1NH7A 3AXFA 4IO3A 5H8HA 4AB5A 3FV2A 4KYDA 1RKMA 1B3GA 2DSFA 5AA2D 5L8DA 3HHFA 3IB0A 1RYXA 3CIJA 4NMYA 2RC9A 3ILUB 4NF8A 2Q88A 3P7IA 3VV5A 4GQOA 1IZ1A 1OLCA 2YPNA 5H8FA 4TQUQ 3CG3A 2QRYA 2DE2A 3TCGA 4OENA 1QJMA 4U2RA 1UTBA 1NH8A 4IGTA 4YAHX 4OFJA 3EF7A 3N26A 4OVJA 5AE4A 3TTRA 2HFBA 1MM7A 2DOJA 1HSEA 3CSGA 1B0LA 1FCKA 4GL0A 3R26A 4LUBA 3SKPA 4ZEFA 2ZYNA 3PMWA 1DTGA 4FE8A 2XXTA 4UACA 3HCQA 4YKIA 1A8FA 3TUSA 2Y7KA 1H76A 3H6TA 1A8EA 4QSDA 2Q2CA 1BIYA 4F39A 4LATA 4OQOA 4R6HA 3KBRA 5EHMA 3L6HA 4F3SA 1B3LA 4FIMA 3SESA 3FXQA 1ELJA 3SERA 4F1YA 1UTBB 4MBPA 5DVFA 1GTKA 4GL8A 3QK6A 2F34A 3IOUA 2H4IA 3C35A 5ICTA 5A5XB 2M8CA 4JSOA 4UA8A 2RCAA 3OO7A 3ODBA 3PU5A 4R6KA 3MPLA 3EN3A 1Y4TA 4WEDA 4OESA 1L5TA 1HSJA 5H8QA 1SW5A 1UQWA 4KYSA 3SETA 4BDRA 5JTYA 2VP1A 1P1QA 4F1UA 3OOAA 1N3WA 5AA2A 2XXHA 3WAFA 2FA7A 1Q35A 3O2AA 4XKPA 5CMKA 1B9JA 3TCFA 4LZ7A 3FV1A 4IO2A 4N07A 4FAJA 4PE5B 3KSJA 2ZYOA 4OWDA 5J1DA 3RN8A 1DSNA 2W7YA 4NF6A 3LSLA 1R9QA 2QPQA 1P1NA 2ZNSA 4HCWA 3OD7A 4DXCA 4MF3A 5I58A 4Z7EA 3W9WA 1LFIA 3B6WA 2Y7PA 2F6PA 2HEUA 2ONKE 2RC7A 3G3JA 3M3FA 3K6UA 3KN8A 3O6GA 4G8MA 1DOTA 4KFQA 4QFKA 4BDOA 4E0XA 1JQFA 2OLBA 2B65A 3CG1A 2Q2AA 3TAJA 5L9MA 1P1OA 1MXYA 1RYOA 2BJJX 1S7YA 3K2DA 3KG2A 2I0BA 4YB6A 3IR1A 4X48A 1B6HA 2B3BA 3PUWE 4KI0E 2QS2A 1B2HA 3ILTB 3TTLA 3ZS6A 5HPQA 1BKAA 3PUVE 4FEBA 3C9HA 4FECA 1AL3A 1JVXA 3HN0A 4K3FA 3EHSA 3H7MA 3ZSFA 2QL3A 1LCTA 2HQ0A 5H8FB 1PC3A 3MVWA 2ZNUA 1N3XA 3C31A 3VVFA 1N7WA 5AA4B 1N04A 4NWDA 4LZ8A 1D9YA 1OQHA 4RPOA 2DE3A 3H3GA 3PV0E 3V83A 1QULA 4RJZA 3LC8A 2Q9TA 1A55A 2Z8DA 5DYHA 1MY4A 1FQDA 1NFTA 1SW1A 1XS5A 3DLNA 5I59B 4IY5A 2THIA 4OHNA 3EHTA 1ZLQA 4P0GA 4BDLA 5AA3A 3TFLA 5I2NA 4NF5B 3FZVA 1EZ9A 3IO4A 2DVZA 3UIFA 4PFTA 4YKKA 4H8IA 3E9XA 3TYHA 3MW0A 4GXSB 1O63A 2F8DA 1LAGE 2I48A 3E4RA 4DZ1A 4OTEA 2XXQA 4XKNA 4H5FA 4ZZAA 4GXAA 3B7DA 3K1MA 1Y3QA 1A54A 2ONRA 2A5TB 5HBCA 4BDQA 4ESXA 1B1XA 1B4HA 4NF6B 4QFLA 5I57B 5F1QA 3A3UA 4G8HA 1IEJA 3MVZA 3O28A 2R9JA 4PP0A 4ZEKA 2VD2A 3MP6A 4KPTA 5CMMA 3RUMA 4F3BA 1VFDA 3KOTA 3FJMA 3N5LA 4JBZA 5H8QB 4ZZEA 5KCJA 4F3PA 3SEWA 5EHSA 4LVQA 3N6UA 4H6DA 4FJPA 4ELQA 3PD8A 5TPAA 4GD5A 3G7WA 5KDTB 3PMVA 1MY0A 2UVHA 4XKQA 4BDMA 2F97A 2ZXTA 1LB9A 1IXGA 1POY1 2HXWA 2XXPA 3E3KA 3TELA 3Q27A 3FVOA 3N94A 4MLQA 4PFYA 3T66A 3VDFA 3FVNA 4QFPA 4G68B 1URSA 4DXBA 4BLAA 2F35A 2XXRA 3PMXA 3B6TA 3OENA 4R9FA 1NNTA 2I6EA 2QMXA 1SVXB 3K01A 3PPRA 3QUFA 4GLIA 1TT1A 4I1DA 5KDTA 1MM6A 3HV1A 3RPWA 1P1WA 4N13A 3D4GA 1CE2A 1O64A 3D4CA 1ZBMA 1B46A 4E0WA 1OMPA 3TDJA 4KCDA 3RY3A 1LFHA 2DWHA 4OMBA 3CFZA 1MQIA 5ELVA 5I2KB 4IO4A 3LUYA 2H99A 1B3EA 2RC8A 3G3GA 3IOTA 3R6UA 4KQPA 1QKBA 3FXRA 1URDA 3B6QA 1D9VA 3DP8A 4NF8B 4ZE8A 5JK4A 5DT6A 1WODA 4ELOA 3VXBA 4TLLB 1AOVA 3S9MC 3BFTA 4X1BA 1FW0A 5H8SA 5L9OA 2A5SA 3IL1B 3H06B 1QUJA 3KN7A 2CZLA 1OIBA 1MXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MJN A;  4QRZ A;  2V25 A;  3C36 A;  1N76 A;  3MC2 A;  2AYS A;  3LSF B;  3CSB A;  5FTH A;  5H8H B;  1Y9U A;  3FVK A;  3FVG A;  4ELR A;  2QS4 A;  2ZYM A;  4GIZ A;  1B40 A;  2VGQ A;  1FTJ A;  2XHD A;  1SI1 A;  4U1Z A;  1B7Z A;  3W15 C;  3S9E A;  2PX1 A;  2F7B A;  3VVD A;  4U4S A;  1Z7N E;  4G77 A;  1JW1 A;  2DXY A;  1B7U A;  2REG A;  1PDA A;  1YPN A;  4G68 A;  2PVU A;  3HO7 A;  4HS7 A;  4GVO A;  1ZJL A;  1CB6 A;  1M5B A;  3M3K A;  3MVX A;  5DEX A;  3TMG A;  5CBR A;  2UVG A;  3O66 A;  1AIV A;  1D3K A;  3PPO A;  3VXC A;  1ZIU A;  4G2Z A;  3K1N A;  5H8N A;  2O6A A;  2XX7 A;  3FUZ A;  4THI A;  3BKI B;  1H44 A;  4QFO A;  1Z7M E;  2D21 A;  3Q29 A;  3K0V A;  5M2V A;  4N6P A;  5CBS A;  2I3V A;  3OEM A;  1IXC A;  2NVU B;  4RA1 A;  1MDP 1;  1MY1 A;  4ZEI A;  4F29 A;  3IB2 A;  4QFN A;  3JZJ A;  4IY6 A;  1B05 A;  1MRP A;  5AA2 B;  4GFR A;  1SBP A;  4U21 A;  2Z23 A;  3K6W A;  1VSO A;  1P1U A;  3IOR A;  1EZO A;  1Q1K A;  2F36 A;  4U4X A;  3SEY A;  1FTO A;  4AQ4 A;  4FOR A;  5FHM A;  2A5T A;  3GZG A;  2PMS A;  4EQ9 A;  3MZ9 A;  5L9S A;  4R9G A;  1MY2 A;  4OYV A;  2F78 A;  1QVS A;  2VOZ A;  2I4C A;  4I9D A;  4Q0C A;  1B52 A;  3KJ7 A;  4IO5 A;  2V3T A;  5DVI A;  2OJT A;  5CRY A;  1GR2 A;  2XX9 A;  1YCJ A;  1B1H A;  3A09 A;  3GBA A;  3TPA A;  3TTK A;  1MXX A;  2D5W A;  2DXR A;  1I6B A;  1DTZ A;  4LON B;  3JV9 A;  4BDN A;  2DQV A;  1JW4 A;  3RLF E;  4LZ5 A;  2KLF A;  4F19 A;  3VLU A;  1ZTY A;  3O29 A;  4NF4 A;  3IX1 A;  4YB5 A;  5TP9 A;  1Y3N A;  1J1N A;  1MS7 A;  1PBP A;  2GHB A;  5ITP A;  4F22 A;  3W9V A;  5KZT A;  1FQC A;  1A40 A;  1NNF A;  1Y1Z A;  3IOV A;  4H65 A;  4PET A;  3PPP A;  4DCX A;  2ABH A;  2XXY A;  4JWO A;  3S9N C;  1BLF A;  4HTG A;  3EPE A;  3V5A A;  4O3A A;  3DP6 A;  3MAM A;  1N0T A;  1MQH A;  4NE4 A;  1B0H A;  2X26 A;  1LST A;  3FIR A;  3FXU A;  3RNN A;  1LFG A;  4YMA A;  2F6G A;  2PBW A;  2DE4 A;  3A3C A;  1I6A A;  3K6V A;  2IA4 A;  3T9U A;  2B3F A;  2DWI A;  2OWS A;  4R6Y A;  1ZU0 A;  4TLM B;  4FAT A;  4DCY A;  1SD3 A;  1LLS A;  3CVG A;  3E13 X;  1EU8 A;  5FHN A;  1GVC A;  1P99 A;  5H8N B;  4QSC A;  2Y7R A;  1DMB A;  2I49 A;  1B32 A;  1JVY A;  1TWY A;  4QF9 A;  4Z0I A;  1OVB A;  1TFA A;  2OWT A;  4JWY A;  4GF8 A;  4PFW A;  2FYI A;  4IO6 A;  4X1D A;  1R9L A;  4ND9 A;  4IO7 A;  2RIN A;  1N84 A;  3VE1 B;  4I8C A;  5I84 A;  2O1L A;  5DEX B;  3QSL A;  