1A40A

Phosphate-binding protein with ala 197 replaced with trp
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
321
structure length
321
Chain Sequence
EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGTSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYWYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dominant role of local dipolar interactions in phosphate binding to a receptor cleft with an electronegative charge surface: equilibrium, kinetic, and crystallographic studies.
pubmed rcsb
source organism Escherichia coli
molecule tags Phosphate-binding protein
molecule keywords PHOSPHATE-BINDING PERIPLASMIC PROTEIN PRECURSOR
total genus 102
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 1998-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1a40A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1a40A02
3H3GA 2AL4A 1SW5A 2O69A 2ZYOA 4OZ9A 3WAEA 4F2OA 1B51A 4QSCA 1FTKA 2I3VA 2F78A 4XTCQ 3A09A 1VSOA 3U92A 2AL5A 3T22A 1B5IA 1XC1A 3ONMA 4PFWA 3MZ9A 4YU0A 5B7DA 4R75A 3FATA 4H6DA 1A8EA 1ELJA 1SW4A 3C32A 1P1WA 3IB1A 3LSWA 2FNCA 1M5CA 4G8HA 3IX1A 4QFNA 3C9HA 3SETA 3UORA 4Q0CA 4R9GA 3D4CA 3T9VA 1B6HA 1MXVA 2DWHA 2H9BA 2UYEA 3SKPA 4UA8A 1N7WA 3FD3A 2G93A 4QRZA 3W9WA 2I3WA 3DM0A 3EHUA 3O6GA 4RYAA 5FHOA 1BKAA 3G3IA 3WAFA 4H5GA 1MXXA 4KD5A 3H03A 4RA1A 1SD3A 5CMKA 1PB8A 5I57A 1FTMA 3BKIB 3E9XA 3PUVE 3TTLA 3OO6A 3EPEA 4DLDA 1B32A 1UTHA 4PFUA 5DVIA 3ZS6A 4GXSB 4OFJA 1JVXA 4IY5A 1SI0A 4M4GA 3R6UA 4IO3A 4KCDA 3PPPA 2QMXA 3FXRA 1Q35A 4LVQA 5I57B 2REGA 1B2HA 1QVSA 4POXA 3RT8A 2RC7A 5A5XA 1S9TA 1P99A 1WDNA 4NF4A 3RTFB 5AE4A 2ZYNA 2P0SA 1BTJA 2Y7WA 1UQWA 1D3KA 2OK2A 4ELPA 2THIA 1MQGA 1H3DA 3TZAA 2KLFA 1BIYA 3VXCA 1B1XA 5L9MA 2Y84A 1LB9A 1IIWA 3JV9A 5EHMA 5TPAA 5AA4B 1VR5A 2F35A 4LQ5A 4H1XA 1GV8A 1I6QA 3OELA 3TCGA 3S4UA 1OVTA 1N04A 4MLQA 2F36A 1GGGA 1URGA 2HZLA 3VVFA 2LAOA 4GLIA 4TLLB 1SQYA 2XX8A 4NTLA 3QSLA 3B6WA 4YKIA 1NH7A 2ZYMA 4OVJA 5EYFA 3M8UA 1B05A 1RYXA 1H43A 2UVHA 2PVUA 4YKJA 3IB2A 4LP2B 3KSXA 1MPCA 4O3CA 5H8HB 3KJTA 4U21A 3GLBA 3IOTA 3U8QA 3EHTA 4DXBA 1MS7A 1M5FA 4I62A 4JWXA 3USDA 5BWJA 5H8NB 1FQDA 1LFIA 4GOTA 3TYHA 3B6TA 4Q5TA 3QUJA 4C0RA 3MWBA 1UIUA 4OYVA 3IOWA 4FIMA 4GF8A 2QL3A 1N84A 1OLCA 3PPRA 4NF5B 3RLFE 1NNFA 3FJMA 1B3GA 2F6PA 2AYSA 1Y9UA 3I5OA 1SYHA 4RK9A 1TWYA 1LAGE 4KHZE 5TU0A 3V8XB 2R71A 5CI5A 3IJOB 4ZEBA 1GVCA 1A40A 1QKBA 2D3IA 4I9DA 3U93A 5KDTA 3MVXA 4MFIA 3S9EA 3O9PA 3TMGA 3QXMA 3DP4A 2Z8EA 4G4PA 1IXCA 3G3FA 3GBAA 2DWJA 3CFXA 4I1DA 3LSXA 3RPWA 1JW1A 3CVGA 5I84A 5F7VA 4E0XA 2V3TA 2X7PA 1FTLA 4JSOA 1IXHA 2FYIA 3CG3A 3OD7A 4EF1A 4F29A 2Q8JA 1O63A 2NUVA 3JYRA 3LC8A 4OETA 5AA1A 4WKMA 5TP9B 3T96B 1ZIUA 4HS7A 4OWDA 3BFTA 3SDFA 3UGWA 3AXFA 1NNPA 3VVDA 3VVEA 5I58B 5I56B 4ND9A 2B65A 4R6HA 1DTZA 2Q89A 3VLVA 2ESNA 2QRYA 1MY3A 4GRKA 1PBQA 4YMBA 2O6AA 3FV1A 1FQBA 3HV1A 3OO9A 1EU8A 2VHAA 1ZMGA 2HXWA 1MH4A 4G68C 4KYSA 1Z7ME 2V3QA 2BJJX 2XD3A 4ZECA 3O28A 4H0WA 3V5AA 3DP8A 4NF5A 4TLMB 3TEPA 3CR9A 3HN0A 2UXAA 4N6PA 1NNKA 3TODA 1D9VA 1SI1A 3C35A 4OHNA 4F2QA 4DIGA 1MY0A 3MP6A 5FHMA 3CRBA 3G3KA 1MPDA 3MQ9A 3Q25A 5H8HA 1DPPA 2NVUB 2FA7A 4FATA 4KR5A 1PC3A 3K02A 3U94A 3HHGA 1JW4A 3OO8A 3PPQA 4P11A 4ZDMA 4QSEA 4THIA 1AL3A 5HM4B 2XXHA 1LBCA 3SEUA 1JNFA 2RF1A 3SEYA 3KJ7A 5DVJA 4GWOA 2AIXA 2G29A 1R6ZA 3A3UA 2A5TB 3LBSA 1USYE 3THIA 3KFMA 2VD2A 2O84X 5H8QB 4BLAA 4G77A 4LZ7A 5B70A 3N6UA 4DCYA 3Q29A 4IO7A 4O3AA 1N3XA 3PV0E 5H8SA 4Q30B 4F19A 1B52A 2OCUA 2QJEA 4AQ4A 1PDAA 4ELRA 4XKQA 1FTJA 1NL5A 1IZ1A 1Y20A 2XX7A 3LSLA 4QFKA 5DT6A 5K2XA 4BDLA 1OQHA 3C33A 4LATA 4QFLA 3VLUA 4F1VA 1VFEA 4HCYA 3Q27A 3OENA 4NMYA 3UN6A 3T9UA 3MVWA 3EF7A 5H8FB 3T9HB 3BFUA 4U22A 2GRVA 4HTGA 3ZSFA 2I0CA 4GIZA 3ZKLA 4EQ9A 3HO7A 5AA3A 1D9YA 3O97A 1UTBB 2DVZA 2HEUA 4G2ZA 2NWJA 5KCJB 4OFLA 2ONKE 4PE5B 3V89B 2VOZA 1MQJA 1N7XA 2I4CA 4OENA 4BDOA 4I8CA 1B4ZA 1EZOA 5I2KB 2DSFA 2PT1A 3CFZA 5J1DA 4FORA 4N13A 4QF9A 3H6VA 1RKMA 3PUXE 1LLSA 3DP6A 3PU5A 4YICA 3S9NC 1LSTA 1MY4A 3MUQA 3SEWA 1MXUA 1QULA 1B0LA 3RNNA 1JW5A 2D21A 3MZ1A 1M5EA 1B7UA 1ZBMA 3PGFA 1B46A 1IITA 4FEBA 1URDA 2IEEA 4IGTA 3RN8A 1XS5A 1CB6A 1Y4TA 3FVOA 4N07A 4E0WA 3PUZE 1POTA 2UVGA 1I6BA 3ODBA 3Q28A 4GQOA 1VE4A 2DOJA 3H06B 3K1MA 4UACA 5L8DA 4F3PA 3V83A 5ITOA 3T9XB 1YCJA 3K01A 2Z23A 4OERA 2YPNA 4NWDA 5AA2A 3VLWA 1B5HA 1MQDA 2GHBA 4GXAA 1JEUA 2DS9A 3K1PA 2X26A 2XD2A 2XXXA 3O29A 1II5A 1F9BA 3KZGA 1B9JA 2ZXTA 4R6KA 4OESA 5HPQA 4JWOA 2QPQA 2R6GE 1DTGA 4MF3A 4X9TA 4PQJA 3SEVA 3KN8A 1KWHA 1HSLA 4F1UA 4GD5A 4ESWA 2XXRA 3MC2A 4ZEDA 2UVJA 1MPBA 1EH3A 2XXPA 4GL0A 1NKXA 3G3GA 3H6WA 3M3KA 4NEDA 2DP8A 2Z8DA 4P0IA 2DXYA 1H76A 2UYFA 4ZEIA 3S9LC 4RPOA 4R2FA 1TFDA 4F39A 1UIVA 1AOVA 2ONRA 3HSTA 3MPKA 3QK6A 3ILTB 4POWA 4IO2A 2P2AA 4XKPA 4YB6A 3IK6B 5M2VA 3MVZA 3E13X 3TTKA 4DXUA 1I6AA 3I6VA 2XXVA 1AMFA 4F22A 3CIJA 5I2NA 2YJPA 2E0SA 3KSJA 3W15C 1US4A 3QIMA 3EN3A 2XXTA 2X7QA 1Y1ZA 3EHSA 1IQ7A 2PX1A 2WKYA 3FJ7A 3K6VA 4GVOA 5AA4A 3G7WA 2CZLA 1MG1A 3C36A 1P1QA 1EZ9A 1ZU0A 3IR1A 1JETA 3PD8A 4ELOA 1MY1A 1OVBA 3TELA 2F7AA 3VFJA 1R9LA 4EUOA 5FHNA 1DSNA 3U72A 3K1NA 2HCAA 2PMSA 1ANFA 1MXZA 4NE4A 2OJTA 1MQHA 4QFOA 1SYIA 4ZEFA 4JBZA 1JQFA 2ZMBA 3HHFA 3MW0A 4IGRA 2H5YA 1OQGA 4X1BA 1Z7NE 4ISUA 4OFOA 2I49A 1SVXB 1XT8A 1QKAA 1Y3NA 3K00A 4XIGQ 5H8NA 4ZZAA 4IO4A 3I3VA 3VV5A 4EF2A 2NXOA 4PETA 4YKPA 3TTRA 4YAHX 4ZE8A 2XXYA 4OEVA 3HCQA 1Y1MA 1B3FA 3VXBA 2QS2A 2A5SA 3EQ1A 1MM6A 4YB7A 2I0BA 5CM6A 3T66A 2H25A 2Y7RA 5TP9A 2QMWA 3H4ZA 4AB5A 3OMBA 5ICTA 2DWAA 2I4BA 3TTNA 2B3FA 2V25A 3K6XA 3QUFA 1A8FA 2ZNUA 3QYTA 2A5TA 2GH9A 3KN3A 5F1QA 3TCHA 3D4GA 1JVYA 2RINA 3KOSA 1WODA 4G68A 4G68B 4H67A 4X1DA 1QUJA 2QS1A 4RK2A 1XHYA 2OBGA 3K0VA 4IB2A 2O7UA 4Q8RA 1JEVA 2H98A 4ZE9A 5ISUA 1L5TA 4U4SA 2ZNSA 3O6HA 4PFYA 1B3EA 1IXIA 2QS4A 2RKMA 4TOZA 4JB7A 4OQOA 1AIVA 1FQAA 1YTVA 3OXNA 2E1SA 1ZKBA 2REJA 3CFLA 3KG2A 5FTIA 5CBRA 5L9SA 3H6TA 4DZ1A 1BP5A 1EZPA 2GFEA 5DTBA 3PPNA 4RY1A 1GR2A 1PB7A 1A99A 1VFDA 2O51A 3MBPA 4O3BA 3ZKKA 2RC8A 4EDPA 4OTEA 2HZKA 2QSXA 4L17A 5CBSA 1B3HA 2D5WA 3FXUA 1FQEA 4OEUA 1QUIA 4OMBA 1MM7A 5I2NB 4GFRA 3KN7A 1DOTA 1O7TA 1Y3PA 2UVIA 1IUDA 2HAUA 2ZNTA 4KCCA 2F34A 4FJPA 4K3FA 1NMUA 4XKRA 3UIFA 4G8MA 4F31B 2RCBA 4MLVA 5K2YA 1LCTA 1PBPA 3PMVA 2NOOA 1URSA 3E3KA 4IY6A 4QHQA 4Z0IA 3TTMA 4DDDA 5LOMA 3UA8A 5JEIA 3H6UA 4IO6A 1LAFE 4RXLA 1N3WA 1A54A 3IOVA 3O66A 2ABHA 5DEXA 3TFLA 5A5XB 3K2DA 2O1LA 2OWTA 3SEXA 4EXKA 3H7MA 3LUYA 5ICQA 1PEBA 3GXAA 4F18A 1SBPA 1IXGA 1POY1 2P1SA 1M5DA 3RY3A 1B7HA 3TPAA 1LFHA 3TKDA 4LQ2A 4F3GA 5I59A 1D4NA 1IEJA 2O7IA 4Z7EA 1B4HA 3GZGA 5CMMA 2PBWA 2OLBA 4QSDA 3UK4A 3KEIA 1WVJA 3MP1A 5EHSA 2V93A 4DXCA 4F1YA 3FASA 2IA4A 4NWCA 3OSRA 4TQUQ 2CMOA 3O6IA 4DCXA 2QS3A 1S7YA 2F5XA 1XVYA 2VP1A 1H45A 3O2AA 1MH3A 1MXYA 3VE1B 4RNSA 4PFTA 3RGYA 1LCFA 3DLNA 1B7ZA 3CI8A 4F3BA 3E4RA 2ONSA 3FJGA 3FXQA 1NH8A 4YB5A 3TQLA 4C1TA 3TCFA 1OLAA 1QUKA 5L9OA 1B1HA 1LBBA 3MPLA 4ONYA 1Y4CA 2OZZA 4ZEKA 1ZLQA 4JWYA 4C1UA 3C4MA 2DQVA 2O1MA 5I59B 1SW1A 3R7XA 1Q1KA 5DEXB 4YZZA 2Y7IA 3ECRA 3MZBA 4FE8A 5TPAB 2VGQA 4AB6A 3K6UA 4R73A 2Y7KA 4ZZEA 1FCKA 1B3LA 4KYDA 2I58A 5BUUA 4HW8A 1H44A 1B58A 4DE8A 5CRYA 1S50A 1SDXA 3FVGA 3IB0A 2DE3A 3Q26A 3TDJA 1LAHE 3FVNA 3N26A 4IO5A 4LONB 3SERA 4BDQA 4H65A 1FQCA 3IAZA 3L6HA 3OOAA 3A3CA 5DVFA 3FGSA 2I48A 3IO4A 4FEDA 4X48A 2R9JA 3TUSA 2F97A 4KFQA 3BBRA 3ILUB 1LAXA 1I69A 1O64A 2M8CA 2HAVA 4U1ZA 1NNTA 3UP9A 2XXIA 5CMCA 1ZJLA 1MY2A 1XOCA 2ZYKA 1UTHB 1R9QA 2RCAA 4R74A 2Z8FA 2VD3A 4KQPA 3K6WA 5ITPA 2XHDA 3CSBA 4NF8B 2W7YA 1P1UA 5I56A 5I58A 2DWIA 3VDFA 1T0KA 5IAIA 2XXQA 2V84A 4H5FA 4JXIA 3TQWA 1CE2A 4F3SA 1MRPA 5AA2D 1OIBA 1TXFA 1QW0A 4XKNA 2Q2AA 1A7LA 3LR1A 2F7CA 1MDP1 2DE2A 3B6QA 2Q9TA 4KI0E 3IORA 4ZS9A 4M1VA 5FTHA 4GL8A 2F8DA 1MDQA 2DVCA 3OSQA 1DPEA 3PMXA 3PPOA 1MQIA 1TFAA 4JDFA 1FQFA 3DELB 2H99A 4LUBA 4RJZA 3S9MC 1AH5A 2ANJA 3FIRA 2XXUA 3B7DA 3IOUA 4LZ8A 2GHAA 1B0HA 1FW0A 1XVXA 3R26A 3U1OA 4BDNA 4BDRA 5KZTA 2OWSA 2DYXA 1BLFA 1HSEA 2H4IA 3N6TA 4G8NA 4HCWA 4R6YA 3RQTA 3T93B 3PMWA 3C31A 3RUMA 5I2KA 2Q2CA 2PT2A 3LSFB 2Q88A 3MJNA 1MXWA 1B40A 2PYYA 1B5JA 2YLNA 1NFTA 1UTBA 3L6GA 3MP8A 3PUWE 5KCJA 3CSGA 1SW2A 4U2RA 2F6GA 3G3JA 3C34A 5JTYA 4EXLA 4RPNA 1R1NA 1LB8A 3F11A 3S2VA 3KOTA 4R2BA 4QFPA 5CMBA 3W9VA 3TAJA 4U4XA 1HSJA 3FUZA 4XXUA 5ELVA 1LGBC 1TT1A 3GBBA 3OO7A 4LA9A 1LFGA 4KYEA 2DXRA 3OEKA 4H8IA 4NF8A 3RT6B 3FZVA 3SESA 2V3UA 2ALUA 2B3BA 2Z22A 4ESXA 2XX9A 4R9FA 1YAEA 2XXWA 4OXVA 1ZTYA 4MH5A 5DYHA 1GTKA 1FTOA 3N5LA 3OEMA 1DMBA 4WXJA 1USYH 1YPNA 2DE4A 3G3HA 1Y3QA 2I6EA 5H8QA 3M3FA 5HBCA 5IKBA 3PUYE 4R72A 3CG1A 3IL1B 1QJMA 3N94A 5AA2B 5KDTB 1OMPA 4BDMA 1P1NA 3PD9A 4U1OA 4ELQA 1N76A 4YMAA 2O68A 3KBRA 3MVYA 1N0TA 4WEDA 1PB9A 4JSDA 4FAJA 3KGCA 1ATGA 5CC2A 4NF6B 3MAMA 4NF6A 3K4UA 4EQBA 2HFBA 4KPTA 3FVKA 3IO6A 4WEPA 2RC9A 3M3LA 3P7IA 4MBPA 4YKKA 4PP0A 1P1OA 3JZJA 2HQ0A 4FECA 4H8JA 4U23A 4EQ7A 3HPIA 3QAXA 4LZ5A 3IJXB 4NF4B 1J1NA 4ECFA 5H8FA 3RTWB 3FV2A 4P0GA 5JK4A 1A55A 5JTYB 1M5BA 1RYOA 2Y7PA 2F7BA 1US5A
