1A40A

Phosphate-binding protein with ala 197 replaced with trp
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
321
structure length
321
Chain Sequence
EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGTSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYWYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATE-BINDING PERIPLASMIC PROTEIN PRECURSOR
publication title Dominant role of local dipolar interactions in phosphate binding to a receptor cleft with an electronegative charge surface: equilibrium, kinetic, and crystallographic studies.
pubmed rcsb
source organism Escherichia coli
molecule tags Phosphate-binding protein
total genus 102
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 1998-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1a40A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1a40A02
3T9HB 4R9FA 4POWA 1B7HA 4OFJA 3PPOA 3CSGA 3TAJA 2YPNA 3EPEA 4G8MA 5EYFA 4GQOA 4OQOA 5ITOA 1VE4A 4JSDA 1NH7A 3CFZA 3U92A 4OFOA 1URDA 2Z8DA 4QFOA 4TLMB 1GV8A 4DCXA 4JDFA 3TQWA 1MXYA 3KOTA 2R6GE 3VLUA 3W9VA 1UIUA 3SEWA 2OBGA 5BUUA 4IGRA 4R6HA 1B3GA 3OD7A 1H44A 1RYOA 3TTNA 5ICQA 5KDTB 1ANFA 2VGQA 3V5AA 4YKKA 4EXKA 4N6PA 3N26A 5H8SA 1FW0A 1WVJA 4KYEA 5H8QA 3TELA 3UA8A 4UA8A 5IAIA 2RC8A 4OENA 1B1HA 3P7IA 4DIGA 3R26A 4JBZA 2Z22A 4H1XA 1I6QA 4NF8B 3KZGA 1EZPA 3H4ZA 4O3BA 4H6DA 4EXLA 3EHTA 2F35A 3TDJA 1MXZA 2DVCA 3ZKKA 4OWDA 1B1XA 4FECA 5CM6A 3HV1A 5I58A 5I84A 3KN3A 3FZVA 1DPEA 1MXXA 3O28A 1MQJA 4N13A 2PX1A 1M5DA 5CMCA 4P11A 2P2AA 3FVGA 2ZYNA 4I8CA 3TTMA 1SW5A 2ONRA 4N07A 1DTGA 4F1VA 3B6TA 4O3CA 4IO3A 3CG1A 3MJNA 4QRZA 1N3XA 2OZZA 5H8FA 4ESWA 2GFEA 5CRYA 2Z8EA 4YU0A 1QULA 4NF5B 2RKMA 1YTVA 4IO6A 1QUIA 5H8HA 1D4NA 4GXSB 3V89B 3K6UA 2XXWA 5DEXB 4THIA 1FTOA 3U93A 1IXCA 1YPNA 1B7ZA 1EZ9A 1FQFA 2Y7RA 3UP9A 1BKAA 1Q1KA 3IX1A 2OWSA 3TCGA 4QF9A 2QRYA 1JEVA 2RCBA 5K2XA 2UVHA 3LR1A 5H8NB 4H65A 3S9LC 2ZNSA 1O7TA 3KEIA 4LZ7A 1BLFA 4YKIA 3RT8A 3N5LA 3MP8A 3EHSA 5DYHA 1B3HA 1BIYA 1P1OA 1SW2A 4Q8RA 5DEXA 3I6VA 3FATA 4R75A 3ZKLA 1B51A 3QAXA 3BFTA 3FXUA 2B3BA 1GVCA 3FXRA 2QSXA 4Z0IA 2XXIA 2D3IA 4ELRA 3KJTA 1FQBA 3GBBA 5AA2D 5HM4B 1SYIA 1QUKA 4ZE8A 2XD2A 3PD8A 3MPKA 1SBPA 2DE2A 4I1DA 4F39A 3RNNA 3OSQA 2XX7A 3MZ9A 4PETA 3ODBA 1H3DA 4RK9A 2AL4A 4G2ZA 3VLVA 3RUMA 3MC2A 2XXXA 3IOUA 4UACA 1MY2A 5AA3A 1LLSA 4RA1A 5I59A 3MP1A 2XD3A 3IO6A 2RF1A 1A55A 5L9SA 2OLBA 3C4MA 3PV0E 2I0BA 1XOCA 4ZEKA 3JZJA 3O29A 1SQYA 2AL5A 3HCQA 5JEIA 5AA4B 1M5FA 4M4GA 5FTIA 2M8CA 4POXA 2R71A 2QS1A 1MY3A 1IEJA 3O6IA 4R9GA 5CMMA 4EQBA 4F22A 5AA1A 2V93A 1GR2A 3BBRA 1N7WA 2V3TA 4MFIA 2YLNA 2O1MA 2KLFA 4F3PA 2ABHA 2UVIA 1SW4A 3H6TA 4KQPA 4PFTA 4E0WA 4XTCQ 1UTBB 3T96B 1VFDA 2B65A 5LOMA 3A09A 4P0IA 1OVTA 4R73A 5JTYB 1MPDA 3KSXA 4U2RA 3ZS6A 3LSWA 4I9DA 3M3LA 4EUOA 2GHBA 3HO7A 2VHAA 1HSEA 1MM7A 3N6UA 1D9VA 4G68C 3M8UA 1B3FA 1XHYA 1XS5A 3E13X 4F2QA 4G77A 2XXYA 4DXCA 3RTWB 3UK4A 2DWHA 4XIGQ 5EHMA 2DQVA 4OZ9A 4XXUA 2YJPA 5TP9A 3C35A 2AIXA 3OMBA 4TLLB 1N0TA 1QVSA 4RK2A 2ONSA 1IITA 4QFKA 1B4ZA 3RQTA 1AMFA 1B52A 1URSA 4ZE9A 4IY6A 3GZGA 2OJTA 3IB2A 4QFPA 4PFYA 4G68B 1B2HA 3KN7A 4GXAA 2F7CA 2UYFA 3Q25A 1N3WA 1MG1A 1B40A 4BDRA 4KCDA 4ZS9A 2XXPA 1O64A 2P0SA 1B4HA 4ZEIA 5CMBA 1UQWA 3G3HA 4X1BA 4QSEA 2X7PA 4U4SA 3WAFA 3JYRA 3SKPA 3O97A 4H5GA 4ECFA 3OO8A 3K6WA 1A99A 5L9OA 1MH4A 4GRKA 1QUJA 4YICA 4YB7A 1NNFA 1B58A 1CE2A 4L17A 1PEBA 3U8QA 1H76A 1P1NA 3IB0A 4H5FA 3G3GA 1M5CA 3O6GA 4XKQA 4YZZA 1ZJLA 4HCYA 2QJEA 1L5TA 2PMSA 4RJZA 2G29A 2ALUA 3O66A 4IO2A 3GLBA 5I57A 4NF6A 4FEDA 5J1DA 4GFRA 1SW1A 3M3FA 4WEDA 1POY1 5H8QB 4KCCA 1Y4TA 1TT1A 2X7QA 4YKPA 1PB8A 1OQHA 4DDDA 2Y84A 2QS2A 4BDLA 4NWCA 3TCHA 2RINA 1LCTA 1DPPA 3SEUA 3C9HA 4QSCA 4E0XA 2DXYA 5DT6A 1A8FA 1N76A 3CFLA 5I58B 3IR1A 4ONYA 4YB6A 4G4PA 2A5TA 4OHNA 3GBAA 3I3VA 4JSOA 4DXUA 2I4BA 2UYEA 1FQEA 1SI0A 4F29A 2BJJX 3FASA 4G8NA 3FUZA 4OVJA 2VD3A 4NF4A 1S50A 1MDP1 4ND9A 4OYVA 2Y7WA 1MQGA 3Q26A 5I56A 3PU5A 3O6HA 1PDAA 4ZEBA 3MVZA 4MBPA 1S9TA 4JWXA 3RLFE 4LA9A 2DSFA 3TTKA 3RPWA 2UVGA 3PMVA 3R7XA 4LQ2A 2I58A 3FVOA 1TWYA 3DM0A 1N84A 3H6VA 1PC3A 3CG3A 5H8FB 1NNTA 5DVJA 4F18A 1R9LA 1LFIA 4OEVA 2F36A 4KI0E 3BFUA 3TUSA 1UTHA 1MY0A 2VD2A 1TXFA 1P1WA 4MF3A 3K02A 3IORA 5H8HB 3H6UA 4WXJA 3HPIA 4P0GA 2HQ0A 3S9EA 1JQFA 3F11A 3PPRA 2I3VA 1SYHA 2W7YA 3PPNA 4F1YA 1EZOA 1JEUA 3DP4A 5F1QA 2V25A 3PUYE 3S2VA 5K2YA 4O3AA 2G93A 2F6PA 2Y7PA 4LATA 3HN0A 1FTMA 3PD9A 1KWHA 3OSRA 3L6GA 2UVJA 1P1UA 4YMBA 2RC7A 4K3FA 3B6WA 4U4XA 1B9JA 4C0RA 1QKBA 3HSTA 4KD5A 3FJGA 4DCYA 1MM6A 1MXUA 3H03A 4X1DA 3CR9A 3TCFA 4NWDA 1B3LA 2Q88A 3LSLA 4DZ1A 4EF2A 3A3UA 2XXTA 2XX9A 1A54A 2A5SA 4U22A 3LBSA 1Z7NE 1OIBA 5ITPA 4JB7A 4DXBA 3FVNA 3K1MA 3IAZA 4GLIA 3SDFA 3H7MA 1QW0A 2I6EA 1HSJA 2ZYOA 1OVBA 1MXVA 3FJ7A 1MQDA 3EQ1A 2H25A 2I4CA 1FQAA 4HTGA 3IO4A 2XHDA 2XXUA 2PYYA 4DE8A 3TODA 4LZ5A 2DWJA 1USYE 4R72A 4AQ4A 3JV9A 3G3FA 4NMYA 3FGSA 2QMXA 3UN6A 1OLAA 3KFMA 5I59B 1FTLA 5TPAA 3S9MC 4RYAA 4FJPA 3TZAA 1MY4A 1R1NA 2XXVA 2PVUA 4HW8A 2WKYA 2UXAA 1PBQA 1R9QA 4IO4A 1LFGA 4BDMA 5IKBA 1P1QA 3C31A 3QK6A 2QS3A 2I0CA 4JWYA 1B32A 3O2AA 4Q5TA 4IY5A 4MH5A 4R6KA 4F3GA 1ZTYA 1O63A 2FA7A 2Q9TA 1CB6A 5B7DA 2LAOA 2F8DA 2ZYMA 3FVKA 3ECRA 3MVYA 1USYH 2QL3A 1OQGA 2ZNTA 2REJA 5ISUA 1TFDA 1LAGE 1OMPA 1SVXB 3KGCA 2HZLA 2Q2CA 4F1UA 2QPQA 1EU8A 1VFEA 4TOZA 4FATA 1NMUA 1SD3A 3HHFA 3TKDA 2HAVA 3IOWA 1ZMGA 3K1PA 4KYSA 3KSJA 3E9XA 2O6AA 2ANJA 2FNCA 1M5EA 4LONB 1B7UA 4AB6A 3PPPA 3S4UA 3GXAA 4C1TA 4FIMA 2GH9A 2Z23A 4WKMA 2F7AA 3QUFA 3VFJA 2GHAA 2DVZA 1FQDA 3T9UA 4C1UA 5TP9B 1FTKA 1II5A 1B0LA 4F31B 4U23A 1NNKA 4XKNA 1PB9A 1RYXA 1URGA 1LAFE 2HEUA 2R9JA 3K2DA 4FE8A 1A8EA 4GVOA 2OWTA 1IXGA 1AOVA 3IJXB 1JETA 3OO9A 2Z8FA 2REGA 3CI8A 1US5A 5A5XA 3G3IA 2RCAA 1AH5A 2DE4A 4U21A 4EF1A 1JNFA 4PP0A 3FD3A 3ILTB 3QSLA 3PUXE 3SERA 3C33A 1B3EA 2IEEA 3RN8A 4AB5A 5HBCA 4JWOA 5DTBA 1NFTA 4U1ZA 1YAEA 1B5IA 3MW0A 3V8XB 3SESA 3IOVA 4YB5A 5JK4A 1B5JA 3CSBA 3SEXA 1H43A 1I6AA 4BDNA 3OEMA 5L8DA 2IA4A 4IGTA 5CI5A 2DS9A 1T0KA 3OENA 5FTHA 2Q89A 1Y9UA 3VVEA 2O84X 5I57B 4NF6B 1LGBC 4GL0A 2V84A 4TQUQ 3D4GA 2FYIA 5HPQA 1FCKA 1QKAA 1HSLA 1YCJA 3RGYA 3MZBA 1LAXA 1F9BA 5BWJA 1MY1A 4KR5A 4HS7A 5I2KB 4GD5A 3R6UA 3K00A 3VVFA 3VE1B 2B3FA 3EN3A 3AXFA 2PT2A 5FHNA 3TEPA 4BDOA 3CVGA 2NXOA 4PFUA 1NH8A 1MH3A 3RT6B 1PB7A 5FHOA 2A5TB 3U72A 3G3KA 3LUYA 4R6YA 3PUWE 1Q35A 3QUJA 3B7DA 4QHQA 3CRBA 4Z7EA 3OO7A 2O1LA 3H3GA 1J1NA 1JW1A 1LFHA 5I2KA 3KJ7A 2ZNUA 4EQ7A 4NF4B 4ZZEA 1Y4CA 1TFAA 1Y1ZA 3I5OA 4QSDA 4GIZA 4YMAA 3H06B 2ZMBA 5I56B 2Q2AA 3QYTA 3FV1A 1DMBA 3VXBA 3QIMA 1XVXA 2O7UA 4JXIA 2NVUB 4ELPA 1GTKA 4FORA 3UORA 4YKJA 5B70A 3T22A 3Q29A 5AA2B 2DXRA 4ZDMA 4H8IA 3DELB 2H98A 2I3WA 2H4IA 3G3JA 4F3SA 3T9VA 4RY1A 1UTHB 3TYHA 1NL5A 4R74A 3WAEA 1ELJA 1WODA 1ZIUA 3UIFA 3W9WA 4F2OA 3TTRA 2NOOA 1RKMA 4ESXA 5DVIA 3PUZE 3PMWA 2GRVA 4ISUA 3OO6A 1VR5A 4ZEDA 5AA2A 1ATGA 3RY3A 1Y3NA 5KDTA 1ZU0A 3TMGA 2O68A 2DP8A 2XXHA 3MZ1A 1Y1MA 2OCUA 2D21A 3U94A 2HCAA 3OOAA 1MQIA 3IJOB 5I2NB 5ELVA 4RPNA 4XKPA 2OK2A 3MVXA 3MAMA 1LBCA 5DVFA 4FAJA 1XC1A 5KCJB 4NF8A 4H0WA 4YAHX 4QFNA 2Y7KA 2E1SA 2ESNA 3PPQA 5L9MA 3T66A 3N94A 1IQ7A 2XXQA 1NNPA 3E3KA 2CZLA 1MQHA 2X26A 2O69A 5KZTA 3KG2A 2V3QA 1A40A 3DP8A 4RPOA 1R6ZA 5I2NA 1H45A 3LSXA 3TTLA 3Q28A 1N04A 1ZKBA 3FXQA 5KCJA 3A3CA 3FIRA 3ONMA 2H99A 4U1OA 1D9YA 5F7VA 1IXHA 2O7IA 1US4A 3OELA 1JW5A 3SEYA 1FTJA 2QMWA 3VLWA 4IB2A 2ONKE 4KHZE 2HAUA 1WDNA 4PE5B 2AYSA 3K6VA 4WEPA 3SEVA 2DWIA 4MLVA 3S9NC 5TPAB 1UIVA 4H67A 3MP6A 5TU0A 4LVQA 3TQLA 2F97A 4GL8A 1I69A 2ZXTA 1ZLQA 1MPCA 3C36A 2F5XA 3CFXA 4OETA 2Y7IA 3UGWA 3MVWA 2DYXA 4OFLA 5CBRA 4KFQA 4ZECA 3H6WA 4Q30B 3QXMA 4NF5A 3EHUA 4ELOA 2ZYKA 3K6XA 4BDQA 3FJMA 3PMXA 1PBPA 2XXRA 3D4CA 5CMKA 3C32A 4XKRA 1AIVA 4ZEFA 3MWBA 4OEUA 2F34A 4PFWA 2F78A 2D5WA 2CMOA 3FV2A 3C34A 3E4RA 4NTLA 3TPAA 1MDQA 1EH3A 5H8NA 1M5BA 1N7XA 4RNSA 3K1NA 4LP2B 4X9TA 4EDPA 3HHGA 4KPTA 2I48A 1MS7A 4R2BA 2E0SA 3MBPA 1JVYA 4GF8A 2I49A 4LZ8A 1LCFA 3N6TA 1BTJA 3K0VA 3T9XB 2QS4A 3MUQA 2P1SA 4F3BA 1OLCA 3DLNA 1LB9A 2RC9A 3USDA 1IZ1A 1MPBA 4OMBA 3M3KA 1XT8A 1IUDA 4EQ9A 1MXWA 2F6GA 3B6QA 4KYDA 1MRPA 5FHMA 3THIA 3DP6A 4HCWA 1IXIA 3W15C 1SDXA 3VXCA 2H5YA 3MQ9A 1JVXA 4OXVA 1B6HA 3LC8A 2HXWA 1ZBMA 2NWJA 5A5XB 1Y3PA 1LSTA 3KN8A 4FEBA 4G8HA 4GOTA 1Y3QA 5CBSA 2HZKA 3PGFA 4OTEA 5M2VA 2H9BA 3IL1B 3G7WA 3TFLA 1Y20A 1B5HA 5ICTA 2VOZA 4Q0CA 3VV5A 4MLQA 1P99A 5AA4A 1B46A 2V3UA 3IB1A 4RXLA 3EF7A 4LQ5A 3T93B 1D3KA 1DTZA 3KOSA 1GGGA 4I62A 3O9PA 1LAHE 4ZZAA 3V83A 4IO5A 4LUBA 2DE3A 1DSNA 1NKXA 3ILUB 1XVYA 2XX8A 4OERA 1JW4A 2HFBA 4NEDA 2DWAA 2PT1A 3Q27A 3RTFB 1UTBA 3K01A 1QJMA 1IIWA 4H8JA 3KBRA 4F19A 1B0HA 4BLAA 4OESA 1FQCA 1SI1A 4M1VA 2F7BA 3VVDA 5JTYA 4ELQA 3OXNA 3U1OA 2DOJA 2NUVA 3L6HA 4QFLA 1Z7ME 1AL3A 1POTA 3K4UA 1LBBA 3ZSFA 4R2FA 2VP1A 1S7YA 4DLDA 3IK6B 2PBWA 1B05A 1A7LA 3MPLA 5AE4A 1VSOA 4NE4A 3CIJA 4PQJA 3BKIB 3PUVE 3VDFA 2O51A 2THIA 4IO7A 1LB8A 3IOTA 3OEKA 5CC2A 2Q8JA 4X48A 4GWOA 1DOTA 5EHSA 3LSFB 3SETA 1I6BA 1BP5A 4G68A