1B4Z A;  3U72 A;  3CI8 A;  1UIV A;  1O7T A;  5I56 B;  4ONY A;  1PB8 A;  4DE8 A;  4EF1 A;  1AMF A;  2H25 A;  1WVJ A;  2QS3 A;  4ELP A;  2RCB A;  2O7I A;  3H6U A;  3VVE A;  4R2B A;  1AH5 A;  3KFM A;  1Y4C A;  1JEU A;  3OEK A;  3MZB A;  3ZKL A;  1QUI A;  2WKY A;  3K1P A;  5JTY B;  4QHQ A;  3LBS A;  3M3L A;  3WAE A;  5LOM A;  1PB7 A;  4Q8R A;  3OEL A;  4XXU A;  3G3K A;  3K6X A;  2Q8J A;  2DWJ A;  1M5F A;  2HCA A;  4H5G A;  2XD3 A;  2HZK A;  3U92 A;  5DVJ A;  4U1O A;  1II5 A;  3EQ1 A;  4MH5 A;  3UK4 A;  4ZE9 A;  2Q89 A;  3T22 A;  1FQB A;  2GRV A;  2ZNT A;  3QAX A;  3RTF B;  5I2N B;  1PBQ A;  1M5E A;  2P2A A;  3FD3 A;  5AA1 A;  2H9B A;  1B58 A;  3L6G A;  1S50 A;  1S9T A;  3TCH A;  3UA8 A;  2NXO A;  3MQ9 A;  5ICQ A;  5CMC A;  4EXL A;  1IXH A;  1ATG A;  4I62 A;  1SI0 A;  3TZA A;  5I59 A;  1UIU A;  4ZDM A;  3H6W A;  1VFE A;  4OXV A;  5FTI A;  1GGG A;  2I58 A;  3FAT A;  1A7L A;  1DPE A;  4OEU A;  3T9H B;  3CR9 A;  3PUY E;  3LSW A;  1BP5 A;  4H1X A;  1MXZ A;  2RKM A;  4YMB A;  2OBG A;  2R71 A;  4JSD A;  1MH3 A;  3KSX A;  1FTM A;  1Y20 A;  2HZL A;  4QSE A;  3TQL A;  4Q5T A;  4ISU A;  1YAE A;  4R74 A;  4ESW A;  4YU0 A;  2R6G E;  2HAV A;  1VR5 A;  3CFX A;  2I4B A;  3DP4 A;  3OO8 A;  1MG1 A;  3MBP A;  1R6Z A;  4KHZ E;  2F7A A;  4EXK A;  3MWB A;  1N7X A;  5EYF A;  5I57 A;  1LB8 A;  2FNC A;  4EUO A;  4RY1 A;  4H67 A;  2GFE A;  4U22 A;  3RT6 B;  2NUV A;  1EH3 A;  3BFU A;  3IOW A;  1B3H A;  3R7X A;  2HAU A;  5I58 B;  1USY E;  1XT8 A;  3T96 B;  2D3I A;  4HW8 A;  2PT1 A;  2QJE A;  4NWC A;  4G4P A;  1UTH A;  5TU0 A;  2XXU A;  4RK9 A;  2X7P A;  3JYR A;  4NF5 A;  4F31 B;  1R1N A;  5HM4 B;  4KYE A;  5JEI A;  1US5 A;  3S4U A;  4NF4 B;  3Q26 A;  4GRK A;  3O6H A;  4C1U A;  5B70 A;  3OMB A;  4LQ5 A;  2Z22 A;  4GOT A;  2I0C A;  4R75 A;  4WEP A;  2V84 A;  5CI5 A;  4DLD A;  2VD3 A;  1MPC A;  4AB6 A;  4F2O A;  4R72 A;  3UOR A;  3U93 A;  4JXI A;  3PD9 A;  1LAF E;  3IJO B;  3PPN A;  3GXA A;  5CMB A;  1H3D A;  5DTB A;  3KOS A;  1XVX A;  2AL5 A;  4ZEB A;  4F3G A;  2Y7W A;  4IB2 A;  1B5H A;  4RYA A;  1T0K A;  4RK2 A;  4DIG A;  1B51 A;  2Y7I A;  5B7D A;  5I2K A;  1MH4 A;  3HPI A;  3V8X B;  2UYF A;  3BBR A;  3HST A;  2DYX A;  3DEL B;  3ONM A;  3MP8 A;  4L17 A;  1OVT A;  2OCU A;  2XXX A;  5F7V A;  2XXI A;  4M1V A;  4YZZ A;  2UVI A;  4G8N A;  4OET A;  1M5D A;  3UP9 A;  1PEB A;  1SW4 A;  2NOO A;  2V3U A;  1JEV A;  3C32 A;  3PUX E;  4P11 A;  1NNK A;  2F7C A;  4OER A;  1HSL A;  4ZS9 A;  5K2X A;  3V89 B;  4YIC A;  1VE4 A;  2OK2 A;  1KWH A;  3FJG A;  1PB9 A;  3T9V A;  3K4U A;  3MPK A;  4FED A;  2UYE A;  3IO6 A;  3KJT A;  3EHU A;  3U1O A;  1MQG A;  3KZG A;  4WXJ A;  5K2Y A;  5ISU A;  5BWJ A;  1URG A;  2F5X A;  1NL5 A;  3T93 B;  1F9B A;  3CFL A;  3Q25 A;  2PYY A;  1MPB A;  5FHO A;  2LAO A;  3QYT A;  3TTM A;  2UXA A;  1A99 A;  1H45 A;  2E1S A;  3IB1 A;  3RT8 A;  4C1T A;  2GHA A;  1LBB A;  5AA4 A;  4XIG Q;  2NWJ A;  1TFD A;  1JW5 A;  2I3W A;  3PUZ E;  1XC1 A;  3QUJ A;  4JWX A;  4R2F A;  3ECR A;  5TP9 B;  1QW0 A;  2CMO A;  2GH9 A;  1POT A;  3K00 A;  1MPD A;  3CRB A;  3RGY A;  1B5J A;  1LCF A;  2O7U A;  2XD2 A;  3IJX B;  3VLV A;  5A5X A;  2IEE A;  1MXW A;  4RNS A;  2G93 A;  4F18 A;  3FJ7 A;  4IGR A;  1SYI A;  3SEX A;  3OO9 A;  3QXM A;  2DVC A;  2UVJ A;  3KGC A;  5ITO A;  2DP8 A;  4G68 C;  4MFI A;  4U23 A;  3GLB A;  3TEP A;  4NTL A;  1NMU A;  5IKB A;  1MY3 A;  1JNF A;  2ESN A;  3Q28 A;  3OSR A;  4KD5 A;  3MUQ A;  1XOC A;  1IIT A;  3LR1 A;  1B3F A;  3G3H A;  4PQJ A;  4EF2 A;  1EZP A;  4YB7 A;  1B5I A;  3F11 A;  4F1V A;  5IAI A;  2ANJ A;  2RF1 A;  3USD A;  2H98 A;  3K02 A;  4HCY A;  3VLW A;  4ECF A;  4POX A;  1IUD A;  4LA9 A;  3MVY A;  4XKR A;  4DDD A;  4JB7 A;  2O68 A;  1FTK A;  1WDN A;  1NKX A;  1XVY A;  2Y84 A;  3O9P A;  3RTW B;  4EQ7 A;  3H4Z A;  1IIW A;  3UN6 A;  3O97 A;  2O84 X;  3PPQ A;  3KEI A;  2PT2 A;  2QS1 A;  3OSQ A;  4RXL A;  2XX8 A;  4X9T A;  4YKJ A;  5TPA B;  1GV8 A;  3SEV A;  3RQT A;  3OXN A;  2AL4 A;  3U8Q A;  2DS9 A;  3H6V A;  2E0S A;  3LSX A;  2Z8F A;  1LAX A;  2ONS A;  1QUK A;  3I5O A;  3S9L C;  1LBC A;  1YTV A;  2V3Q A;  1IQ7 A;  3QIM A;  2XXW A;  1D4N A;  1M5C A;  4NED A;  1FQA A;  2YJP A;  3VFJ A;  4F2Q A;  1FQF A;  3C34 A;  3MP1 A;  3M8U A;  2P1S A;  5CC2 A;  1ZKB A;  1USY H;  2V93 A;  1XHY A;  4JDF A;  3THI A;  2ZYK A;  3TOD A;  4DXU A;  1TXF A;  3G3F A;  1MDQ A;  1UTH B;  3N6T A;  3I3V A;  4OZ9 A;  4RPN A;  3TKD A;  3TQW A;  3GBB A;  1H43 A;  2O51 A;  1I6Q A;  2REJ A;  1MXV A;  3C33 A;  3FAS A;  3IK6 B;  4LQ2 A;  3SDF A;  4C0R A;  3OO6 A;  1NNP A;  1SQY A;  4TOZ A;  1I69 A;  4H8J A;  4OFO A;  2DWA A;  4MLV A;  4POW A;  2X7Q A;  4OEV A;  5KCJ B;  1SYH A;  4O3B A;  2P0S A;  4XTC Q;  3UGW A;  2QSX A;  2AIX A;  4EQB A;  1Y1M A;  4R73 A;  2ALU A;  3TTN A;  1IXI A;  4ZED A;  1FQE A;  1LGB C;  1Y3P A;  4O3C A;  1OLA A;  4Q30 B;  1SDX A;  2OZZ A;  1QKA A;  5BUU A;  4ZEC A;  3KN3 A;  5CM6 A;  1LAH E;  1MQJ A;  4LP2 B;  5I56 A;  3S2V A;  4WKM A;  4OFL A;  2O1M A;  4M4G A;  4YKP A;  3T9X B;  3U94 A;  1SW2 A;  3PGF A;  4KR5 A;  2QMW A;  3C4M A;  1FTL A;  1US4 A;  3G3I A;  2H5Y A;  3MZ1 A;  3SEU A;  3ZKK A;  2XXV A;  1DPP A;  2ZMB A;  3I6V A;  3DM0 A;  2VHA A;  3H03 A;  1JET A;  