chains in the Genus database with same CATH superfamily
3H3GA 2AL4A 2O69A 1B51A 3U92A 2AL5A 3T22A 1XC1A 4H6DA 1A8EA 1SW4A 1P1WA 3LSWA 3IX1A 3C9HA 4R9GA 1B6HA 2UYEA 2FIXA 3O6GA 4RYAA 3E79A 5FHOA 3G3IA 3WAFA 5IM2A 2QVUA 1MXXA 5EQ9A 3H03A 4RA1A 5CMKA 4PFUA 5DVIA 4OFJA 4M4GA 3PPPA 3FXRA 5I57B 5A5XA 2B4LA 3RTFB 1P99A 2P0SA 1UQWA 2OK2A 3D1RA 1MQGA 2KLFA 4JVIA 4P1LA 1B1XA 5L9MA 1LB9A 3LUZA 4H1XA 1I6QA 4AS4A 3S4UA 4MLQA 2HZLA 4GLIA 4YKIA 3B6WA 2ZYMA 5EYFA 3M8UA 4YKJA 2Y5LA 3USDA 1FQDA 1LFIA 5T3JA 3B6TA 3MWBA 4FIMA 2QL3A 3RLFE 3FJMA 1B3GA 2OWZA 4KHZE 2R71A 3IJOB 1GVCA 1QKBA 3DP4A 3G3FA 2DWJA 3LSXA 3RPWA 1JW1A 4E0XA 2X7PA 2NUVA 4GWXA 3AXFA 1NNPA 3VVEA 4ND9A 1DCUA 1DTZA 3VLVA 2QRYA 4YMBA 1EU8A 4ZECA 2QFLA 3TEPA 3CR9A 4FBPA 3TODA 1D9VA 3C35A 1INPA 1CNQA 3MP6A 1KZ8A 5ET7A 1MPDA 5H8HA 1DPPA 2FA7A 3K02A 3U94A 3HHGA 1JW4A 4QSEA 1IMEA 4THIA 1JNFA 4OVRA 2G29A 2A5TB 3LBSA 2VD2A 2O84X 4G77A 4AQ4A 4QFKA 4LATA 4F1VA 3T9UA 4N6DA 3EF7A 4U22A 4HTGA 3ZKLA 5AA3A 1D9YA 3O97A 4G2ZA 2NWJA 2VOZA 1N7XA 4OENA 1EZOA 5J1DA 3DP6A 4N4UA 3SEWA 1MXUA 1QULA 3RNNA 3RUMA 2D21A 2IEEA 3RN8A 1Y4TA 1CB6A 4N07A 1POTA 2UVGA 3ODBA 1FBPA 3H06B 3T9XB 1NV6A 1YCJA 4OERA 4GXAA 1MQDA 3K1PA 2XXXA 1B9JA 4R6KA 3U65A 2R6GE 4MF3A 1DTGA 1HSLA 4H46A 3MC2A 4N91A 4PDHA 2UVJA 4GL0A 3H6WA 3LV0A 1UIVA 1AOVA 2WYKA 2ONRA 3E78A 3IK6B 4DXUA 2ZZVA 3TTKA 4F22A 1AMFA 2E0SA 3EN3A 4GVOA 1IQ7A 3G7WA 2CZLA 3C36A 1EZ9A 3TELA 1DSNA 2HCAA 2PMSA 1ANFA 1MXZA 4QFOA 4MCOA 4QBAA 2ZMBA 4X1BA 4ISUA 1Y3NA 4ZZAA 3TTRA 3KC0A 1KA0A 2A5SA 2I0BA 3T66A 2H25A 2Y7RA 3OMBA 2DWAA 2B3FA 2V25A 3K6XA 3QUFA 3QYTA 2ZNUA 2GH9A 3T0JA 3FXBA 5A5LA 1XHYA 3K0VA 5ISUA 1IXIA 4OQOA 1AIVA 1YTVA 2REJA 4N17A 1EZPA 1LBVA 4RY1A 4O3BA 1VFDA 4EDPA 2QSXA 1B3HA 2D5WA 3FXUA 3T1BA 4PDDA 4OMBA 4GFRA 1DOTA 1O7TA 2UVIA 1IUDA 2HAUA 2F34A 4FJPA 4F31B 1FBEA 2RCBA 1LCTA 1URSA 4Z0IA 3UA8A 1N3WA 3HFUA 1IMAA 2OWTA 1EYJA 3H7MA 2CZHA 3MSTA 5ICQA 3GXAA 1BK4A 1B7HA 3ROJA 3TPAA 1WVJA 3BIGA 3MP1A 5EHSA 4DCXA 2CMOA 3O6IA 2QS3A 2F5XA 1FRPA 1XVYA 3O2AA 1MXYA 1NH8A 1OLAA 1LBBA 5I7IA 3R7XA 4YZZA 2VGQA 4AB6A 1KA1A 4KYDA 5BUUA 4HW8A 1H44A 5CRYA 4QXDA 3IB0A 3Q26A 3IAZA 3L6HA 2I48A 4FEDA 2OX3A 4KFQA 4U1ZA 1NNTA 3SZPA 1UTHB 2RCAA 2VD3A 4KQPA 3K6WA 2XHDA 1P1UA 1XI6A 5I58A 2XXQA 4H5FA 3TQWA 4F3SA 1QGXA 1A7LA 2F7CA 3IORA 2MKZA 1TFAA 3DELB 4LUBA 3ZSFA 2XXUA 3B7DA 1B0HA 3R26A 3U1OA 1BLFA 4HCWA 3PMWA 3MJNA 1B5JA 3L6GA 5KCJA 1LB8A 3TAJA 3FUZA 3GBBA 3RT6B 2V3UA 2ALUA 2Z22A 4R9FA 2XXWA 5DYHA 3OEMA 1YPNA 3G3HA 2XA5A 3N94A 4YMAA 2O68A 1N0TA 4X04A 1ATGA 3RPLB 3MAMA 4NF6A 3K4UA 2HFBA 3IO6A 4WEPA 2RC9A 3P7IA 3JZJA 2HQ0A 5H8FA 4NF4B 3RTWB 5JK4A 1M5BA 2Y7PA 4MNIA 4F2OA 1VSOA 2JJKA 3V83A 1FPFA 1ELJA 3SETA 2DWHA 1N7WA 3W9WA 2I3WA 3DM0A 3EHUA 4O94A 4O7IA 4KD5A 1PB8A 1FTMA 3PUVE 3EPEA 1UTHA 1JP4A 1SI0A 4PE3A 4KCDA 1B2HA 1QVSA 4POXA 3RT8A 1S9TA 1WDNA 4P47A 4GWWA 2ZYNA 2Y7WA 1D3KA 2FIEA 2THIA 1H3DA 1IIWA 1FBDA 3IFCA 3OELA 3TCGA 5EQAA 1N04A 1GGGA 3VVFA 4TLLB 1SQYA 3QSLA 1H43A 2UVHA 2PVUA 1IMDA 1MPCA 3KSXA 2DDKA 3KJTA 3IOTA 4DXBA 1M5FA 4GOTA 3B50A 2CEXA 4OYVA 1OLCA 4NF5B 4RK9A 3I5OA 5TU0A 1TWYA 5CI5A 3FBPA 4ZEBA 3U93A 4I9DA 3O9PA 3CFXA 3CVGA 2V3TA 4F29A 2Q8JA 1O63A 3JYRA 4OETA 5TP9B 4OWDA 3BFTA 3UGWA 4I40A 5I56B 4N81A 2ESNA 3HV1A 1ZMGA 4G68C 4OA4A 3O28A 4H0WA 3V5AA 3DP8A 1NNKA 1SI1A 1MY0A 2KR0A 3CRBA 3MQ9A 3Q25A 2NVUB 4LN5A 3PPQA 1AL3A 3SEUA 4GWOA 1R6ZA 1USYE 3KFMA 4DCYA 4IO7A 3PV0E 2OCUA 1NL5A 3LSLA 5K2XA 3C33A 4XFEA 4HCYA 3Q27A 3UN6A 3MVWA 3BFUA 4EQ9A 2I0CA 3HO7A 5KCJB 2ONKE 3V89B 3PTYA 2DSFA 2PT1A 5ESYA 3H6VA 4FEBA 1B7UA 1ZBMA 3PGFA 1IITA 1URDA 1XS5A 4E0WA 5EQ8A 3Q28A 4GQOA 1VE4A 2DOJA 3K1MA 4HE2A 5IZZA 3K01A 4PGNA 4HE0A 1B5HA 2X26A 1F9BA 2ZXTA 4OESA 4OVQA 4PQJA 2XWOA 2XXRA 1IMBA 4P0IA 2UYFA 5ET5A 3HSTA 4POWA 4IO2A 2P2AA 4PFBA 2XXVA 1FBCA 3QIMA 2XXTA 2X7QA 3EHSA 2PX1A 2WKYA 4PCDA 3IR1A 3PD8A 4GX6A 4ELOA 1MY1A 2F7AA 3K1NA 4NE4A 1MQHA 4ZEFA 4JBZA 1JQFA 1OQGA 1Z7NE 3K00A 4XIGQ 3TUSA 5H8NA 4IO4A 2XXYA 4OEVA 1Y1MA 1B3FA 2QS2A 4PFRA 3EQ1A 5TP9A 2QMWA 4GWZA 1A8FA 4P56A 3KOSA 1QUJA 4IB2A 2O7UA 2H98A 4GX3A 1L5TA 1FJ9A 4PFYA 3CFLA 4GX4A 5FTIA 5CBRA 4DZ1A 1BP5A 2GFEA 1NUXA 1RDZA 3PPNA 4NG7A 3KN7A 4KCCA 3UIFA 1NMUA 4G8MA 5K2YA 4DDDA 4QHQA 3TTMA 1LAFE 4RXLA 3IOVA 1A54A 2ABHA 3TFLA 5A5XB 3K2DA 1IMCA 2O1LA 1LBYA 1IXGA 2WEFA 2P1SA 3RY3A 1LFHA 3TKDA 4F3GA 2PFYA 1IEJA 3GZGA 4JVCA 2PBWA 2V93A 3FASA 4NWCA 3OSRA 2VP1A 3VE1B 1MH3A 4OVSA 3RGYA 2ONSA 3FJGA 4YB5A 4C1TA 3TCFA 1EYIA 1QUKA 3MPLA 4ONYA 3KC1A 4ZEKA 1Y4CA 2GQ1A 1YXIA 4NN3A 5DEXB 4I3EA 1FCKA 4LONB 3SERA 4H65A 5DVFA 4MAGA 3A3CA 2XWIA 1I69A 5CMCA 4OVTA 4R74A 2Z8FA 5ITPA 1T0KA 5IAIA 4G61A 4JXIA 1MRPA 5AA2D 1OIBA 1TXFA 3RPLA 4ZS9A 4KI0E 4M1VA 1MDQA 2DVCA 3OSQA 1DPEA 3PMXA 3PPOA 2WYPA 1FQFA 4RJZA 2H99A 3S9MC 4LZ8A 4BDRA 1FW0A 2OWSA 3N6TA 4G8NA 3T93B 1AWBA 2Q2CA 2PT2A 2Q88A 2YLNA 1NFTA 3PUWE 5I3SA 3C34A 4EXLA 1R1NA 3F11A 4R2BA 4U4XA 5ELVA 1LFGA 4KYEA 4NF8A 3FZVA 2XX9A 1ZTYA 4WXJA 2DE4A 2P3NA 1Y3QA 3M3FA 5HBCA 1P1NA 4PAIA 1N76A 3MVYA 4FAJA 3KGCA 1G0IA 5CC2A 4NF6B 4EQBA 4PP0A 4FECA 1RDYA 1LEVA 1FBGA 5JTYB 2HHMA 2ZYOA 3WAEA 1FTKA 4XTCQ 3A09A 2XXKA 4PFWA 4YU0A 2XWVA 1NI9A 3FATA 4R75A 3C32A 4G8HA 3IB1A 3S9EA 5L9SA 2FNCA 1M5CA 4Q0CA 2QVRA 4NX1A 2H9BA 3SKPA 2FVZA 3FD3A 2G93A 4QRZA 1BKAA 4H5GA 5I57A 3BKIB 3TTLA 3E9XA 3ZS6A 4GXSB 4IY5A 4IO3A 2QMXA 1Q35A 4LVQA 5LDZA 2REGA 1YYZA 1YZ0A 1BTJA 4GBWA 1BIYA 3VXCA 5EHMA 3JV9A 5TPAA 5AA4B 1VR5A 4LQ5A 2CEYA 1OVTA 2F36A 1URGA 2LAOA 5DW8A 1NH7A 4OVJA 1B05A 1RYXA 1SPIA 3IB2A 4LP2B 4U21A 3U8QA 3EHTA 1MS7A 4JWXA 5ET6A 2WX9A 4Q5TA 3NOHA 4GF8A 3PPRA 1NNFA 2AYSA 1SYHA 5KDTA 1A40A 2D3IA 3TMGA 3QXMA 4G4PA 1IXCA 3GBAA 4I1DA 5F7VA 1IXHA 2FYIA 3CG3A 3OD7A 4EF1A 1RDXA 3LC8A 1ZIUA 4HS7A 1FTAA 3SDFA 4NHBA 3VVDA 2B65A 4R6HA 2Q89A 1PBQA 3OO9A 4P1EA 2HXWA 2XD3A 4TLMB 3HN0A 2UXAA 4N6PA 4OHNA 5FHMA 2HPGA 2PFZA 4FATA 2Q8MA 1NUYA 3KJ7A 2AIXA 5H8QB 4BLAA 4LZ7A 5B70A 4JVDA 3N6UA 4O3AA 1N3XA 4F19A 1PDAA 5FBPA 1FTJA 1Y20A 3VLUA 4MEVA 3T9HB 2HEUA 1FPJA 1MQJA 1B4ZA 5I2KB 3CFZA 5IZ3A 3IFAA 3PUXE 1LLSA 1JW5A 1M5EA 4IGTA 1B46A 3PUZE 1I6BA 5LTCA 5ITOA 2YPNA 5AA2A 3A29A 2XD2A 1II5A 5IZ1A 4X9TA 4F1UA 1KWHA 4GD5A 1EH3A 2XXPA 3G3GA 1NV2A 1H76A 2DXYA 4ZEIA 3S9LC 1LBZA 4R2FA 4F39A 3ILTB 4XKPA 5M2VA 3MVZA 3E13X 1NUWA 3I6VA 4OANA 5I2NA 3W15C 3KSJA 1US4A 5I59A 3FJ7A 5AA4A 1P1QA 1ZU0A 1JETA 3VFJA 2WBDA 1R9LA 4EUOA 5FHNA 3U72A 4PGPA 4GBVA 1SYIA 3HHFA 4IGRA 2H5YA 2I49A 1SVXB 4EF2A 3I3VA 4PETA 4YKPA 4PAFA 3VXBA 1MM6A 5ICTA 3TTNA 2A5TA 3KN3A 3D4GA 4H67A 1WODA 4P9KA 2QS1A 4ZE9A 4N6KA 4U4SA 4MMPA 2RKMA 1FQAA 3OXNA 2E1SA 3KG2A 4N8YA 3H6TA 1NV3A 3ZKKA 4MNPA 4OTEA 2HZKA 4L17A 1FQEA 4I3YA 1Y3PA 4PBQA 2F3DA 2ZNTA 4XKRA 4K3FA 4MLVA 1PBPA 3PMVA 4IY6A 5LOMA 5DEXA 1LBXA 3EKIA 4EXKA 3LUYA 5J16A 1DK4A 1PEBA 4F18A 1POY1 1M5DA 1B4HA 3UK4A 2OLBA 4QSDA 4AS5A 4PAKA 4F1YA 4TQUQ 1S7YA 3KBZA 1H45A 4RNSA 4PFTA 3DLNA 4F3BA 3CI8A 3TQLA 3FXQA 5L9OA 4JWYA 4C1UA 3C4MA 2O1MA 1SW1A 2Y7IA 3ECRA 4FE8A 2B4MA 4ZZEA 2I58A 1S50A 1SDXA 2DE3A 1D9QA 1FQCA 3OOAA 4X48A 1NV5A 4MHFA 3CHGA 2F97A 3ILUB 3UP9A 1MY2A 2ZYKA 5I56A 2DWIA 2V84A 4HXVA 1QW0A 4XKNA 2PCRA 2Q2AA 3LR1A 3B6QA 1MDP1 2Q9TA 4GL8A 1FJ6A 1MQIA 4JDFA 2ANJA 3FIRA 2V4CA 4O7MA 4BDNA 2DYXA 1HSEA 2H4IA 4OVPA 3RQTA 4R6YA 3LSFB 2PYYA 1UTBA 2WBBA 1SW2A 4RPNA 3KOTA 3W9VA 5CMBA 1LGBC 1TT1A 3B8BA 3OO7A 4LA9A 4H8IA 1YAEA 4OXVA 3N5LA 1DMBA 1USYH 4O8MA 5IKBA 3PUYE 3CG1A 1QJMA 5AA2B 1OMPA 4U1OA 5ET8A 1PB9A 2ZZWA 4JSDA 5EQ7A 4DI3D 1IMFA 4KPTA 4YKKA 3M3LA 4MBPA 4NQ8A 2P3VA 4XF5A 3HPIA 3QAXA 4LZ5A 3IJXB 3FV2A 4X8RA 4ESWA 1US5A 2Q74A 1SW5A 4OZ9A 4QSCA 1FPKA 2I3VA 2F78A 5EYHA 1B5IA 3ONMA 3MZ9A 1NV0A 4QFNA 1NV1A 3UORA 3D4CA 