chains in the Genus database with same CATH superfamily
3T9HB 4R9FA 1RDXA 4POWA 1B7HA 4OFJA 3PPOA 3CSGA 3TAJA 2YPNA 3EPEA 1FJ9A 4G8MA 4GBWA 4GQOA 4OQOA 5EYFA 1FBFA 2QVVA 5ITOA 1VE4A 4JSDA 1NH7A 3CFZA 4H46A 3U92A 4OFOA 1URDA 1G0IA 2VT5A 2ZZVA 2Z8DA 4QFOA 4TLMB 4N6KA 1GV8A 4DCXA 4JDFA 3TQWA 3D1RA 1MXYA 3KOTA 2R6GE 2B4LA 3VLUA 1LBWA 4OVQA 5A5LA 3W9VA 4PTKA 1UIUA 2JJKA 3FBPA 2XA5A 3SEWA 2OBGA 5BUUA 4IGRA 4R6HA 5EQ9A 1B3GA 3OD7A 1H44A 1RYOA 3TTNA 5ICQA 5KDTB 1ANFA 2VGQA 3IFAA 3V5AA 4YKKA 4EXKA 4N6PA 3N26A 5H8SA 1FW0A 1WVJA 4KYEA 5H8QA 3TELA 3UA8A 4UA8A 2CZHA 5IAIA 2RC8A 4OENA 1B1HA 3P7IA 4DIGA 4LN5A 3R26A 4JBZA 2Z22A 4H1XA 1I6QA 4NF8B 3KZGA 1EZPA 3H4ZA 4O3BA 4H6DA 4EXLA 3EHTA 2F35A 3TDJA 1MXZA 2DVCA 3ZKKA 4OWDA 5T3JA 1B1XA 4FECA 5CM6A 3HV1A 5I58A 1FJ6A 5I84A 3KN3A 3FZVA 4NAPA 4XFEA 1DPEA 4OA4A 1MXXA 3O28A 1FPFA 1MQJA 4N13A 3T1BA 2PX1A 1M5DA 5CMCA 1KA0A 1EYIA 1IMFA 4P11A 2P2AA 4PGPA 3LUZA 3FVGA 2ZYNA 1KA1A 4I8CA 3TTMA 1SW5A 2ONRA 4N07A 1DTGA 4F1VA 3B6TA 4O3CA 4IO3A 3CG1A 3MJNA 2CEYA 4QRZA 1N3XA 2OZZA 5H8FA 4ESWA 2GFEA 5CRYA 4QXDA 2Z8EA 4YU0A 1QULA 4NF5B 3KC1A 2RKMA 1YTVA 4IO6A 4XEQA 4NGUA 1QUIA 5H8HA 1D4NA 4GXSB 2P3VA 3V89B 3K6UA 2XXWA 5DEXB 4THIA 1FTOA 4HE2A 3U93A 1IXCA 1YPNA 1B7ZA 1EZ9A 1FQFA 2Y7RA 3UP9A 1BKAA 1Q1KA 3IX1A 2WEFA 2F3DA 2OWSA 1IMEA 3TCGA 4QF9A 2QRYA 1JEVA 2RCBA 5I5PA 5K2XA 2UVHA 2VPNA 3LR1A 5H8NB 4H65A 3S9LC 4GWSA 2ZNSA 2HHMA 1O7TA 3KEIA 4LZ7A 1BLFA 4YKIA 3RT8A 3N5LA 1YYZA 3MP8A 3EHSA 5DYHA 1B3HA 1BIYA 1P1OA 1SW2A 2WYPA 4Q8RA 5DEXA 3I6VA 3FATA 4R75A 3ZKLA 4PBQA 1B51A 3QAXA 3BFTA 3FXUA 1FPJA 2B3BA 1GVCA 3FXRA 2QSXA 1D9QA 4Z0IA 2XXIA 2D3IA 4P8BA 4ELRA 1LBXA 3KJTA 1FQBA 2XXKA 3GBBA 4P3LA 5AA2D 5HM4B 1SYIA 1QUKA 4ZE8A 2XD2A 3PD8A 3MPKA 1SBPA 2DE2A 4I1DA 1LBZA 4F39A 2FVZA 3RNNA 3OSQA 2XX7A 3MZ9A 4PETA 3ODBA 1H3DA 4RK9A 2AL4A 4G2ZA 3VLVA 1FPIA 3RUMA 3MC2A 2XXXA 3IOUA 4UACA 1MY2A 5AA3A 4HE1A 1LLSA 4RA1A 5I59A 1FPKA 3MP1A 2XD3A 3IO6A 2RF1A 1A55A 5L9SA 2OLBA 3C4MA 3PV0E 2I0BA 1XOCA 4ZEKA 3JZJA 3O29A 1SQYA 2AL5A 3HCQA 5JEIA 5AA4B 2FIEA 4X8RA 1M5FA 4M4GA 5FTIA 2M8CA 4POXA 2R71A 2QS1A 1MY3A 1IEJA 3O6IA 4R9GA 5CMMA 4PF6A 4EQBA 2QFLA 4F22A 5AA1A 2V93A 4O94A 1GR2A 3BBRA 1N7WA 2V3TA 4MFIA 2YLNA 2O1MA 2KLFA 4F3PA 2ABHA 3KBZA 1LBYA 2UVIA 5EYHA 1RDZA 2QVRA 1SW4A 3H6TA 1FBCA 4KQPA 4PFTA 4E0WA 3SZPA 1DBZA 4XTCQ 1UTBB 4O8MA 1VFDA 2B65A 3T96B 5LOMA 1IMCA 3A09A 4P0IA 1OVTA 4R73A 5JTYB 1MPDA 5IGAA 1NV6A 3KSXA 4U2RA 3ZS6A 3LSWA 4I9DA 3M3LA 4P1EA 4EUOA 2GHBA 3HO7A 2VHAA 1HSEA 1MM7A 3N6UA 1D9VA 4G68C 3M8UA 1FBPA 1B3FA 1XHYA 1XS5A 2WBDA 3E13X 5IZ3A 4F2QA 4G77A 5I3SA 2XXYA 5EQ7A 3LV0A 1NI9A 4DXCA 3RTWB 3UK4A 2DWHA 4XIGQ 5EHMA 2KQZA 2DQVA 4OZ9A 4O7MA 4XXUA 2YJPA 5TP9A 3C35A 2AIXA 3OMBA 4TLLB 1N0TA 1QVSA 4RK2A 2ONSA 1IITA 4QFKA 1B4ZA 1NUWA 3RQTA 1AMFA 1B52A 1URSA 4ZE9A 4IY6A 4MAGA 3GZGA 2OJTA 3IB2A 4QFPA 4PFYA 4G68B 1SPIA 1NUXA 1B2HA 3MSTA 3KN7A 4GXAA 2F7CA 2UYFA 3Q25A 2WX9A 1N3WA 1MG1A 1B40A 4BDRA 4KCDA 2XWIA 4ZS9A 2XXPA 1O64A 2P0SA 1B4HA 4MNIA 4ZEIA 5CMBA 4OVSA 1UQWA 3G3HA 4X1BA 4QSEA 2X7PA 4U4SA 3WAFA 3JYRA 3SKPA 3O97A 4H5GA 4ECFA 3OO8A 3K6WA 3QMFA 1A99A 5L9OA 1MH4A 4GRKA 4MMPA 5ET7A 1QUJA 4YICA 4YB7A 1NNFA 4PDHA 4GWUA 1B58A 1CE2A 4L17A 1PEBA 3U8QA 1H76A 1P1NA 3IB0A 4H5FA 2F3BA 3G3GA 1M5CA 3O6GA 4XKQA 4YZZA 1ZJLA 4HCYA 2QJEA 1L5TA 2PMSA 4RJZA 2G29A 2ALUA 3O66A 4IO2A 3GLBA 5I57A 4NF6A 4FEDA 5J1DA 4GFRA 2FIXA 1SW1A 4I3EA 3M3FA 4N6DA 4GWYA 4WEDA 1POY1 2WBBA 5H8QB 4KCCA 1Y4TA 1TT1A 2X7QA 4YKPA 1PB8A 1OQHA 4DDDA 1FPGA 2Y84A 2QS2A 4BDLA 4NWCA 3TCHA 2RINA 1LCTA 1DPPA 3SEUA 3C9HA 4QSCA 4E0XA 2DXYA 5DT6A 1A8FA 2BJIA 2ZZXA 1N76A 4FBPA 3CFLA 2XWKA 5I58B 2XWOA 3IR1A 4ONYA 5DW8A 1DK4A 4YB6A 4G4PA 2A5TA 4OHNA 4KXPA 2KR0A 3GBAA 3I3VA 2PCRA 4JSOA 4DXUA 2I4BA 2UYEA 1FQEA 1SI0A 3RYDA 4F29A 2BJJX 3EKIA 3FASA 4G8NA 3FUZA 4OVJA 2VD3A 4NF4A 1S50A 1MDP1 2VPOA 4ND9A 4OYVA 2Y7WA 1MQGA 3Q26A 5I56A 3PU5A 3O6HA 1PDAA 4ZEBA 3MVZA 4MBPA 1S9TA 4JWXA 3RLFE 4LA9A 2DSFA 3TTKA 3RPWA 2UVGA 3PMVA 3R7XA 4I3YA 1G0HA 4LQ2A 2I58A 4GX4A 3FVOA 1TWYA 3DM0A 1N84A 3H6VA 1PC3A 2OWZA 4GBVA 3CG3A 5H8FB 2CZIA 1NNTA 5DVJA 4F18A 1R9LA 4O7IA 1LFIA 4PCDA 5FBPA 4OEVA 1AWBA 2F36A 4KI0E 3BFUA 3TUSA 1FBGA 1UTHA 4PAIA 1MY0A 2VD2A 1TXFA 1EYKA 1P1WA 4MF3A 3K02A 3IORA 5H8HB 3H6UA 4WXJA 1FRPA 3HPIA 4P0GA 2HQ0A 3S9EA 4P9KA 1JQFA 3F11A 3PPRA 2I3VA 1SYHA 2W7YA 3PPNA 4F1YA 1EZOA 1JEUA 3DP4A 5F1QA 2V25A 3PUYE 3S2VA 5K2YA 4O3AA 2G93A 2F6PA 2Y7PA 4LATA 3HN0A 1FTMA 3PD9A 1KWHA 1K9ZA 3OSRA 3L6GA 2UVJA 1P1UA 4NF0A 4YMBA 2RC7A 4G61A 4K3FA 3B6WA 4U4XA 1B9JA 4C0RA 1QKBA 3HSTA 4KD5A 3FJGA 4DCYA 1MM6A 1MXUA 3H03A 4X1DA 3CR9A 3TCFA 4NWDA 1B3LA 2Q88A 3LSLA 4DZ1A 4EF2A 3A3UA 2XXTA 4AS5A 5LTCA 2XX9A 1A54A 2A5SA 2Y5LA 4U22A 3LBSA 1XI6A 1Z7NE 1OIBA 5ITPA 4JB7A 4DXBA 3FVNA 3K1MA 3IAZA 4GLIA 3SDFA 3H7MA 1QW0A 4PGNA 2I6EA 1HSJA 2PFZA 2ZYOA 1OVBA 1MXVA 3FJ7A 1MQDA 3EQ1A 2H25A 2I4CA 1FQAA 4HTGA 3IO4A 2XHDA 2XXUA 2PYYA 4NG7A 4DE8A 3TODA 4LZ5A 2DWJA 1USYE 4R72A 4AQ4A 1LBVA 3JV9A 3G3FA 4NMYA 2OX3A 3FGSA 3E79A 1QGXA 2QMXA 3UN6A 1OLAA 3KFMA 5J16A 5I59B 1FTLA 5TPAA 3S9MC 3PTYA 4RYAA 4FJPA 3TZAA 1MY4A 1K9YA 1R1NA 2XXVA 2PVUA 2B4MA 4HW8A 2WKYA 2UXAA 1PBQA 1R9QA 4IO4A 1LFGA 3E78A 4BDMA 5IKBA 1P1QA 2DDKA 4MEVA 3C31A 3QK6A 2QS3A 2I0CA 4PDDA 4MNPA 4JWYA 1B32A 3O2AA 4OVRA 4Q5TA 4IY5A 4MH5A 4R6KA 4P47A 4F3GA 1ZTYA 1O63A 2FA7A 2Q9TA 1CB6A 5B7DA 2LAOA 2F8DA 2ZYMA 3FVKA 5IZ1A 3ECRA 3MVYA 1USYH 5IZZA 2QL3A 1OQGA 2ZNTA 2REJA 5ISUA 1TFDA 1LAGE 1OMPA 1SVXB 3KGCA 2HZLA 2Q2CA 4F1UA 2QPQA 5EQAA 4MX6A 1EU8A 1VFEA 4TOZA 4FATA 1NMUA 1SD3A 3HHFA 3TKDA 2HAVA 3IOWA 1ZMGA 3K1PA 1RDYA 4KYSA 3KSJA 3E9XA 2O6AA 2ANJA 2FNCA 1M5EA 4LONB 4PFBA 1B7UA 4AB6A 3PPPA 3S4UA 3GXAA 4C1TA 4FIMA 4N4UA 2GH9A 2Z23A 4WKMA 5ET8A 2F7AA 3QUFA 5IZ3B 3VFJA 2P3NA 2GHAA 2DVZA 4JVCA 1FQDA 3T9UA 4C1UA 5TP9B 1FTKA 1II5A 1B0LA 4F31B 4U23A 1NNKA 4XKNA 1PB9A 1RYXA 1URGA 3BIHA 1LAFE 2HEUA 2R9JA 3K2DA 4PBHA 4FE8A 3KC0A 1A8EA 4GVOA 2OWTA 1IXGA 1AOVA 3IJXB 1JETA 3OO9A 2Z8FA 2REGA 3CI8A 1US5A 5A5XA 3G3IA 2RCAA 1AH5A 2DE4A 4U21A 4EF1A 1JNFA 4PP0A 3FD3A 3ILTB 3QSLA 3PUXE 3SERA 3C33A 1B3EA 2IEEA 3RN8A 4AB5A 5HBCA 2GQ1A 4JVIA 4JWOA 2V4CA 5DTBA 1NFTA 4HE0A 4MNCA 3HFUA 4U1ZA 2FHYA 1YAEA 1B5IA 4P56A 3MW0A 3V8XB 3SESA 3IOVA 4YB5A 5JK4A 1B5JA 3CSBA 3SEXA 1H43A 1I6AA 4HXVA 4BDNA 2R8TA 3OEMA 5L8DA 2IA4A 4IGTA 1NV1A 4N8GA 5CI5A 2DS9A 1T0KA 4PAFA 3OENA 5FTHA 2Q89A 1FSAA 1Y9UA 3VVEA 2O84X 5I57B 4NF6B 1LGBC 4GL0A 2V84A 4TQUQ 3D4GA 2FYIA 5HPQA 1FCKA 1QKAA 1HSLA 2ZZWA 1YCJA 3RGYA 1VDWA 3MZBA 1LAXA 1KZ8A 1F9BA 5BWJA 1MY1A 2CEXA 4KR5A 4HS7A 5I2KB 4GD5A 3R6UA 3K00A 3VVFA 3VE1B 2B3FA 3EN3A 3AXFA 2PT2A 4N8YA 5FHNA 3TEPA 4NHBA 4BDOA 3CVGA 2Q74A 4NN3A 2NXOA 4PAKA 4PFUA 1NH8A 1MH3A 3RT6B 1PB7A 5FHOA 2A5TB 3U72A 5EYGA 3G3KA 4GWXA 3LUYA 4R6YA 3PUWE 1Q35A 3CHGA 3QUJA 1FPLA 3B7DA 4QHQA 3CRBA 4Z7EA 3OO7A 2O1LA 3H3GA 4PFRA 1J1NA 1JW1A 1LFHA 5I2KA 3KJ7A 5ESYA 1IMBA 4PF8A 2ZNUA 4EQ7A 4NF4B 4ZZEA 1Y4CA 1NV0A 1TFAA 1Y1ZA 1CNQA 3I5OA 4QSDA 4GIZA 4YMAA 4NQ8A 3H06B 2ZMBA 1FPBA 5I56B 3BIGA 2Q2AA 3QYTA 3FV1A 1DMBA 3VXBA 3QIMA 1XVXA 2O7UA 4JXIA 2NVUB 4ELPA 1GTKA 4FORA 3UORA 4YKJA 5B70A 3T22A 3Q29A 5F24A 5AA2B 2DXRA 4PE3A 4ZDMA 4H8IA 3DELB 2H98A 2I3WA 2H4IA 3G3JA 4DI3D 5LDZA 4F3SA 1LEVA 4I40A 3T9VA 4PFIA 4GX6A 4RY1A 1UTHB 3TYHA 1NL5A 4R74A 3FXBA 3WAEA 1ELJA 1WODA 1ZIUA 3UIFA 3W9WA 4F2OA 3TTRA 2NOOA 1RKMA 4ESXA 5DVIA 1Q9DA 3PUZE 3PMWA 2GRVA 4ISUA 3OO6A 4MIJA 3ISPA 1VR5A 5EQ8A 4ZEDA 5AA2A 1ATGA 3RY3A 1Y3NA 5KDTA 1YZ0A 1ZU0A 3TMGA 2O68A 2DP8A 1NV4A 1FBHA 2XXHA 3MZ1A 1Y1MA 2OCUA 2D21A 3U94A 1BK4A 2HCAA 3OOAA 1MQIA 3IJOB 5I2NB 5ELVA 4RPNA 4XKPA 2OK2A 3MVXA 3MAMA 1LBCA 5DVFA 4FAJA 1XC1A 1INPA 5KCJB 