2YLN A;  2Z8E A;  1MQD A;  2O69 A;  4P0I A;  3HHG A;  4KCC A;  4PFU A;  3FGS A;  3IAZ A;  1B7H A;  4EDP A;  1OQG A;  1ANF A;  3O6I A;  2G29 A;  1BTJ A;  1ZMG A;  4GWO A;  4H0W A;  1NH7 A;  3AXF A;  4IO3 A;  5H8H A;  4AB5 A;  3FV2 A;  4KYD A;  1RKM A;  1B3G A;  2DSF A;  5AA2 D;  5L8D A;  3HHF A;  3IB0 A;  1RYX A;  3CIJ A;  4NMY A;  2RC9 A;  3ILU B;  4NF8 A;  2Q88 A;  3P7I A;  3VV5 A;  4GQO A;  1IZ1 A;  1OLC A;  2YPN A;  5H8F A;  4TQU Q;  3CG3 A;  2QRY A;  2DE2 A;  3TCG A;  4OEN A;  1QJM A;  4U2R A;  1UTB A;  1NH8 A;  4IGT A;  4YAH X;  4OFJ A;  3EF7 A;  3N26 A;  4OVJ A;  5AE4 A;  3TTR A;  2HFB A;  1MM7 A;  2DOJ A;  1HSE A;  3CSG A;  1B0L A;  1FCK A;  4GL0 A;  3R26 A;  4LUB A;  3SKP A;  4ZEF A;  2ZYN A;  3PMW A;  1DTG A;  4FE8 A;  2XXT A;  4UAC A;  3HCQ A;  4YKI A;  1A8F A;  3TUS A;  2Y7K A;  1H76 A;  3H6T A;  1A8E A;  4QSD A;  2Q2C A;  1BIY A;  4F39 A;  4LAT A;  4OQO A;  4R6H A;  3KBR A;  5EHM A;  3L6H A;  4F3S A;  1B3L A;  4FIM A;  3SES A;  3FXQ A;  1ELJ A;  3SER A;  4F1Y A;  1UTB B;  4MBP A;  5DVF A;  1GTK A;  4GL8 A;  3QK6 A;  2F34 A;  3IOU A;  2H4I A;  3C35 A;  5ICT A;  5A5X B;  2M8C A;  4JSO A;  4UA8 A;  2RCA A;  3OO7 A;  3ODB A;  3PU5 A;  4R6K A;  3MPL A;  3EN3 A;  1Y4T A;  4WED A;  4OES A;  1L5T A;  1HSJ A;  5H8Q A;  1SW5 A;  1UQW A;  4KYS A;  3SET A;  4BDR A;  5JTY A;  2VP1 A;  1P1Q A;  4F1U A;  3OOA A;  1N3W A;  5AA2 A;  2XXH A;  3WAF A;  2FA7 A;  1Q35 A;  3O2A A;  4XKP A;  5CMK A;  1B9J A;  3TCF A;  4LZ7 A;  3FV1 A;  4IO2 A;  4N07 A;  4FAJ A;  4PE5 B;  3KSJ A;  2ZYO A;  4OWD A;  5J1D A;  3RN8 A;  1DSN A;  2W7Y A;  4NF6 A;  3LSL A;  1R9Q A;  2QPQ A;  1P1N A;  2ZNS A;  4HCW A;  3OD7 A;  4DXC A;  4MF3 A;  5I58 A;  4Z7E A;  3W9W A;  1LFI A;  3B6W A;  2Y7P A;  2F6P A;  2HEU A;  2ONK E;  2RC7 A;  3G3J A;  3M3F A;  3K6U A;  3KN8 A;  3O6G A;  4G8M A;  1DOT A;  4KFQ A;  4QFK A;  4BDO A;  4E0X A;  1JQF A;  2OLB A;  2B65 A;  3CG1 A;  2Q2A A;  3TAJ A;  5L9M A;  1P1O A;  1MXY A;  1RYO A;  2BJJ X;  1S7Y A;  3K2D A;  3KG2 A;  2I0B A;  4YB6 A;  3IR1 A;  4X48 A;  1B6H A;  2B3B A;  3PUW E;  4KI0 E;  2QS2 A;  1B2H A;  3ILT B;  3TTL A;  3ZS6 A;  5HPQ A;  1BKA A;  3PUV E;  4FEB A;  3C9H A;  4FEC A;  1AL3 A;  1JVX A;  3HN0 A;  4K3F A;  3EHS A;  3H7M A;  3ZSF A;  2QL3 A;  1LCT A;  2HQ0 A;  5H8F B;  1PC3 A;  3MVW A;  2ZNU A;  1N3X A;  3C31 A;  3VVF A;  1N7W A;  5AA4 B;  1N04 A;  4NWD A;  4LZ8 A;  1D9Y A;  1OQH A;  4RPO A;  2DE3 A;  3H3G A;  3PV0 E;  3V83 A;  1QUL A;  4RJZ A;  3LC8 A;  2Q9T A;  1A55 A;  2Z8D A;  5DYH A;  1MY4 A;  1FQD A;  1NFT A;  1SW1 A;  1XS5 A;  3DLN A;  5I59 B;  4IY5 A;  2THI A;  4OHN A;  3EHT A;  1ZLQ A;  4P0G A;  4BDL A;  5AA3 A;  3TFL A;  5I2N A;  4NF5 B;  3FZV A;  1EZ9 A;  3IO4 A;  2DVZ A;  3UIF A;  4PFT A;  4YKK A;  4H8I A;  3E9X A;  3TYH A;  3MW0 A;  4GXS B;  1O63 A;  2F8D A;  1LAG E;  2I48 A;  3E4R A;  4DZ1 A;  4OTE A;  2XXQ A;  4XKN A;  4H5F A;  4ZZA A;  4GXA A;  3B7D A;  3K1M A;  1Y3Q A;  1A54 A;  2ONR A;  2A5T B;  5HBC A;  4BDQ A;  4ESX A;  1B1X A;  1B4H A;  4NF6 B;  4QFL A;  5I57 B;  5F1Q A;  3A3U A;  4G8H A;  1IEJ A;  3MVZ A;  3O28 A;  2R9J A;  4PP0 A;  4ZEK A;  2VD2 A;  3MP6 A;  4KPT A;  5CMM A;  3RUM A;  4F3B A;  1VFD A;  3KOT A;  3FJM A;  3N5L A;  4JBZ A;  5H8Q B;  4ZZE A;  5KCJ A;  4F3P A;  3SEW A;  5EHS A;  4LVQ A;  3N6U A;  4H6D A;  4FJP A;  4ELQ A;  3PD8 A;  5TPA A;  4GD5 A;  3G7W A;  5KDT B;  3PMV A;  1MY0 A;  2UVH A;  4XKQ A;  4BDM A;  2F97 A;  2ZXT A;  1LB9 A;  1IXG A;  1POY 1;  2HXW A;  2XXP A;  3E3K A;  3TEL A;  3Q27 A;  3FVO A;  3N94 A;  4MLQ A;  4PFY A;  3T66 A;  3VDF A;  3FVN A;  4QFP A;  4G68 B;  1URS A;  4DXB A;  4BLA A;  2F35 A;  2XXR A;  3PMX A;  3B6T A;  3OEN A;  4R9F A;  1NNT A;  2I6E A;  2QMX A;  1SVX B;  3K01 A;  3PPR A;  3QUF A;  4GLI A;  1TT1 A;  4I1D A;  5KDT A;  1MM6 A;  3HV1 A;  3RPW A;  1P1W A;  4N13 A;  3D4G A;  1CE2 A;  1O64 A;  3D4C A;  1ZBM A;  1B46 A;  4E0W A;  1OMP A;  3TDJ A;  4KCD A;  3RY3 A;  1LFH A;  2DWH A;  4OMB A;  3CFZ A;  1MQI A;  5ELV A;  5I2K B;  4IO4 A;  3LUY A;  2H99 A;  1B3E A;  2RC8 A;  3G3G A;  3IOT A;  3R6U A;  4KQP A;  1QKB A;  3FXR A;  1URD A;  3B6Q A;  1D9V A;  3DP8 A;  4NF8 B;  4ZE8 A;  5JK4 A;  5DT6 A;  1WOD A;  4ELO A;  3VXB A;  4TLL B;  1AOV A;  3S9M C;  3BFT A;  4X1B A;  1FW0 A;  5H8S A;  5L9O A;  2A5S A;  3IL1 B;  3H06 B;  1QUJ A;  3KN7 A;  2CZL A;  1OIB A;  1MXU A; 
#chains in the Genus database with same CATH topology
 4QRZ A;  2V25 A;  3MC2 A;  2AYS A;  4PAK A;  3LSF B;  1Y9U A;  2XA5 A;  3FVK A;  2QS4 A;  3S9E A;  2F7B A;  1Z7N E;  4G77 A;  1JW1 A;  4HS7 A;  4F1U A;  1M5B A;  2UVG A;  3O66 A;  3VXC A;  4I40 A;  5AA4 B;  2XX7 A;  4THI A;  3BKI B;  3K0V A;  1MY1 A;  2PFY A;  4JVI A;  3JZJ A;  5AA2 B;  5EQ8 A;  3IOR A;  4U4X A;  4PF6 A;  4KXP A;  2VOZ A;  2I4C A;  4Q0C A;  2OJT A;  4GX6 A;  3A09 A;  3TTK A;  2DXR A;  1I6B A;  1DTZ A;  4BDN A;  4LZ5 A;  1QUJ A;  5TP9 A;  4MIJ A;  4F22 A;  3W9V A;  4PFB A;  1FQC A;  1A40 A;  3IOV A;  4H65 A;  4PET A;  4DCX A;  4JWO A;  3S9N C;  3MAM A;  1LFG A;  4PDH A;  2DE4 A;  1I6A A;  4DI3 D;  3K6V A;  2IA4 A;  3T9U A;  2DWI A;  4FAT A;  1LLS A;  3E13 X;  1EU8 A;  1DMB A;  1JVY A;  1TWY A;  4JWY A;  4GF8 A;  1FBC A;  4N15 A;  