1MXVA 1K9ZA 4UA8A 2XWKA 1FBFA 1FPEA 1SD3A 4DLDA 3OO6A 1B32A 1JVXA 3R6UA 4N8GA 1G0HA 2RC7A 4NF4A 5AE4A 4ELPA 2VPNA 3TZAA 2Y84A 5IGAA 4P8BA 2F35A 1GV8A 1DBZA 4GWUA 2XX8A 4NTLA 4MIJA 4GWYA 4O3CA 5H8HB 3GLBA 4I62A 5BWJA 5H8NB 3TYHA 3QUJA 4C0RA 1UIUA 3IOWA 1N84A 2F6PA 4UABA 1Y9UA 1LAGE 3V8XB 1FBHA 3MVXA 4MFIA 2Z8EA 4N15A 5I84A 1FTLA 4JSOA 3GYYA 3T96B 5AA1A 4WKMA 5I58B 2KQZA 4GRKA 1MY3A 2O6AA 3FV1A 1FQBA 2VHAA 4KYSA 1MH4A 1Z7ME 2V3QA 2BJJX 4NF5A 4F2QA 4MNCA 4DIGA 3G3KA 1Q9DA 4KR5A 1PC3A 2BJIA 4P11A 3OO8A 4ZDMA 5HM4B 2XXHA 1LBCA 3SEYA 2RF1A 5DVJA 3A3UA 3THIA 1FPGA 3Q29A 4MX6A 5H8SA 4Q30B 1B52A 2QJEA 4ELRA 4XKQA 1IZ1A 2XX7A 4BDLA 5DT6A 4KXPA 1OQHA 4QFLA 1VFEA 4PF8A 4NMYA 3OENA 5H8FB 2GRVA 4GIZA 2CZIA 1UTBB 2DVZA 4OFLA 4PE5B 2I4CA 4BDOA 4I8CA 5IZ3B 4FORA 4N13A 4QF9A 1RKMA 3PU5A 4YICA 3S9NC 1LSTA 1MY4A 3MUQA 1B0LA 4ECFA 3MZ1A 3FVOA 2R8TA 4PTKA 4UACA 4F3PA 5L8DA 2Z23A 1NV4A 4NWDA 4XEQA 5I5PA 3VLWA 4NGUA 2GHBA 1JEUA 2DS9A 3O29A 3KZGA 5HPQA 4JWOA 2QPQA 3SEVA 3KN8A 4ZEDA 1MPBA 3T9VA 2HXRA 1NKXA 3M3KA 4NEDA 2DP8A 2Z8DA 4RPOA 1TFDA 3MPKA 4MJOA 3QK6A 4YB6A 3MYUA 1I6AA 1NV7A 3CIJA 2YJPA 4H8JA 1Y1ZA 3K6VA 1FPIA 1MG1A 2CZKA 2ZZXA 2F3BA 1OVBA 4PC9A 1NUZA 2OJTA 3MW0A 4GWSA 4OFOA 1XT8A 1QKAA 3VV5A 2NXOA 4YAHX 4ZE8A 3HCQA 4YB7A 5CM6A 3H4ZA 4AB5A 2I4BA 3BIHA 5F1QA 3TCHA 4G68A 1JVYA 2RINA 4X1DA 4G68B 4RK2A 2OBGA 4Q8RA 1JEVA 2ZNSA 3O6HA 1B3EA 2QS4A 4TOZA 4JB7A 1ZKBA 1FPLA 2FHYA 4P3LA 5DTBA 1GR2A 1PB7A 1A99A 3MBPA 2O51A 2RC8A 5CBSA 1FSAA 2L5VA 4OEUA 1QUIA 1MM7A 5I2NB 5B7DA 1FPDA 2NOOA 3E3KA 5JEIA 3H6UA 4IO6A 3O66A 4PFIA 3SEXA 3QMFA 1SBPA 5F24A 4IR8A 4LQ2A 1D4NA 2O7IA 5CMMA 3KEIA 4DXCA 2IA4A 2FBPA 1LCFA 1B7ZA 3E4RA 1B1HA 2OZZA 1ZLQA 2DQVA 5I59B 4DI4B 1Q1KA 3MZBA 5TPAB 3K6UA 4R73A 2Y7KA 1B3LA 1K9YA 1B58A 4DE8A 3ISPA 3FVGA 3TDJA 1LAHE 3FVNA 3N26A 4IO5A 4BDQA 4Z7EA 3FGSA 3IO4A 1LBWA 2R9JA 3BBRA 4NF0A 4NAPA 1LAXA 1O64A 2M8CA 2HAVA 3RYDA 2XXIA 1ZJLA 1FPBA 1XOCA 1R9QA 3CSBA 4NF8B 2W7YA 4PBHA 2VT5A 3VDFA 4PF6A 1CE2A 2DE2A 5FTHA 2F8DA 2VPOA 1AH5A 3IOUA 2GHAA 1XVXA 5KZTA 1EYKA 5I2KA 3C31A 1MXWA 1B40A 3MP8A 3CSGA 4U2RA 5JTYA 2F6GA 3G3JA 2QVVA 3S2VA 4QFPA 1HSJA 4XXUA 2Y5KA 2DXRA 3OEKA 3SESA 2B3BA 4ESXA 5EYGA 4HE1A 4MH5A 1GTKA 1FTOA 2I6EA 5H8QA 4R72A 3IL1B 5KDTB 4ELQA 4BDMA 3PD9A 3KBRA 4WEDA 3FVKA 1P1OA 4U23A 1VDWA 4EQ7A 1J1NA 4P0GA 4H45A 1A55A 1RYOA 2F7BA
chains in the Genus database with same CATH topology
3H3GA 2AL4A 1SW5A 2O69A 2ZYOA 4OZ9A 3WAEA 4F2OA 1B51A 4QSCA 1FTKA 2I3VA 2F78A 4XTCQ 3A09A 1VSOA 3U92A 2AL5A 3T22A 1B5IA 1XC1A 3ONMA 4PFWA 3MZ9A 4YU0A 5B7DA 4R75A 3FATA 4H6DA 1A8EA 1ELJA 1SW4A 3C32A 1P1WA 3IB1A 3LSWA 2FNCA 1M5CA 4G8HA 3IX1A 4QFNA 3C9HA 3SETA 3UORA 4Q0CA 4R9GA 3D4CA 3T9VA 1B6HA 1MXVA 2DWHA 2H9BA 2UYEA 3SKPA 4UA8A 1N7WA 3FD3A 2G93A 4QRZA 3W9WA 2I3WA 3DM0A 3EHUA 3O6GA 4RYAA 5FHOA 1BKAA 3G3IA 3WAFA 4H5GA 1MXXA 4KD5A 3H03A 4RA1A 1SD3A 5CMKA 1PB8A 5I57A 1FTMA 3BKIB 3E9XA 3PUVE 3TTLA 3OO6A 3EPEA 4DLDA 1B32A 1UTHA 4PFUA 5DVIA 3ZS6A 4GXSB 4OFJA 1JVXA 4IY5A 1SI0A 4M4GA 3R6UA 4IO3A 4KCDA 3PPPA 2QMXA 3FXRA 1Q35A 4LVQA 5I57B 2REGA 1B2HA 1QVSA 4POXA 3RT8A 2RC7A 5A5XA 1S9TA 1P99A 1WDNA 4NF4A 3RTFB 5AE4A 2ZYNA 2P0SA 1BTJA 2Y7WA 1UQWA 1D3KA 2OK2A 4ELPA 2THIA 1MQGA 1H3DA 3TZAA 2KLFA 1BIYA 3VXCA 1B1XA 5L9MA 2Y84A 1LB9A 1IIWA 3JV9A 5EHMA 5TPAA 5AA4B 1VR5A 2F35A 4LQ5A 4H1XA 1GV8A 1I6QA 3OELA 3TCGA 3S4UA 1OVTA 1N04A 4MLQA 2F36A 1GGGA 1URGA 2HZLA 3VVFA 2LAOA 4GLIA 4TLLB 1SQYA 2XX8A 4NTLA 3QSLA 3B6WA 4YKIA 1NH7A 2ZYMA 4OVJA 5EYFA 3M8UA 1B05A 1RYXA 1H43A 2UVHA 2PVUA 4YKJA 3IB2A 4LP2B 3KSXA 1MPCA 4O3CA 5H8HB 3KJTA 4U21A 3GLBA 3IOTA 3U8QA 3EHTA 4DXBA 1MS7A 1M5FA 4I62A 4JWXA 3USDA 5BWJA 5H8NB 1FQDA 1LFIA 4GOTA 3TYHA 3B6TA 4Q5TA 3QUJA 4C0RA 3MWBA 1UIUA 4OYVA 3IOWA 4FIMA 4GF8A 2QL3A 1N84A 1OLCA 3PPRA 4NF5B 3RLFE 1NNFA 3FJMA 1B3GA 2F6PA 2AYSA 1Y9UA 3I5OA 1SYHA 4RK9A 1TWYA 1LAGE 4KHZE 5TU0A 3V8XB 2R71A 5CI5A 3IJOB 4ZEBA 1GVCA 1A40A 1QKBA 2D3IA 4I9DA 3U93A 5KDTA 3MVXA 4MFIA 3S9EA 3O9PA 3TMGA 3QXMA 3DP4A 2Z8EA 4G4PA 1IXCA 3G3FA 3GBAA 2DWJA 3CFXA 4I1DA 3LSXA 3RPWA 1JW1A 3CVGA 5I84A 5F7VA 4E0XA 2V3TA 2X7PA 1FTLA 4JSOA 1IXHA 2FYIA 3CG3A 3OD7A 4EF1A 4F29A 2Q8JA 1O63A 2NUVA 3JYRA 3LC8A 4OETA 5AA1A 4WKMA 5TP9B 3T96B 1ZIUA 4HS7A 4OWDA 3BFTA 3SDFA 3UGWA 3AXFA 1NNPA 3VVDA 3VVEA 5I58B 5I56B 4ND9A 2B65A 4R6HA 1DTZA 2Q89A 3VLVA 2ESNA 2QRYA 1MY3A 4GRKA 1PBQA 4YMBA 2O6AA 3FV1A 1FQBA 3HV1A 3OO9A 1EU8A 2VHAA 1ZMGA 2HXWA 1MH4A 4G68C 4KYSA 1Z7ME 2V3QA 2BJJX 2XD3A 4ZECA 3O28A 4H0WA 3V5AA 3DP8A 4NF5A 4TLMB 3TEPA 3CR9A 3HN0A 2UXAA 4N6PA 1NNKA 3TODA 1D9VA 1SI1A 3C35A 4OHNA 4F2QA 4DIGA 1MY0A 3MP6A 5FHMA 3CRBA 3G3KA 1MPDA 3MQ9A 3Q25A 5H8HA 1DPPA 2NVUB 2FA7A 4FATA 4KR5A 1PC3A 3K02A 3U94A 3HHGA 1JW4A 3OO8A 3PPQA 4P11A 4ZDMA 4QSEA 4THIA 1AL3A 5HM4B 2XXHA 1LBCA 3SEUA 1JNFA 2RF1A 3SEYA 3KJ7A 5DVJA 4GWOA 2AIXA 2G29A 1R6ZA 3A3UA 2A5TB 3LBSA 1USYE 3THIA 3KFMA 2VD2A 2O84X 5H8QB 4BLAA 4G77A 4LZ7A 5B70A 3N6UA 4DCYA 3Q29A 4IO7A 4O3AA 1N3XA 3PV0E 5H8SA 4Q30B 4F19A 1B52A 2OCUA 2QJEA 4AQ4A 1PDAA 4ELRA 4XKQA 1FTJA 1NL5A 1IZ1A 1Y20A 2XX7A 3LSLA 4QFKA 5DT6A 5K2XA 4BDLA 1OQHA 3C33A 4LATA 4QFLA 3VLUA 4F1VA 1VFEA 4HCYA 3Q27A 3OENA 4NMYA 3UN6A 3T9UA 3MVWA 3EF7A 5H8FB 3T9HB 3BFUA 4U22A 2GRVA 4HTGA 3ZSFA 2I0CA 4GIZA 3ZKLA 4EQ9A 3HO7A 5AA3A 1D9YA 3O97A 1UTBB 2DVZA 2HEUA 4G2ZA 2NWJA 5KCJB 4OFLA 2ONKE 4PE5B 3V89B 2VOZA 1MQJA 1N7XA 2I4CA 4OENA 4BDOA 4I8CA 1B4ZA 1EZOA 5I2KB 2DSFA 2PT1A 3CFZA 5J1DA 4FORA 4N13A 4QF9A 3H6VA 1RKMA 3PUXE 1LLSA 3DP6A 3PU5A 4YICA 3S9NC 1LSTA 1MY4A 3MUQA 3SEWA 1MXUA 1QULA 1B0LA 3RNNA 1JW5A 2D21A 3MZ1A 1M5EA 1B7UA 1ZBMA 3PGFA 1B46A 1IITA 4FEBA 1URDA 2IEEA 4IGTA 3RN8A 1XS5A 1CB6A 1Y4TA 3FVOA 4N07A 4E0WA 3PUZE 1POTA 2UVGA 1I6BA 3ODBA 3Q28A 4GQOA 1VE4A 2DOJA 3H06B 3K1MA 4UACA 5L8DA 4F3PA 3V83A 5ITOA 3T9XB 1YCJA 3K01A 2Z23A 4OERA 2YPNA 4NWDA 5AA2A 3VLWA 1B5HA 1MQDA 2GHBA 4GXAA 1JEUA 2DS9A 3K1PA 2X26A 2XD2A 2XXXA 3O29A 1II5A 1F9BA 3KZGA 1B9JA 2ZXTA 4R6KA 4OESA 5HPQA 4JWOA 2QPQA 2R6GE 1DTGA 4MF3A 4X9TA 4PQJA 3SEVA 3KN8A 1KWHA 1HSLA 4F1UA 4GD5A 4ESWA 2XXRA 3MC2A 4ZEDA 2UVJA 1MPBA 1EH3A 2XXPA 4GL0A 1NKXA 3G3GA 3H6WA 3M3KA 4NEDA 2DP8A 2Z8DA 4P0IA 2DXYA 1H76A 2UYFA 4ZEIA 3S9LC 4RPOA 4R2FA 1TFDA 4F39A 1UIVA 1AOVA 2ONRA 3HSTA 3MPKA 3QK6A 3ILTB 4POWA 4IO2A 2P2AA 4XKPA 4YB6A 3IK6B 5M2VA 3MVZA 3E13X 3TTKA 4DXUA 1I6AA 3I6VA 2XXVA 1AMFA 4F22A 3CIJA 5I2NA 2YJPA 2E0SA 3KSJA 3W15C 1US4A 3QIMA 3EN3A 2XXTA 2X7QA 1Y1ZA 3EHSA 1IQ7A 2PX1A 2WKYA 3FJ7A 3K6VA 4GVOA 5AA4A 3G7WA 2CZLA 1MG1A 3C36A 1P1QA 1EZ9A 1ZU0A 3IR1A 1JETA 3PD8A 4ELOA 1MY1A 1OVBA 3TELA 2F7AA 3VFJA 1R9LA 4EUOA 5FHNA 1DSNA 3U72A 3K1NA 2HCAA 2PMSA 1ANFA 1MXZA 4NE4A 2OJTA 1MQHA 4QFOA 1SYIA 4ZEFA 4JBZA 1JQFA 2ZMBA 3HHFA 3MW0A 4IGRA 2H5YA 1OQGA 4X1BA 1Z7NE 4ISUA 4OFOA 2I49A 1SVXB 1XT8A 1QKAA 1Y3NA 3K00A 4XIGQ 5H8NA 4ZZAA 4IO4A 3I3VA 3VV5A 4EF2A 2NXOA 4PETA 4YKPA 3TTRA 4YAHX 4ZE8A 2XXYA 4OEVA 3HCQA 1Y1MA 1B3FA 3VXBA 2QS2A 2A5SA 3EQ1A 1MM6A 4YB7A 2I0BA 5CM6A 3T66A 2H25A 2Y7RA 5TP9A 2QMWA 3H4ZA 4AB5A 3OMBA 5ICTA 2DWAA 2I4BA 3TTNA 2B3FA 2V25A 3K6XA 3QUFA 1A8FA 2ZNUA 3QYTA 2A5TA 2GH9A 3KN3A 5F1QA 3TCHA 3D4GA 1JVYA 2RINA 3KOSA 1WODA 4G68A 4G68B 4H67A 4X1DA 1QUJA 2QS1A 4RK2A 1XHYA 2OBGA 3K0VA 4IB2A 2O7UA 4Q8RA 1JEVA 2H98A 4ZE9A 5ISUA 1L5TA 4U4SA 2ZNSA 3O6HA 4PFYA 1B3EA 1IXIA 2QS4A 2RKMA 4TOZA 4JB7A 4OQOA 1AIVA 1FQAA 1YTVA 3OXNA 2E1SA 1ZKBA 2REJA 3CFLA 3KG2A 5FTIA 5CBRA 5L9SA 3H6TA 4DZ1A 1BP5A 1EZPA 2GFEA 5DTBA 3PPNA 4RY1A 1GR2A 1PB7A 1A99A 1VFDA 2O51A 3MBPA 4O3BA 3ZKKA 2RC8A 4EDPA 4OTEA 2HZKA 2QSXA 4L17A 5CBSA 1B3HA 2D5WA 3FXUA 1FQEA 4OEUA 1QUIA 4OMBA 1MM7A 5I2NB 4GFRA 3KN7A 1DOTA 1O7TA 1Y3PA 2UVIA 1IUDA 2HAUA 2ZNTA 4KCCA 2F34A 4FJPA 4K3FA 1NMUA 4XKRA 3UIFA 4G8MA 4F31B 2RCBA 4MLVA 5K2YA 1LCTA 1PBPA 3PMVA 2NOOA 1URSA 3E3KA 4IY6A 4QHQA 4Z0IA 3TTMA 4DDDA 5LOMA 3UA8A 5JEIA 3H6UA 4IO6A 1LAFE 4RXLA 1N3WA 1A54A 3IOVA 3O66A 2ABHA 5DEXA 3TFLA 5A5XB 3K2DA 2O1LA 2OWTA 3SEXA 4EXKA 3H7MA 3LUYA 5ICQA 1PEBA 3GXAA 4F18A 1SBPA 1IXGA 1POY1 2P1SA 1M5DA 3RY3A 1B7HA 3TPAA 1LFHA 3TKDA 4LQ2A 4F3GA 5I59A 1D4NA 1IEJA 2O7IA 4Z7EA 1B4HA 3GZGA 5CMMA 2PBWA 2OLBA 4QSDA 3UK4A 3KEIA 1WVJA 3MP1A 5EHSA 2V93A 4DXCA 4F1YA 3FASA 2IA4A 4NWCA 3OSRA 4TQUQ 2CMOA 3O6IA 4DCXA 2QS3A 1S7YA 2F5XA 1XVYA 2VP1A 1H45A 3O2AA 1MH3A 1MXYA 3VE1B 4RNSA 4PFTA 3RGYA 1LCFA 3DLNA 1B7ZA 