4NF8A 4H0WA 4YAHX 4QFNA 2Y7KA 2E1SA 2ESNA 3PPQA 5L9MA 3T66A 3N94A 1IQ7A 2XXQA 1NNPA 3E3KA 2CZLA 1MQHA 2X26A 4XF5A 2O69A 5KZTA 3KG2A 2V3QA 4MJOA 1A40A 3DP8A 4RPOA 1R6ZA 5I2NA 1H45A 4QBAA 1FBEA 3LSXA 4N81A 3TTLA 3Q28A 1N04A 1FTAA 1ZKBA 3FXQA 5KCJA 3A3CA 3FIRA 3ONMA 2H99A 4U1OA 1D9YA 5F7VA 1IXHA 2O7IA 2QVUA 1US4A 3OELA 1JW5A 3SEYA 1FTJA 2QMWA 3VLWA 3MYUA 4IB2A 2ONKE 4KHZE 5IM2A 2HAUA 1WDNA 4PE5B 2AYSA 3K6VA 4WEPA 3SEVA 2DWIA 4MLVA 3S9NC 5TPAB 1UIVA 4H67A 3MP6A 5TU0A 4LVQA 1NV3A 3TQLA 2F97A 4MHFA 4GL8A 1I69A 3RPLB 2ZXTA 1ZLQA 1MPCA 3C36A 2F5XA 3CFXA 4AS4A 4P1LA 4OETA 2Y7IA 3UGWA 3MVWA 2DYXA 4OFLA 5CBRA 4KFQA 4ZECA 3H6WA 4Q30B 3QXMA 4NF5A 3EHUA 4ELOA 4OANA 2ZYKA 3K6XA 4BDQA 3FJMA 3PMXA 1PBPA 2XXRA 3D4CA 5CMKA 3C32A 4XKRA 1AIVA 4ZEFA 5ET5A 3MWBA 4N15A 4OEUA 1EYJA 2F34A 2PFYA 4PFWA 4X04A 4NX1A 2F78A 2D5WA 2CMOA 3FV2A 3RPLA 3C34A 3E4RA 4NTLA 3TPAA 1MDQA 1EH3A 3T0JA 5H8NA 1M5BA 1N7XA 4RNSA 3K1NA 2HXRA 4LP2B 4X9TA 4EDPA 3HHGA 4KPTA 2I48A 1MS7A 4R2BA 4N17A 2E0SA 3MBPA 1JVYA 4GF8A 2I49A 2MKZA 4LZ8A 1LCFA 3N6TA 1BTJA 3K0VA 2CZKA 3T9XB 5ET6A 2QS4A 1NUZA 3MUQA 4GWWA 2P1SA 4F3BA 1OLCA 1IMAA 3DLNA 1NV7A 1LB9A 2RC9A 3B50A 3USDA 1IZ1A 1MPBA 4N91A 4OMBA 3M3KA 1XT8A 1IUDA 4EQ9A 1MXWA 2F6GA 3B6QA 4KYDA 1MRPA 5FHMA 3THIA 3DP6A 4HCWA 1IXIA 3W15C 4H45A 1SDXA 4DI4B 2HPGA 3VXCA 2H5YA 3MQ9A 1JVXA 4OXVA 1IMDA 1FPDA 2Y5KA 4MCOA 1B6HA 3LC8A 2HXWA 1ZBMA 3A29A 3U65A 2NWJA 5A5XB 4JVDA 1Y3PA 1LSTA 3KN8A 4FEBA 4G8HA 3B8BA 4GOTA 1Y3QA 5CBSA 2HZKA 3PGFA 4OTEA 2XWVA 1DCUA 1NV5A 5M2VA 2H9BA 3IL1B 3G7WA 3TFLA 1Y20A 1B5HA 5ICTA 2VOZA 4Q0CA 3VV5A 4MLQA 1P99A 1NUYA 5AA4A 1B46A 2V3UA 3IB1A 4RXLA 3EF7A 2FBPA 3IFCA 4LQ5A 3T93B 1D3KA 1DTZA 3KOSA 1FPEA 1GGGA 4I62A 3O9PA 1LAHE 4ZZAA 3V83A 4IO5A 1YXIA 2DE3A 4LUBA 1DSNA 4PC9A 1NKXA 3ILUB 1XVYA 4UABA 2XX8A 4OERA 1FBDA 1JW4A 2HFBA 4NEDA 4OVPA 2DWAA 4IR8A 2PT1A 4GX3A 3ROJA 2L5VA 3Q27A 3RTFB 1UTBA 3K01A 1QJMA 1IIWA 4H8JA 5I7IA 3KBRA 3NOHA 1B0HA 4F19A 4BLAA 4OESA 1FQCA 1SI1A 1NV2A 4M1VA 2F7BA 3VVDA 5JTYA 4ELQA 4OVTA 3OXNA 3U1OA 2DOJA 2NUVA 3L6HA 4GWZA 4QFLA 1Z7ME 1AL3A 1POTA 3K4UA 1LBBA 3ZSFA 4R2FA 2VP1A 1S7YA 4DLDA 3IK6B 2PBWA 1B05A 1A7LA 3MPLA 5AE4A 1VSOA 4NE4A 3CIJA 4PQJA 3BKIB 3PUVE 3VDFA 2O51A 2THIA 4IO7A 1LB8A 3IOTA 3OEKA 1JP4A 2Q8JA 2WYKA 5CC2A 4X48A 4GWOA 1DOTA 5EHSA 3LSFB 3SETA 1I6BA 3GYYA 1BP5A 2Q8MA 4G68A
chains in the Genus database with same CATH topology
3T9HB 4R9FA 4POWA 1B7HA 4OFJA 3PPOA 3CSGA 3TAJA 2YPNA 3EPEA 4G8MA 5EYFA 4GQOA 4OQOA 5ITOA 1VE4A 4JSDA 1NH7A 3CFZA 3U92A 4OFOA 1URDA 2Z8DA 4QFOA 4TLMB 1GV8A 4DCXA 4JDFA 3TQWA 1MXYA 3KOTA 2R6GE 3VLUA 3W9VA 1UIUA 3SEWA 2OBGA 5BUUA 4IGRA 4R6HA 1B3GA 3OD7A 1H44A 1RYOA 3TTNA 5ICQA 5KDTB 1ANFA 2VGQA 3V5AA 4YKKA 4EXKA 4N6PA 3N26A 5H8SA 1FW0A 1WVJA 4KYEA 5H8QA 3TELA 3UA8A 4UA8A 5IAIA 2RC8A 4OENA 1B1HA 3P7IA 4DIGA 3R26A 4JBZA 2Z22A 4H1XA 1I6QA 4NF8B 3KZGA 1EZPA 3H4ZA 4O3BA 4H6DA 4EXLA 3EHTA 2F35A 3TDJA 1MXZA 2DVCA 3ZKKA 4OWDA 1B1XA 4FECA 5CM6A 3HV1A 5I58A 5I84A 3KN3A 3FZVA 1DPEA 1MXXA 3O28A 1MQJA 4N13A 2PX1A 1M5DA 5CMCA 4P11A 2P2AA 3FVGA 2ZYNA 4I8CA 3TTMA 1SW5A 2ONRA 4N07A 1DTGA 4F1VA 3B6TA 4O3CA 4IO3A 3CG1A 3MJNA 4QRZA 1N3XA 2OZZA 5H8FA 4ESWA 2GFEA 5CRYA 2Z8EA 4YU0A 1QULA 4NF5B 2RKMA 1YTVA 4IO6A 1QUIA 5H8HA 1D4NA 4GXSB 3V89B 3K6UA 2XXWA 5DEXB 4THIA 1FTOA 3U93A 1IXCA 1YPNA 1B7ZA 1EZ9A 1FQFA 2Y7RA 3UP9A 1BKAA 1Q1KA 3IX1A 2OWSA 3TCGA 4QF9A 2QRYA 1JEVA 2RCBA 5K2XA 2UVHA 3LR1A 5H8NB 4H65A 3S9LC 2ZNSA 1O7TA 3KEIA 4LZ7A 1BLFA 4YKIA 3RT8A 3N5LA 3MP8A 3EHSA 5DYHA 1B3HA 1BIYA 1P1OA 1SW2A 4Q8RA 5DEXA 3I6VA 3FATA 4R75A 3ZKLA 1B51A 3QAXA 3BFTA 3FXUA 2B3BA 1GVCA 3FXRA 2QSXA 4Z0IA 2XXIA 2D3IA 4ELRA 3KJTA 1FQBA 3GBBA 5AA2D 5HM4B 1SYIA 1QUKA 4ZE8A 2XD2A 3PD8A 3MPKA 1SBPA 2DE2A 4I1DA 4F39A 3RNNA 3OSQA 2XX7A 3MZ9A 4PETA 3ODBA 1H3DA 4RK9A 2AL4A 4G2ZA 3VLVA 3RUMA 3MC2A 2XXXA 3IOUA 4UACA 1MY2A 5AA3A 1LLSA 4RA1A 5I59A 3MP1A 2XD3A 3IO6A 2RF1A 1A55A 5L9SA 2OLBA 3C4MA 3PV0E 2I0BA 1XOCA 4ZEKA 3JZJA 3O29A 1SQYA 2AL5A 3HCQA 5JEIA 5AA4B 1M5FA 4M4GA 5FTIA 2M8CA 4POXA 2R71A 2QS1A 1MY3A 1IEJA 3O6IA 4R9GA 5CMMA 4EQBA 4F22A 5AA1A 2V93A 1GR2A 3BBRA 1N7WA 2V3TA 4MFIA 2YLNA 2O1MA 2KLFA 4F3PA 2ABHA 2UVIA 1SW4A 3H6TA 4KQPA 4PFTA 4E0WA 4XTCQ 1UTBB 3T96B 1VFDA 2B65A 5LOMA 3A09A 4P0IA 1OVTA 4R73A 5JTYB 1MPDA 3KSXA 4U2RA 3ZS6A 3LSWA 4I9DA 3M3LA 4EUOA 2GHBA 3HO7A 2VHAA 1HSEA 1MM7A 3N6UA 1D9VA 4G68C 3M8UA 1B3FA 1XHYA 1XS5A 3E13X 4F2QA 4G77A 2XXYA 4DXCA 3RTWB 3UK4A 2DWHA 4XIGQ 5EHMA 2DQVA 4OZ9A 4XXUA 2YJPA 5TP9A 3C35A 2AIXA 3OMBA 4TLLB 1N0TA 1QVSA 4RK2A 2ONSA 1IITA 4QFKA 1B4ZA 3RQTA 1AMFA 1B52A 1URSA 4ZE9A 4IY6A 3GZGA 2OJTA 3IB2A 4QFPA 4PFYA 4G68B 1B2HA 3KN7A 4GXAA 2F7CA 2UYFA 3Q25A 1N3WA 1MG1A 1B40A 4BDRA 4KCDA 4ZS9A 2XXPA 1O64A 2P0SA 1B4HA 4ZEIA 5CMBA 1UQWA 3G3HA 4X1BA 4QSEA 2X7PA 4U4SA 3WAFA 3JYRA 3SKPA 3O97A 4H5GA 4ECFA 3OO8A 3K6WA 1A99A 5L9OA 1MH4A 4GRKA 1QUJA 4YICA 4YB7A 1NNFA 1B58A 1CE2A 4L17A 1PEBA 3U8QA 1H76A 1P1NA 3IB0A 4H5FA 3G3GA 1M5CA 3O6GA 4XKQA 4YZZA 1ZJLA 4HCYA 2QJEA 1L5TA 2PMSA 4RJZA 2G29A 2ALUA 3O66A 4IO2A 3GLBA 5I57A 4NF6A 4FEDA 5J1DA 4GFRA 1SW1A 3M3FA 4WEDA 1POY1 5H8QB 4KCCA 1Y4TA 1TT1A 2X7QA 4YKPA 1PB8A 1OQHA 4DDDA 2Y84A 2QS2A 4BDLA 4NWCA 3TCHA 2RINA 1LCTA 1DPPA 3SEUA 3C9HA 4QSCA 4E0XA 2DXYA 5DT6A 1A8FA 1N76A 3CFLA 5I58B 3IR1A 4ONYA 4YB6A 4G4PA 2A5TA 4OHNA 3GBAA 3I3VA 4JSOA 4DXUA 2I4BA 2UYEA 1FQEA 1SI0A 4F29A 2BJJX 3FASA 4G8NA 3FUZA 4OVJA 2VD3A 4NF4A 1S50A 1MDP1 4ND9A 4OYVA 2Y7WA 1MQGA 3Q26A 5I56A 3PU5A 3O6HA 1PDAA 4ZEBA 3MVZA 4MBPA 1S9TA 4JWXA 3RLFE 4LA9A 2DSFA 3TTKA 3RPWA 2UVGA 3PMVA 3R7XA 4LQ2A 2I58A 3FVOA 1TWYA 3DM0A 1N84A 3H6VA 1PC3A 3CG3A 5H8FB 1NNTA 5DVJA 4F18A 1R9LA 1LFIA 4OEVA 2F36A 4KI0E 3BFUA 3TUSA 1UTHA 1MY0A 2VD2A 1TXFA 1P1WA 4MF3A 3K02A 3IORA 5H8HB 3H6UA 4WXJA 3HPIA 4P0GA 2HQ0A 3S9EA 1JQFA 3F11A 3PPRA 2I3VA 1SYHA 2W7YA 3PPNA 4F1YA 1EZOA 1JEUA 3DP4A 5F1QA 2V25A 3PUYE 3S2VA 5K2YA 4O3AA 2G93A 2F6PA 2Y7PA 4LATA 3HN0A 1FTMA 3PD9A 1KWHA 3OSRA 3L6GA 2UVJA 1P1UA 4YMBA 2RC7A 4K3FA 3B6WA 4U4XA 1B9JA 4C0RA 1QKBA 3HSTA 4KD5A 3FJGA 4DCYA 1MM6A 1MXUA 3H03A 4X1DA 3CR9A 3TCFA 4NWDA 1B3LA 2Q88A 3LSLA 4DZ1A 4EF2A 3A3UA 2XXTA 2XX9A 1A54A 2A5SA 4U22A 3LBSA 1Z7NE 1OIBA 5ITPA 4JB7A 4DXBA 3FVNA 3K1MA 3IAZA 4GLIA 3SDFA 3H7MA 1QW0A 2I6EA 1HSJA 2ZYOA 1OVBA 1MXVA 3FJ7A 1MQDA 3EQ1A 2H25A 2I4CA 1FQAA 4HTGA 3IO4A 2XHDA 2XXUA 2PYYA 4DE8A 3TODA 4LZ5A 2DWJA 1USYE 4R72A 4AQ4A 3JV9A 3G3FA 4NMYA 3FGSA 2QMXA 3UN6A 1OLAA 3KFMA 5I59B 1FTLA 5TPAA 3S9MC 4RYAA 4FJPA 3TZAA 1MY4A 1R1NA 2XXVA 2PVUA 4HW8A 2WKYA 2UXAA 1PBQA 1R9QA 4IO4A 1LFGA 4BDMA 5IKBA 1P1QA 3C31A 3QK6A 2QS3A 2I0CA 4JWYA 1B32A 3O2AA 4Q5TA 4IY5A 4MH5A 4R6KA 4F3GA 1ZTYA 1O63A 2FA7A 2Q9TA 1CB6A 5B7DA 2LAOA 2F8DA 2ZYMA 3FVKA 3ECRA 3MVYA 1USYH 2QL3A 1OQGA 2ZNTA 2REJA 5ISUA 1TFDA 1LAGE 1OMPA 1SVXB 3KGCA 2HZLA 2Q2CA 4F1UA 2QPQA 1EU8A 1VFEA 4TOZA 4FATA 1NMUA 1SD3A 3HHFA 3TKDA 2HAVA 3IOWA 1ZMGA 3K1PA 4KYSA 3KSJA 3E9XA 2O6AA 2ANJA 2FNCA 1M5EA 4LONB 1B7UA 4AB6A 3PPPA 3S4UA 3GXAA 4C1TA 4FIMA 2GH9A 2Z23A 4WKMA 2F7AA 3QUFA 3VFJA 2GHAA 2DVZA 1FQDA 3T9UA 4C1UA 5TP9B 1FTKA 1II5A 1B0LA 4F31B 4U23A 1NNKA 4XKNA 1PB9A 1RYXA 1URGA 1LAFE 2HEUA 2R9JA 3K2DA 4FE8A 1A8EA 4GVOA 2OWTA 1IXGA 1AOVA 3IJXB 1JETA 3OO9A 2Z8FA 2REGA 3CI8A 1US5A 5A5XA 3G3IA 2RCAA 1AH5A 2DE4A 4U21A 4EF1A 1JNFA 4PP0A 3FD3A 3ILTB 3QSLA 3PUXE 3SERA 3C33A 1B3EA 2IEEA 3RN8A 4AB5A 5HBCA 4JWOA 5DTBA 1NFTA 4U1ZA 1YAEA 1B5IA 3MW0A 3V8XB 3SESA 3IOVA 4YB5A 5JK4A 1B5JA 3CSBA 3SEXA 1H43A 1I6AA 4BDNA 3OEMA 5L8DA 2IA4A 4IGTA 5CI5A 2DS9A 1T0KA 3OENA 5FTHA 2Q89A 1Y9UA 3VVEA 2O84X 5I57B 4NF6B 1LGBC 4GL0A 2V84A 4TQUQ 3D4GA 2FYIA 5HPQA 1FCKA 1QKAA 1HSLA 1YCJA 3RGYA 3MZBA 1LAXA 1F9BA 5BWJA 1MY1A 4KR5A 4HS7A 5I2KB 4GD5A 3R6UA 3K00A 3VVFA 3VE1B 2B3FA 3EN3A 3AXFA 2PT2A 5FHNA 3TEPA 4BDOA 3CVGA 2NXOA 4PFUA 1NH8A 1MH3A 3RT6B 1PB7A 5FHOA 2A5TB 3U72A 3G3KA 3LUYA 4R6YA 3PUWE 1Q35A 3QUJA 3B7DA 4QHQA 3CRBA 4Z7EA 3OO7A 2O1LA 3H3GA 1J1NA 1JW1A 1LFHA 5I2KA 3KJ7A 2ZNUA 4EQ7A 4NF4B 4ZZEA 1Y4CA 1TFAA 1Y1ZA 3I5OA 4QSDA 4GIZA 4YMAA 3H06B 2ZMBA 5I56B 2Q2AA 3QYTA 3FV1A 1DMBA 3VXBA 3QIMA 1XVXA 2O7UA 4JXIA 2NVUB 4ELPA 1GTKA 4FORA 3UORA 4YKJA 5B70A 3T22A 3Q29A 5AA2B 2DXRA 4ZDMA 4H8IA 3DELB 2H98A 2I3WA 2H4IA 3G3JA 4F3SA 3T9VA 4RY1A 1UTHB 3TYHA 1NL5A 4R74A 3WAEA 1ELJA 1WODA 1ZIUA 3UIFA 3W9WA 4F2OA 3TTRA 2NOOA 1RKMA 