4IO6 A;  1N84 A;  3VE1 B;  1O7T A;  2QS3 A;  3VVE A;  3KFM A;  1QUI A;  2CZI A;  3OEL A;  1M5F A;  4U1O A;  4MH5 A;  3T22 A;  4LN5 A;  3RTF B;  5AA1 A;  3FD3 A;  2H9B A;  3B8B A;  3UA8 A;  5ICQ A;  1FRP A;  2ZZW A;  1IXH A;  1ATG A;  4MAG A;  4ZDM A;  3H6W A;  5FTI A;  2R8T A;  1MXZ A;  4FBP A;  4JSD A;  1FTM A;  4QSE A;  2QVR A;  4ISU A;  4R74 A;  4ESW A;  2HAV A;  3MWB A;  4NF0 A;  4RY1 A;  2GFE A;  4U22 A;  2HAU A;  1USY E;  3T96 B;  1FPF A;  2PT1 A;  5HM4 B;  2DDK A;  4KYE A;  3Q26 A;  4GRK A;  3O6H A;  2XWK A;  4LQ5 A;  5IZ3 A;  5CI5 A;  4P47 A;  4F2O A;  4R72 A;  3PD9 A;  1FJ9 A;  3IJO B;  3PPN A;  5CMB A;  3KOS A;  2AL5 A;  1B5H A;  4DIG A;  5I2K A;  3V8X B;  2UYF A;  2DYX A;  3DEL B;  4L17 A;  5F7V A;  4OET A;  1M5D A;  4XF5 A;  3UP9 A;  1SW4 A;  1PEB A;  4P11 A;  3PUX E;  5K2X A;  1HSL A;  1FSA A;  1KWH A;  1FBD A;  4FED A;  3U1O A;  1MQG A;  1A99 A;  4XFE A;  3PUZ E;  4JWX A;  3S9L C;  1XC1 A;  3K00 A;  5A5X A;  1MXW A;  4F18 A;  1FPL A;  3QXM A;  5ITO A;  4G68 C;  1MY3 A;  3Q28 A;  3F11 A;  4F1V A;  2WBD A;  2ANJ A;  4GX4 A;  4ECF A;  4POX A;  1NKX A;  2Y84 A;  3H4Z A;  1IIW A;  3UN6 A;  3KEI A;  3OSQ A;  4RXL A;  3U8Q A;  4NHB A;  2DS9 A;  2Z8F A;  2ONS A;  2V3Q A;  3QIM A;  1IQ7 A;  2XXW A;  3C34 A;  2P1S A;  1ZKB A;  1TXF A;  2P3V A;  3I3V A;  3TQW A;  4OVS A;  3FAS A;  3C33 A;  4C0R A;  1I69 A;  3MYU A;  2X7Q A;  2P0S A;  4EQB A;  4R73 A;  1FQE A;  1LGB C;  1QKA A;  4ZEC A;  4YKP A;  1SW2 A;  3PGF A;  4KR5 A;  2QMW A;  1US4 A;  2XXV A;  1DPP A;  4O7M A;  2VHA A;  3HHG A;  4HXV A;  4IR8 A;  4PFU A;  4NN3 A;  3IAZ A;  4OVR A;  1ANF A;  3O6I A;  2G29 A;  4GWO A;  2GQ1 A;  4KYD A;  4NMY A;  1NV7 A;  1NV1 A;  3P7I A;  4GQO A;  1IZ1 A;  5H8F A;  3CG3 A;  2XXK A;  3TCG A;  4YAH X;  5AE4 A;  3TTR A;  1MM7 A;  2DOJ A;  1HSE A;  3SKP A;  2ZYN A;  4LAT A;  4P56 A;  3L6H A;  4OA4 A;  3SES A;  1UTB B;  4GL8 A;  3C35 A;  4BDR A;  1SW5 A;  3SET A;  4KYS A;  1N3W A;  2XXH A;  1B9J A;  3TCF A;  4LZ7 A;  4IO2 A;  4N07 A;  4PE5 B;  2HPG A;  3RN8 A;  4NF6 A;  1R9Q A;  2ZNS A;  4HCW A;  3W9W A;  3B6W A;  4Q30 B;  1NUZ A;  2RC7 A;  4BDO A;  1EYI A;  1DOT A;  2OLB A;  3CHG A;  3IR1 A;  2QS2 A;  1B2H A;  3ZS6 A;  5HPQ A;  3PUV E;  1JVX A;  3HN0 A;  5ET7 A;  2PFZ A;  3MVW A;  1FBP A;  1N04 A;  4LZ8 A;  1D9Y A;  4RPO A;  2L5V A;  2DE3 A;  3PV0 E;  2Q9T A;  5A5L A;  1MY4 A;  3DLN A;  2THI A;  4P0G A;  4BDL A;  5AA3 A;  3FZV A;  4GXS B;  2F8D A;  4XKN A;  4OVQ A;  4ESX A;  1B4H A;  5LTC A;  3A3U A;  1IEJ A;  1IMD A;  2VD2 A;  1VFD A;  4JBZ A;  5H8Q B;  4F3P A;  5EHS A;  3PMV A;  2F97 A;  3E3K A;  4MLQ A;  3VDF A;  3FVN A;  4DXB A;  1URS A;  4BLA A;  3PMX A;  3OEN A;  4GLI A;  1IME A;  1NNT A;  2I6E A;  2QMX A;  1LBZ A;  4I1D A;  1TT1 A;  1ZBM A;  2OX3 A;  2DWH A;  2V4C A;  2H99 A;  1LBV A;  1QKB A;  4ZE8 A;  4NF8 B;  5JK4 A;  5DT6 A;  3S9M C;  4ELO A;  4PTK A;  2HHM A;  5L9O A;  3IL1 B;  3I6V A;  3KN7 A;  3MJN A;  4NG7 A;  3CSB A;  4GIZ A;  1FTJ A;  1DCU A;  2QVU A;  4N8Y A;  4N6K A;  4N81 A;  2DXY A;  1GVC A;  2REG A;  5IGA A;  3HO7 A;  1ZJL A;  5CBR A;  3PPO A;  4GBV A;  1FPG A;  4G2Z A;  3FUZ A;  3UOR A;  2XWV A;  4QFO A;  5M2V A;  1NUY A;  3OEM A;  4AS5 A;  1NV0 A;  4RA1 A;  4I3Y A;  1B05 A;  1MRP A;  4GFR A;  4U21 A;  2Z23 A;  1VSO A;  4DI4 B;  1EZO A;  3SEY A;  4FOR A;  2A5T A;  3GZG A;  4OYV A;  2F78 A;  1QVS A;  3GYY A;  2WEF A;  4IO5 A;  2XX9 A;  3TPA A;  3GBA A;  3JV9 A;  4PBH A;  4QBA A;  2KLF A;  3O29 A;  4NF4 A;  5ET6 A;  1J1N A;  5ITP A;  4HTG A;  3EPE A;  1MQH A;  4NE4 A;  3BIG A;  2X26 A;  3KC1 A;  3A3C A;  2WBB A;  4R6Y A;  1ZU0 A;  4TLM B;  4DCY A;  1SD3 A;  3CVG A;  5H8N B;  2Y7R A;  4Z0I A;  4QF9 A;  1TFA A;  2OWT A;  1R9L A;  4IO7 A;  4I8C A;  2O1L A;  5DEX B;  3QSL A;  3CI8 A;  5I56 B;  4ELP A;  1AH5 A;  3MZB A;  3ZKL A;  2WKY A;  3K1P A;  5JTY B;  4QHQ A;  3LBS A;  3M3L A;  1KA1 A;  4N4U A;  2HCA A;  4H5G A;  5DVJ A;  4ZE9 A;  1FQB A;  4PE3 A;  2GRV A;  2ZNT A;  2P2A A;  1S9T A;  3TCH A;  3MQ9 A;  4EXL A;  1UIU A;  3FAT A;  4OEU A;  3LSW A;  2CEY A;  2OBG A;  2R71 A;  4MCO A;  3NOH A;  1MH3 A;  2HZL A;  1Y20 A;  3TQL A;  1CNQ A;  2R6G E;  1VR5 A;  3CFX A;  3DP4 A;  2F7A A;  1N7X A;  3BFU A;  1XT8 A;  2D3I A;  2F3B A;  4F31 B;  3JYR A;  4NF5 A;  4MMP A;  3S4U A;  5B70 A;  4R75 A;  1BK4 A;  1MPC A;  2XWO A;  1NV5 A;  5DTB A;  1XVX A;  4F3G A;  3RPL A;  2Q8M A;  4RK2 A;  2FBP A;  3BBR A;  3HST A;  3ONM A;  3MP8 A;  2OCU A;  3FXB A;  4NX1 A;  5EQ9 A;  2XXX A;  4M1V A;  2UVI A;  1NNK A;  4OER A;  4YIC A;  1VE4 A;  2UYE A;  3KZG A;  5K2Y A;  5ISU A;  3Q25 A;  5FHO A;  2LAO A;  2E1S A;  1H45 A;  3RT8 A;  1DBZ A;  4XIG Q;  1TFD A;  1JP4 A;  4R2F A;  2GH9 A;  4OVT A;  3IJX B;  2IEE A;  4IGR A;  1SYI A;  3T0J A;  3OO9 A;  2UVJ A;  3KGC A;  4MFI A;  4NTL A;  1NMU A;  4MJO A;  5IKB A;  3MUQ A;  1XOC A;  4EF2 A;  4PF8 A;  1EYK A;  4X8R A;  2JJK A;  3VLW A;  1IUD A;  4DDD A;  5IZ3 B;  4JB7 A;  2O68 A;  1XVY A;  3RTW B;  4JVD A;  3O97 A;  4X9T A;  5TPA B;  3RQT A;  1LAX A;  3MP1 A;  3M8U A;  5CC2 A;  4DXU A;  1H43 A;  3IK6 B;  4TOZ A;  4MNC A;  2FHY A;  1SYH A;  3UGW A;  2AIX A;  1Y1M A;  1SDX A;  5ET8 A;  2OZZ A;  4GBW A;  3KN3 A;  5CM6 A;  