3CI8A 4F3BA 3E4RA 2ONSA 3FJGA 3FXQA 1NH8A 4YB5A 3TQLA 4C1TA 3TCFA 1OLAA 1QUKA 5L9OA 1B1HA 1LBBA 3MPLA 4ONYA 1Y4CA 2OZZA 4ZEKA 1ZLQA 4JWYA 4C1UA 3C4MA 2DQVA 2O1MA 5I59B 1SW1A 3R7XA 1Q1KA 5DEXB 4YZZA 2Y7IA 3ECRA 3MZBA 4FE8A 5TPAB 2VGQA 4AB6A 3K6UA 4R73A 2Y7KA 4ZZEA 1FCKA 1B3LA 4KYDA 2I58A 5BUUA 4HW8A 1H44A 1B58A 4DE8A 5CRYA 1S50A 1SDXA 3FVGA 3IB0A 2DE3A 3Q26A 3TDJA 1LAHE 3FVNA 3N26A 4IO5A 4LONB 3SERA 4BDQA 4H65A 1FQCA 3IAZA 3L6HA 3OOAA 3A3CA 5DVFA 3FGSA 2I48A 3IO4A 4FEDA 4X48A 2R9JA 3TUSA 2F97A 4KFQA 3BBRA 3ILUB 1LAXA 1I69A 1O64A 2M8CA 2HAVA 4U1ZA 1NNTA 3UP9A 2XXIA 5CMCA 1ZJLA 1MY2A 1XOCA 2ZYKA 1UTHB 1R9QA 2RCAA 4R74A 2Z8FA 2VD3A 4KQPA 3K6WA 5ITPA 2XHDA 3CSBA 4NF8B 2W7YA 1P1UA 5I56A 5I58A 2DWIA 3VDFA 1T0KA 5IAIA 2XXQA 2V84A 4H5FA 4JXIA 3TQWA 1CE2A 4F3SA 1MRPA 5AA2D 1OIBA 1TXFA 1QW0A 4XKNA 2Q2AA 1A7LA 3LR1A 2F7CA 1MDP1 2DE2A 3B6QA 2Q9TA 4KI0E 3IORA 4ZS9A 4M1VA 5FTHA 4GL8A 2F8DA 1MDQA 2DVCA 3OSQA 1DPEA 3PMXA 3PPOA 1MQIA 1TFAA 4JDFA 1FQFA 3DELB 2H99A 4LUBA 4RJZA 3S9MC 1AH5A 2ANJA 3FIRA 2XXUA 3B7DA 3IOUA 4LZ8A 2GHAA 1B0HA 1FW0A 1XVXA 3R26A 3U1OA 4BDNA 4BDRA 5KZTA 2OWSA 2DYXA 1BLFA 1HSEA 2H4IA 3N6TA 4G8NA 4HCWA 4R6YA 3RQTA 3T93B 3PMWA 3C31A 3RUMA 5I2KA 2Q2CA 2PT2A 3LSFB 2Q88A 3MJNA 1MXWA 1B40A 2PYYA 1B5JA 2YLNA 1NFTA 1UTBA 3L6GA 3MP8A 3PUWE 5KCJA 3CSGA 1SW2A 4U2RA 2F6GA 3G3JA 3C34A 5JTYA 4EXLA 4RPNA 1R1NA 1LB8A 3F11A 3S2VA 3KOTA 4R2BA 4QFPA 5CMBA 3W9VA 3TAJA 4U4XA 1HSJA 3FUZA 4XXUA 5ELVA 1LGBC 1TT1A 3GBBA 3OO7A 4LA9A 1LFGA 4KYEA 2DXRA 3OEKA 4H8IA 4NF8A 3RT6B 3FZVA 3SESA 2V3UA 2ALUA 2B3BA 2Z22A 4ESXA 2XX9A 4R9FA 1YAEA 2XXWA 4OXVA 1ZTYA 4MH5A 5DYHA 1GTKA 1FTOA 3N5LA 3OEMA 1DMBA 4WXJA 1USYH 1YPNA 2DE4A 3G3HA 1Y3QA 2I6EA 5H8QA 3M3FA 5HBCA 5IKBA 3PUYE 4R72A 3CG1A 3IL1B 1QJMA 3N94A 5AA2B 5KDTB 1OMPA 4BDMA 1P1NA 3PD9A 4U1OA 4ELQA 1N76A 4YMAA 2O68A 3KBRA 3MVYA 1N0TA 4WEDA 1PB9A 4JSDA 4FAJA 3KGCA 1ATGA 5CC2A 4NF6B 3MAMA 4NF6A 3K4UA 4EQBA 2HFBA 4KPTA 3FVKA 3IO6A 4WEPA 2RC9A 3M3LA 3P7IA 4MBPA 4YKKA 4PP0A 1P1OA 3JZJA 2HQ0A 4FECA 4H8JA 4U23A 4EQ7A 3HPIA 3QAXA 4LZ5A 3IJXB 4NF4B 1J1NA 4ECFA 5H8FA 3RTWB 3FV2A 4P0GA 5JK4A 1A55A 5JTYB 1M5BA 1RYOA 2Y7PA 2F7BA 1US5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3G A;  2AL4 A;  1SW5 A;  2O69 A;  2ZYO A;  4OZ9 A;  3WAE A;  4F2O A;  1B51 A;  4QSC A;  1FTK A;  2I3V A;  2F78 A;  4XTC Q;  3A09 A;  1VSO A;  3U92 A;  2AL5 A;  3T22 A;  1B5I A;  1XC1 A;  3ONM A;  4PFW A;  3MZ9 A;  4YU0 A;  5B7D A;  4R75 A;  3FAT A;  4H6D A;  1A8E A;  1ELJ A;  1SW4 A;  3C32 A;  1P1W A;  3IB1 A;  3LSW A;  2FNC A;  1M5C A;  4G8H A;  3IX1 A;  4QFN A;  3C9H A;  3SET A;  3UOR A;  4Q0C A;  4R9G A;  3D4C A;  3T9V A;  1B6H A;  1MXV A;  2DWH A;  2H9B A;  2UYE A;  3SKP A;  4UA8 A;  1N7W A;  3FD3 A;  2G93 A;  4QRZ A;  3W9W A;  2I3W A;  3DM0 A;  3EHU A;  3O6G A;  4RYA A;  5FHO A;  1BKA A;  3G3I A;  3WAF A;  4H5G A;  1MXX A;  4KD5 A;  3H03 A;  4RA1 A;  1SD3 A;  5CMK A;  1PB8 A;  5I57 A;  1FTM A;  3BKI B;  3E9X A;  3PUV E;  3TTL A;  3OO6 A;  3EPE A;  4DLD A;  1B32 A;  1UTH A;  4PFU A;  5DVI A;  3ZS6 A;  4GXS B;  4OFJ A;  1JVX A;  4IY5 A;  1SI0 A;  4M4G A;  3R6U A;  4IO3 A;  4KCD A;  3PPP A;  2QMX A;  3FXR A;  1Q35 A;  4LVQ A;  5I57 B;  2REG A;  1B2H A;  1QVS A;  4POX A;  3RT8 A;  2RC7 A;  5A5X A;  1S9T A;  1P99 A;  1WDN A;  4NF4 A;  3RTF B;  5AE4 A;  2ZYN A;  2P0S A;  1BTJ A;  2Y7W A;  1UQW A;  1D3K A;  2OK2 A;  4ELP A;  2THI A;  1MQG A;  1H3D A;  3TZA A;  2KLF A;  1BIY A;  3VXC A;  1B1X A;  5L9M A;  2Y84 A;  1LB9 A;  1IIW A;  3JV9 A;  5EHM A;  5TPA A;  5AA4 B;  1VR5 A;  2F35 A;  4LQ5 A;  4H1X A;  1GV8 A;  1I6Q A;  3OEL A;  3TCG A;  3S4U A;  1OVT A;  1N04 A;  4MLQ A;  2F36 A;  1GGG A;  1URG A;  2HZL A;  3VVF A;  2LAO A;  4GLI A;  4TLL B;  1SQY A;  2XX8 A;  4NTL A;  3QSL A;  3B6W A;  4YKI A;  1NH7 A;  2ZYM A;  4OVJ A;  5EYF A;  3M8U A;  1B05 A;  1RYX A;  1H43 A;  2UVH A;  2PVU A;  4YKJ A;  3IB2 A;  4LP2 B;  3KSX A;  1MPC A;  4O3C A;  5H8H B;  3KJT A;  4U21 A;  3GLB A;  3IOT A;  3U8Q A;  3EHT A;  4DXB A;  1MS7 A;  1M5F A;  4I62 A;  4JWX A;  3USD A;  5BWJ A;  5H8N B;  1FQD A;  1LFI A;  4GOT A;  3TYH A;  3B6T A;  4Q5T A;  3QUJ A;  4C0R A;  3MWB A;  1UIU A;  4OYV A;  3IOW A;  4FIM A;  4GF8 A;  2QL3 A;  1N84 A;  1OLC A;  3PPR A;  4NF5 B;  3RLF E;  1NNF A;  3FJM A;  1B3G A;  2F6P A;  2AYS A;  1Y9U A;  3I5O A;  1SYH A;  4RK9 A;  1TWY A;  1LAG E;  4KHZ E;  5TU0 A;  3V8X B;  2R71 A;  5CI5 A;  3IJO B;  4ZEB A;  1GVC A;  1A40 A;  1QKB A;  2D3I A;  4I9D A;  3U93 A;  5KDT A;  3MVX A;  4MFI A;  3S9E A;  3O9P A;  3TMG A;  3QXM A;  3DP4 A;  2Z8E A;  4G4P A;  1IXC A;  3G3F A;  3GBA A;  2DWJ A;  3CFX A;  4I1D A;  3LSX A;  3RPW A;  1JW1 A;  3CVG A;  5I84 A;  5F7V A;  4E0X A;  2V3T A;  2X7P A;  1FTL A;  4JSO A;  1IXH A;  2FYI A;  3CG3 A;  3OD7 A;  4EF1 A;  4F29 A;  2Q8J A;  1O63 A;  2NUV A;  3JYR A;  3LC8 A;  4OET A;  5AA1 A;  4WKM A;  5TP9 B;  3T96 B;  1ZIU A;  4HS7 A;  4OWD A;  3BFT A;  3SDF A;  3UGW A;  3AXF A;  1NNP A;  3VVD A;  3VVE A;  5I58 B;  5I56 B;  4ND9 A;  2B65 A;  4R6H A;  1DTZ A;  2Q89 A;  3VLV A;  2ESN A;  2QRY A;  1MY3 A;  4GRK A;  1PBQ A;  4YMB A;  2O6A A;  3FV1 A;  1FQB A;  3HV1 A;  3OO9 A;  1EU8 A;  2VHA A;  1ZMG A;  2HXW A;  1MH4 A;  4G68 C;  4KYS A;  1Z7M E;  2V3Q A;  2BJJ X;  2XD3 A;  4ZEC A;  3O28 A;  4H0W A;  3V5A A;  3DP8 A;  4NF5 A;  4TLM B;  3TEP A;  3CR9 A;  3HN0 A;  2UXA A;  4N6P A;  1NNK A;  3TOD A;  1D9V A;  1SI1 A;  3C35 A;  4OHN A;  4F2Q A;  4DIG A;  1MY0 A;  3MP6 A;  5FHM A;  3CRB A;  3G3K A;  1MPD A;  3MQ9 A;  3Q25 A;  5H8H A;  1DPP A;  2NVU B;  2FA7 A;  4FAT A;  4KR5 A;  1PC3 A;  3K02 A;  3U94 A;  3HHG A;  1JW4 A;  3OO8 A;  3PPQ A;  4P11 A;  4ZDM A;  4QSE A;  4THI A;  1AL3 A;  5HM4 B;  2XXH A;  1LBC A;  3SEU A;  1JNF A;  2RF1 A;  3SEY A;  3KJ7 A;  5DVJ A;  4GWO A;  2AIX A;  2G29 A;  1R6Z A;  3A3U A;  2A5T B;  3LBS A;  1USY E;  3THI A;  3KFM A;  2VD2 A;  2O84 X;  5H8Q B;  4BLA A;  4G77 A;  4LZ7 A;  5B70 A;  3N6U A;  4DCY A;  3Q29 A;  4IO7 A;  4O3A A;  1N3X A;  3PV0 E;  5H8S A;  4Q30 B;  4F19 A;  1B52 A;  2OCU A;  2QJE A;  4AQ4 A;  1PDA A;  4ELR A;  4XKQ A;  1FTJ A;  1NL5 A;  1IZ1 A;  1Y20 A;  2XX7 A;  3LSL A;  4QFK A;  5DT6 A;  5K2X A;  4BDL A;  1OQH A;  3C33 A;  4LAT A;  4QFL A;  3VLU A;  4F1V A;  1VFE A;  4HCY A;  3Q27 A;  3OEN A;  4NMY A;  3UN6 A;  3T9U A;  3MVW A;  3EF7 A;  5H8F B;  3T9H B;  3BFU A;  4U22 A;  2GRV A;  4HTG A;  3ZSF A;  2I0C A;  4GIZ A;  3ZKL A;  4EQ9 A;  3HO7 A;  5AA3 A;  1D9Y A;  3O97 A;  1UTB B;  2DVZ A;  2HEU A;  4G2Z A;  2NWJ A;  5KCJ B;  4OFL A;  2ONK E;  4PE5 B;  3V89 B;  2VOZ A;  1MQJ A;  1N7X A;  2I4C A;  4OEN A;  4BDO A;  4I8C A;  1B4Z A;  1EZO A;  5I2K B;  2DSF A;  2PT1 A;  3CFZ A;  5J1D A;  4FOR A;  4N13 A;  4QF9 A;  3H6V A;  1RKM A;  3PUX E;  1LLS A;  3DP6 A;  3PU5 A;  4YIC A;  3S9N C;  1LST A;  1MY4 A;  3MUQ A;  3SEW A;  1MXU A;  1QUL A;  1B0L A;  3RNN A;  1JW5 A;  2D21 A;  3MZ1 A;  1M5E A;  1B7U A;  1ZBM A;  3PGF A;  1B46 A;  1IIT A;  4FEB A;  1URD A;  2IEE A;  4IGT A;  3RN8 A;  1XS5 A;  1CB6 A;  1Y4T A;  3FVO A;  4N07 A;  4E0W A;  3PUZ E;  1POT A;  2UVG A;  1I6B A;  3ODB A;  3Q28 A;  4GQO A;  1VE4 A;  2DOJ A;  3H06 B;  3K1M A;  4UAC A;  5L8D A;  4F3P A;  3V83 A;  5ITO A;  3T9X B;  1YCJ A;  3K01 A;  2Z23 A;  4OER A;  2YPN A;  4NWD A;  5AA2 A;  3VLW A;  1B5H A;  1MQD A;  2GHB A;  4GXA A;  1JEU A;  2DS9 A;  3K1P A;  2X26 A;  2XD2 A;  2XXX A;  3O29 A;  1II5 A;  1F9B A;  3KZG A;  1B9J A;  2ZXT A;  4R6K A;  4OES A;  5HPQ A;  4JWO A;  2QPQ A;  2R6G E;  1DTG A;  4MF3 A;  4X9T A;  4PQJ A;  3SEV A;  3KN8 A;  1KWH A;  1HSL A;  4F1U A;  4GD5 A;  4ESW A;  2XXR A;  3MC2 A;  4ZED A;  2UVJ A;  1MPB A;  1EH3 A;  2XXP A;  4GL0 A;  1NKX A;  3G3G A;  3H6W A;  3M3K A;  4NED A;  2DP8 A;  2Z8D A;  4P0I A;  2DXY A;  1H76 A;  2UYF A;  4ZEI A;  3S9L C;  4RPO A;  4R2F A;  1TFD A;  4F39 A;  1UIV A;  1AOV A;  2ONR A;  3HST A;  3MPK A;  3QK6 A;  3ILT B;  4POW A;  4IO2 A;  2P2A A;  4XKP A;  4YB6 A;  3IK6 B;  5M2V A;  3MVZ A;  3E13 X;  3TTK A;  4DXU A;  1I6A A;  3I6V A;  2XXV A;  1AMF A;  4F22 A;  3CIJ A;  5I2N A;  2YJP A;  2E0S A;  3KSJ A;  3W15 C;  1US4 A;  3QIM A;  3EN3 A;  2XXT A;  2X7Q A;  1Y1Z A;  3EHS A;  1IQ7 A;  2PX1 A;  2WKY A;  3FJ7 A;  3K6V A;  4GVO A;  5AA4 