4ESXA 5DVIA 3PUZE 3PMWA 2GRVA 4ISUA 3OO6A 1VR5A 4ZEDA 5AA2A 1ATGA 3RY3A 1Y3NA 5KDTA 1ZU0A 3TMGA 2O68A 2DP8A 2XXHA 3MZ1A 1Y1MA 2OCUA 2D21A 3U94A 2HCAA 3OOAA 1MQIA 3IJOB 5I2NB 5ELVA 4RPNA 4XKPA 2OK2A 3MVXA 3MAMA 1LBCA 5DVFA 4FAJA 1XC1A 5KCJB 4NF8A 4H0WA 4YAHX 4QFNA 2Y7KA 2E1SA 2ESNA 3PPQA 5L9MA 3T66A 3N94A 1IQ7A 2XXQA 1NNPA 3E3KA 2CZLA 1MQHA 2X26A 2O69A 5KZTA 3KG2A 2V3QA 1A40A 3DP8A 4RPOA 1R6ZA 5I2NA 1H45A 3LSXA 3TTLA 3Q28A 1N04A 1ZKBA 3FXQA 5KCJA 3A3CA 3FIRA 3ONMA 2H99A 4U1OA 1D9YA 5F7VA 1IXHA 2O7IA 1US4A 3OELA 1JW5A 3SEYA 1FTJA 2QMWA 3VLWA 4IB2A 2ONKE 4KHZE 2HAUA 1WDNA 4PE5B 2AYSA 3K6VA 4WEPA 3SEVA 2DWIA 4MLVA 3S9NC 5TPAB 1UIVA 4H67A 3MP6A 5TU0A 4LVQA 3TQLA 2F97A 4GL8A 1I69A 2ZXTA 1ZLQA 1MPCA 3C36A 2F5XA 3CFXA 4OETA 2Y7IA 3UGWA 3MVWA 2DYXA 4OFLA 5CBRA 4KFQA 4ZECA 3H6WA 4Q30B 3QXMA 4NF5A 3EHUA 4ELOA 2ZYKA 3K6XA 4BDQA 3FJMA 3PMXA 1PBPA 2XXRA 3D4CA 5CMKA 3C32A 4XKRA 1AIVA 4ZEFA 3MWBA 4OEUA 2F34A 4PFWA 2F78A 2D5WA 2CMOA 3FV2A 3C34A 3E4RA 4NTLA 3TPAA 1MDQA 1EH3A 5H8NA 1M5BA 1N7XA 4RNSA 3K1NA 4LP2B 4X9TA 4EDPA 3HHGA 4KPTA 2I48A 1MS7A 4R2BA 2E0SA 3MBPA 1JVYA 4GF8A 2I49A 4LZ8A 1LCFA 3N6TA 1BTJA 3K0VA 3T9XB 2QS4A 3MUQA 2P1SA 4F3BA 1OLCA 3DLNA 1LB9A 2RC9A 3USDA 1IZ1A 1MPBA 4OMBA 3M3KA 1XT8A 1IUDA 4EQ9A 1MXWA 2F6GA 3B6QA 4KYDA 1MRPA 5FHMA 3THIA 3DP6A 4HCWA 1IXIA 3W15C 1SDXA 3VXCA 2H5YA 3MQ9A 1JVXA 4OXVA 1B6HA 3LC8A 2HXWA 1ZBMA 2NWJA 5A5XB 1Y3PA 1LSTA 3KN8A 4FEBA 4G8HA 4GOTA 1Y3QA 5CBSA 2HZKA 3PGFA 4OTEA 5M2VA 2H9BA 3IL1B 3G7WA 3TFLA 1Y20A 1B5HA 5ICTA 2VOZA 4Q0CA 3VV5A 4MLQA 1P99A 5AA4A 1B46A 2V3UA 3IB1A 4RXLA 3EF7A 4LQ5A 3T93B 1D3KA 1DTZA 3KOSA 1GGGA 4I62A 3O9PA 1LAHE 4ZZAA 3V83A 4IO5A 4LUBA 2DE3A 1DSNA 1NKXA 3ILUB 1XVYA 2XX8A 4OERA 1JW4A 2HFBA 4NEDA 2DWAA 2PT1A 3Q27A 3RTFB 1UTBA 3K01A 1QJMA 1IIWA 4H8JA 3KBRA 4F19A 1B0HA 4BLAA 4OESA 1FQCA 1SI1A 4M1VA 2F7BA 3VVDA 5JTYA 4ELQA 3OXNA 3U1OA 2DOJA 2NUVA 3L6HA 4QFLA 1Z7ME 1AL3A 1POTA 3K4UA 1LBBA 3ZSFA 4R2FA 2VP1A 1S7YA 4DLDA 3IK6B 2PBWA 1B05A 1A7LA 3MPLA 5AE4A 1VSOA 4NE4A 3CIJA 4PQJA 3BKIB 3PUVE 3VDFA 2O51A 2THIA 4IO7A 1LB8A 3IOTA 3OEKA 5CC2A 2Q8JA 4X48A 4GWOA 1DOTA 5EHSA 3LSFB 3SETA 1I6BA 1BP5A 4G68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9H B;  4R9F A;  4POW A;  1B7H A;  4OFJ A;  3PPO A;  3CSG A;  3TAJ A;  2YPN A;  3EPE A;  4G8M A;  5EYF A;  4GQO A;  4OQO A;  5ITO A;  1VE4 A;  4JSD A;  1NH7 A;  3CFZ A;  3U92 A;  4OFO A;  1URD A;  2Z8D A;  4QFO A;  4TLM B;  1GV8 A;  4DCX A;  4JDF A;  3TQW A;  1MXY A;  3KOT A;  2R6G E;  3VLU A;  3W9V A;  1UIU A;  3SEW A;  2OBG A;  5BUU A;  4IGR A;  4R6H A;  1B3G A;  3OD7 A;  1H44 A;  1RYO A;  3TTN A;  5ICQ A;  5KDT B;  1ANF A;  2VGQ A;  3V5A A;  4YKK A;  4EXK A;  4N6P A;  3N26 A;  5H8S A;  1FW0 A;  1WVJ A;  4KYE A;  5H8Q A;  3TEL A;  3UA8 A;  4UA8 A;  5IAI A;  2RC8 A;  4OEN A;  1B1H A;  3P7I A;  4DIG A;  3R26 A;  4JBZ A;  2Z22 A;  4H1X A;  1I6Q A;  4NF8 B;  3KZG A;  1EZP A;  3H4Z A;  4O3B A;  4H6D A;  4EXL A;  3EHT A;  2F35 A;  3TDJ A;  1MXZ A;  2DVC A;  3ZKK A;  4OWD A;  1B1X A;  4FEC A;  5CM6 A;  3HV1 A;  5I58 A;  5I84 A;  3KN3 A;  3FZV A;  1DPE A;  1MXX A;  3O28 A;  1MQJ A;  4N13 A;  2PX1 A;  1M5D A;  5CMC A;  4P11 A;  2P2A A;  3FVG A;  2ZYN A;  4I8C A;  3TTM A;  1SW5 A;  2ONR A;  4N07 A;  1DTG A;  4F1V A;  3B6T A;  4O3C A;  4IO3 A;  3CG1 A;  3MJN A;  4QRZ A;  1N3X A;  2OZZ A;  5H8F A;  4ESW A;  2GFE A;  5CRY A;  2Z8E A;  4YU0 A;  1QUL A;  4NF5 B;  2RKM A;  1YTV A;  4IO6 A;  1QUI A;  5H8H A;  1D4N A;  4GXS B;  3V89 B;  3K6U A;  2XXW A;  5DEX B;  4THI A;  1FTO A;  3U93 A;  1IXC A;  1YPN A;  1B7Z A;  1EZ9 A;  1FQF A;  2Y7R A;  3UP9 A;  1BKA A;  1Q1K A;  3IX1 A;  2OWS A;  3TCG A;  4QF9 A;  2QRY A;  1JEV A;  2RCB A;  5K2X A;  2UVH A;  3LR1 A;  5H8N B;  4H65 A;  3S9L C;  2ZNS A;  1O7T A;  3KEI A;  4LZ7 A;  1BLF A;  4YKI A;  3RT8 A;  3N5L A;  3MP8 A;  3EHS A;  5DYH A;  1B3H A;  1BIY A;  1P1O A;  1SW2 A;  4Q8R A;  5DEX A;  3I6V A;  3FAT A;  4R75 A;  3ZKL A;  1B51 A;  3QAX A;  3BFT A;  3FXU A;  2B3B A;  1GVC A;  3FXR A;  2QSX A;  4Z0I A;  2XXI A;  2D3I A;  4ELR A;  3KJT A;  1FQB A;  3GBB A;  5AA2 D;  5HM4 B;  1SYI A;  1QUK A;  4ZE8 A;  2XD2 A;  3PD8 A;  3MPK A;  1SBP A;  2DE2 A;  4I1D A;  4F39 A;  3RNN A;  3OSQ A;  2XX7 A;  3MZ9 A;  4PET A;  3ODB A;  1H3D A;  4RK9 A;  2AL4 A;  4G2Z A;  3VLV A;  3RUM A;  3MC2 A;  2XXX A;  3IOU A;  4UAC A;  1MY2 A;  5AA3 A;  1LLS A;  4RA1 A;  5I59 A;  3MP1 A;  2XD3 A;  3IO6 A;  2RF1 A;  1A55 A;  5L9S A;  2OLB A;  3C4M A;  3PV0 E;  2I0B A;  1XOC A;  4ZEK A;  3JZJ A;  3O29 A;  1SQY A;  2AL5 A;  3HCQ A;  5JEI A;  5AA4 B;  1M5F A;  4M4G A;  5FTI A;  2M8C A;  4POX A;  2R71 A;  2QS1 A;  1MY3 A;  1IEJ A;  3O6I A;  4R9G A;  5CMM A;  4EQB A;  4F22 A;  5AA1 A;  2V93 A;  1GR2 A;  3BBR A;  1N7W A;  2V3T A;  4MFI A;  2YLN A;  2O1M A;  2KLF A;  4F3P A;  2ABH A;  2UVI A;  1SW4 A;  3H6T A;  4KQP A;  4PFT A;  4E0W A;  4XTC Q;  1UTB B;  3T96 B;  1VFD A;  2B65 A;  5LOM A;  3A09 A;  4P0I A;  1OVT A;  4R73 A;  5JTY B;  1MPD A;  3KSX A;  4U2R A;  3ZS6 A;  3LSW A;  4I9D A;  3M3L A;  4EUO A;  2GHB A;  3HO7 A;  2VHA A;  1HSE A;  1MM7 A;  3N6U A;  1D9V A;  4G68 C;  3M8U A;  1B3F A;  1XHY A;  1XS5 A;  3E13 X;  4F2Q A;  4G77 A;  2XXY A;  4DXC A;  3RTW B;  3UK4 A;  2DWH A;  4XIG Q;  5EHM A;  2DQV A;  4OZ9 A;  4XXU A;  2YJP A;  5TP9 A;  3C35 A;  2AIX A;  3OMB A;  4TLL B;  1N0T A;  1QVS A;  4RK2 A;  2ONS A;  1IIT A;  4QFK A;  1B4Z A;  3RQT A;  1AMF A;  1B52 A;  1URS A;  4ZE9 A;  4IY6 A;  3GZG A;  2OJT A;  3IB2 A;  4QFP A;  4PFY A;  4G68 B;  1B2H A;  3KN7 A;  4GXA A;  2F7C A;  2UYF A;  3Q25 A;  1N3W A;  1MG1 A;  1B40 A;  4BDR A;  4KCD A;  4ZS9 A;  2XXP A;  1O64 A;  2P0S A;  1B4H A;  4ZEI A;  5CMB A;  1UQW A;  3G3H A;  4X1B A;  4QSE A;  2X7P A;  4U4S A;  3WAF A;  3JYR A;  3SKP A;  3O97 A;  4H5G A;  4ECF A;  3OO8 A;  3K6W A;  1A99 A;  5L9O A;  1MH4 A;  4GRK A;  1QUJ A;  4YIC A;  4YB7 A;  1NNF A;  1B58 A;  1CE2 A;  4L17 A;  1PEB A;  3U8Q A;  1H76 A;  1P1N A;  3IB0 A;  4H5F A;  3G3G A;  1M5C A;  3O6G A;  4XKQ A;  4YZZ A;  1ZJL A;  4HCY A;  2QJE A;  1L5T A;  2PMS A;  4RJZ A;  2G29 A;  2ALU A;  3O66 A;  4IO2 A;  3GLB A;  5I57 A;  4NF6 A;  4FED A;  5J1D A;  4GFR A;  1SW1 A;  3M3F A;  4WED A;  1POY 1;  5H8Q B;  4KCC A;  1Y4T A;  1TT1 A;  2X7Q A;  4YKP A;  1PB8 A;  1OQH A;  4DDD A;  2Y84 A;  2QS2 A;  4BDL A;  4NWC A;  3TCH A;  2RIN A;  1LCT A;  1DPP A;  3SEU A;  3C9H A;  4QSC A;  4E0X A;  2DXY A;  5DT6 A;  1A8F A;  1N76 A;  3CFL A;  5I58 B;  3IR1 A;  4ONY A;  4YB6 A;  4G4P A;  2A5T A;  4OHN A;  3GBA A;  3I3V A;  4JSO A;  4DXU A;  2I4B A;  2UYE A;  1FQE A;  1SI0 A;  4F29 A;  2BJJ X;  3FAS A;  4G8N A;  3FUZ A;  4OVJ A;  2VD3 A;  4NF4 A;  1S50 A;  1MDP 1;  4ND9 A;  4OYV A;  2Y7W A;  1MQG A;  3Q26 A;  5I56 A;  3PU5 A;  3O6H A;  1PDA A;  4ZEB A;  3MVZ A;  4MBP A;  1S9T A;  4JWX A;  3RLF E;  4LA9 A;  2DSF A;  3TTK A;  3RPW A;  2UVG A;  3PMV A;  3R7X A;  4LQ2 A;  2I58 A;  3FVO A;  1TWY A;  3DM0 A;  1N84 A;  3H6V A;  1PC3 A;  3CG3 A;  5H8F B;  1NNT A;  5DVJ A;  4F18 A;  1R9L A;  1LFI A;  4OEV A;  2F36 A;  4KI0 E;  3BFU A;  3TUS A;  1UTH A;  1MY0 A;  2VD2 A;  1TXF A;  1P1W A;  4MF3 A;  3K02 A;  3IOR A;  5H8H B;  3H6U A;  4WXJ A;  3HPI A;  4P0G A;  2HQ0 A;  3S9E A;  1JQF A;  3F11 A;  3PPR A;  2I3V A;  1SYH A;  2W7Y A;  3PPN A;  4F1Y A;  1EZO A;  1JEU A;  3DP4 A;  5F1Q A;  2V25 A;  3PUY E;  3S2V A;  5K2Y A;  4O3A A;  2G93 A;  2F6P A;  2Y7P A;  4LAT A;  3HN0 A;  1FTM A;  3PD9 A;  1KWH A;  3OSR A;  3L6G A;  2UVJ A;  1P1U A;  4YMB A;  2RC7 A;  4K3F A;  3B6W A;  4U4X A;  1B9J A;  4C0R A;  1QKB A;  3HST A;  4KD5 A;  3FJG A;  4DCY A;  1MM6 A;  1MXU A;  3H03 A;  4X1D A;  3CR9 A;  3TCF A;  4NWD A;  1B3L A;  2Q88 A;  3LSL A;  4DZ1 A;  4EF2 A;  3A3U A;  2XXT A;  2XX9 A;  1A54 A;  2A5S A;  4U22 A;  3LBS A;  1Z7N E;  1OIB A;  5ITP A;  4JB7 A;  4DXB A;  3FVN A;  3K1M A;  3IAZ A;  4GLI A;  3SDF A;  3H7M A;  1QW0 A;  2I6E A;  1HSJ A;  2ZYO A;  1OVB A;  1MXV A;  3FJ7 A;  1MQD A;  3EQ1 A;  2H25 A;  2I4C A;  1FQA A;  4HTG A;  3IO4 A;  2XHD A;  2XXU A;  2PYY A;  4DE8 A;  3TOD A;  4LZ5 A;  2DWJ A;  1USY E;  4R72 A;  4AQ4 A;  3JV9 A;  3G3F A;  4NMY A;  3FGS A;  2QMX A;  3UN6 A;  1OLA A;  3KFM A;  5I59 B;  1FTL A;  5TPA A;  3S9M C;  4RYA A;  