4LP2 B;  5I56 A;  4WKM A;  4M4G A;  1FTL A;  3ZKK A;  2ZMB A;  1FJ6 A;  4UAB A;  4P0I A;  4GWW A;  1FPJ A;  1OQG A;  1BTJ A;  1ZMG A;  4AB5 A;  1NH7 A;  3AXF A;  5IZ1 A;  1NUX A;  5AA2 D;  1FPE A;  3IB0 A;  4P8B A;  4GWY A;  4NF8 A;  1OLC A;  2QRY A;  2DE2 A;  4GL0 A;  5EQ7 A;  3R26 A;  2FIE A;  4ZEF A;  3PMW A;  1DTG A;  4FE8 A;  2XXT A;  4UAC A;  2Q2C A;  4OQO A;  5EHM A;  5J16 A;  3KBR A;  4F3S A;  1QGX A;  4FIM A;  3FXQ A;  1ELJ A;  4G61 A;  1GTK A;  2F34 A;  3EKI A;  2H4I A;  3PU5 A;  3MPL A;  3EN3 A;  5H8Q A;  2VP1 A;  3OOA A;  5EYG A;  3KSJ A;  2ZYO A;  1DSN A;  2QPQ A;  1FBH A;  2P3N A;  5I58 A;  1LFI A;  3M3F A;  2VT5 A;  3K6U A;  3O6G A;  1P1O A;  1S7Y A;  4X48 A;  3PUW E;  3ILT B;  1BKA A;  4FEB A;  4JVC A;  2QL3 A;  5H8F B;  1N3X A;  3VVF A;  1N7W A;  3H3G A;  1QUL A;  1A55 A;  5DYH A;  1SW1 A;  1XS5 A;  3EHT A;  5I2N A;  3TFL A;  1RDX A;  4PFT A;  4H8I A;  4H5F A;  4GXA A;  3B7D A;  4PFR A;  1Y3Q A;  1A54 A;  4BDQ A;  5I57 B;  4NF6 B;  4QFL A;  4G8H A;  4F3B A;  1KZ8 A;  4ZEK A;  5L9S A;  1KA0 A;  4ZZE A;  5FBP A;  4LVQ A;  5LDZ A;  4ELQ A;  3PD8 A;  5TPA A;  3G7W A;  5KDT B;  1IXG A;  1POY 1;  2HXW A;  3TEL A;  3Q27 A;  4PFY A;  3T66 A;  4QFP A;  4G68 B;  2F35 A;  3QUF A;  1MM6 A;  1P1W A;  3D4G A;  1O64 A;  3D4C A;  4MNP A;  1G0I A;  3IFA A;  1B3E A;  4KQP A;  4ONY A;  2RC8 A;  3R6U A;  3DP8 A;  1AOV A;  1G0H A;  4TLL B;  3BFT A;  1FW0 A;  4PGN A;  5H8S A;  1OIB A;  4NED A;  1MXU A;  2CEX A;  3C36 A;  5FTH A;  1B40 A;  1SI1 A;  1B7Z A;  5I3S A;  5ESY A;  2PX1 A;  3VVD A;  4U4S A;  1YPN A;  4LQ2 A;  2PVU A;  4GVO A;  1CB6 A;  1LEV A;  4MX6 A;  3QMF A;  1Q9D A;  1ZIU A;  1H44 A;  3Q29 A;  4N6P A;  2NVU B;  1MDP 1;  4F29 A;  4QFN A;  4PBQ A;  1SBP A;  3K6W A;  4AQ4 A;  1FTO A;  5FHM A;  2PMS A;  4EQ9 A;  1MY2 A;  1B52 A;  2V3T A;  5DVI A;  5CRY A;  1GR2 A;  1MXX A;  2DQV A;  3RLF E;  4F19 A;  1ZTY A;  1MS7 A;  3PPP A;  3V5A A;  4O3A A;  3DP6 A;  1B0H A;  1LST A;  3FXU A;  4YMA A;  2PBW A;  2B3F A;  1D9Q A;  1P99 A;  4QSC A;  1B32 A;  1OVB A;  4PFW A;  4HE2 A;  2RIN A;  4HE1 A;  1B4Z A;  3U72 A;  1PB8 A;  4DE8 A;  4EF1 A;  1AMF A;  2H25 A;  1WVJ A;  2RCB A;  4R2B A;  1Y4C A;  3OEK A;  2B4M A;  1YZ0 A;  1PB7 A;  4GX3 A;  4Q8R A;  4XXU A;  2HZK A;  3LUZ A;  3EQ1 A;  3UK4 A;  3FBP A;  4OVP A;  1B58 A;  2ZZX A;  3TZA A;  4OXV A;  1GGG A;  2I58 A;  1A7L A;  3CR9 A;  3PUY E;  4H1X A;  2RKM A;  1LBY A;  1EYJ A;  2I4B A;  3OO8 A;  3MBP A;  1R6Z A;  4KHZ E;  5F24 A;  4EXK A;  5EYF A;  5I57 A;  1LB8 A;  4H67 A;  3RT6 B;  1EH3 A;  3IOW A;  1B3H A;  4HW8 A;  2QJE A;  1UTH A;  4RK9 A;  1R1N A;  4NF4 B;  3OMB A;  3H06 B;  2Z22 A;  4GOT A;  4DLD A;  3U93 A;  4JXI A;  1LAF E;  3GXA A;  4ZEB A;  1B51 A;  1OVT A;  2XXI A;  2V3U A;  3C32 A;  4ZS9 A;  2BJI A;  4N8G A;  1PB9 A;  4XEQ A;  3K4U A;  3T9V A;  3IO6 A;  3EHU A;  4WXJ A;  5BWJ A;  3T93 B;  5J1D A;  3CFL A;  2PYY A;  3TTM A;  4C1T A;  2GHA A;  2NWJ A;  5I59 B;  1NV4 A;  2CMO A;  3E78 A;  1MPD A;  3RGY A;  1LCF A;  4RNS A;  4PC9 A;  3FJ7 A;  3MST A;  2DP8 A;  4U23 A;  3TEP A;  3OSR A;  1IIT A;  1B3F A;  3G3H A;  4YB7 A;  1B5I A;  1NV6 A;  2RF1 A;  3USD A;  4HCY A;  3MVY A;  4XKR A;  3KBZ A;  1WDN A;  3RYD A;  4EQ7 A;  2O84 X;  1IMA A;  4HE0 A;  1T0K A;  2XX8 A;  1GV8 A;  3SEV A;  3OXN A;  2AL4 A;  2E0S A;  3I5O A;  4P9K A;  1LBC A;  1YTV A;  1M5C A;  1FQA A;  2YJP A;  4F2Q A;  1K9Z A;  1USY H;  2V93 A;  4JDF A;  2ZYK A;  3G3F A;  1MDQ A;  3TKD A;  2O51 A;  2REJ A;  3SDF A;  3OO6 A;  1NNP A;  1SQY A;  1K9Y A;  2DWA A;  2QSX A;  4H45 A;  1Y3P A;  4H46 A;  4O3C A;  1LAH E;  1MQJ A;  3A29 A;  3S2V A;  2O1M A;  3U94 A;  3G3I A;  3HFU A;  4AS4 A;  1JET A;  2Z8E A;  1MQD A;  4KCC A;  4GWS A;  1FBF A;  2ZZV A;  4H0W A;  4IO3 A;  2HXR A;  1B3G A;  2DSF A;  1NUW A;  5L8D A;  4GWX A;  3CIJ A;  2Q88 A;  2YPN A;  1FPI A;  1QJM A;  4U2R A;  1UTB A;  4IGT A;  1FTA A;  3N26 A;  1YXI A;  2HFB A;  3CSG A;  1B0L A;  1FCK A;  1VDW A;  4YKI A;  3TUS A;  4QSD A;  1B3L A;  3SER A;  4F1Y A;  4MNI A;  3QK6 A;  3IOU A;  2MKZ A;  2OWZ A;  2Y5L A;  4JSO A;  2RCA A;  4UA8 A;  3ODB A;  4OES A;  1HSJ A;  1UQW A;  1P1Q A;  5AA2 A;  2FIX A;  4QXD A;  2FA7 A;  1Q35 A;  3O2A A;  5CMK A;  3LV0 A;  1NV2 A;  4OWD A;  3LSL A;  4P3L A;  4DXC A;  4MF3 A;  4NAP A;  2F6P A;  1IMF A;  4G8M A;  4KFQ A;  4QFK A;  1DK4 A;  3CG1 A;  5L9M A;  3B50 A;  1RYO A;  2BJJ X;  4YB6 A;  2I0B A;  3KG2 A;  1B6H A;  5EQA A;  2XWI A;  5I5P A;  1AL3 A;  4K3F A;  1YYZ A;  3ZSF A;  1LCT A;  1PC3 A;  3C31 A;  1RDZ A;  2QFL A;  3LC8 A;  2Z8D A;  1FQD A;  1NFT A;  4OHN A;  1ZLQ A;  4NF5 B;  1EZ9 A;  3TYH A;  3MW0 A;  1O63 A;  3E4R A;  4OTE A;  4P1L A;  3K1M A;  5HBC A;  2ONR A;  3RUM A;  2R9J A;  3MP6 A;  4KPT A;  5CMM A;  3KOT A;  3FJM A;  1FPB A;  3E79 A;  5KCJ A;  1MY0 A;  2UVH A;  4N6D A;  1LB9 A;  2XXP A;  3FVO A;  1SVX B;  3HV1 A;  3RPW A;  4E0W A;  1CE2 A;  1B46 A;  1OMP A;  5T3J A;  1LFH A;  4OMB A;  1MQI A;  4O7I A;  3G3G A;  3FXR A;  3B6Q A;  1WOD A;  3VXB A;  3K01 A;  2QVV A;  1N76 A;  5H8H B;  4ELR A;  3FVG A;  2ZYM A;  2VGQ A;  2XHD A;  4U1Z A;  1INP A;  3W15 C;  5IZZ A;  2WYP A;  1B7U A;  4G68 A;  1PDA A;  5DEX A;  3TMG A;  1AIV A;  3M3K A;  