A;  3G7W A;  2CZL A;  1MG1 A;  3C36 A;  1P1Q A;  1EZ9 A;  1ZU0 A;  3IR1 A;  1JET A;  3PD8 A;  4ELO A;  1MY1 A;  1OVB A;  3TEL A;  2F7A A;  3VFJ A;  1R9L A;  4EUO A;  5FHN A;  1DSN A;  3U72 A;  3K1N A;  2HCA A;  2PMS A;  1ANF A;  1MXZ A;  4NE4 A;  2OJT A;  1MQH A;  4QFO A;  1SYI A;  4ZEF A;  4JBZ A;  1JQF A;  2ZMB A;  3HHF A;  3MW0 A;  4IGR A;  2H5Y A;  1OQG A;  4X1B A;  1Z7N E;  4ISU A;  4OFO A;  2I49 A;  1SVX B;  1XT8 A;  1QKA A;  1Y3N A;  3K00 A;  4XIG Q;  5H8N A;  4ZZA A;  4IO4 A;  3I3V A;  3VV5 A;  4EF2 A;  2NXO A;  4PET A;  4YKP A;  3TTR A;  4YAH X;  4ZE8 A;  2XXY A;  4OEV A;  3HCQ A;  1Y1M A;  1B3F A;  3VXB A;  2QS2 A;  2A5S A;  3EQ1 A;  1MM6 A;  4YB7 A;  2I0B A;  5CM6 A;  3T66 A;  2H25 A;  2Y7R A;  5TP9 A;  2QMW A;  3H4Z A;  4AB5 A;  3OMB A;  5ICT A;  2DWA A;  2I4B A;  3TTN A;  2B3F A;  2V25 A;  3K6X A;  3QUF A;  1A8F A;  2ZNU A;  3QYT A;  2A5T A;  2GH9 A;  3KN3 A;  5F1Q A;  3TCH A;  3D4G A;  1JVY A;  2RIN A;  3KOS A;  1WOD A;  4G68 A;  4G68 B;  4H67 A;  4X1D A;  1QUJ A;  2QS1 A;  4RK2 A;  1XHY A;  2OBG A;  3K0V A;  4IB2 A;  2O7U A;  4Q8R A;  1JEV A;  2H98 A;  4ZE9 A;  5ISU A;  1L5T A;  4U4S A;  2ZNS A;  3O6H A;  4PFY A;  1B3E A;  1IXI A;  2QS4 A;  2RKM A;  4TOZ A;  4JB7 A;  4OQO A;  1AIV A;  1FQA A;  1YTV A;  3OXN A;  2E1S A;  1ZKB A;  2REJ A;  3CFL A;  3KG2 A;  5FTI A;  5CBR A;  5L9S A;  3H6T A;  4DZ1 A;  1BP5 A;  1EZP A;  2GFE A;  5DTB A;  3PPN A;  4RY1 A;  1GR2 A;  1PB7 A;  1A99 A;  1VFD A;  2O51 A;  3MBP A;  4O3B A;  3ZKK A;  2RC8 A;  4EDP A;  4OTE A;  2HZK A;  2QSX A;  4L17 A;  5CBS A;  1B3H A;  2D5W A;  3FXU A;  1FQE A;  4OEU A;  1QUI A;  4OMB A;  1MM7 A;  5I2N B;  4GFR A;  3KN7 A;  1DOT A;  1O7T A;  1Y3P A;  2UVI A;  1IUD A;  2HAU A;  2ZNT A;  4KCC A;  2F34 A;  4FJP A;  4K3F A;  1NMU A;  4XKR A;  3UIF A;  4G8M A;  4F31 B;  2RCB A;  4MLV A;  5K2Y A;  1LCT A;  1PBP A;  3PMV A;  2NOO A;  1URS A;  3E3K A;  4IY6 A;  4QHQ A;  4Z0I A;  3TTM A;  4DDD A;  5LOM A;  3UA8 A;  5JEI A;  3H6U A;  4IO6 A;  1LAF E;  4RXL A;  1N3W A;  1A54 A;  3IOV A;  3O66 A;  2ABH A;  5DEX A;  3TFL A;  5A5X B;  3K2D A;  2O1L A;  2OWT A;  3SEX A;  4EXK A;  3H7M A;  3LUY A;  5ICQ A;  1PEB A;  3GXA A;  4F18 A;  1SBP A;  1IXG A;  1POY 1;  2P1S A;  1M5D A;  3RY3 A;  1B7H A;  3TPA A;  1LFH A;  3TKD A;  4LQ2 A;  4F3G A;  5I59 A;  1D4N A;  1IEJ A;  2O7I A;  4Z7E A;  1B4H A;  3GZG A;  5CMM A;  2PBW A;  2OLB A;  4QSD A;  3UK4 A;  3KEI A;  1WVJ A;  3MP1 A;  5EHS A;  2V93 A;  4DXC A;  4F1Y A;  3FAS A;  2IA4 A;  4NWC A;  3OSR A;  4TQU Q;  2CMO A;  3O6I A;  4DCX A;  2QS3 A;  1S7Y A;  2F5X A;  1XVY A;  2VP1 A;  1H45 A;  3O2A A;  1MH3 A;  1MXY A;  3VE1 B;  4RNS A;  4PFT A;  3RGY A;  1LCF A;  3DLN A;  1B7Z A;  3CI8 A;  4F3B A;  3E4R A;  2ONS A;  3FJG A;  3FXQ A;  1NH8 A;  4YB5 A;  3TQL A;  4C1T A;  3TCF A;  1OLA A;  1QUK A;  5L9O A;  1B1H A;  1LBB A;  3MPL A;  4ONY A;  1Y4C A;  2OZZ A;  4ZEK A;  1ZLQ A;  4JWY A;  4C1U A;  3C4M A;  2DQV A;  2O1M A;  5I59 B;  1SW1 A;  3R7X A;  1Q1K A;  5DEX B;  4YZZ A;  2Y7I A;  3ECR A;  3MZB A;  4FE8 A;  5TPA B;  2VGQ A;  4AB6 A;  3K6U A;  4R73 A;  2Y7K A;  4ZZE A;  1FCK A;  1B3L A;  4KYD A;  2I58 A;  5BUU A;  4HW8 A;  1H44 A;  1B58 A;  4DE8 A;  5CRY A;  1S50 A;  1SDX A;  3FVG A;  3IB0 A;  2DE3 A;  3Q26 A;  3TDJ A;  1LAH E;  3FVN A;  3N26 A;  4IO5 A;  4LON B;  3SER A;  4BDQ A;  4H65 A;  1FQC A;  3IAZ A;  3L6H A;  3OOA A;  3A3C A;  5DVF A;  3FGS A;  2I48 A;  3IO4 A;  4FED A;  4X48 A;  2R9J A;  3TUS A;  2F97 A;  4KFQ A;  3BBR A;  3ILU B;  1LAX A;  1I69 A;  1O64 A;  2M8C A;  2HAV A;  4U1Z A;  1NNT A;  3UP9 A;  2XXI A;  5CMC A;  1ZJL A;  1MY2 A;  1XOC A;  2ZYK A;  1UTH B;  1R9Q A;  2RCA A;  4R74 A;  2Z8F A;  2VD3 A;  4KQP A;  3K6W A;  5ITP A;  2XHD A;  3CSB A;  4NF8 B;  2W7Y A;  1P1U A;  5I56 A;  5I58 A;  2DWI A;  3VDF A;  1T0K A;  5IAI A;  2XXQ A;  2V84 A;  4H5F A;  4JXI A;  3TQW A;  1CE2 A;  4F3S A;  1MRP A;  5AA2 D;  1OIB A;  1TXF A;  1QW0 A;  4XKN A;  2Q2A A;  1A7L A;  3LR1 A;  2F7C A;  1MDP 1;  2DE2 A;  3B6Q A;  2Q9T A;  4KI0 E;  3IOR A;  4ZS9 A;  4M1V A;  5FTH A;  4GL8 A;  2F8D A;  1MDQ A;  2DVC A;  3OSQ A;  1DPE A;  3PMX A;  3PPO A;  1MQI A;  1TFA A;  4JDF A;  1FQF A;  3DEL B;  2H99 A;  4LUB A;  4RJZ A;  3S9M C;  1AH5 A;  2ANJ A;  3FIR A;  2XXU A;  3B7D A;  3IOU A;  4LZ8 A;  2GHA A;  1B0H A;  1FW0 A;  1XVX A;  3R26 A;  3U1O A;  4BDN A;  4BDR A;  5KZT A;  2OWS A;  2DYX A;  1BLF A;  1HSE A;  2H4I A;  3N6T A;  4G8N A;  4HCW A;  4R6Y A;  3RQT A;  3T93 B;  3PMW A;  3C31 A;  3RUM A;  5I2K A;  2Q2C A;  2PT2 A;  3LSF B;  2Q88 A;  3MJN A;  1MXW A;  1B40 A;  2PYY A;  1B5J A;  2YLN A;  1NFT A;  1UTB A;  3L6G A;  3MP8 A;  3PUW E;  5KCJ A;  3CSG A;  1SW2 A;  4U2R A;  2F6G A;  3G3J A;  3C34 A;  5JTY A;  4EXL A;  4RPN A;  1R1N A;  1LB8 A;  3F11 A;  3S2V A;  3KOT A;  4R2B A;  4QFP A;  5CMB A;  3W9V A;  3TAJ A;  4U4X A;  1HSJ A;  3FUZ A;  4XXU A;  5ELV A;  1LGB C;  1TT1 A;  3GBB A;  3OO7 A;  4LA9 A;  1LFG A;  4KYE A;  2DXR A;  3OEK A;  4H8I A;  4NF8 A;  3RT6 B;  3FZV A;  3SES A;  2V3U A;  2ALU A;  2B3B A;  2Z22 A;  4ESX A;  2XX9 A;  4R9F A;  1YAE A;  2XXW A;  4OXV A;  1ZTY A;  4MH5 A;  5DYH A;  1GTK A;  1FTO A;  3N5L A;  3OEM A;  1DMB A;  4WXJ A;  1USY H;  1YPN A;  2DE4 A;  3G3H A;  1Y3Q A;  2I6E A;  5H8Q A;  3M3F A;  5HBC A;  5IKB A;  3PUY E;  4R72 A;  3CG1 A;  3IL1 B;  1QJM A;  3N94 A;  5AA2 B;  5KDT B;  1OMP A;  4BDM A;  1P1N A;  3PD9 A;  4U1O A;  4ELQ A;  1N76 A;  4YMA A;  2O68 A;  3KBR A;  3MVY A;  1N0T A;  4WED A;  1PB9 A;  4JSD A;  4FAJ A;  3KGC A;  1ATG A;  5CC2 A;  4NF6 B;  3MAM A;  4NF6 A;  3K4U A;  4EQB A;  2HFB A;  4KPT A;  3FVK A;  3IO6 A;  4WEP A;  2RC9 A;  3M3L A;  3P7I A;  4MBP A;  4YKK A;  4PP0 A;  1P1O A;  3JZJ A;  2HQ0 A;  4FEC A;  4H8J A;  4U23 A;  4EQ7 A;  3HPI A;  3QAX A;  4LZ5 A;  3IJX B;  4NF4 B;  1J1N A;  4ECF A;  5H8F A;  3RTW B;  3FV2 A;  4P0G A;  5JK4 A;  1A55 A;  5JTY B;  1M5B A;  1RYO A;  2Y7P A;  2F7B A;  1US5 A; 
#chains in the Genus database with same CATH topology
 3H3G A;  2AL4 A;  2O69 A;  1B51 A;  3U92 A;  2AL5 A;  3T22 A;  1XC1 A;  4H6D A;  1A8E A;  1SW4 A;  1P1W A;  3LSW A;  3IX1 A;  3C9H A;  4R9G A;  1B6H A;  2UYE A;  2FIX A;  3O6G A;  4RYA A;  3E79 A;  5FHO A;  3G3I A;  3WAF A;  5IM2 A;  2QVU A;  1MXX A;  5EQ9 A;  3H03 A;  4RA1 A;  5CMK A;  4PFU A;  5DVI A;  4OFJ A;  4M4G A;  3PPP A;  3FXR A;  5I57 B;  5A5X A;  2B4L A;  3RTF B;  1P99 A;  2P0S A;  1UQW A;  2OK2 A;  3D1R A;  1MQG A;  2KLF A;  4JVI A;  4P1L A;  1B1X A;  5L9M A;  1LB9 A;  3LUZ A;  4H1X A;  1I6Q A;  4AS4 A;  3S4U A;  4MLQ A;  2HZL A;  4GLI A;  4YKI A;  3B6W A;  2ZYM A;  5EYF A;  3M8U A;  4YKJ A;  2Y5L A;  3USD A;  1FQD A;  1LFI A;  5T3J A;  3B6T A;  3MWB A;  4FIM A;  2QL3 A;  3RLF E;  3FJM A;  1B3G A;  2OWZ A;  4KHZ E;  2R71 A;  3IJO B;  1GVC A;  1QKB A;  3DP4 A;  3G3F A;  2DWJ A;  3LSX A;  3RPW A;  1JW1 A;  4E0X A;  2X7P A;  2NUV A;  4GWX A;  3AXF A;  1NNP A;  3VVE A;  4ND9 A;  1DCU A;  1DTZ A;  3VLV A;  2QRY A;  4YMB A;  1EU8 A;  4ZEC A;  2QFL A;  3TEP A;  3CR9 A;  4FBP A;  3TOD A;  1D9V A;  3C35 A;  1INP A;  1CNQ A;  3MP6 A;  1KZ8 A;  5ET7 A;  1MPD A;  5H8H A;  1DPP A;  2FA7 A;  3K02 A;  3U94 A;  3HHG A;  1JW4 A;  4QSE A;  1IME A;  4THI A;  1JNF A;  4OVR A;  2G29 A;  2A5T B;  3LBS A;  2VD2 A;  2O84 X;  4G77 A;  4AQ4 A;  4QFK A;  4LAT A;  4F1V A;  3T9U A;  4N6D A;  3EF7 A;  4U22 A;  4HTG A;  3ZKL A;  5AA3 A;  1D9Y A;  3O97 A;  4G2Z A;  2NWJ A;  2VOZ A;  1N7X A;  4OEN A;  1EZO A;  5J1D A;  3DP6 A;  4N4U A;  3SEW A;  1MXU A;  1QUL A;  3RNN A;  3RUM A;  2D21 A;  2IEE A;  3RN8 A;  1Y4T A;  1CB6 A;  4N07 A;  1POT A;  2UVG A;  3ODB A;  1FBP A;  3H06 B;  3T9X B;  1NV6 A;  1YCJ A;  4OER A;  4GXA A;  1MQD A;  3K1P A;  2XXX A;  1B9J A;  4R6K A;  3U65 A;  2R6G E;  4MF3 A;  1DTG A;  1HSL A;  4H46 A;  3MC2 A;  4N91 A;  4PDH A;  2UVJ A;  4GL0 A;  3H6W A;  3LV0 A;  1UIV A;  1AOV A;  2WYK A;  2ONR A;  3E78 A;  3IK6 B;  4DXU A;  2ZZV A;  3TTK A;  4F22 A;  1AMF A;  2E0S A;  3EN3 A;  4GVO A;  1IQ7 A;  3G7W A;  2CZL A;  3C36 A;  1EZ9 A;  3TEL A;  1DSN A;  2HCA A;  2PMS A;  1ANF A;  1MXZ A;  4QFO A;  4MCO A;  4QBA A;  2ZMB A;  4X1B A;  4ISU A;  1Y3N A;  4ZZA A;  3TTR A;  3KC0 A;  1KA0 A;  2A5S A;  2I0B A;  