4FJP A;  3TZA A;  1MY4 A;  1R1N A;  2XXV A;  2PVU A;  4HW8 A;  2WKY A;  2UXA A;  1PBQ A;  1R9Q A;  4IO4 A;  1LFG A;  4BDM A;  5IKB A;  1P1Q A;  3C31 A;  3QK6 A;  2QS3 A;  2I0C A;  4JWY A;  1B32 A;  3O2A A;  4Q5T A;  4IY5 A;  4MH5 A;  4R6K A;  4F3G A;  1ZTY A;  1O63 A;  2FA7 A;  2Q9T A;  1CB6 A;  5B7D A;  2LAO A;  2F8D A;  2ZYM A;  3FVK A;  3ECR A;  3MVY A;  1USY H;  2QL3 A;  1OQG A;  2ZNT A;  2REJ A;  5ISU A;  1TFD A;  1LAG E;  1OMP A;  1SVX B;  3KGC A;  2HZL A;  2Q2C A;  4F1U A;  2QPQ A;  1EU8 A;  1VFE A;  4TOZ A;  4FAT A;  1NMU A;  1SD3 A;  3HHF A;  3TKD A;  2HAV A;  3IOW A;  1ZMG A;  3K1P A;  4KYS A;  3KSJ A;  3E9X A;  2O6A A;  2ANJ A;  2FNC A;  1M5E A;  4LON B;  1B7U A;  4AB6 A;  3PPP A;  3S4U A;  3GXA A;  4C1T A;  4FIM A;  2GH9 A;  2Z23 A;  4WKM A;  2F7A A;  3QUF A;  3VFJ A;  2GHA A;  2DVZ A;  1FQD A;  3T9U A;  4C1U A;  5TP9 B;  1FTK A;  1II5 A;  1B0L A;  4F31 B;  4U23 A;  1NNK A;  4XKN A;  1PB9 A;  1RYX A;  1URG A;  1LAF E;  2HEU A;  2R9J A;  3K2D A;  4FE8 A;  1A8E A;  4GVO A;  2OWT A;  1IXG A;  1AOV A;  3IJX B;  1JET A;  3OO9 A;  2Z8F A;  2REG A;  3CI8 A;  1US5 A;  5A5X A;  3G3I A;  2RCA A;  1AH5 A;  2DE4 A;  4U21 A;  4EF1 A;  1JNF A;  4PP0 A;  3FD3 A;  3ILT B;  3QSL A;  3PUX E;  3SER A;  3C33 A;  1B3E A;  2IEE A;  3RN8 A;  4AB5 A;  5HBC A;  4JWO A;  5DTB A;  1NFT A;  4U1Z A;  1YAE A;  1B5I A;  3MW0 A;  3V8X B;  3SES A;  3IOV A;  4YB5 A;  5JK4 A;  1B5J A;  3CSB A;  3SEX A;  1H43 A;  1I6A A;  4BDN A;  3OEM A;  5L8D A;  2IA4 A;  4IGT A;  5CI5 A;  2DS9 A;  1T0K A;  3OEN A;  5FTH A;  2Q89 A;  1Y9U A;  3VVE A;  2O84 X;  5I57 B;  4NF6 B;  1LGB C;  4GL0 A;  2V84 A;  4TQU Q;  3D4G A;  2FYI A;  5HPQ A;  1FCK A;  1QKA A;  1HSL A;  1YCJ A;  3RGY A;  3MZB A;  1LAX A;  1F9B A;  5BWJ A;  1MY1 A;  4KR5 A;  4HS7 A;  5I2K B;  4GD5 A;  3R6U A;  3K00 A;  3VVF A;  3VE1 B;  2B3F A;  3EN3 A;  3AXF A;  2PT2 A;  5FHN A;  3TEP A;  4BDO A;  3CVG A;  2NXO A;  4PFU A;  1NH8 A;  1MH3 A;  3RT6 B;  1PB7 A;  5FHO A;  2A5T B;  3U72 A;  3G3K A;  3LUY A;  4R6Y A;  3PUW E;  1Q35 A;  3QUJ A;  3B7D A;  4QHQ A;  3CRB A;  4Z7E A;  3OO7 A;  2O1L A;  3H3G A;  1J1N A;  1JW1 A;  1LFH A;  5I2K A;  3KJ7 A;  2ZNU A;  4EQ7 A;  4NF4 B;  4ZZE A;  1Y4C A;  1TFA A;  1Y1Z A;  3I5O A;  4QSD A;  4GIZ A;  4YMA A;  3H06 B;  2ZMB A;  5I56 B;  2Q2A A;  3QYT A;  3FV1 A;  1DMB A;  3VXB A;  3QIM A;  1XVX A;  2O7U A;  4JXI A;  2NVU B;  4ELP A;  1GTK A;  4FOR A;  3UOR A;  4YKJ A;  5B70 A;  3T22 A;  3Q29 A;  5AA2 B;  2DXR A;  4ZDM A;  4H8I A;  3DEL B;  2H98 A;  2I3W A;  2H4I A;  3G3J A;  4F3S A;  3T9V A;  4RY1 A;  1UTH B;  3TYH A;  1NL5 A;  4R74 A;  3WAE A;  1ELJ A;  1WOD A;  1ZIU A;  3UIF A;  3W9W A;  4F2O A;  3TTR A;  2NOO A;  1RKM A;  4ESX A;  5DVI A;  3PUZ E;  3PMW A;  2GRV A;  4ISU A;  3OO6 A;  1VR5 A;  4ZED A;  5AA2 A;  1ATG A;  3RY3 A;  1Y3N A;  5KDT A;  1ZU0 A;  3TMG A;  2O68 A;  2DP8 A;  2XXH A;  3MZ1 A;  1Y1M A;  2OCU A;  2D21 A;  3U94 A;  2HCA A;  3OOA A;  1MQI A;  3IJO B;  5I2N B;  5ELV A;  4RPN A;  4XKP A;  2OK2 A;  3MVX A;  3MAM A;  1LBC A;  5DVF A;  4FAJ A;  1XC1 A;  5KCJ B;  4NF8 A;  4H0W A;  4YAH X;  4QFN A;  2Y7K A;  2E1S A;  2ESN A;  3PPQ A;  5L9M A;  3T66 A;  3N94 A;  1IQ7 A;  2XXQ A;  1NNP A;  3E3K A;  2CZL A;  1MQH A;  2X26 A;  2O69 A;  5KZT A;  3KG2 A;  2V3Q A;  1A40 A;  3DP8 A;  4RPO A;  1R6Z A;  5I2N A;  1H45 A;  3LSX A;  3TTL A;  3Q28 A;  1N04 A;  1ZKB A;  3FXQ A;  5KCJ A;  3A3C A;  3FIR A;  3ONM A;  2H99 A;  4U1O A;  1D9Y A;  5F7V A;  1IXH A;  2O7I A;  1US4 A;  3OEL A;  1JW5 A;  3SEY A;  1FTJ A;  2QMW A;  3VLW A;  4IB2 A;  2ONK E;  4KHZ E;  2HAU A;  1WDN A;  4PE5 B;  2AYS A;  3K6V A;  4WEP A;  3SEV A;  2DWI A;  4MLV A;  3S9N C;  5TPA B;  1UIV A;  4H67 A;  3MP6 A;  5TU0 A;  4LVQ A;  3TQL A;  2F97 A;  4GL8 A;  1I69 A;  2ZXT A;  1ZLQ A;  1MPC A;  3C36 A;  2F5X A;  3CFX A;  4OET A;  2Y7I A;  3UGW A;  3MVW A;  2DYX A;  4OFL A;  5CBR A;  4KFQ A;  4ZEC A;  3H6W A;  4Q30 B;  3QXM A;  4NF5 A;  3EHU A;  4ELO A;  2ZYK A;  3K6X A;  4BDQ A;  3FJM A;  3PMX A;  1PBP A;  2XXR A;  3D4C A;  5CMK A;  3C32 A;  4XKR A;  1AIV A;  4ZEF A;  3MWB A;  4OEU A;  2F34 A;  4PFW A;  2F78 A;  2D5W A;  2CMO A;  3FV2 A;  3C34 A;  3E4R A;  4NTL A;  3TPA A;  1MDQ A;  1EH3 A;  5H8N A;  1M5B A;  1N7X A;  4RNS A;  3K1N A;  4LP2 B;  4X9T A;  4EDP A;  3HHG A;  4KPT A;  2I48 A;  1MS7 A;  4R2B A;  2E0S A;  3MBP A;  1JVY A;  4GF8 A;  2I49 A;  4LZ8 A;  1LCF A;  3N6T A;  1BTJ A;  3K0V A;  3T9X B;  2QS4 A;  3MUQ A;  2P1S A;  4F3B A;  1OLC A;  3DLN A;  1LB9 A;  2RC9 A;  3USD A;  1IZ1 A;  1MPB A;  4OMB A;  3M3K A;  1XT8 A;  1IUD A;  4EQ9 A;  1MXW A;  2F6G A;  3B6Q A;  4KYD A;  1MRP A;  5FHM A;  3THI A;  3DP6 A;  4HCW A;  1IXI A;  3W15 C;  1SDX A;  3VXC A;  2H5Y A;  3MQ9 A;  1JVX A;  4OXV A;  1B6H A;  3LC8 A;  2HXW A;  1ZBM A;  2NWJ A;  5A5X B;  1Y3P A;  1LST A;  3KN8 A;  4FEB A;  4G8H A;  4GOT A;  1Y3Q A;  5CBS A;  2HZK A;  3PGF A;  4OTE A;  5M2V A;  2H9B A;  3IL1 B;  3G7W A;  3TFL A;  1Y20 A;  1B5H A;  5ICT A;  2VOZ A;  4Q0C A;  3VV5 A;  4MLQ A;  1P99 A;  5AA4 A;  1B46 A;  2V3U A;  3IB1 A;  4RXL A;  3EF7 A;  4LQ5 A;  3T93 B;  1D3K A;  1DTZ A;  3KOS A;  1GGG A;  4I62 A;  3O9P A;  1LAH E;  4ZZA A;  3V83 A;  4IO5 A;  4LUB A;  2DE3 A;  1DSN A;  1NKX A;  3ILU B;  1XVY A;  2XX8 A;  4OER A;  1JW4 A;  2HFB A;  4NED A;  2DWA A;  2PT1 A;  3Q27 A;  3RTF B;  1UTB A;  3K01 A;  1QJM A;  1IIW A;  4H8J A;  3KBR A;  4F19 A;  1B0H A;  4BLA A;  4OES A;  1FQC A;  1SI1 A;  4M1V A;  2F7B A;  3VVD A;  5JTY A;  4ELQ A;  3OXN A;  3U1O A;  2DOJ A;  2NUV A;  3L6H A;  4QFL A;  1Z7M E;  1AL3 A;  1POT A;  3K4U A;  1LBB A;  3ZSF A;  4R2F A;  2VP1 A;  1S7Y A;  4DLD A;  3IK6 B;  2PBW A;  1B05 A;  1A7L A;  3MPL A;  5AE4 A;  1VSO A;  4NE4 A;  3CIJ A;  4PQJ A;  3BKI B;  3PUV E;  3VDF A;  2O51 A;  2THI A;  4IO7 A;  1LB8 A;  3IOT A;  3OEK A;  5CC2 A;  2Q8J A;  4X48 A;  4GWO A;  1DOT A;  5EHS A;  3LSF B;  3SET A;  1I6B A;  1BP5 A;  4G68 A; 
#chains in the Genus database with same CATH topology
 3T9H B;  4R9F A;  1RDX A;  4POW A;  1B7H A;  4OFJ A;  3PPO A;  3CSG A;  3TAJ A;  2YPN A;  3EPE A;  1FJ9 A;  4G8M A;  4GBW A;  4GQO A;  4OQO A;  5EYF A;  1FBF A;  2QVV A;  5ITO A;  1VE4 A;  4JSD A;  1NH7 A;  3CFZ A;  4H46 A;  3U92 A;  4OFO A;  1URD A;  1G0I A;  2VT5 A;  2ZZV A;  2Z8D A;  4QFO A;  4TLM B;  4N6K A;  1GV8 A;  4DCX A;  4JDF A;  3TQW A;  3D1R A;  1MXY A;  3KOT A;  2R6G E;  2B4L A;  3VLU A;  1LBW A;  4OVQ A;  5A5L A;  3W9V A;  4PTK A;  1UIU A;  2JJK A;  3FBP A;  2XA5 A;  3SEW A;  2OBG A;  5BUU A;  4IGR A;  4R6H A;  5EQ9 A;  1B3G A;  3OD7 A;  1H44 A;  1RYO A;  3TTN A;  5ICQ A;  5KDT B;  1ANF A;  2VGQ A;  3IFA A;  3V5A A;  4YKK A;  4EXK A;  4N6P A;  3N26 A;  5H8S A;  1FW0 A;  1WVJ A;  4KYE A;  5H8Q A;  3TEL A;  3UA8 A;  4UA8 A;  2CZH A;  5IAI A;  2RC8 A;  4OEN A;  1B1H A;  3P7I A;  4DIG A;  4LN5 A;  3R26 A;  4JBZ A;  2Z22 A;  4H1X A;  1I6Q A;  4NF8 B;  3KZG A;  1EZP A;  3H4Z A;  4O3B A;  4H6D A;  4EXL A;  3EHT A;  2F35 A;  3TDJ A;  1MXZ A;  2DVC A;  3ZKK A;  4OWD A;  5T3J A;  1B1X A;  4FEC A;  5CM6 A;  3HV1 A;  5I58 A;  1FJ6 A;  5I84 A;  3KN3 A;  3FZV A;  4NAP A;  4XFE A;  1DPE A;  4OA4 A;  1MXX A;  3O28 A;  1FPF A;  1MQJ A;  4N13 A;  3T1B A;  2PX1 A;  1M5D A;  5CMC A;  1KA0 A;  1EYI A;  1IMF A;  4P11 A;  2P2A A;  4PGP A;  3LUZ A;  3FVG A;  2ZYN A;  1KA1 A;  4I8C A;  3TTM A;  1SW5 A;  2ONR A;  4N07 A;  1DTG A;  4F1V A;  3B6T A;  4O3C A;  4IO3 A;  3CG1 A;  3MJN A;  2CEY A;  4QRZ A;  1N3X A;  2OZZ A;  5H8F A;  4ESW A;  2GFE A;  5CRY A;  4QXD A;  2Z8E A;  4YU0 A;  1QUL A;  4NF5 B;  3KC1 A;  2RKM A;  1YTV A;  4IO6 A;  4XEQ A;  4NGU A;  1QUI A;  5H8H A;  1D4N A;  4GXS B;  2P3V A;  3V89 B;  3K6U A;  2XXW A;  5DEX B;  4THI A;  1FTO A;  4HE2 A;  3U93 A;  1IXC A;  1YPN A;  1B7Z A;  1EZ9 A;  1FQF A;  2Y7R A;  3UP9 A;  1BKA A;  1Q1K A;  3IX1 A;  2WEF A;  2F3D A;  2OWS A;  1IME A;  3TCG A;  4QF9 A;  2QRY A;  1JEV A;  2RCB A;  5I5P A;  5K2X A;  2UVH A;  2VPN A;  3LR1 A;  5H8N B;  4H65 A;  3S9L C;  4GWS A;  2ZNS A;  2HHM A;  1O7T A;  3KEI A;  4LZ7 A;  1BLF A;  4YKI A;  3RT8 A;  3N5L A;  1YYZ A;  3MP8 A;  3EHS A;  5DYH A;  1B3H A;  1BIY A;  1P1O A;  1SW2 A;  2WYP A;  4Q8R A;  5DEX A;  3I6V A;  3FAT A;  4R75 