3MVX A;  1D3K A;  3K1N A;  5H8N A;  2O6A A;  5CBS A;  1Z7M E;  2D21 A;  2I3V A;  1IXC A;  4ZEI A;  3IB2 A;  4IY6 A;  1IMB A;  1P1U A;  1Q1K A;  2F36 A;  3MZ9 A;  4R9G A;  4OAN A;  4I9D A;  3KJ7 A;  1YCJ A;  1B1H A;  2D5W A;  4LON B;  1JW4 A;  3VLU A;  4YB5 A;  3IX1 A;  2KQZ A;  1Y3N A;  1PBP A;  4NQ8 A;  4PFI A;  5KZT A;  1FPD A;  1NNF A;  1Y1Z A;  2ABH A;  2XXY A;  1BLF A;  1N0T A;  4PDD A;  3FIR A;  3RNN A;  2F6G A;  2OWS A;  5FHN A;  2B4L A;  2I49 A;  2FVZ A;  3KC0 A;  4O8M A;  4P1E A;  2FYI A;  4X1D A;  4ND9 A;  5I84 A;  4I3E A;  1UIV A;  3H6U A;  1FPK A;  2O7I A;  1LBX A;  1JEU A;  3BIH A;  3WAE A;  5LOM A;  2Y5K A;  3G3K A;  3K6X A;  4O94 A;  2Q8J A;  2DWJ A;  2XD3 A;  2WYK A;  3U92 A;  5EYH A;  1II5 A;  2Q89 A;  3QAX A;  5I2N B;  1PBQ A;  1M5E A;  3L6G A;  1S50 A;  2NXO A;  5CMC A;  4I62 A;  1SI0 A;  1VFE A;  1DPE A;  3T9H B;  1BP5 A;  4YMB A;  3SZP A;  3KSX A;  4Q5T A;  1YAE A;  3ROJ A;  4GWU A;  4YU0 A;  2KR0 A;  1FBG A;  1MG1 A;  4NGU A;  2FNC A;  4EUO A;  1IMC A;  2NUV A;  3R7X A;  5I58 B;  4NWC A;  4G4P A;  5TU0 A;  2XXU A;  5JEI A;  2X7P A;  1US5 A;  4C1U A;  5DW8 A;  2VPO A;  4WEP A;  2V84 A;  2CZL A;  2VD3 A;  4AB6 A;  2WX9 A;  1H3D A;  2Y7W A;  4IB2 A;  4RYA A;  5B7D A;  2Y7I A;  1MH4 A;  3HPI A;  4YZZ A;  4G8N A;  2NOO A;  5AA4 A;  4N17 A;  1JEV A;  2F7C A;  3V89 B;  2OK2 A;  3FJG A;  3MPK A;  3KJT A;  1URG A;  2F5X A;  1NL5 A;  3VV5 A;  1F9B A;  1MPB A;  3QYT A;  2UXA A;  3IB1 A;  1LBB A;  2I3W A;  1JW5 A;  3QUJ A;  5I59 A;  5TP9 B;  3ECR A;  1QW0 A;  1POT A;  3CRB A;  3VLV A;  1B5J A;  2O7U A;  3ISP A;  2XD2 A;  2G93 A;  3T1B A;  3SEX A;  2DVC A;  3GLB A;  1JNF A;  3D1R A;  2ESN A;  4KD5 A;  4PQJ A;  3LR1 A;  1NI9 A;  5IAI A;  2H98 A;  3K02 A;  4LA9 A;  1FTK A;  3O9P A;  3PPQ A;  2PT2 A;  2QS1 A;  4YKJ A;  3H6V A;  3LSX A;  1RDY A;  1QUK A;  3VFJ A;  1D4N A;  1FQF A;  1NV3 A;  3TOD A;  1XHY A;  3THI A;  4MHF A;  4OZ9 A;  1UTH B;  3N6T A;  4RPN A;  5IM2 A;  2Q74 A;  3GBB A;  1I6Q A;  1MXV A;  4H8J A;  1XI6 A;  4OFO A;  4MLV A;  4POW A;  4OEV A;  5KCJ B;  4O3B A;  4XTC Q;  2PCR A;  3TTN A;  2ALU A;  4ZED A;  1IXI A;  1AWB A;  1OLA A;  5BUU A;  2CZK A;  4OFL A;  3T9X B;  3C4M A;  4GWZ A;  4PAF A;  2H5Y A;  3MZ1 A;  4N91 A;  3SEU A;  3DM0 A;  3H03 A;  2YLN A;  2O69 A;  3FGS A;  1B7H A;  4EDP A;  5H8H A;  3FV2 A;  1RKM A;  3PTY A;  2CZH A;  3HHF A;  1RYX A;  2RC9 A;  3ILU B;  4TQU Q;  4OEN A;  1NH8 A;  4OFJ A;  3EF7 A;  4OVJ A;  4LUB A;  3HCQ A;  1A8F A;  2Y7K A;  1H76 A;  3H6T A;  1A8E A;  4X04 A;  1BIY A;  4F39 A;  4R6H A;  3RPL B;  4MBP A;  5DVF A;  5ICT A;  5A5X B;  2M8C A;  3OO7 A;  4R6K A;  1L5T A;  1Y4T A;  5JTY A;  3WAF A;  4XKP A;  2F3D A;  3FV1 A;  4FAJ A;  2W7Y A;  1P1N A;  3OD7 A;  1FBE A;  2VPN A;  4Z7E A;  4PGP A;  3G3J A;  2Y7P A;  2HEU A;  2ONK E;  4KCD A;  3KN8 A;  4E0X A;  1JQF A;  4PCD A;  2B65 A;  3TAJ A;  2Q2A A;  1MXY A;  3K2D A;  5ET5 A;  2B3B A;  4KI0 E;  3TTL A;  3C9H A;  4FEC A;  3EHS A;  3H7M A;  2HQ0 A;  2ZNU A;  3IFC A;  4PAI A;  5I7I A;  4NWD A;  1OQH A;  3V83 A;  4RJZ A;  3UIF A;  2DVZ A;  3E9X A;  2I48 A;  1LAG E;  4DZ1 A;  2XXQ A;  4ZZA A;  2A5T B;  1B1X A;  5F1Q A;  3MVZ A;  3O28 A;  4PP0 A;  3N5L A;  3SEW A;  1SPI A;  3N6U A;  4H6D A;  4FJP A;  4GD5 A;  1LBW A;  4XKQ A;  4BDM A;  2ZXT A;  3N94 A;  2XXR A;  3U65 A;  3B6T A;  4R9F A;  4WED A;  4YKK A;  3PPR A;  5KDT A;  4N13 A;  3TDJ A;  3RY3 A;  3CFZ A;  5ELV A;  5I2K B;  4IO4 A;  3LUY A;  1EZP A;  3IOT A;  1URD A;  1D9V A;  4X1B A;  2A5S A;  4MEV A;  2I0C A;  4IY5 A;  2GHB A;  3IO4 A; 
#chains in the Genus database with same CATH homology
 3MJN A;  4QRZ A;  2V25 A;  3C36 A;  1N76 A;  3MC2 A;  2AYS A;  3LSF B;  3CSB A;  5FTH A;  5H8H B;  1Y9U A;  3FVK A;  3FVG A;  4ELR A;  2QS4 A;  2ZYM A;  4GIZ A;  1B40 A;  2VGQ A;  1FTJ A;  2XHD A;  1SI1 A;  4U1Z A;  1B7Z A;  3W15 C;  3S9E A;  2PX1 A;  2F7B A;  3VVD A;  4U4S A;  1Z7N E;  4G77 A;  1JW1 A;  2DXY A;  1B7U A;  2REG A;  1PDA A;  1YPN A;  4G68 A;  2PVU A;  3HO7 A;  4HS7 A;  4GVO A;  1ZJL A;  1CB6 A;  1M5B A;  3M3K A;  3MVX A;  5DEX A;  3TMG A;  5CBR A;  2UVG A;  3O66 A;  1AIV A;  1D3K A;  3PPO A;  3VXC A;  1ZIU A;  4G2Z A;  3K1N A;  5H8N A;  2O6A A;  2XX7 A;  3FUZ A;  4THI A;  3BKI B;  1H44 A;  4QFO A;  1Z7M E;  2D21 A;  3Q29 A;  3K0V A;  5M2V A;  4N6P A;  5CBS A;  2I3V A;  3OEM A;  1IXC A;  2NVU B;  4RA1 A;  1MDP 1;  1MY1 A;  4ZEI A;  4F29 A;  3IB2 A;  4QFN A;  3JZJ A;  4IY6 A;  1B05 A;  1MRP A;  5AA2 B;  4GFR A;  1SBP A;  4U21 A;  2Z23 A;  3K6W A;  1VSO A;  1P1U A;  3IOR A;  1EZO A;  1Q1K A;  2F36 A;  4U4X A;  3SEY A;  1FTO A;  4AQ4 A;  4FOR A;  5FHM A;  2A5T A;  3GZG A;  2PMS A;  4EQ9 A;  3MZ9 A;  5L9S A;  4R9G A;  1MY2 A;  4OYV A;  2F78 A;  1QVS A;  2VOZ A;  2I4C A;  4I9D A;  4Q0C A;  1B52 A;  3KJ7 A;  4IO5 A;  2V3T A;  5DVI A;  2OJT A;  5CRY A;  1GR2 A;  2XX9 A;  1YCJ A;  1B1H A;  3A09 A;  3GBA A;  3TPA A;  3TTK A;  1MXX A;  2D5W A;  2DXR A;  1I6B A;  1DTZ A;  4LON B;  3JV9 A;  4BDN A;  2DQV A;  1JW4 A;  3RLF E;  4LZ5 A;  2KLF A;  4F19 A;  3VLU A;  1ZTY A;  3O29 A;  4NF4 A;  3IX1 A;  4YB5 A;  5TP9 A;  1Y3N A;  1J1N A;  1MS7 A;  1PBP A;  2GHB A;  5ITP A;  4F22 A;  3W9V A;  5KZT A;  1FQC