3T66 A;  2H25 A;  2Y7R A;  3OMB A;  2DWA A;  2B3F A;  2V25 A;  3K6X A;  3QUF A;  3QYT A;  2ZNU A;  2GH9 A;  3T0J A;  3FXB A;  5A5L A;  1XHY A;  3K0V A;  5ISU A;  1IXI A;  4OQO A;  1AIV A;  1YTV A;  2REJ A;  4N17 A;  1EZP A;  1LBV A;  4RY1 A;  4O3B A;  1VFD A;  4EDP A;  2QSX A;  1B3H A;  2D5W A;  3FXU A;  3T1B A;  4PDD A;  4OMB A;  4GFR A;  1DOT A;  1O7T A;  2UVI A;  1IUD A;  2HAU A;  2F34 A;  4FJP A;  4F31 B;  1FBE A;  2RCB A;  1LCT A;  1URS A;  4Z0I A;  3UA8 A;  1N3W A;  3HFU A;  1IMA A;  2OWT A;  1EYJ A;  3H7M A;  2CZH A;  3MST A;  5ICQ A;  3GXA A;  1BK4 A;  1B7H A;  3ROJ A;  3TPA A;  1WVJ A;  3BIG A;  3MP1 A;  5EHS A;  4DCX A;  2CMO A;  3O6I A;  2QS3 A;  2F5X A;  1FRP A;  1XVY A;  3O2A A;  1MXY A;  1NH8 A;  1OLA A;  1LBB A;  5I7I A;  3R7X A;  4YZZ A;  2VGQ A;  4AB6 A;  1KA1 A;  4KYD A;  5BUU A;  4HW8 A;  1H44 A;  5CRY A;  4QXD A;  3IB0 A;  3Q26 A;  3IAZ A;  3L6H A;  2I48 A;  4FED A;  2OX3 A;  4KFQ A;  4U1Z A;  1NNT A;  3SZP A;  1UTH B;  2RCA A;  2VD3 A;  4KQP A;  3K6W A;  2XHD A;  1P1U A;  1XI6 A;  5I58 A;  2XXQ A;  4H5F A;  3TQW A;  4F3S A;  1QGX A;  1A7L A;  2F7C A;  3IOR A;  2MKZ A;  1TFA A;  3DEL B;  4LUB A;  3ZSF A;  2XXU A;  3B7D A;  1B0H A;  3R26 A;  3U1O A;  1BLF A;  4HCW A;  3PMW A;  3MJN A;  1B5J A;  3L6G A;  5KCJ A;  1LB8 A;  3TAJ A;  3FUZ A;  3GBB A;  3RT6 B;  2V3U A;  2ALU A;  2Z22 A;  4R9F A;  2XXW A;  5DYH A;  3OEM A;  1YPN A;  3G3H A;  2XA5 A;  3N94 A;  4YMA A;  2O68 A;  1N0T A;  4X04 A;  1ATG A;  3RPL B;  3MAM A;  4NF6 A;  3K4U A;  2HFB A;  3IO6 A;  4WEP A;  2RC9 A;  3P7I A;  3JZJ A;  2HQ0 A;  5H8F A;  4NF4 B;  3RTW B;  5JK4 A;  1M5B A;  2Y7P A;  4MNI A;  4F2O A;  1VSO A;  2JJK A;  3V83 A;  1FPF A;  1ELJ A;  3SET A;  2DWH A;  1N7W A;  3W9W A;  2I3W A;  3DM0 A;  3EHU A;  4O94 A;  4O7I A;  4KD5 A;  1PB8 A;  1FTM A;  3PUV E;  3EPE A;  1UTH A;  1JP4 A;  1SI0 A;  4PE3 A;  4KCD A;  1B2H A;  1QVS A;  4POX A;  3RT8 A;  1S9T A;  1WDN A;  4P47 A;  4GWW A;  2ZYN A;  2Y7W A;  1D3K A;  2FIE A;  2THI A;  1H3D A;  1IIW A;  1FBD A;  3IFC A;  3OEL A;  3TCG A;  5EQA A;  1N04 A;  1GGG A;  3VVF A;  4TLL B;  1SQY A;  3QSL A;  1H43 A;  2UVH A;  2PVU A;  1IMD A;  1MPC A;  3KSX A;  2DDK A;  3KJT A;  3IOT A;  4DXB A;  1M5F A;  4GOT A;  3B50 A;  2CEX A;  4OYV A;  1OLC A;  4NF5 B;  4RK9 A;  3I5O A;  5TU0 A;  1TWY A;  5CI5 A;  3FBP A;  4ZEB A;  3U93 A;  4I9D A;  3O9P A;  3CFX A;  3CVG A;  2V3T A;  4F29 A;  2Q8J A;  1O63 A;  3JYR A;  4OET A;  5TP9 B;  4OWD A;  3BFT A;  3UGW A;  4I40 A;  5I56 B;  4N81 A;  2ESN A;  3HV1 A;  1ZMG A;  4G68 C;  4OA4 A;  3O28 A;  4H0W A;  3V5A A;  3DP8 A;  1NNK A;  1SI1 A;  1MY0 A;  2KR0 A;  3CRB A;  3MQ9 A;  3Q25 A;  2NVU B;  4LN5 A;  3PPQ A;  1AL3 A;  3SEU A;  4GWO A;  1R6Z A;  1USY E;  3KFM A;  4DCY A;  4IO7 A;  3PV0 E;  2OCU A;  1NL5 A;  3LSL A;  5K2X A;  3C33 A;  4XFE A;  4HCY A;  3Q27 A;  3UN6 A;  3MVW A;  3BFU A;  4EQ9 A;  2I0C A;  3HO7 A;  5KCJ B;  2ONK E;  3V89 B;  3PTY A;  2DSF A;  2PT1 A;  5ESY A;  3H6V A;  4FEB A;  1B7U A;  1ZBM A;  3PGF A;  1IIT A;  1URD A;  1XS5 A;  4E0W A;  5EQ8 A;  3Q28 A;  4GQO A;  1VE4 A;  2DOJ A;  3K1M A;  4HE2 A;  5IZZ A;  3K01 A;  4PGN A;  4HE0 A;  1B5H A;  2X26 A;  1F9B A;  2ZXT A;  4OES A;  4OVQ A;  4PQJ A;  2XWO A;  2XXR A;  1IMB A;  4P0I A;  2UYF A;  5ET5 A;  3HST A;  4POW A;  4IO2 A;  2P2A A;  4PFB A;  2XXV A;  1FBC A;  3QIM A;  2XXT A;  2X7Q A;  3EHS A;  2PX1 A;  2WKY A;  4PCD A;  3IR1 A;  3PD8 A;  4GX6 A;  4ELO A;  1MY1 A;  2F7A A;  3K1N A;  4NE4 A;  1MQH A;  4ZEF A;  4JBZ A;  1JQF A;  1OQG A;  1Z7N E;  3K00 A;  4XIG Q;  3TUS A;  5H8N A;  4IO4 A;  2XXY A;  4OEV A;  1Y1M A;  1B3F A;  2QS2 A;  4PFR A;  3EQ1 A;  5TP9 A;  2QMW A;  4GWZ A;  1A8F A;  4P56 A;  3KOS A;  1QUJ A;  4IB2 A;  2O7U A;  2H98 A;  4GX3 A;  1L5T A;  1FJ9 A;  4PFY A;  3CFL A;  4GX4 A;  5FTI A;  5CBR A;  4DZ1 A;  1BP5 A;  2GFE A;  1NUX A;  1RDZ A;  3PPN A;  4NG7 A;  3KN7 A;  4KCC A;  3UIF A;  1NMU A;  4G8M A;  5K2Y A;  4DDD A;  4QHQ A;  3TTM A;  1LAF E;  4RXL A;  3IOV A;  1A54 A;  2ABH A;  3TFL A;  5A5X B;  3K2D A;  1IMC A;  2O1L A;  1LBY A;  1IXG A;  2WEF A;  2P1S A;  3RY3 A;  1LFH A;  3TKD A;  4F3G A;  2PFY A;  1IEJ A;  3GZG A;  4JVC A;  2PBW A;  2V93 A;  3FAS A;  4NWC A;  3OSR A;  2VP1 A;  3VE1 B;  1MH3 A;  4OVS A;  3RGY A;  2ONS A;  3FJG A;  4YB5 A;  4C1T A;  3TCF A;  1EYI A;  1QUK A;  3MPL A;  4ONY A;  3KC1 A;  4ZEK A;  1Y4C A;  2GQ1 A;  1YXI A;  4NN3 A;  5DEX B;  4I3E A;  1FCK A;  4LON B;  3SER A;  4H65 A;  5DVF A;  4MAG A;  3A3C A;  2XWI A;  1I69 A;  5CMC A;  4OVT A;  4R74 A;  2Z8F A;  5ITP A;  1T0K A;  5IAI A;  4G61 A;  4JXI A;  1MRP A;  5AA2 D;  1OIB A;  1TXF A;  3RPL A;  4ZS9 A;  4KI0 E;  4M1V A;  1MDQ A;  2DVC A;  3OSQ A;  1DPE A;  3PMX A;  3PPO A;  2WYP A;  1FQF A;  4RJZ A;  2H99 A;  3S9M C;  4LZ8 A;  4BDR A;  1FW0 A;  2OWS A;  3N6T A;  4G8N A;  3T93 B;  1AWB A;  2Q2C A;  2PT2 A;  2Q88 A;  2YLN A;  1NFT A;  3PUW E;  5I3S A;  3C34 A;  4EXL A;  1R1N A;  3F11 A;  4R2B A;  4U4X A;  5ELV A;  1LFG A;  4KYE A;  4NF8 A;  3FZV A;  2XX9 A;  1ZTY A;  4WXJ A;  2DE4 A;  2P3N A;  1Y3Q A;  3M3F A;  5HBC A;  1P1N A;  4PAI A;  1N76 A;  3MVY A;  4FAJ A;  3KGC A;  1G0I A;  5CC2 A;  4NF6 B;  4EQB A;  4PP0 A;  4FEC A;  1RDY A;  1LEV A;  1FBG A;  5JTY B;  2HHM A;  2ZYO A;  3WAE A;  1FTK A;  4XTC Q;  3A09 A;  2XXK A;  4PFW A;  4YU0 A;  2XWV A;  1NI9 A;  3FAT A;  4R75 A;  3C32 A;  4G8H A;  3IB1 A;  3S9E A;  5L9S A;  2FNC A;  1M5C A;  4Q0C A;  2QVR A;  4NX1 A;  2H9B A;  3SKP A;  2FVZ A;  3FD3 A;  2G93 A;  4QRZ A;  1BKA A;  4H5G A;  5I57 A;  3BKI B;  3TTL A;  3E9X A;  3ZS6 A;  4GXS B;  4IY5 A;  4IO3 A;  2QMX A;  1Q35 A;  4LVQ A;  5LDZ A;  2REG A;  1YYZ A;  1YZ0 A;  1BTJ A;  4GBW A;  1BIY A;  3VXC A;  5EHM A;  3JV9 A;  5TPA A;  5AA4 B;  1VR5 A;  4LQ5 A;  2CEY A;  1OVT A;  2F36 A;  1URG A;  2LAO A;  5DW8 A;  1NH7 A;  4OVJ A;  1B05 A;  1RYX A;  1SPI A;  3IB2 A;  4LP2 B;  4U21 A;  3U8Q A;  3EHT A;  1MS7 A;  4JWX A;  5ET6 A;  2WX9 A;  4Q5T A;  3NOH A;  4GF8 A;  3PPR A;  1NNF A;  2AYS A;  1SYH A;  5KDT A;  1A40 A;  2D3I A;  3TMG A;  3QXM A;  4G4P A;  1IXC A;  3GBA A;  4I1D A;  5F7V A;  1IXH A;  2FYI A;  3CG3 A;  3OD7 A;  4EF1 A;  1RDX A;  3LC8 A;  1ZIU A;  4HS7 A;  1FTA A;  3SDF A;  4NHB A;  3VVD A;  2B65 A;  4R6H A;  2Q89 A;  1PBQ A;  3OO9 A;  4P1E A;  2HXW A;  2XD3 A;  4TLM B;  3HN0 A;  2UXA A;  4N6P A;  4OHN A;  5FHM A;  2HPG A;  2PFZ A;  4FAT A;  2Q8M A;  1NUY A;  3KJ7 A;  2AIX A;  5H8Q B;  4BLA A;  4LZ7 A;  5B70 A;  4JVD A;  3N6U A;  4O3A A;  1N3X A;  4F19 A;  1PDA A;  5FBP A;  1FTJ A;  1Y20 A;  3VLU A;  4MEV A;  3T9H B;  2HEU A;  1FPJ A;  1MQJ A;  1B4Z A;  5I2K B;  3CFZ A;  5IZ3 A;  3IFA A;  3PUX E;  1LLS A;  1JW5 A;  1M5E A;  4IGT A;  1B46 A;  3PUZ E;  1I6B A;  5LTC A;  5ITO A;  2YPN A;  5AA2 A;  3A29 A;  2XD2 A;  1II5 A;  5IZ1 A;  4X9T A;  4F1U A;  1KWH A;  4GD5 A;  1EH3 A;  2XXP A;  3G3G A;  1NV2 A;  1H76 A;  2DXY A;  4ZEI A;  3S9L C;  1LBZ A;  4R2F A;  4F39 A;  3ILT B;  4XKP A;  5M2V A;  3MVZ A;  3E13 X;  1NUW A;  3I6V A;  4OAN A;  5I2N A;  3W15 C;  3KSJ A;  1US4 A;  5I59 A;  3FJ7 A;  5AA4 A;  1P1Q A;  1ZU0 A;  1JET A;  3VFJ A;  2WBD A;  1R9L A;  4EUO A;  5FHN A;  3U72 A;  4PGP A;  4GBV A;  1SYI A;  3HHF A;  4IGR A;  2H5Y A;  2I49 A;  1SVX B;  4EF2 A;  3I3V A;  4PET A;  4YKP A;  4PAF A;  3VXB A;  1MM6 A;  5ICT A;  3TTN A;  2A5T A;  3KN3 A;  3D4G A;  4H67 A;  1WOD A;  4P9K A;  2QS1 A;  4ZE9 A;  4N6K A;  4U4S A;  4MMP A;  2RKM A;  1FQA A;  3OXN A;  2E1S A;  3KG2 A;  4N8Y A;  3H6T A;  1NV3 A;  3ZKK A;  4MNP A;  4OTE A;  2HZK A;  4L17 A;  1FQE A;  4I3Y A;  1Y3P A;  4PBQ A;  2F3D A;  2ZNT A;  4XKR A;  4K3F A;  4MLV A;  1PBP A;  3PMV A;  4IY6 A;  5LOM A;  5DEX A;  1LBX A;  3EKI A;  4EXK A;  3LUY A;  5J16 A;  1DK4 A;  1PEB A;  4F18 A;  1POY 1;  1M5D A;  1B4H A;  3UK4 A;  2OLB A;  4QSD A;  4AS5 A;  4PAK A;  4F1Y A;  4TQU Q;  1S7Y A;  3KBZ A;  1H45 A;  4RNS A;  4PFT A;  3DLN A;  4F3B A;  3CI8 A;  3TQL A;  3FXQ A;  5L9O A;  4JWY A;  4C1U A;  3C4M A;  2O1M A;  1SW1 A;  2Y7I A;  3ECR A;  4FE8 A;  2B4M A;  4ZZE A;  2I58 A;  1S50 A;  1SDX A;  2DE3 A;  1D9Q A;  1FQC A;  3OOA A;  4X48 A;  1NV5 A;  4MHF A;  3CHG A;  2F97 A;  3ILU B;  3UP9 A;  1MY2 A;  2ZYK A;  5I56 A;  2DWI