A;  3ZKL A;  4PBQ A;  1B51 A;  3QAX A;  3BFT A;  3FXU A;  1FPJ A;  2B3B A;  1GVC A;  3FXR A;  2QSX A;  1D9Q A;  4Z0I A;  2XXI A;  2D3I A;  4P8B A;  4ELR A;  1LBX A;  3KJT A;  1FQB A;  2XXK A;  3GBB A;  4P3L A;  5AA2 D;  5HM4 B;  1SYI A;  1QUK A;  4ZE8 A;  2XD2 A;  3PD8 A;  3MPK A;  1SBP A;  2DE2 A;  4I1D A;  1LBZ A;  4F39 A;  2FVZ A;  3RNN A;  3OSQ A;  2XX7 A;  3MZ9 A;  4PET A;  3ODB A;  1H3D A;  4RK9 A;  2AL4 A;  4G2Z A;  3VLV A;  1FPI A;  3RUM A;  3MC2 A;  2XXX A;  3IOU A;  4UAC A;  1MY2 A;  5AA3 A;  4HE1 A;  1LLS A;  4RA1 A;  5I59 A;  1FPK A;  3MP1 A;  2XD3 A;  3IO6 A;  2RF1 A;  1A55 A;  5L9S A;  2OLB A;  3C4M A;  3PV0 E;  2I0B A;  1XOC A;  4ZEK A;  3JZJ A;  3O29 A;  1SQY A;  2AL5 A;  3HCQ A;  5JEI A;  5AA4 B;  2FIE A;  4X8R A;  1M5F A;  4M4G A;  5FTI A;  2M8C A;  4POX A;  2R71 A;  2QS1 A;  1MY3 A;  1IEJ A;  3O6I A;  4R9G A;  5CMM A;  4PF6 A;  4EQB A;  2QFL A;  4F22 A;  5AA1 A;  2V93 A;  4O94 A;  1GR2 A;  3BBR A;  1N7W A;  2V3T A;  4MFI A;  2YLN A;  2O1M A;  2KLF A;  4F3P A;  2ABH A;  3KBZ A;  1LBY A;  2UVI A;  5EYH A;  1RDZ A;  2QVR A;  1SW4 A;  3H6T A;  1FBC A;  4KQP A;  4PFT A;  4E0W A;  3SZP A;  1DBZ A;  4XTC Q;  1UTB B;  4O8M A;  1VFD A;  2B65 A;  3T96 B;  5LOM A;  1IMC A;  3A09 A;  4P0I A;  1OVT A;  4R73 A;  5JTY B;  1MPD A;  5IGA A;  1NV6 A;  3KSX A;  4U2R A;  3ZS6 A;  3LSW A;  4I9D A;  3M3L A;  4P1E A;  4EUO A;  2GHB A;  3HO7 A;  2VHA A;  1HSE A;  1MM7 A;  3N6U A;  1D9V A;  4G68 C;  3M8U A;  1FBP A;  1B3F A;  1XHY A;  1XS5 A;  2WBD A;  3E13 X;  5IZ3 A;  4F2Q A;  4G77 A;  5I3S A;  2XXY A;  5EQ7 A;  3LV0 A;  1NI9 A;  4DXC A;  3RTW B;  3UK4 A;  2DWH A;  4XIG Q;  5EHM A;  2KQZ A;  2DQV A;  4OZ9 A;  4O7M A;  4XXU A;  2YJP A;  5TP9 A;  3C35 A;  2AIX A;  3OMB A;  4TLL B;  1N0T A;  1QVS A;  4RK2 A;  2ONS A;  1IIT A;  4QFK A;  1B4Z A;  1NUW A;  3RQT A;  1AMF A;  1B52 A;  1URS A;  4ZE9 A;  4IY6 A;  4MAG A;  3GZG A;  2OJT A;  3IB2 A;  4QFP A;  4PFY A;  4G68 B;  1SPI A;  1NUX A;  1B2H A;  3MST A;  3KN7 A;  4GXA A;  2F7C A;  2UYF A;  3Q25 A;  2WX9 A;  1N3W A;  1MG1 A;  1B40 A;  4BDR A;  4KCD A;  2XWI A;  4ZS9 A;  2XXP A;  1O64 A;  2P0S A;  1B4H A;  4MNI A;  4ZEI A;  5CMB A;  4OVS A;  1UQW A;  3G3H A;  4X1B A;  4QSE A;  2X7P A;  4U4S A;  3WAF A;  3JYR A;  3SKP A;  3O97 A;  4H5G A;  4ECF A;  3OO8 A;  3K6W A;  3QMF A;  1A99 A;  5L9O A;  1MH4 A;  4GRK A;  4MMP A;  5ET7 A;  1QUJ A;  4YIC A;  4YB7 A;  1NNF A;  4PDH A;  4GWU A;  1B58 A;  1CE2 A;  4L17 A;  1PEB A;  3U8Q A;  1H76 A;  1P1N A;  3IB0 A;  4H5F A;  2F3B A;  3G3G A;  1M5C A;  3O6G A;  4XKQ A;  4YZZ A;  1ZJL A;  4HCY A;  2QJE A;  1L5T A;  2PMS A;  4RJZ A;  2G29 A;  2ALU A;  3O66 A;  4IO2 A;  3GLB A;  5I57 A;  4NF6 A;  4FED A;  5J1D A;  4GFR A;  2FIX A;  1SW1 A;  4I3E A;  3M3F A;  4N6D A;  4GWY A;  4WED A;  1POY 1;  2WBB A;  5H8Q B;  4KCC A;  1Y4T A;  1TT1 A;  2X7Q A;  4YKP A;  1PB8 A;  1OQH A;  4DDD A;  1FPG A;  2Y84 A;  2QS2 A;  4BDL A;  4NWC A;  3TCH A;  2RIN A;  1LCT A;  1DPP A;  3SEU A;  3C9H A;  4QSC A;  4E0X A;  2DXY A;  5DT6 A;  1A8F A;  2BJI A;  2ZZX A;  1N76 A;  4FBP A;  3CFL A;  2XWK A;  5I58 B;  2XWO A;  3IR1 A;  4ONY A;  5DW8 A;  1DK4 A;  4YB6 A;  4G4P A;  2A5T A;  4OHN A;  4KXP A;  2KR0 A;  3GBA A;  3I3V A;  2PCR A;  4JSO A;  4DXU A;  2I4B A;  2UYE A;  1FQE A;  1SI0 A;  3RYD A;  4F29 A;  2BJJ X;  3EKI A;  3FAS A;  4G8N A;  3FUZ A;  4OVJ A;  2VD3 A;  4NF4 A;  1S50 A;  1MDP 1;  2VPO A;  4ND9 A;  4OYV A;  2Y7W A;  1MQG A;  3Q26 A;  5I56 A;  3PU5 A;  3O6H A;  1PDA A;  4ZEB A;  3MVZ A;  4MBP A;  1S9T A;  4JWX A;  3RLF E;  4LA9 A;  2DSF A;  3TTK A;  3RPW A;  2UVG A;  3PMV A;  3R7X A;  4I3Y A;  1G0H A;  4LQ2 A;  2I58 A;  4GX4 A;  3FVO A;  1TWY A;  3DM0 A;  1N84 A;  3H6V A;  1PC3 A;  2OWZ A;  4GBV A;  3CG3 A;  5H8F B;  2CZI A;  1NNT A;  5DVJ A;  4F18 A;  1R9L A;  4O7I A;  1LFI A;  4PCD A;  5FBP A;  4OEV A;  1AWB A;  2F36 A;  4KI0 E;  3BFU A;  3TUS A;  1FBG A;  1UTH A;  4PAI A;  1MY0 A;  2VD2 A;  1TXF A;  1EYK A;  1P1W A;  4MF3 A;  3K02 A;  3IOR A;  5H8H B;  3H6U A;  4WXJ A;  1FRP A;  3HPI A;  4P0G A;  2HQ0 A;  3S9E A;  4P9K A;  1JQF A;  3F11 A;  3PPR A;  2I3V A;  1SYH A;  2W7Y A;  3PPN A;  4F1Y A;  1EZO A;  1JEU A;  3DP4 A;  5F1Q A;  2V25 A;  3PUY E;  3S2V A;  5K2Y A;  4O3A A;  2G93 A;  2F6P A;  2Y7P A;  4LAT A;  3HN0 A;  1FTM A;  3PD9 A;  1KWH A;  1K9Z A;  3OSR A;  3L6G A;  2UVJ A;  1P1U A;  4NF0 A;  4YMB A;  2RC7 A;  4G61 A;  4K3F A;  3B6W A;  4U4X A;  1B9J A;  4C0R A;  1QKB A;  3HST A;  4KD5 A;  3FJG A;  4DCY A;  1MM6 A;  1MXU A;  3H03 A;  4X1D A;  3CR9 A;  3TCF A;  4NWD A;  1B3L A;  2Q88 A;  3LSL A;  4DZ1 A;  4EF2 A;  3A3U A;  2XXT A;  4AS5 A;  5LTC A;  2XX9 A;  1A54 A;  2A5S A;  2Y5L A;  4U22 A;  3LBS A;  1XI6 A;  1Z7N E;  1OIB A;  5ITP A;  4JB7 A;  4DXB A;  3FVN A;  3K1M A;  3IAZ A;  4GLI A;  3SDF A;  3H7M A;  1QW0 A;  4PGN A;  2I6E A;  1HSJ A;  2PFZ A;  2ZYO A;  1OVB A;  1MXV A;  3FJ7 A;  1MQD A;  3EQ1 A;  2H25 A;  2I4C A;  1FQA A;  4HTG A;  3IO4 A;  2XHD A;  2XXU A;  2PYY A;  4NG7 A;  4DE8 A;  3TOD A;  4LZ5 A;  2DWJ A;  1USY E;  4R72 A;  4AQ4 A;  1LBV A;  3JV9 A;  3G3F A;  4NMY A;  2OX3 A;  3FGS A;  3E79 A;  1QGX A;  2QMX A;  3UN6 A;  1OLA A;  3KFM A;  5J16 A;  5I59 B;  1FTL A;  5TPA A;  3S9M C;  3PTY A;  4RYA A;  4FJP A;  3TZA A;  1MY4 A;  1K9Y A;  1R1N A;  2XXV A;  2PVU A;  2B4M A;  4HW8 A;  2WKY A;  2UXA A;  1PBQ A;  1R9Q A;  4IO4 A;  1LFG A;  3E78 A;  4BDM A;  5IKB A;  1P1Q A;  2DDK A;  4MEV A;  3C31 A;  3QK6 A;  2QS3 A;  2I0C A;  4PDD A;  4MNP A;  4JWY A;  1B32 A;  3O2A A;  4OVR A;  4Q5T A;  4IY5 A;  4MH5 A;  4R6K A;  4P47 A;  4F3G A;  1ZTY A;  1O63 A;  2FA7 A;  2Q9T A;  1CB6 A;  5B7D A;  2LAO A;  2F8D A;  2ZYM A;  3FVK A;  5IZ1 A;  3ECR A;  3MVY A;  1USY H;  5IZZ A;  2QL3 A;  1OQG A;  2ZNT A;  2REJ A;  5ISU A;  1TFD A;  1LAG E;  1OMP A;  1SVX B;  3KGC A;  2HZL A;  2Q2C A;  4F1U A;  2QPQ A;  5EQA A;  4MX6 A;  1EU8 A;  1VFE A;  4TOZ A;  4FAT A;  1NMU A;  1SD3 A;  3HHF A;  3TKD A;  2HAV A;  3IOW A;  1ZMG A;  3K1P A;  1RDY A;  4KYS A;  3KSJ A;  3E9X A;  2O6A A;  2ANJ A;  2FNC A;  1M5E A;  4LON B;  4PFB A;  1B7U A;  4AB6 A;  3PPP A;  3S4U A;  3GXA A;  4C1T A;  4FIM A;  4N4U A;  2GH9 A;  2Z23 A;  4WKM A;  5ET8 A;  2F7A A;  3QUF A;  5IZ3 B;  3VFJ A;  2P3N A;  2GHA A;  2DVZ A;  4JVC A;  1FQD A;  3T9U A;  4C1U A;  5TP9 B;  1FTK A;  1II5 A;  1B0L A;  4F31 B;  4U23 A;  1NNK A;  4XKN A;  1PB9 A;  1RYX A;  1URG A;  3BIH A;  1LAF E;  2HEU A;  2R9J A;  3K2D A;  4PBH A;  4FE8 A;  3KC0 A;  1A8E A;  4GVO A;  2OWT A;  1IXG A;  1AOV A;  3IJX B;  1JET A;  3OO9 A;  2Z8F A;  2REG A;  3CI8 A;  1US5 A;  5A5X A;  3G3I A;  2RCA A;  1AH5 A;  2DE4 A;  4U21 A;  4EF1 A;  1JNF A;  4PP0 A;  3FD3 A;  3ILT B;  3QSL A;  3PUX E;  3SER A;  3C33 A;  1B3E A;  2IEE A;  3RN8 A;  4AB5 A;  5HBC A;  2GQ1 A;  4JVI A;  4JWO A;  2V4C A;  5DTB A;  1NFT A;  4HE0 A;  4MNC A;  3HFU A;  4U1Z A;  2FHY A;  1YAE A;  1B5I A;  4P56 A;  3MW0 A;  3V8X B;  3SES A;  3IOV A;  4YB5 A;  5JK4 A;  1B5J A;  3CSB A;  3SEX A;  1H43 A;  1I6A A;  4HXV A;  4BDN A;  2R8T A;  3OEM A;  5L8D A;  2IA4 A;  4IGT A;  1NV1 A;  4N8G A;  5CI5 A;  2DS9 A;  1T0K A;  4PAF A;  3OEN A;  5FTH A;  2Q89 A;  1FSA A;  1Y9U A;  3VVE A;  2O84 X;  5I57 B;  4NF6 B;  1LGB C;  4GL0 A;  2V84 A;  4TQU Q;  3D4G A;  2FYI A;  5HPQ A;  1FCK A;  1QKA A;  1HSL A;  2ZZW A;  1YCJ A;  3RGY A;  1VDW A;  3MZB A;  1LAX A;  1KZ8 A;  1F9B A;  5BWJ A;  1MY1 A;  2CEX A;  4KR5 A;  4HS7 A;  5I2K B;  4GD5 A;  3R6U A;  3K00 A;  3VVF A;  3VE1 B;  2B3F A;  3EN3 A;  3AXF A;  2PT2 A;  4N8Y A;  5FHN A;  3TEP A;  4NHB A;  4BDO A;  3CVG A;  2Q74 A;  4NN3 A;  2NXO A;  4PAK A;  4PFU A;  1NH8 A;  1MH3 A;  3RT6 B;  1PB7 A;  5FHO A;  2A5T B;  3U72 A;  5EYG A;  3G3K A;  4GWX A;  3LUY A;  4R6Y A;  3PUW E;  1Q35 A;  3CHG A;  3QUJ A;  1FPL A;  3B7D A;  4QHQ A;  3CRB A;  4Z7E A;  3OO7 A;  2O1L A;  3H3G A;  4PFR A;  1J1N A;  1JW1 A;  1LFH A;  5I2K A;  3KJ7 A;  5ESY A;  1IMB A;  4PF8 A;  2ZNU A;  4EQ7 A;  4NF4 B;  4ZZE A;  1Y4C A;  1NV0 A;  1TFA A;  1Y1Z A;  1CNQ A;  3I5O A;  4QSD A;  4GIZ A;  4YMA A;  4NQ8 A;  3H06 B;  2ZMB A;  1FPB A;  5I56 B;  3BIG A;  2Q2A A;  3QYT A;  3FV1 A;  1DMB A;  3VXB A;  3QIM A;  1XVX A;  2O7U A;  4JXI A;  2NVU B;  