A;  1A40 A;  1NNF A;  1Y1Z A;  3IOV A;  4H65 A;  4PET A;  3PPP A;  4DCX A;  2ABH A;  2XXY A;  4JWO A;  3S9N C;  1BLF A;  4HTG A;  3EPE A;  3V5A A;  4O3A A;  3DP6 A;  3MAM A;  1N0T A;  1MQH A;  4NE4 A;  1B0H A;  2X26 A;  1LST A;  3FIR A;  3FXU A;  3RNN A;  1LFG A;  4YMA A;  2F6G A;  2PBW A;  2DE4 A;  3A3C A;  1I6A A;  3K6V A;  2IA4 A;  3T9U A;  2B3F A;  2DWI A;  2OWS A;  4R6Y A;  1ZU0 A;  4TLM B;  4FAT A;  4DCY A;  1SD3 A;  1LLS A;  3CVG A;  3E13 X;  1EU8 A;  5FHN A;  1GVC A;  1P99 A;  5H8N B;  4QSC A;  2Y7R A;  1DMB A;  2I49 A;  1B32 A;  1JVY A;  1TWY A;  4QF9 A;  4Z0I A;  1OVB A;  1TFA A;  2OWT A;  4JWY A;  4GF8 A;  4PFW A;  2FYI A;  4IO6 A;  4X1D A;  1R9L A;  4ND9 A;  4IO7 A;  2RIN A;  1N84 A;  3VE1 B;  4I8C A;  5I84 A;  2O1L A;  5DEX B;  3QSL A;  1B4Z A;  3U72 A;  3CI8 A;  1UIV A;  1O7T A;  5I56 B;  4ONY A;  1PB8 A;  4DE8 A;  4EF1 A;  1AMF A;  2H25 A;  1WVJ A;  2QS3 A;  4ELP A;  2RCB A;  2O7I A;  3H6U A;  3VVE A;  4R2B A;  1AH5 A;  3KFM A;  1Y4C A;  1JEU A;  3OEK A;  3MZB A;  3ZKL A;  1QUI A;  2WKY A;  3K1P A;  5JTY B;  4QHQ A;  3LBS A;  3M3L A;  3WAE A;  5LOM A;  1PB7 A;  4Q8R A;  3OEL A;  4XXU A;  3G3K A;  3K6X A;  2Q8J A;  2DWJ A;  1M5F A;  2HCA A;  4H5G A;  2XD3 A;  2HZK A;  3U92 A;  5DVJ A;  4U1O A;  1II5 A;  3EQ1 A;  4MH5 A;  3UK4 A;  4ZE9 A;  2Q89 A;  3T22 A;  1FQB A;  2GRV A;  2ZNT A;  3QAX A;  3RTF B;  5I2N B;  1PBQ A;  1M5E A;  2P2A A;  3FD3 A;  5AA1 A;  2H9B A;  1B58 A;  3L6G A;  1S50 A;  1S9T A;  3TCH A;  3UA8 A;  2NXO A;  3MQ9 A;  5ICQ A;  5CMC A;  4EXL A;  1IXH A;  1ATG A;  4I62 A;  1SI0 A;  3TZA A;  5I59 A;  1UIU A;  4ZDM A;  3H6W A;  1VFE A;  4OXV A;  5FTI A;  1GGG A;  2I58 A;  3FAT A;  1A7L A;  1DPE A;  4OEU A;  3T9H B;  3CR9 A;  3PUY E;  3LSW A;  1BP5 A;  4H1X A;  1MXZ A;  2RKM A;  4YMB A;  2OBG A;  2R71 A;  4JSD A;  1MH3 A;  3KSX A;  1FTM A;  1Y20 A;  2HZL A;  4QSE A;  3TQL A;  4Q5T A;  4ISU A;  1YAE A;  4R74 A;  4ESW A;  4YU0 A;  2R6G E;  2HAV A;  1VR5 A;  3CFX A;  2I4B A;  3DP4 A;  3OO8 A;  1MG1 A;  3MBP A;  1R6Z A;  4KHZ E;  2F7A A;  4EXK A;  3MWB A;  1N7X A;  5EYF A;  5I57 A;  1LB8 A;  2FNC A;  4EUO A;  4RY1 A;  4H67 A;  2GFE A;  4U22 A;  3RT6 B;  2NUV A;  1EH3 A;  3BFU A;  3IOW A;  1B3H A;  3R7X A;  2HAU A;  5I58 B;  1USY E;  1XT8 A;  3T96 B;  2D3I A;  4HW8 A;  2PT1 A;  2QJE A;  4NWC A;  4G4P A;  1UTH A;  5TU0 A;  2XXU A;  4RK9 A;  2X7P A;  3JYR A;  4NF5 A;  4F31 B;  1R1N A;  5HM4 B;  4KYE A;  5JEI A;  1US5 A;  3S4U A;  4NF4 B;  3Q26 A;  4GRK A;  3O6H A;  4C1U A;  5B70 A;  3OMB A;  4LQ5 A;  2Z22 A;  4GOT A;  2I0C A;  4R75 A;  4WEP A;  2V84 A;  5CI5 A;  4DLD A;  2VD3 A;  1MPC A;  4AB6 A;  4F2O A;  4R72 A;  3UOR A;  3U93 A;  4JXI A;  3PD9 A;  1LAF E;  3IJO B;  3PPN A;  3GXA A;  5CMB A;  1H3D A;  5DTB A;  3KOS A;  1XVX A;  2AL5 A;  4ZEB A;  4F3G A;  2Y7W A;  4IB2 A;  1B5H A;  4RYA A;  1T0K A;  4RK2 A;  4DIG A;  1B51 A;  2Y7I A;  5B7D A;  5I2K A;  1MH4 A;  3HPI A;  3V8X B;  2UYF A;  3BBR A;  3HST A;  2DYX A;  3DEL B;  3ONM A;  3MP8 A;  4L17 A;  1OVT A;  2OCU A;  2XXX A;  5F7V A;  2XXI A;  4M1V A;  4YZZ A;  2UVI A;  4G8N A;  4OET A;  1M5D A;  3UP9 A;  1PEB A;  1SW4 A;  2NOO A;  2V3U A;  1JEV A;  3C32 A;  3PUX E;  4P11 A;  1NNK A;  2F7C A;  4OER A;  1HSL A;  4ZS9 A;  5K2X A;  3V89 B;  4YIC A;  1VE4 A;  2OK2 A;  1KWH A;  3FJG A;  1PB9 A;  3T9V A;  3K4U A;  3MPK A;  4FED A;  2UYE A;  3IO6 A;  3KJT A;  3EHU A;  3U1O A;  1MQG A;  3KZG A;  4WXJ A;  5K2Y A;  5ISU A;  5BWJ A;  1URG A;  2F5X A;  1NL5 A;  3T93 B;  1F9B A;  3CFL A;  3Q25 A;  2PYY A;  1MPB A;  5FHO A;  2LAO A;  3QYT A;  3TTM A;  2UXA A;  1A99 A;  1H45 A;  2E1S A;  3IB1 A;  3RT8 A;  4C1T A;  2GHA A;  1LBB A;  5AA4 A;  4XIG Q;  2NWJ A;  1TFD A;  1JW5 A;  2I3W A;  3PUZ E;  1XC1 A;  3QUJ A;  4JWX A;  4R2F A;  3ECR A;  5TP9 B;  1QW0 A;  2CMO A;  2GH9 A;  1POT A;  3K00 A;  1MPD A;  3CRB A;  3RGY A;  1B5J A;  1LCF A;  2O7U A;  2XD2 A;  3IJX B;  3VLV A;  5A5X A;  2IEE A;  1MXW A;  4RNS A;  2G93 A;  4F18 A;  3FJ7 A;  4IGR A;  1SYI A;  3SEX A;  3OO9 A;  3QXM A;  2DVC A;  2UVJ A;  3KGC A;  5ITO A;  2DP8 A;  4G68 C;  4MFI A;  4U23 A;  3GLB A;  3TEP A;  4NTL A;  1NMU A;  5IKB A;  1MY3 A;  1JNF A;  2ESN A;  3Q28 A;  3OSR A;  4KD5 A;  3MUQ A;  1XOC A;  1IIT A;  3LR1 A;  1B3F A;  3G3H A;  4PQJ A;  4EF2 A;  1EZP A;  4YB7 A;  1B5I A;  3F11 A;  4F1V A;  5IAI A;  2ANJ A;  2RF1 A;  3USD A;  2H98 A;  3K02 A;  4HCY A;  3VLW A;  4ECF A;  4POX A;  1IUD A;  4LA9 A;  3MVY A;  4XKR A;  4DDD A;  4JB7 A;  2O68 A;  1FTK A;  1WDN A;  1NKX A;  1XVY A;  2Y84 A;  3O9P A;  3RTW B;  4EQ7 A;  3H4Z A;  1IIW A;  3UN6 A;  3O97 A;  2O84 X;  3PPQ A;  3KEI A;  2PT2 A;  2QS1 A;  3OSQ A;  4RXL A;  2XX8 A;  4X9T A;  4YKJ A;  5TPA B;  1GV8 A;  3SEV A;  3RQT A;  3OXN A;  2AL4 A;  3U8Q A;  2DS9 A;  3H6V A;  2E0S A;  3LSX A;  2Z8F A;  1LAX A;  2ONS A;  1QUK A;  3I5O A;  3S9L C;  1LBC A;  1YTV A;  2V3Q A;  1IQ7 A;  3QIM A;  2XXW A;  1D4N A;  1M5C A;  4NED A;  1FQA A;  2YJP A;  3VFJ A;  4F2Q A;  1FQF A;  3C34 A;  3MP1 A;  3M8U A;  2P1S A;  5CC2 A;  1ZKB A;  1USY H;  2V93 A;  1XHY A;  4JDF A;  3THI A;  2ZYK A;  3TOD A;  4DXU A;  1TXF A;  3G3F A;  1MDQ A;  1UTH B;  3N6T A;  3I3V A;  4OZ9 A;  4RPN A;  3TKD A;  3TQW