A;  2V84 A;  4HXV A;  1QW0 A;  4XKN A;  2PCR A;  2Q2A A;  3LR1 A;  3B6Q A;  1MDP 1;  2Q9T A;  4GL8 A;  1FJ6 A;  1MQI A;  4JDF A;  2ANJ A;  3FIR A;  2V4C A;  4O7M A;  4BDN A;  2DYX A;  1HSE A;  2H4I A;  4OVP A;  3RQT A;  4R6Y A;  3LSF B;  2PYY A;  1UTB A;  2WBB A;  1SW2 A;  4RPN A;  3KOT A;  3W9V A;  5CMB A;  1LGB C;  1TT1 A;  3B8B A;  3OO7 A;  4LA9 A;  4H8I A;  1YAE A;  4OXV A;  3N5L A;  1DMB A;  1USY H;  4O8M A;  5IKB A;  3PUY E;  3CG1 A;  1QJM A;  5AA2 B;  1OMP A;  4U1O A;  5ET8 A;  1PB9 A;  2ZZW A;  4JSD A;  5EQ7 A;  4DI3 D;  1IMF A;  4KPT A;  4YKK A;  3M3L A;  4MBP A;  4NQ8 A;  2P3V A;  4XF5 A;  3HPI A;  3QAX A;  4LZ5 A;  3IJX B;  3FV2 A;  4X8R A;  4ESW A;  1US5 A;  2Q74 A;  1SW5 A;  4OZ9 A;  4QSC A;  1FPK A;  2I3V A;  2F78 A;  5EYH A;  1B5I A;  3ONM A;  3MZ9 A;  1NV0 A;  4QFN A;  1NV1 A;  3UOR A;  3D4C A;  1MXV A;  1K9Z A;  4UA8 A;  2XWK A;  1FBF A;  1FPE A;  1SD3 A;  4DLD A;  3OO6 A;  1B32 A;  1JVX A;  3R6U A;  4N8G A;  1G0H A;  2RC7 A;  4NF4 A;  5AE4 A;  4ELP A;  2VPN A;  3TZA A;  2Y84 A;  5IGA A;  4P8B A;  2F35 A;  1GV8 A;  1DBZ A;  4GWU A;  2XX8 A;  4NTL A;  4MIJ A;  4GWY A;  4O3C A;  5H8H B;  3GLB A;  4I62 A;  5BWJ A;  5H8N B;  3TYH A;  3QUJ A;  4C0R A;  1UIU A;  3IOW A;  1N84 A;  2F6P A;  4UAB A;  1Y9U A;  1LAG E;  3V8X B;  1FBH A;  3MVX A;  4MFI A;  2Z8E A;  4N15 A;  5I84 A;  1FTL A;  4JSO A;  3GYY A;  3T96 B;  5AA1 A;  4WKM A;  5I58 B;  2KQZ A;  4GRK A;  1MY3 A;  2O6A A;  3FV1 A;  1FQB A;  2VHA A;  4KYS A;  1MH4 A;  1Z7M E;  2V3Q A;  2BJJ X;  4NF5 A;  4F2Q A;  4MNC A;  4DIG A;  3G3K A;  1Q9D A;  4KR5 A;  1PC3 A;  2BJI A;  4P11 A;  3OO8 A;  4ZDM A;  5HM4 B;  2XXH A;  1LBC A;  3SEY A;  2RF1 A;  5DVJ A;  3A3U A;  3THI A;  1FPG A;  3Q29 A;  4MX6 A;  5H8S A;  4Q30 B;  1B52 A;  2QJE A;  4ELR A;  4XKQ A;  1IZ1 A;  2XX7 A;  4BDL A;  5DT6 A;  4KXP A;  1OQH A;  4QFL A;  1VFE A;  4PF8 A;  4NMY A;  3OEN A;  5H8F B;  2GRV A;  4GIZ A;  2CZI A;  1UTB B;  2DVZ A;  4OFL A;  4PE5 B;  2I4C A;  4BDO A;  4I8C A;  5IZ3 B;  4FOR A;  4N13 A;  4QF9 A;  1RKM A;  3PU5 A;  4YIC A;  3S9N C;  1LST A;  1MY4 A;  3MUQ A;  1B0L A;  4ECF A;  3MZ1 A;  3FVO A;  2R8T A;  4PTK A;  4UAC A;  4F3P A;  5L8D A;  2Z23 A;  1NV4 A;  4NWD A;  4XEQ A;  5I5P A;  3VLW A;  4NGU A;  2GHB A;  1JEU A;  2DS9 A;  3O29 A;  3KZG A;  5HPQ A;  4JWO A;  2QPQ A;  3SEV A;  3KN8 A;  4ZED A;  1MPB A;  3T9V A;  2HXR A;  1NKX A;  3M3K A;  4NED A;  2DP8 A;  2Z8D A;  4RPO A;  1TFD A;  3MPK A;  4MJO A;  3QK6 A;  4YB6 A;  3MYU A;  1I6A A;  1NV7 A;  3CIJ A;  2YJP A;  4H8J A;  1Y1Z A;  3K6V A;  1FPI A;  1MG1 A;  2CZK A;  2ZZX A;  2F3B A;  1OVB A;  4PC9 A;  1NUZ A;  2OJT A;  3MW0 A;  4GWS A;  4OFO A;  1XT8 A;  1QKA A;  3VV5 A;  2NXO A;  4YAH X;  4ZE8 A;  3HCQ A;  4YB7 A;  5CM6 A;  3H4Z A;  4AB5 A;  2I4B A;  3BIH A;  5F1Q A;  3TCH A;  4G68 A;  1JVY A;  2RIN A;  4X1D A;  4G68 B;  4RK2 A;  2OBG A;  4Q8R A;  1JEV A;  2ZNS A;  3O6H A;  1B3E A;  2QS4 A;  4TOZ A;  4JB7 A;  1ZKB A;  1FPL A;  2FHY A;  4P3L A;  5DTB A;  1GR2 A;  1PB7 A;  1A99 A;  3MBP A;  2O51 A;  2RC8 A;  5CBS A;  1FSA A;  2L5V A;  4OEU A;  1QUI A;  1MM7 A;  5I2N B;  5B7D A;  1FPD A;  2NOO A;  3E3K A;  5JEI A;  3H6U A;  4IO6 A;  3O66 A;  4PFI A;  3SEX A;  3QMF A;  1SBP A;  5F24 A;  4IR8 A;  4LQ2 A;  1D4N A;  2O7I A;  5CMM A;  3KEI A;  4DXC A;  2IA4 A;  2FBP A;  1LCF A;  1B7Z A;  3E4R A;  1B1H A;  2OZZ A;  1ZLQ A;  2DQV A;  5I59 B;  4DI4 B;  1Q1K A;  3MZB A;  5TPA B;  3K6U A;  4R73 A;  2Y7K A;  1B3L A;  1K9Y A;  1B58 A;  4DE8 A;  3ISP A;  3FVG A;  3TDJ A;  1LAH E;  3FVN A;  3N26 A;  4IO5 A;  4BDQ A;  4Z7E A;  3FGS A;  3IO4 A;  1LBW A;  2R9J A;  3BBR A;  4NF0 A;  4NAP A;  1LAX A;  1O64 A;  2M8C A;  2HAV A;  3RYD A;  2XXI A;  1ZJL A;  1FPB A;  1XOC A;  1R9Q A;  3CSB A;  4NF8 B;  2W7Y A;  4PBH A;  2VT5 A;  3VDF A;  4PF6 A;  1CE2 A;  2DE2 A;  5FTH A;  2F8D A;  2VPO A;  1AH5 A;  3IOU A;  2GHA A;  1XVX A;  5KZT A;  1EYK A;  5I2K A;  3C31 A;  1MXW A;  1B40 A;  3MP8 A;  3CSG A;  4U2R A;  5JTY A;  2F6G A;  3G3J A;  2QVV A;  3S2V A;  4QFP A;  1HSJ A;  4XXU A;  2Y5K A;  2DXR A;  3OEK A;  3SES A;  2B3B A;  4ESX A;  5EYG A;  4HE1 A;  4MH5 A;  1GTK A;  1FTO A;  2I6E A;  5H8Q A;  4R72 A;  3IL1 B;  5KDT B;  4ELQ A;  4BDM A;  3PD9 A;  3KBR A;  4WED A;  3FVK A;  1P1O A;  4U23 A;  1VDW A;  4EQ7 A;  1J1N A;  4P0G A;  4H45 A;  1A55 A;  1RYO A;  2F7B A; 
#chains in the Genus database with same CATH homology
 3H3G A;  2AL4 A;  1SW5 A;  2O69 A;  2ZYO A;  4OZ9 A;  3WAE A;  4F2O A;  1B51 A;  4QSC A;  1FTK A;  2I3V A;  2F78 A;  4XTC Q;  3A09 A;  1VSO A;  3U92 A;  2AL5 A;  3T22 A;  1B5I A;  1XC1 A;  3ONM A;  4PFW A;  3MZ9 A;  4YU0 A;  5B7D A;  4R75 A;  3FAT A;  4H6D A;  1A8E A;  1ELJ A;  1SW4 A;  3C32 A;  1P1W A;  3IB1 A;  3LSW A;  2FNC A;  1M5C A;  4G8H A;  3IX1 A;  4QFN A;  3C9H A;  3SET A;  3UOR A;  4Q0C A;  4R9G A;  3D4C A;  3T9V A;  1B6H A;  1MXV A;  2DWH A;  2H9B A;  2UYE A;  3SKP A;  4UA8 A;  1N7W A;  3FD3 A;  2G93 A;  4QRZ A;  3W9W A;  2I3W A;  3DM0 A;  3EHU A;  3O6G A;  4RYA A;  5FHO A;  1BKA A;  3G3I A;  3WAF A;  4H5G A;  1MXX A;  4KD5 A;  3H03 A;  4RA1 A;  1SD3 A;  5CMK A;  1PB8 A;  5I57 A;  1FTM A;  3BKI B;  3E9X A;  3PUV E;  3TTL A;  3OO6 A;  3EPE A;  4DLD A;  1B32 A;  1UTH A;  4PFU A;  5DVI A;  3ZS6 A;  4GXS B;  4OFJ A;  1JVX A;  4IY5 A;  1SI0 A;  4M4G A;  3R6U A;  4IO3 A;  4KCD A;  3PPP A;  2QMX A;  3FXR A;  1Q35 A;  4LVQ A;  5I57 B;  2REG A;  1B2H A;  1QVS A;  4POX A;  3RT8 A;  2RC7 A;  5A5X A;  1S9T A;  1P99 A;  1WDN A;  4NF4 A;  3RTF B;  5AE4 A;  2ZYN A;  2P0S A;  1BTJ A;  2Y7W A;  1UQW A;  1D3K A;  2OK2 A;  4ELP A;  2THI A;  1MQG A;  1H3D A;  3TZA A;  2KLF A;  1BIY A;  3VXC A;  1B1X A;  5L9M A;  2Y84 A;  1LB9 A;  1IIW A;  3JV9 A;  5EHM A;  5TPA A;  5AA4 B;  1VR5 A;  2F35 A;  4LQ5 A;  4H1X A;  1GV8 A;  1I6Q A;  3OEL A;  3TCG A;  3S4U A;  1OVT A;  1N04 A;  4MLQ A;  2F36 A;  1GGG A;  1URG A;  2HZL A;  3VVF A;  2LAO A;  4GLI A;  4TLL B;  1SQY A;  2XX8 A;  4NTL A;  3QSL A;  3B6W A;  4YKI A;  1NH7 A;  2ZYM A;  4OVJ A;  5EYF A;  3M8U A;  1B05 A;  1RYX A;  1H43 A;  2UVH A;  2PVU A;  4YKJ A;  3IB2 A;  4LP2 B;  3KSX A;  1MPC A;  4O3C A;  5H8H B;  3KJT A;  4U21 A;  3GLB A;  3IOT A;  3U8Q A;  3EHT A;  4DXB A;  1MS7 A;  1M5F A;  4I62 A;  4JWX A;  3USD A;  5BWJ A;  5H8N B;  1FQD A;  1LFI A;  4GOT A;  3TYH A;  3B6T A;  4Q5T A;  3QUJ A;  4C0R A;  3MWB A;  1UIU A;  4OYV A;  3IOW A;  4FIM A;  4GF8 A;  2QL3 A;  1N84 A;  1OLC A;  3PPR A;  4NF5 B;  3RLF E;  1NNF A;  3FJM A;  1B3G A;  2F6P A;  2AYS A;  1Y9U A;  3I5O A;  1SYH A;  4RK9 A;  1TWY A;  1LAG E;  4KHZ E;  5TU0 A;  3V8X B;  2R71 A;  5CI5 A;  3IJO B;  4ZEB A;  1GVC A;  1A40 A;  1QKB A;  2D3I A;  4I9D A;  3U93 A;  5KDT A;  3MVX A;  4MFI A;  3S9E A;  3O9P A;  3TMG A;  3QXM A;  3DP4 A;  2Z8E A;  4G4P A;  1IXC A;  3G3F A;  3GBA A;  2DWJ A;  3CFX A;  4I1D A;  3LSX A;  3RPW A;  1JW1 A;  3CVG A;  5I84 A;  5F7V A;  4E0X A;  2V3T A;  2X7P A;  1FTL A;  4JSO A;  1IXH A;  2FYI A;  3CG3 A;  3OD7 A;  4EF1 A;  4F29 A;  2Q8J A;  1O63 A;  2NUV A;  3JYR A;  3LC8 A;  4OET A;  5AA1 A;  4WKM A;  5TP9 B;  3T96 B;  1ZIU A;  4HS7 A;  4OWD A;  3BFT A;  3SDF A;  3UGW A;  3AXF A;  1NNP A;  3VVD A;  3VVE A;  5I58 B;  5I56 B;  4ND9 A;  2B65 A;  4R6H A;  1DTZ A;  2Q89 A;  3VLV A;  2ESN A;  2QRY A;  1MY3 A;  4GRK A;  1PBQ A;  4YMB A;  2O6A A;  3FV1 A;  1FQB A;  3HV1 A;  3OO9 A;  1EU8 A;  2VHA A;  1ZMG A;  2HXW A;  1MH4 A;  4G68 C;  4KYS A;  1Z7M E;  2V3Q A;  2BJJ X;  2XD3 A;  4ZEC A;  3O28 A;  4H0W A;  3V5A A;  3DP8 A;  4NF5 A;  4TLM B;  3TEP A;  3CR9 A;  3HN0 A;  2UXA A;  4N6P A;  1NNK A;  3TOD A;  1D9V A;  1SI1 A;  3C35 A;  4OHN A;  4F2Q A;  4DIG A;  1MY0 A;  3MP6 A;  5FHM A;  3CRB A;  3G3K A;  1MPD A;  3MQ9 A;  3Q25 A;  5H8H A;  1DPP A;  2NVU B;  2FA7 A;  4FAT A;  4KR5 A;  1PC3 A;  3K02 A;  3U94 A;  3HHG A;  1JW4 A;  3OO8 A;  3PPQ A;  4P11 A;  4ZDM A;  4QSE A;  4THI A;  1AL3 A;  5HM4 B;  2XXH A;  1LBC A;  3SEU A;  1JNF A;  2RF1 A;  3SEY A;  3KJ7 A;  5DVJ A;  4GWO A;  2AIX A;  2G29 A;  1R6Z A;  3A3U A;  2A5T B;  3LBS A;  1USY E;  3THI A;  3KFM A;  2VD2 A;  2O84 X;  5H8Q B;  4BLA A;  4G77 A;  4LZ7 A;  5B70 A;  3N6U A;  4DCY A;  3Q29 A;  4IO7 A;  4O3A A;  1N3X A;  3PV0 E;  5H8S A;  