4ELP A;  1GTK A;  4FOR A;  3UOR A;  4YKJ A;  5B70 A;  3T22 A;  3Q29 A;  5F24 A;  5AA2 B;  2DXR A;  4PE3 A;  4ZDM A;  4H8I A;  3DEL B;  2H98 A;  2I3W A;  2H4I A;  3G3J A;  4DI3 D;  5LDZ A;  4F3S A;  1LEV A;  4I40 A;  3T9V A;  4PFI A;  4GX6 A;  4RY1 A;  1UTH B;  3TYH A;  1NL5 A;  4R74 A;  3FXB A;  3WAE A;  1ELJ A;  1WOD A;  1ZIU A;  3UIF A;  3W9W A;  4F2O A;  3TTR A;  2NOO A;  1RKM A;  4ESX A;  5DVI A;  1Q9D A;  3PUZ E;  3PMW A;  2GRV A;  4ISU A;  3OO6 A;  4MIJ A;  3ISP A;  1VR5 A;  5EQ8 A;  4ZED A;  5AA2 A;  1ATG A;  3RY3 A;  1Y3N A;  5KDT A;  1YZ0 A;  1ZU0 A;  3TMG A;  2O68 A;  2DP8 A;  1NV4 A;  1FBH A;  2XXH A;  3MZ1 A;  1Y1M A;  2OCU A;  2D21 A;  3U94 A;  1BK4 A;  2HCA A;  3OOA A;  1MQI A;  3IJO B;  5I2N B;  5ELV A;  4RPN A;  4XKP A;  2OK2 A;  3MVX A;  3MAM A;  1LBC A;  5DVF A;  4FAJ A;  1XC1 A;  1INP A;  5KCJ B;  4NF8 A;  4H0W A;  4YAH X;  4QFN A;  2Y7K A;  2E1S A;  2ESN A;  3PPQ A;  5L9M A;  3T66 A;  3N94 A;  1IQ7 A;  2XXQ A;  1NNP A;  3E3K A;  2CZL A;  1MQH A;  2X26 A;  4XF5 A;  2O69 A;  5KZT A;  3KG2 A;  2V3Q A;  4MJO A;  1A40 A;  3DP8 A;  4RPO A;  1R6Z A;  5I2N A;  1H45 A;  4QBA A;  1FBE A;  3LSX A;  4N81 A;  3TTL A;  3Q28 A;  1N04 A;  1FTA A;  1ZKB A;  3FXQ A;  5KCJ A;  3A3C A;  3FIR A;  3ONM A;  2H99 A;  4U1O A;  1D9Y A;  5F7V A;  1IXH A;  2O7I A;  2QVU A;  1US4 A;  3OEL A;  1JW5 A;  3SEY A;  1FTJ A;  2QMW A;  3VLW A;  3MYU A;  4IB2 A;  2ONK E;  4KHZ E;  5IM2 A;  2HAU A;  1WDN A;  4PE5 B;  2AYS A;  3K6V A;  4WEP A;  3SEV A;  2DWI A;  4MLV A;  3S9N C;  5TPA B;  1UIV A;  4H67 A;  3MP6 A;  5TU0 A;  4LVQ A;  1NV3 A;  3TQL A;  2F97 A;  4MHF A;  4GL8 A;  1I69 A;  3RPL B;  2ZXT A;  1ZLQ A;  1MPC A;  3C36 A;  2F5X A;  3CFX A;  4AS4 A;  4P1L A;  4OET A;  2Y7I A;  3UGW A;  3MVW A;  2DYX A;  4OFL A;  5CBR A;  4KFQ A;  4ZEC A;  3H6W A;  4Q30 B;  3QXM A;  4NF5 A;  3EHU A;  4ELO A;  4OAN A;  2ZYK A;  3K6X A;  4BDQ A;  3FJM A;  3PMX A;  1PBP A;  2XXR A;  3D4C A;  5CMK A;  3C32 A;  4XKR A;  1AIV A;  4ZEF A;  5ET5 A;  3MWB A;  4N15 A;  4OEU A;  1EYJ A;  2F34 A;  2PFY A;  4PFW A;  4X04 A;  4NX1 A;  2F78 A;  2D5W A;  2CMO A;  3FV2 A;  3RPL A;  3C34 A;  3E4R A;  4NTL A;  3TPA A;  1MDQ A;  1EH3 A;  3T0J A;  5H8N A;  1M5B A;  1N7X A;  4RNS A;  3K1N A;  2HXR A;  4LP2 B;  4X9T A;  4EDP A;  3HHG A;  4KPT A;  2I48 A;  1MS7 A;  4R2B A;  4N17 A;  2E0S A;  3MBP A;  1JVY A;  4GF8 A;  2I49 A;  2MKZ A;  4LZ8 A;  1LCF A;  3N6T A;  1BTJ A;  3K0V A;  2CZK A;  3T9X B;  5ET6 A;  2QS4 A;  1NUZ A;  3MUQ A;  4GWW A;  2P1S A;  4F3B A;  1OLC A;  1IMA A;  3DLN A;  1NV7 A;  1LB9 A;  2RC9 A;  3B50 A;  3USD A;  1IZ1 A;  1MPB A;  4N91 A;  4OMB A;  3M3K A;  1XT8 A;  1IUD A;  4EQ9 A;  1MXW A;  2F6G A;  3B6Q A;  4KYD A;  1MRP A;  5FHM A;  3THI A;  3DP6 A;  4HCW A;  1IXI A;  3W15 C;  4H45 A;  1SDX A;  4DI4 B;  2HPG A;  3VXC A;  2H5Y A;  3MQ9 A;  1JVX A;  4OXV A;  1IMD A;  1FPD A;  2Y5K A;  4MCO A;  1B6H A;  3LC8 A;  2HXW A;  1ZBM A;  3A29 A;  3U65 A;  2NWJ A;  5A5X B;  4JVD A;  1Y3P A;  1LST A;  3KN8 A;  4FEB A;  4G8H A;  3B8B A;  4GOT A;  1Y3Q A;  5CBS A;  2HZK A;  3PGF A;  4OTE A;  2XWV A;  1DCU A;  1NV5 A;  5M2V A;  2H9B A;  3IL1 B;  3G7W A;  3TFL A;  1Y20 A;  1B5H A;  5ICT A;  2VOZ A;  4Q0C A;  3VV5 A;  4MLQ A;  1P99 A;  1NUY A;  5AA4 A;  1B46 A;  2V3U A;  3IB1 A;  4RXL A;  3EF7 A;  2FBP A;  3IFC A;  4LQ5 A;  3T93 B;  1D3K A;  1DTZ A;  3KOS A;  1FPE A;  1GGG A;  4I62 A;  3O9P A;  1LAH E;  4ZZA A;  3V83 A;  4IO5 A;  1YXI A;  2DE3 A;  4LUB A;  1DSN A;  4PC9 A;  1NKX A;  3ILU B;  1XVY A;  4UAB A;  2XX8 A;  4OER A;  1FBD A;  1JW4 A;  2HFB A;  4NED A;  4OVP A;  2DWA A;  4IR8 A;  2PT1 A;  4GX3 A;  3ROJ A;  2L5V A;  3Q27 A;  3RTF B;  1UTB A;  3K01 A;  1QJM A;  1IIW A;  4H8J A;  5I7I A;  3KBR A;  3NOH A;  1B0H A;  4F19 A;  4BLA A;  4OES A;  1FQC A;  1SI1 A;  1NV2 A;  4M1V A;  2F7B A;  3VVD A;  5JTY A;  4ELQ A;  4OVT A;  3OXN A;  3U1O A;  2DOJ A;  2NUV A;  3L6H A;  4GWZ A;  4QFL A;  1Z7M E;  1AL3 A;  1POT A;  3K4U A;  1LBB A;  3ZSF A;  4R2F A;  2VP1 A;  1S7Y A;  4DLD A;  3IK6 B;  2PBW A;  1B05 A;  1A7L A;  3MPL A;  5AE4 A;  1VSO A;  4NE4 A;  3CIJ A;  4PQJ A;  3BKI B;  3PUV E;  3VDF A;  2O51 A;  2THI A;  4IO7 A;  1LB8 A;  3IOT A;  3OEK A;  1JP4 A;  2Q8J A;  2WYK A;  5CC2 A;  4X48 A;  4GWO A;  1DOT A;  5EHS A;  3LSF B;  3SET A;  1I6B A;  3GYY A;  1BP5 A;  2Q8M A;  4G68 A; 
#chains in the Genus database with same CATH homology
 3T9H B;  4R9F A;  4POW A;  1B7H A;  4OFJ A;  3PPO A;  3CSG A;  3TAJ A;  2YPN A;  3EPE A;  4G8M A;  5EYF A;  4GQO A;  4OQO A;  5ITO A;  1VE4 A;  4JSD A;  1NH7 A;  3CFZ A;  3U92 A;  4OFO A;  1URD A;  2Z8D A;  4QFO A;  4TLM B;  1GV8 A;  4DCX A;  4JDF A;  3TQW A;  1MXY A;  3KOT A;  2R6G E;  3VLU A;  3W9V A;  1UIU A;  3SEW A;  2OBG A;  5BUU A;  4IGR A;  4R6H A;  1B3G A;  3OD7 A;  1H44 A;  1RYO A;  3TTN A;  5ICQ A;  5KDT B;  1ANF A;  2VGQ A;  3V5A A;  4YKK A;  4EXK A;  4N6P A;  3N26 A;  5H8S A;  1FW0 A;  1WVJ A;  4KYE A;  5H8Q A;  3TEL A;  3UA8 A;  4UA8 A;  5IAI A;  2RC8 A;  4OEN A;  1B1H A;  3P7I A;  4DIG A;  3R26 A;  4JBZ A;  2Z22 A;  4H1X A;  1I6Q A;  4NF8 B;  3KZG A;  1EZP A;  3H4Z A;  4O3B A;  4H6D A;  4EXL A;  3EHT A;  2F35 A;  3TDJ A;  1MXZ A;  2DVC A;  3ZKK A;  4OWD A;  1B1X A;  4FEC A;  5CM6 A;  3HV1 A;  5I58 A;  5I84 A;  3KN3 A;  3FZV A;  1DPE A;  1MXX A;  3O28 A;  1MQJ A;  4N13 A;  2PX1 A;  1M5D A;  5CMC A;  4P11 A;  2P2A A;  3FVG A;  2ZYN A;  4I8C A;  3TTM A;  1SW5 A;  2ONR A;  4N07 A;  1DTG A;  4F1V A;  3B6T A;  4O3C A;  4IO3 A;  3CG1 A;  3MJN A;  4QRZ A;  1N3X A;  2OZZ A;  5H8F A;  4ESW A;  2GFE A;  5CRY A;  2Z8E A;  4YU0 A;  1QUL A;  4NF5 B;  2RKM A;  1YTV A;  4IO6 A;  1QUI A;  5H8H A;  1D4N A;  4GXS B;  3V89 B;  3K6U A;  2XXW A;  5DEX B;  4THI A;  1FTO A;  3U93 A;  1IXC A;  1YPN A;  1B7Z A;  1EZ9 A;  1FQF A;  2Y7R A;  3UP9 A;  1BKA A;  1Q1K A;  3IX1 A;  2OWS A;  3TCG A;  4QF9 A;  2QRY A;  1JEV A;  2RCB A;  5K2X A;  2UVH A;  3LR1 A;  5H8N B;  4H65 A;  3S9L C;  2ZNS A;  1O7T A;  3KEI A;  4LZ7 A;  1BLF A;  4YKI A;  3RT8 A;  3N5L A;  3MP8 A;  3EHS A;  5DYH A;  1B3H A;  1BIY A;  1P1O A;  1SW2 A;  4Q8R A;  5DEX A;  3I6V A;  3FAT A;  4R75 A;  3ZKL A;  1B51 A;  3QAX A;  3BFT A;  3FXU A;  2B3B A;  1GVC A;  3FXR A;  2QSX A;  4Z0I A;  2XXI A;  2D3I A;  4ELR A;  3KJT A;  1FQB A;  3GBB A;  5AA2 D;  5HM4 B;  1SYI A;  1QUK A;  4ZE8 A;  2XD2 A;  3PD8 A;  3MPK A;  1SBP A;  2DE2 A;  4I1D A;  4F39 A;  3RNN A;  3OSQ A;  2XX7 A;  3MZ9 A;  4PET A;  3ODB A;  1H3D A;  4RK9 A;  2AL4 A;  4G2Z A;  3VLV A;  3RUM A;  3MC2 A;  2XXX A;  3IOU A;  4UAC A;  1MY2 A;  5AA3 A;  1LLS A;  4RA1 A;  5I59 A;  3MP1 A;  2XD3 A;  3IO6 A;  2RF1 A;  1A55 A;  5L9S A;  2OLB A;  3C4M A;  3PV0 E;  2I0B A;  1XOC A;  4ZEK A;  3JZJ A;  3O29 A;  1SQY A;  2AL5 A;  3HCQ A;  5JEI A;  5AA4 B;  1M5F A;  4M4G A;  5FTI A;  2M8C A;  4POX A;  2R71 A;  2QS1 A;  1MY3 A;  1IEJ A;  3O6I A;  4R9G A;  5CMM A;  4EQB A;  4F22 A;  5AA1 A;  2V93 A;  1GR2 A;  3BBR A;  1N7W A;  2V3T A;  4MFI A;  2YLN A;  2O1M A;  2KLF A;  4F3P A;  2ABH A;  2UVI A;  1SW4 A;  3H6T A;  4KQP A;  4PFT A;  4E0W A;  4XTC Q;  1UTB B;  3T96 B;  1VFD A;  2B65 A;  5LOM A;  3A09 A;  4P0I A;  1OVT A;  4R73 A;  5JTY B;  1MPD A;  3KSX A;  4U2R A;  3ZS6 A;  3LSW A;  4I9D A;  3M3L A;  4EUO A;  2GHB A;  3HO7 A;  2VHA A;  1HSE A;  1MM7 A;  3N6U A;  1D9V A;  4G68 C;  3M8U A;  1B3F A;  1XHY A;  1XS5 A;  3E13 X;  4F2Q A;  4G77 A;  2XXY A;  4DXC A;  3RTW B;  3UK4 A;  2DWH A;  4XIG Q;  5EHM A;  2DQV A;  4OZ9 A;  4XXU A;  2YJP A;  5TP9 A;  3C35 A;  2AIX A;  3OMB A;  4TLL B;  1N0T A;  1QVS A;  4RK2 A;  2ONS A;  1IIT A;  4QFK A;  1B4Z A;  3RQT A;  1AMF A;  1B52 A;  1URS A;  4ZE9 A;  4IY6 A;  3GZG A;  2OJT A;  3IB2 A;  4QFP A;  4PFY A;  4G68 B;  1B2H A;  3KN7 A;  4GXA A;  2F7C A;  2UYF A;  3Q25 A;  1N3W A;  1MG1 A;  1B40 A;  4BDR A;  4KCD A;  4ZS9 A;  2XXP A;  1O64 A;  2P0S A;  1B4H A;  4ZEI A;  5CMB A;  1UQW A;  3G3H A;  4X1B A;  4QSE A;  2X7P A;  4U4S A;  3WAF A;  3JYR A;  3SKP A;  3O97 A;  4H5G A;  4ECF A;  3OO8 A;  3K6W A;  1A99 A;  5L9O A;  1MH4 A;  4GRK A;  1QUJ A;  4YIC A;  4YB7 A;  1NNF A;  1B58 A;  1CE2 A;  4L17 A;  1PEB A;  3U8Q A;  1H76 A;  1P1N A;  3IB0 A;  4H5F A;  3G3G A;  1M5C A;  3O6G A;  