A;  3GBB A;  1H43 A;  2O51 A;  1I6Q A;  2REJ A;  1MXV A;  3C33 A;  3FAS A;  3IK6 B;  4LQ2 A;  3SDF A;  4C0R A;  3OO6 A;  1NNP A;  1SQY A;  4TOZ A;  1I69 A;  4H8J A;  4OFO A;  2DWA A;  4MLV A;  4POW A;  2X7Q A;  4OEV A;  5KCJ B;  1SYH A;  4O3B A;  2P0S A;  4XTC Q;  3UGW A;  2QSX A;  2AIX A;  4EQB A;  1Y1M A;  4R73 A;  2ALU A;  3TTN A;  1IXI A;  4ZED A;  1FQE A;  1LGB C;  1Y3P A;  4O3C A;  1OLA A;  4Q30 B;  1SDX A;  2OZZ A;  1QKA A;  5BUU A;  4ZEC A;  3KN3 A;  5CM6 A;  1LAH E;  1MQJ A;  4LP2 B;  5I56 A;  3S2V A;  4WKM A;  4OFL A;  2O1M A;  4M4G A;  4YKP A;  3T9X B;  3U94 A;  1SW2 A;  3PGF A;  4KR5 A;  2QMW A;  3C4M A;  1FTL A;  1US4 A;  3G3I A;  2H5Y A;  3MZ1 A;  3SEU A;  3ZKK A;  2XXV A;  1DPP A;  2ZMB A;  3I6V A;  3DM0 A;  2VHA A;  3H03 A;  1JET A;  2YLN A;  2Z8E A;  1MQD A;  2O69 A;  4P0I A;  3HHG A;  4KCC A;  4PFU A;  3FGS A;  3IAZ A;  1B7H A;  4EDP A;  1OQG A;  1ANF A;  3O6I A;  2G29 A;  1BTJ A;  1ZMG A;  4GWO A;  4H0W A;  1NH7 A;  3AXF A;  4IO3 A;  5H8H A;  4AB5 A;  3FV2 A;  4KYD A;  1RKM A;  1B3G A;  2DSF A;  5AA2 D;  5L8D A;  3HHF A;  3IB0 A;  1RYX A;  3CIJ A;  4NMY A;  2RC9 A;  3ILU B;  4NF8 A;  2Q88 A;  3P7I A;  3VV5 A;  4GQO A;  1IZ1 A;  1OLC A;  2YPN A;  5H8F A;  4TQU Q;  3CG3 A;  2QRY A;  2DE2 A;  3TCG A;  4OEN A;  1QJM A;  4U2R A;  1UTB A;  1NH8 A;  4IGT A;  4YAH X;  4OFJ A;  3EF7 A;  3N26 A;  4OVJ A;  5AE4 A;  3TTR A;  2HFB A;  1MM7 A;  2DOJ A;  1HSE A;  3CSG A;  1B0L A;  1FCK A;  4GL0 A;  3R26 A;  4LUB A;  3SKP A;  4ZEF A;  2ZYN A;  3PMW A;  1DTG A;  4FE8 A;  2XXT A;  4UAC A;  3HCQ A;  4YKI A;  1A8F A;  3TUS A;  2Y7K A;  1H76 A;  3H6T A;  1A8E A;  4QSD A;  2Q2C A;  1BIY A;  4F39 A;  4LAT A;  4OQO A;  4R6H A;  3KBR A;  5EHM A;  3L6H A;  4F3S A;  1B3L A;  4FIM A;  3SES A;  3FXQ A;  1ELJ A;  3SER A;  4F1Y A;  1UTB B;  4MBP A;  5DVF A;  1GTK A;  4GL8 A;  3QK6 A;  2F34 A;  3IOU A;  2H4I A;  3C35 A;  5ICT A;  5A5X B;  2M8C A;  4JSO A;  4UA8 A;  2RCA A;  3OO7 A;  3ODB A;  3PU5 A;  4R6K A;  3MPL A;  3EN3 A;  1Y4T A;  4WED A;  4OES A;  1L5T A;  1HSJ A;  5H8Q A;  1SW5 A;  1UQW A;  4KYS A;  3SET A;  4BDR A;  5JTY A;  2VP1 A;  1P1Q A;  4F1U A;  3OOA A;  1N3W A;  5AA2 A;  2XXH A;  3WAF A;  2FA7 A;  1Q35 A;  3O2A A;  4XKP A;  5CMK A;  1B9J A;  3TCF A;  4LZ7 A;  3FV1 A;  4IO2 A;  4N07 A;  4FAJ A;  4PE5 B;  3KSJ A;  2ZYO A;  4OWD A;  5J1D A;  3RN8 A;  1DSN A;  2W7Y A;  4NF6 A;  3LSL A;  1R9Q A;  2QPQ A;  1P1N A;  2ZNS A;  4HCW A;  3OD7 A;  4DXC A;  4MF3 A;  5I58 A;  4Z7E A;  3W9W A;  1LFI A;  3B6W A;  2Y7P A;  2F6P A;  2HEU A;  2ONK E;  2RC7 A;  3G3J A;  3M3F A;  3K6U A;  3KN8 A;  3O6G A;  4G8M A;  1DOT A;  4KFQ A;  4QFK A;  4BDO A;  4E0X A;  1JQF A;  2OLB A;  2B65 A;  3CG1 A;  2Q2A A;  3TAJ A;  5L9M A;  1P1O A;  1MXY A;  1RYO A;  2BJJ X;  1S7Y A;  3K2D A;  3KG2 A;  2I0B A;  4YB6 A;  3IR1 A;  4X48 A;  1B6H A;  2B3B A;  3PUW E;  4KI0 E;  2QS2 A;  1B2H A;  3ILT B;  3TTL A;  3ZS6 A;  5HPQ A;  1BKA A;  3PUV E;  4FEB A;  3C9H A;  4FEC A;  1AL3 A;  1JVX A;  3HN0 A;  4K3F A;  3EHS A;  3H7M A;  3ZSF A;  2QL3 A;  1LCT A;  2HQ0 A;  5H8F B;  1PC3 A;  3MVW A;  2ZNU A;  1N3X A;  3C31 A;  3VVF A;  1N7W A;  5AA4 B;  1N04 A;  4NWD A;  4LZ8 A;  1D9Y A;  1OQH A;  4RPO A;  2DE3 A;  3H3G A;  3PV0 E;  3V83 A;  1QUL A;  4RJZ A;  3LC8 A;  2Q9T A;  1A55 A;  2Z8D A;  5DYH A;  1MY4 A;  1FQD A;  1NFT A;  1SW1 A;  1XS5 A;  3DLN A;  5I59 B;  4IY5 A;  2THI A;  4OHN A;  3EHT A;  1ZLQ A;  4P0G A;  4BDL A;  5AA3 A;  3TFL A;  5I2N A;  4NF5 B;  3FZV A;  1EZ9 A;  3IO4 A;  2DVZ A;  3UIF A;  4PFT A;  4YKK A;  4H8I A;  3E9X A;  3TYH A;  3MW0 A;  4GXS B;  1O63 A;  2F8D A;  1LAG E;  2I48 A;  3E4R A;  4DZ1 A;  4OTE A;  2XXQ A;  4XKN A;  4H5F A;  4ZZA A;  4GXA A;  3B7D A;  3K1M A;  1Y3Q A;  1A54 A;  2ONR A;  2A5T B;  5HBC A;  4BDQ A;  4ESX A;  1B1X A;  1B4H A;  4NF6 B;  4QFL A;  5I57 B;  5F1Q A;  3A3U A;  4G8H A;  1IEJ A;  3MVZ A;  3O28 A;  2R9J A;  4PP0 A;  4ZEK A;  2VD2 A;  3MP6 A;  4KPT A;  5CMM A;  3RUM A;  4F3B A;  1VFD A;  3KOT A;  3FJM A;  3N5L A;  4JBZ A;  5H8Q B;  4ZZE A;  5KCJ A;  4F3P A;  3SEW A;  5EHS A;  4LVQ A;  3N6U A;  4H6D A;  4FJP A;  4ELQ A;  3PD8 A;  5TPA A;  4GD5 A;  3G7W A;  5KDT B;  3PMV A;  1MY0 A;  2UVH A;  4XKQ A;  4BDM A;  2F97 A;  2ZXT A;  1LB9 A;  1IXG A;  1POY 1;  2HXW A;  2XXP A;  3E3K A;  3TEL A;  3Q27 A;  3FVO A;  3N94 A;  4MLQ A;  4PFY A;  3T66 A;  3VDF A;  3FVN A;  4QFP A;  4G68 B;  1URS A;  4DXB A;  4BLA A;  2F35 A;  2XXR A;  3PMX A;  3B6T A;  3OEN A;  4R9F A;  1NNT A;  2I6E A;  2QMX A;  1SVX B;  3K01 A;  3PPR A;  3QUF A;  4GLI A;  1TT1 A;  4I1D A;  5KDT A;  1MM6 A;  3HV1 A;  3RPW A;  1P1W A;  4N13 A;  3D4G A;  1CE2 A;  1O64 A;  3D4C A;  1ZBM A;  1B46 A;  4E0W A;  1OMP A;  3TDJ A;  4KCD A;  3RY3 A;  1LFH A;  2DWH A;  4OMB A;  3CFZ A;  1MQI A;  5ELV A;  5I2K B;  4IO4 A;  3LUY A;  2H99 A;  1B3E A;  2RC8 A;  3G3G A;  3IOT A;  3R6U A;  4KQP A;  1QKB A;  3FXR A;  1URD A;  3B6Q A;  1D9V A;  3DP8 A;  4NF8 B;  4ZE8 A;  5JK4 A;  5DT6 A;  1WOD A;  4ELO A;  3VXB A;  4TLL B;  1AOV A;  3S9M C;  3BFT A;  4X1B A;  1FW0 A;  5H8S A;  5L9O A;  2A5S A;  3IL1 B;  3H06 B;  1QUJ A;  3KN7 A;  2CZL A;  1OIB A;  1MXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...