4Q30 B;  4F19 A;  1B52 A;  2OCU A;  2QJE A;  4AQ4 A;  1PDA A;  4ELR A;  4XKQ A;  1FTJ A;  1NL5 A;  1IZ1 A;  1Y20 A;  2XX7 A;  3LSL A;  4QFK A;  5DT6 A;  5K2X A;  4BDL A;  1OQH A;  3C33 A;  4LAT A;  4QFL A;  3VLU A;  4F1V A;  1VFE A;  4HCY A;  3Q27 A;  3OEN A;  4NMY A;  3UN6 A;  3T9U A;  3MVW A;  3EF7 A;  5H8F B;  3T9H B;  3BFU A;  4U22 A;  2GRV A;  4HTG A;  3ZSF A;  2I0C A;  4GIZ A;  3ZKL A;  4EQ9 A;  3HO7 A;  5AA3 A;  1D9Y A;  3O97 A;  1UTB B;  2DVZ A;  2HEU A;  4G2Z A;  2NWJ A;  5KCJ B;  4OFL A;  2ONK E;  4PE5 B;  3V89 B;  2VOZ A;  1MQJ A;  1N7X A;  2I4C A;  4OEN A;  4BDO A;  4I8C A;  1B4Z A;  1EZO A;  5I2K B;  2DSF A;  2PT1 A;  3CFZ A;  5J1D A;  4FOR A;  4N13 A;  4QF9 A;  3H6V A;  1RKM A;  3PUX E;  1LLS A;  3DP6 A;  3PU5 A;  4YIC A;  3S9N C;  1LST A;  1MY4 A;  3MUQ A;  3SEW A;  1MXU A;  1QUL A;  1B0L A;  3RNN A;  1JW5 A;  2D21 A;  3MZ1 A;  1M5E A;  1B7U A;  1ZBM A;  3PGF A;  1B46 A;  1IIT A;  4FEB A;  1URD A;  2IEE A;  4IGT A;  3RN8 A;  1XS5 A;  1CB6 A;  1Y4T A;  3FVO A;  4N07 A;  4E0W A;  3PUZ E;  1POT A;  2UVG A;  1I6B A;  3ODB A;  3Q28 A;  4GQO A;  1VE4 A;  2DOJ A;  3H06 B;  3K1M A;  4UAC A;  5L8D A;  4F3P A;  3V83 A;  5ITO A;  3T9X B;  1YCJ A;  3K01 A;  2Z23 A;  4OER A;  2YPN A;  4NWD A;  5AA2 A;  3VLW A;  1B5H A;  1MQD A;  2GHB A;  4GXA A;  1JEU A;  2DS9 A;  3K1P A;  2X26 A;  2XD2 A;  2XXX A;  3O29 A;  1II5 A;  1F9B A;  3KZG A;  1B9J A;  2ZXT A;  4R6K A;  4OES A;  5HPQ A;  4JWO A;  2QPQ A;  2R6G E;  1DTG A;  4MF3 A;  4X9T A;  4PQJ A;  3SEV A;  3KN8 A;  1KWH A;  1HSL A;  4F1U A;  4GD5 A;  4ESW A;  2XXR A;  3MC2 A;  4ZED A;  2UVJ A;  1MPB A;  1EH3 A;  2XXP A;  4GL0 A;  1NKX A;  3G3G A;  3H6W A;  3M3K A;  4NED A;  2DP8 A;  2Z8D A;  4P0I A;  2DXY A;  1H76 A;  2UYF A;  4ZEI A;  3S9L C;  4RPO A;  4R2F A;  1TFD A;  4F39 A;  1UIV A;  1AOV A;  2ONR A;  3HST A;  3MPK A;  3QK6 A;  3ILT B;  4POW A;  4IO2 A;  2P2A A;  4XKP A;  4YB6 A;  3IK6 B;  5M2V A;  3MVZ A;  3E13 X;  3TTK A;  4DXU A;  1I6A A;  3I6V A;  2XXV A;  1AMF A;  4F22 A;  3CIJ A;  5I2N A;  2YJP A;  2E0S A;  3KSJ A;  3W15 C;  1US4 A;  3QIM A;  3EN3 A;  2XXT A;  2X7Q A;  1Y1Z A;  3EHS A;  1IQ7 A;  2PX1 A;  2WKY A;  3FJ7 A;  3K6V A;  4GVO A;  5AA4 A;  3G7W A;  2CZL A;  1MG1 A;  3C36 A;  1P1Q A;  1EZ9 A;  1ZU0 A;  3IR1 A;  1JET A;  3PD8 A;  4ELO A;  1MY1 A;  1OVB A;  3TEL A;  2F7A A;  3VFJ A;  1R9L A;  4EUO A;  5FHN A;  1DSN A;  3U72 A;  3K1N A;  2HCA A;  2PMS A;  1ANF A;  1MXZ A;  4NE4 A;  2OJT A;  1MQH A;  4QFO A;  1SYI A;  4ZEF A;  4JBZ A;  1JQF A;  2ZMB A;  3HHF A;  3MW0 A;  4IGR A;  2H5Y A;  1OQG A;  4X1B A;  1Z7N E;  4ISU A;  4OFO A;  2I49 A;  1SVX B;  1XT8 A;  1QKA A;  1Y3N A;  3K00 A;  4XIG Q;  5H8N A;  4ZZA A;  4IO4 A;  3I3V A;  3VV5 A;  4EF2 A;  2NXO A;  4PET A;  4YKP A;  3TTR A;  4YAH X;  4ZE8 A;  2XXY A;  4OEV A;  3HCQ A;  1Y1M A;  1B3F A;  3VXB A;  2QS2 A;  2A5S A;  3EQ1 A;  1MM6 A;  4YB7 A;  2I0B A;  5CM6 A;  3T66 A;  2H25 A;  2Y7R A;  5TP9 A;  2QMW A;  3H4Z A;  4AB5 A;  3OMB A;  5ICT A;  2DWA A;  2I4B A;  3TTN A;  2B3F A;  2V25 A;  3K6X A;  3QUF A;  1A8F A;  2ZNU A;  3QYT A;  2A5T A;  2GH9 A;  3KN3 A;  5F1Q A;  3TCH A;  3D4G A;  1JVY A;  2RIN A;  3KOS A;  1WOD A;  4G68 A;  4G68 B;  4H67 A;  4X1D A;  1QUJ A;  2QS1 A;  4RK2 A;  1XHY A;  2OBG A;  3K0V A;  4IB2 A;  2O7U A;  4Q8R A;  1JEV A;  2H98 A;  4ZE9 A;  5ISU A;  1L5T A;  4U4S A;  2ZNS A;  3O6H A;  4PFY A;  1B3E A;  1IXI A;  2QS4 A;  2RKM A;  4TOZ A;  4JB7 A;  4OQO A;  1AIV A;  1FQA A;  1YTV A;  3OXN A;  2E1S A;  1ZKB A;  2REJ A;  3CFL A;  3KG2 A;  5FTI A;  5CBR A;  5L9S A;  3H6T A;  4DZ1 A;  1BP5 A;  1EZP A;  2GFE A;  5DTB A;  3PPN A;  4RY1 A;  1GR2 A;  1PB7 A;  1A99 A;  1VFD A;  2O51 A;  3MBP A;  4O3B A;  3ZKK A;  2RC8 A;  4EDP A;  4OTE A;  2HZK A;  2QSX A;  4L17 A;  5CBS A;  1B3H A;  2D5W A;  3FXU A;  1FQE A;  4OEU A;  1QUI A;  4OMB A;  1MM7 A;  5I2N B;  4GFR A;  3KN7 A;  1DOT A;  1O7T A;  1Y3P A;  2UVI A;  1IUD A;  2HAU A;  2ZNT A;  4KCC A;  2F34 A;  4FJP A;  4K3F A;  1NMU A;  4XKR A;  3UIF A;  4G8M A;  4F31 B;  2RCB A;  4MLV A;  5K2Y A;  1LCT A;  1PBP A;  3PMV A;  2NOO A;  1URS A;  3E3K A;  4IY6 A;  4QHQ A;  4Z0I A;  3TTM A;  4DDD A;  5LOM A;  3UA8 A;  5JEI A;  3H6U A;  4IO6 A;  1LAF E;  4RXL A;  1N3W A;  1A54 A;  3IOV A;  3O66 A;  2ABH A;  5DEX A;  3TFL A;  5A5X B;  3K2D A;  2O1L A;  2OWT A;  3SEX A;  4EXK A;  3H7M A;  3LUY A;  5ICQ A;  1PEB A;  3GXA A;  4F18 A;  1SBP A;  1IXG A;  1POY 1;  2P1S A;  1M5D A;  3RY3 A;  1B7H A;  3TPA A;  1LFH A;  3TKD A;  4LQ2 A;  4F3G A;  5I59 A;  1D4N A;  1IEJ A;  2O7I A;  4Z7E A;  1B4H A;  3GZG A;  5CMM A;  2PBW A;  2OLB A;  4QSD A;  3UK4 A;  3KEI A;  1WVJ A;  3MP1 A;  5EHS A;  2V93 A;  4DXC A;  4F1Y A;  3FAS A;  2IA4 A;  4NWC A;  3OSR A;  4TQU Q;  2CMO A;  3O6I A;  4DCX A;  2QS3 A;  1S7Y A;  2F5X A;  1XVY A;  2VP1 A;  1H45 A;  3O2A A;  1MH3 A;  1MXY A;  3VE1 B;  4RNS A;  4PFT A;  3RGY A;  1LCF A;  3DLN A;  1B7Z A;  3CI8 A;  4F3B A;  3E4R A;  2ONS A;  3FJG A;  3FXQ A;  1NH8 A;  4YB5 A;  3TQL A;  4C1T A;  3TCF A;  1OLA A;  1QUK A;  5L9O A;  1B1H A;  1LBB A;  3MPL A;  4ONY A;  1Y4C A;  2OZZ A;  4ZEK A;  1ZLQ A;  4JWY A;  4C1U A;  3C4M A;  2DQV A;  2O1M A;  5I59 B;  1SW1 A;  3R7X A;  1Q1K A;  5DEX B;  4YZZ A;  2Y7I A;  3ECR A;  3MZB A;  4FE8 A;  5TPA B;  2VGQ A;  4AB6 A;  3K6U A;  4R73 A;  2Y7K A;  4ZZE A;  1FCK A;  1B3L A;  4KYD A;  2I58 A;  5BUU A;  4HW8 A;  1H44 A;  1B58 A;  4DE8 A;  5CRY A;  1S50 A;  1SDX A;  3FVG A;  3IB0 A;  2DE3 A;  3Q26 A;  3TDJ A;  1LAH E;  3FVN A;  3N26 A;  4IO5 A;  4LON B;  3SER A;  4BDQ A;  4H65 A;  1FQC A;  3IAZ A;  3L6H A;  3OOA A;  3A3C A;  5DVF A;  3FGS A;  2I48 A;  3IO4 A;  4FED A;  4X48 A;  2R9J A;  3TUS A;  2F97 A;  4KFQ A;  3BBR A;  3ILU B;  1LAX A;  1I69 A;  1O64 A;  2M8C A;  2HAV A;  4U1Z A;  1NNT A;  3UP9 A;  2XXI A;  5CMC A;  1ZJL A;  1MY2 A;  1XOC A;  2ZYK A;  1UTH B;  1R9Q A;  2RCA A;  4R74 A;  2Z8F A;  2VD3 A;  4KQP A;  3K6W A;  5ITP A;  2XHD A;  3CSB A;  4NF8 B;  2W7Y A;  1P1U A;  5I56 A;  5I58 A;  2DWI A;  3VDF A;  1T0K A;  5IAI A;  2XXQ A;  2V84 A;  4H5F A;  4JXI A;  3TQW A;  1CE2 A;  4F3S A;  1MRP A;  5AA2 D;  1OIB A;  1TXF A;  1QW0 A;  4XKN A;  2Q2A A;  1A7L A;  3LR1 A;  2F7C A;  1MDP 1;  2DE2 A;  3B6Q A;  2Q9T A;  4KI0 E;  3IOR A;  4ZS9 A;  4M1V A;  5FTH A;  4GL8 A;  2F8D A;  1MDQ A;  2DVC A;  3OSQ A;  1DPE A;  3PMX A;  3PPO A;  1MQI A;  1TFA A;  4JDF A;  1FQF A;  3DEL B;  2H99 A;  4LUB A;  4RJZ A;  3S9M C;  1AH5 A;  2ANJ A;  3FIR A;  2XXU A;  3B7D A;  3IOU A;  4LZ8 A;  2GHA A;  1B0H A;  1FW0 A;  1XVX A;  3R26 A;  3U1O A;  4BDN A;  4BDR A;  5KZT A;  2OWS A;  2DYX A;  1BLF A;  1HSE A;  2H4I A;  3N6T A;  4G8N A;  4HCW A;  4R6Y A;  3RQT A;  3T93 B;  3PMW A;  3C31 A;  3RUM A;  5I2K A;  2Q2C A;  2PT2 A;  3LSF B;  2Q88 A;  3MJN A;  1MXW A;  1B40 A;  2PYY A;  1B5J A;  2YLN A;  1NFT A;  1UTB A;  3L6G A;  3MP8 A;  3PUW E;  5KCJ A;  3CSG A;  1SW2 A;  4U2R A;  2F6G A;  3G3J A;  3C34 A;  5JTY A;  4EXL A;  4RPN A;  1R1N A;  1LB8 A;  3F11 A;  3S2V A;  3KOT A;  4R2B A;  4QFP A;  5CMB A;  3W9V A;  3TAJ A;  4U4X A;  1HSJ A;  3FUZ A;  4XXU A;  5ELV A;  1LGB C;  1TT1 A;  3GBB A;  3OO7 A;  4LA9 A;  1LFG A;  4KYE A;  2DXR A;  3OEK A;  4H8I A;  4NF8 A;  3RT6 B;  3FZV A;  3SES A;  2V3U A;  2ALU A;  2B3B A;  2Z22 A;  4ESX A;  2XX9 A;  4R9F A;  1YAE A;  2XXW A;  4OXV A;  1ZTY A;  4MH5 A;  5DYH A;  1GTK A;  1FTO A;  3N5L A;  3OEM A;  1DMB A;  4WXJ A;  1USY H;  1YPN A;  2DE4 A;  3G3H A;  1Y3Q A;  2I6E A;  5H8Q A;  3M3F A;  5HBC A;  5IKB A;  3PUY E;  4R72 A;  3CG1 A;  3IL1 B;  1QJM A;  3N94 A;  5AA2 B;  5KDT B;  1OMP A;  4BDM A;  1P1N A;  3PD9 A;  4U1O A;  4ELQ A;  1N76 A;  4YMA A;  2O68 A;  3KBR A;  3MVY A;  1N0T A;  4WED A;  1PB9 A;  4JSD A;  4FAJ A;  3KGC A;  1ATG A;  5CC2 A;  4NF6 B;  3MAM A;  4NF6 A;  3K4U A;  4EQB A;  2HFB A;  4KPT A;  3FVK A;  3IO6 A;  4WEP A;  2RC9 A;  3M3L A;  3P7I A;  4MBP A;  4YKK A;  4PP0 A;  1P1O A;  3JZJ A;  2HQ0 A;  4FEC A;  4H8J A;  4U23 A;  4EQ7 A;  3HPI A;  3QAX A;  4LZ5 A;  3IJX B;  4NF4 B;  1J1N A;  4ECF A;  5H8F A;  3RTW B;  3FV2 A;  4P0G A;  5JK4 A;  1A55 A;  5JTY B;  1M5B A;  1RYO A;  2Y7P A;  2F7B A;  1US5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...