4XKQ A;  4YZZ A;  1ZJL A;  4HCY A;  2QJE A;  1L5T A;  2PMS A;  4RJZ A;  2G29 A;  2ALU A;  3O66 A;  4IO2 A;  3GLB A;  5I57 A;  4NF6 A;  4FED A;  5J1D A;  4GFR A;  1SW1 A;  3M3F A;  4WED A;  1POY 1;  5H8Q B;  4KCC A;  1Y4T A;  1TT1 A;  2X7Q A;  4YKP A;  1PB8 A;  1OQH A;  4DDD A;  2Y84 A;  2QS2 A;  4BDL A;  4NWC A;  3TCH A;  2RIN A;  1LCT A;  1DPP A;  3SEU A;  3C9H A;  4QSC A;  4E0X A;  2DXY A;  5DT6 A;  1A8F A;  1N76 A;  3CFL A;  5I58 B;  3IR1 A;  4ONY A;  4YB6 A;  4G4P A;  2A5T A;  4OHN A;  3GBA A;  3I3V A;  4JSO A;  4DXU A;  2I4B A;  2UYE A;  1FQE A;  1SI0 A;  4F29 A;  2BJJ X;  3FAS A;  4G8N A;  3FUZ A;  4OVJ A;  2VD3 A;  4NF4 A;  1S50 A;  1MDP 1;  4ND9 A;  4OYV A;  2Y7W A;  1MQG A;  3Q26 A;  5I56 A;  3PU5 A;  3O6H A;  1PDA A;  4ZEB A;  3MVZ A;  4MBP A;  1S9T A;  4JWX A;  3RLF E;  4LA9 A;  2DSF A;  3TTK A;  3RPW A;  2UVG A;  3PMV A;  3R7X A;  4LQ2 A;  2I58 A;  3FVO A;  1TWY A;  3DM0 A;  1N84 A;  3H6V A;  1PC3 A;  3CG3 A;  5H8F B;  1NNT A;  5DVJ A;  4F18 A;  1R9L A;  1LFI A;  4OEV A;  2F36 A;  4KI0 E;  3BFU A;  3TUS A;  1UTH A;  1MY0 A;  2VD2 A;  1TXF A;  1P1W A;  4MF3 A;  3K02 A;  3IOR A;  5H8H B;  3H6U A;  4WXJ A;  3HPI A;  4P0G A;  2HQ0 A;  3S9E A;  1JQF A;  3F11 A;  3PPR A;  2I3V A;  1SYH A;  2W7Y A;  3PPN A;  4F1Y A;  1EZO A;  1JEU A;  3DP4 A;  5F1Q A;  2V25 A;  3PUY E;  3S2V A;  5K2Y A;  4O3A A;  2G93 A;  2F6P A;  2Y7P A;  4LAT A;  3HN0 A;  1FTM A;  3PD9 A;  1KWH A;  3OSR A;  3L6G A;  2UVJ A;  1P1U A;  4YMB A;  2RC7 A;  4K3F A;  3B6W A;  4U4X A;  1B9J A;  4C0R A;  1QKB A;  3HST A;  4KD5 A;  3FJG A;  4DCY A;  1MM6 A;  1MXU A;  3H03 A;  4X1D A;  3CR9 A;  3TCF A;  4NWD A;  1B3L A;  2Q88 A;  3LSL A;  4DZ1 A;  4EF2 A;  3A3U A;  2XXT A;  2XX9 A;  1A54 A;  2A5S A;  4U22 A;  3LBS A;  1Z7N E;  1OIB A;  5ITP A;  4JB7 A;  4DXB A;  3FVN A;  3K1M A;  3IAZ A;  4GLI A;  3SDF A;  3H7M A;  1QW0 A;  2I6E A;  1HSJ A;  2ZYO A;  1OVB A;  1MXV A;  3FJ7 A;  1MQD A;  3EQ1 A;  2H25 A;  2I4C A;  1FQA A;  4HTG A;  3IO4 A;  2XHD A;  2XXU A;  2PYY A;  4DE8 A;  3TOD A;  4LZ5 A;  2DWJ A;  1USY E;  4R72 A;  4AQ4 A;  3JV9 A;  3G3F A;  4NMY A;  3FGS A;  2QMX A;  3UN6 A;  1OLA A;  3KFM A;  5I59 B;  1FTL A;  5TPA A;  3S9M C;  4RYA A;  4FJP A;  3TZA A;  1MY4 A;  1R1N A;  2XXV A;  2PVU A;  4HW8 A;  2WKY A;  2UXA A;  1PBQ A;  1R9Q A;  4IO4 A;  1LFG A;  4BDM A;  5IKB A;  1P1Q A;  3C31 A;  3QK6 A;  2QS3 A;  2I0C A;  4JWY A;  1B32 A;  3O2A A;  4Q5T A;  4IY5 A;  4MH5 A;  4R6K A;  4F3G A;  1ZTY A;  1O63 A;  2FA7 A;  2Q9T A;  1CB6 A;  5B7D A;  2LAO A;  2F8D A;  2ZYM A;  3FVK A;  3ECR A;  3MVY A;  1USY H;  2QL3 A;  1OQG A;  2ZNT A;  2REJ A;  5ISU A;  1TFD A;  1LAG E;  1OMP A;  1SVX B;  3KGC A;  2HZL A;  2Q2C A;  4F1U A;  2QPQ A;  1EU8 A;  1VFE A;  4TOZ A;  4FAT A;  1NMU A;  1SD3 A;  3HHF A;  3TKD A;  2HAV A;  3IOW A;  1ZMG A;  3K1P A;  4KYS A;  3KSJ A;  3E9X A;  2O6A A;  2ANJ A;  2FNC A;  1M5E A;  4LON B;  1B7U A;  4AB6 A;  3PPP A;  3S4U A;  3GXA A;  4C1T A;  4FIM A;  2GH9 A;  2Z23 A;  4WKM A;  2F7A A;  3QUF A;  3VFJ A;  2GHA A;  2DVZ A;  1FQD A;  3T9U A;  4C1U A;  5TP9 B;  1FTK A;  1II5 A;  1B0L A;  4F31 B;  4U23 A;  1NNK A;  4XKN A;  1PB9 A;  1RYX A;  1URG A;  1LAF E;  2HEU A;  2R9J A;  3K2D A;  4FE8 A;  1A8E A;  4GVO A;  2OWT A;  1IXG A;  1AOV A;  3IJX B;  1JET A;  3OO9 A;  2Z8F A;  2REG A;  3CI8 A;  1US5 A;  5A5X A;  3G3I A;  2RCA A;  1AH5 A;  2DE4 A;  4U21 A;  4EF1 A;  1JNF A;  4PP0 A;  3FD3 A;  3ILT B;  3QSL A;  3PUX E;  3SER A;  3C33 A;  1B3E A;  2IEE A;  3RN8 A;  4AB5 A;  5HBC A;  4JWO A;  5DTB A;  1NFT A;  4U1Z A;  1YAE A;  1B5I A;  3MW0 A;  3V8X B;  3SES A;  3IOV A;  4YB5 A;  5JK4 A;  1B5J A;  3CSB A;  3SEX A;  1H43 A;  1I6A A;  4BDN A;  3OEM A;  5L8D A;  2IA4 A;  4IGT A;  5CI5 A;  2DS9 A;  1T0K A;  3OEN A;  5FTH A;  2Q89 A;  1Y9U A;  3VVE A;  2O84 X;  5I57 B;  4NF6 B;  1LGB C;  4GL0 A;  2V84 A;  4TQU Q;  3D4G A;  2FYI A;  5HPQ A;  1FCK A;  1QKA A;  1HSL A;  1YCJ A;  3RGY A;  3MZB A;  1LAX A;  1F9B A;  5BWJ A;  1MY1 A;  4KR5 A;  4HS7 A;  5I2K B;  4GD5 A;  3R6U A;  3K00 A;  3VVF A;  3VE1 B;  2B3F A;  3EN3 A;  3AXF A;  2PT2 A;  5FHN A;  3TEP A;  4BDO A;  3CVG A;  2NXO A;  4PFU A;  1NH8 A;  1MH3 A;  3RT6 B;  1PB7 A;  5FHO A;  2A5T B;  3U72 A;  3G3K A;  3LUY A;  4R6Y A;  3PUW E;  1Q35 A;  3QUJ A;  3B7D A;  4QHQ A;  3CRB A;  4Z7E A;  3OO7 A;  2O1L A;  3H3G A;  1J1N A;  1JW1 A;  1LFH A;  5I2K A;  3KJ7 A;  2ZNU A;  4EQ7 A;  4NF4 B;  4ZZE A;  1Y4C A;  1TFA A;  1Y1Z A;  3I5O A;  4QSD A;  4GIZ A;  4YMA A;  3H06 B;  2ZMB A;  5I56 B;  2Q2A A;  3QYT A;  3FV1 A;  1DMB A;  3VXB A;  3QIM A;  1XVX A;  2O7U A;  4JXI A;  2NVU B;  4ELP A;  1GTK A;  4FOR A;  3UOR A;  4YKJ A;  5B70 A;  3T22 A;  3Q29 A;  5AA2 B;  2DXR A;  4ZDM A;  4H8I A;  3DEL B;  2H98 A;  2I3W A;  2H4I A;  3G3J A;  4F3S A;  3T9V A;  4RY1 A;  1UTH B;  3TYH A;  1NL5 A;  4R74 A;  3WAE A;  1ELJ A;  1WOD A;  1ZIU A;  3UIF A;  3W9W A;  4F2O A;  3TTR A;  2NOO A;  1RKM A;  4ESX A;  5DVI A;  3PUZ E;  3PMW A;  2GRV A;  4ISU A;  3OO6 A;  1VR5 A;  4ZED A;  5AA2 A;  1ATG A;  3RY3 A;  1Y3N A;  5KDT A;  1ZU0 A;  3TMG A;  2O68 A;  2DP8 A;  2XXH A;  3MZ1 A;  1Y1M A;  2OCU A;  2D21 A;  3U94 A;  2HCA A;  3OOA A;  1MQI A;  3IJO B;  5I2N B;  5ELV A;  4RPN A;  4XKP A;  2OK2 A;  3MVX A;  3MAM A;  1LBC A;  5DVF A;  4FAJ A;  1XC1 A;  5KCJ B;  4NF8 A;  4H0W A;  4YAH X;  4QFN A;  2Y7K A;  2E1S A;  2ESN A;  3PPQ A;  5L9M A;  3T66 A;  3N94 A;  1IQ7 A;  2XXQ A;  1NNP A;  3E3K A;  2CZL A;  1MQH A;  2X26 A;  2O69 A;  5KZT A;  3KG2 A;  2V3Q A;  1A40 A;  3DP8 A;  4RPO A;  1R6Z A;  5I2N A;  1H45 A;  3LSX A;  3TTL A;  3Q28 A;  1N04 A;  1ZKB A;  3FXQ A;  5KCJ A;  3A3C A;  3FIR A;  3ONM A;  2H99 A;  4U1O A;  1D9Y A;  5F7V A;  1IXH A;  2O7I A;  1US4 A;  3OEL A;  1JW5 A;  3SEY A;  1FTJ A;  2QMW A;  3VLW A;  4IB2 A;  2ONK E;  4KHZ E;  2HAU A;  1WDN A;  4PE5 B;  2AYS A;  3K6V A;  4WEP A;  3SEV A;  2DWI A;  4MLV A;  3S9N C;  5TPA B;  1UIV A;  4H67 A;  3MP6 A;  5TU0 A;  4LVQ A;  3TQL A;  2F97 A;  4GL8 A;  1I69 A;  2ZXT A;  1ZLQ A;  1MPC A;  3C36 A;  2F5X A;  3CFX A;  4OET A;  2Y7I A;  3UGW A;  3MVW A;  2DYX A;  4OFL A;  5CBR A;  4KFQ A;  4ZEC A;  3H6W A;  4Q30 B;  3QXM A;  4NF5 A;  3EHU A;  4ELO A;  2ZYK A;  3K6X A;  4BDQ A;  3FJM A;  3PMX A;  1PBP A;  2XXR A;  3D4C A;  5CMK A;  3C32 A;  4XKR A;  1AIV A;  4ZEF A;  3MWB A;  4OEU A;  2F34 A;  4PFW A;  2F78 A;  2D5W A;  2CMO A;  3FV2 A;  3C34 A;  3E4R A;  4NTL A;  3TPA A;  1MDQ A;  1EH3 A;  5H8N A;  1M5B A;  1N7X A;  4RNS A;  3K1N A;  4LP2 B;  4X9T A;  4EDP A;  3HHG A;  4KPT A;  2I48 A;  1MS7 A;  4R2B A;  2E0S A;  3MBP A;  1JVY A;  4GF8 A;  2I49 A;  4LZ8 A;  1LCF A;  3N6T A;  1BTJ A;  3K0V A;  3T9X B;  2QS4 A;  3MUQ A;  2P1S A;  4F3B A;  1OLC A;  3DLN A;  1LB9 A;  2RC9 A;  3USD A;  1IZ1 A;  1MPB A;  4OMB A;  3M3K A;  1XT8 A;  1IUD A;  4EQ9 A;  1MXW A;  2F6G A;  3B6Q A;  4KYD A;  1MRP A;  5FHM A;  3THI A;  3DP6 A;  4HCW A;  1IXI A;  3W15 C;  1SDX A;  3VXC A;  2H5Y A;  3MQ9 A;  1JVX A;  4OXV A;  1B6H A;  3LC8 A;  2HXW A;  1ZBM A;  2NWJ A;  5A5X B;  1Y3P A;  1LST A;  3KN8 A;  4FEB A;  4G8H A;  4GOT A;  1Y3Q A;  5CBS A;  2HZK A;  3PGF A;  4OTE A;  5M2V A;  2H9B A;  3IL1 B;  3G7W A;  3TFL A;  1Y20 A;  1B5H A;  5ICT A;  2VOZ A;  4Q0C A;  3VV5 A;  4MLQ A;  1P99 A;  5AA4 A;  1B46 A;  2V3U A;  3IB1 A;  4RXL A;  3EF7 A;  4LQ5 A;  3T93 B;  1D3K A;  1DTZ A;  3KOS A;  1GGG A;  4I62 A;  3O9P A;  1LAH E;  4ZZA A;  3V83 A;  4IO5 A;  4LUB A;  2DE3 A;  1DSN A;  1NKX A;  3ILU B;  1XVY A;  2XX8 A;  4OER A;  1JW4 A;  2HFB A;  4NED A;  2DWA A;  2PT1 A;  3Q27 A;  3RTF B;  1UTB A;  3K01 A;  1QJM A;  1IIW A;  4H8J A;  3KBR A;  4F19 A;  1B0H A;  4BLA A;  4OES A;  1FQC A;  1SI1 A;  4M1V A;  2F7B A;  3VVD A;  5JTY A;  4ELQ A;  3OXN A;  3U1O A;  2DOJ A;  2NUV A;  3L6H A;  4QFL A;  1Z7M E;  1AL3 A;  1POT A;  3K4U A;  1LBB A;  3ZSF A;  4R2F A;  2VP1 A;  1S7Y A;  4DLD A;  3IK6 B;  2PBW A;  1B05 A;  1A7L A;  3MPL A;  5AE4 A;  1VSO A;  4NE4 A;  3CIJ A;  4PQJ A;  3BKI B;  3PUV E;  3VDF A;  2O51 A;  2THI A;  4IO7 A;  1LB8 A;  3IOT A;  3OEK A;  5CC2 A;  2Q8J A;  4X48 A;  4GWO A;  1DOT A;  5EHS A;  3LSF B;  3SET A;  1I6B A;  1BP5 A;  4G68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...