1A40A

Phosphate-binding protein with ala 197 replaced with trp
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
321
structure length
321
Chain Sequence
b'EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGTSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYWYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATE-BINDING PERIPLASMIC PROTEIN PRECURSOR
publication title Dominant role of local dipolar interactions in phosphate binding to a receptor cleft with an electronegative charge surface: equilibrium, kinetic, and crystallographic studies.
pubmed rcsb
source organism Escherichia coli
molecule tags Phosphate-binding protein
total genus 102
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 1998-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1a40A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1a40A02
1P1NA 1ZTYA 3PPOA 3F11A 1QKBA 4PETA 3DP6A 3K6UA 3GZGA 3TEPA 1HSEA 3DP8A 5L9MA 3TFLA 2PBWA 3B6WA 3JZJA 5H8HA 3CRBA 4EXKA 2XXPA 4O3BA 4I8CA 3EHSA 1QVSA 4F29A 2P0SA 4ZS9A 4Q0CA 5DVJA 1NNKA 3UA8A 3GBAA 1MPBA 2UVHA 4MH5A 2GHBA 2R6GE 2UXAA 1M5EA 3MVWA 3VE1B 3VXCA 1MXZA 3Q28A 2Q8JA 5F1QA 4WKMA 4HCWA 1FQBA 1NH8A 4R2BA 3ZS6A 4XTCQ 2QSXA 4FEBA 4XKNA 3W9VA 4MLVA 3U93A 2V3QA 1GTKA 2PT2A 4HS7A 2Z23A 2DQVA 4OEVA 4FEDA 4OHNA 2XX8A 4HTGA 1LB9A 3M3FA 3IJOB 3CFLA 1XC1A 4KCDA 4LUBA 3MUQA 5M2VA 1URGA 4H0WA 4L17A 5H8FA 4DE8A 4KCCA 2Y7PA 1SBPA 3MZ1A 3G3IA 4GQOA 3IR1A 1LGBC 2QS4A 1B2HA 4QF9A 1B7UA 3N6UA 1MH3A 4O3CA 4FATA 1IXHA 1MXVA 4RY1A 4Q5TA 3BBRA 4NF5B 4BDLA 4QHQA 2W7YA 2RINA 3I3VA 4JBZA 2F7BA 4R2FA 4U2RA 3G3HA 3EPEA 3PV0E 4PP0A 3N26A 1POY1 3H4ZA 5I58B 2FA7A 4LP2B 4U4XA 4YB5A 5H8NB 3MPKA 5ISUA 1PEBA 1URDA 3T66A 1B6HA 3H06B 3QYTA 2XXIA 1FTJA 2YLNA 3FD3A 4GWOA 3IOVA 3ILUB 2XXHA 1JQFA 2I3VA 5FHOA 1QJMA 2ZNSA 3OSQA 2ANJA 2I58A 2P1SA 2VD3A 1MM6A 2DS9A 4R9GA 2AL4A 2PMSA 4LZ8A 2PT1A 4NF6B 3W9WA 1UIVA 2XXQA 2XD2A 3T9VA 4KFQA 4KQPA 3HO7A 1EH3A 2O7IA 4JSDA 3KJTA 5ELVA 2RCBA 1Y1MA 3SEUA 4KYDA 1LCTA 4XKPA 3IOTA 3CSBA 3K01A 1FTLA 4IO7A 2OWTA 3QUJA 1IZ1A 1QKAA 3KG2A 3OELA 3CVGA 3BFTA 4G68B 1SW5A 1I6AA 4NWCA 2XXUA 1FQFA 4OEUA 2FYIA 4O3AA 1QW0A 2ONKE 5AA1A 4FIMA 1VR5A 3PD9A 2H5YA 2XHDA 4Q30B 2OZZA 5I56A 1Y20A 4GD5A 4OQOA 4OXVA 1BIYA 1NKXA 4G2ZA 1QUIA 2ALUA 1FQAA 2AIXA 4X1BA 2O1MA 5L9OA 4OETA 5H8SA 5TU0A 1B4HA 5EHMA 3TAJA 3CI8A 4H67A 3DLNA 2I3WA 5CMMA 4H6DA 2O69A 1SYIA 4ELQA 3KN7A 2XXRA 3TZAA 2ZNUA 3USDA 3Q27A 1ZMGA 4TLLB 4C1TA 1BKAA 1LB8A 1MY1A 3I6VA 4PFWA 5TPAB 4U21A 3T22A 3PMXA 3FJ7A 1IEJA 2GRVA 2PVUA 2V3TA 1H44A 3H7MA 1JNFA 4GFRA 3IO6A 1Y3QA 2QPQA 4F1UA 1CE2A 1MQJA 4RK2A 4F1YA 1JEUA 4H8IA 3C33A 3RTFB 3RNNA 3C31A 3O6GA 1M5FA 1UIUA 3KSXA 1EZOA 3U8QA 1BTJA 1ATGA 5EHSA 1IXGA 2F8DA 5ICQA 4IO6A 1M5CA 1N76A 1N84A 3MPLA 3S2VA 3H6UA 4F39A 2G93A 1LCFA 5A5XB 1B58A 1Y4CA 1IUDA 4JDFA 3MWBA 3OEKA 4M1VA 3LUYA 4EF2A 5HM4B 3PPPA 3PUVE 5I2NB 5ICTA 4GIZA 1MDP1 3PUYE 4WEDA 1LBBA 3U94A 3MVYA 1TFAA 3S9EA 3OOAA 5K2YA 5I84A 1SD3A 3HSTA 3KJ7A 4TLMB 2GH9A 1POTA 3FV1A 4MFIA 4R9FA 3MAMA 4ZE9A 3OD7A 1PBPA 1JW5A 3O29A 1URSA 5AA2B 3C4MA 3L6HA 2PX1A 2ZNTA 5KDTB 4ZZAA 4TQUQ 4DZ1A 4PFUA 3MW0A 3U72A 1XT8A 1B05A 3M3KA 2ESNA 2R71A 5AE4A 1FCKA 2F97A 1M5BA 1JW1A 2A5TB 2D21A 1JEVA 5H8NA 2DE4A 3TCHA 3TMGA 2YJPA 3C9HA 5JTYA 3K0VA 1KWHA 4YAHX 1B7ZA 3C34A 3SDFA 3H6VA 3KZGA 4ELRA 3KEIA 5IAIA 1P1OA 3V89B 2HXWA 3RGYA 1OVBA 4N6PA 1UTHB 1B40A 3E3KA 5BWJA 4NF6A 3LSWA 3SEYA 4IB2A 1S9TA 4NWDA 1NL5A 3UORA 3TTKA 4G4PA 1N04A 3K02A 3MQ9A 1H43A 1SW2A 1B3LA 3FVOA 1AH5A 1Y1ZA 4FORA 4ELPA 4Z7EA 4POXA 4ZZEA 1MXYA 2D3IA 4OENA 1SDXA 1TFDA 3K2DA 2QS1A 3IL1B 2H99A 3K1NA 3TUSA 4KD5A 4RNSA 4XXUA 3KN3A 4G68A 3M8UA 1LFIA 5AA4B 3C35A 1MXXA 3IAZA 3PMWA 2F36A 1OLCA 4XKRA 5CMBA 4YMBA 5I2KA 2DWHA 4ISUA 3K1PA 3B6TA 2OCUA 3TODA 3CG1A 4AB6A 3C36A 1L5TA 4RPOA 1ZKBA 1B3GA 4E0XA 1ZU0A 3K1MA 3TQLA 5B7DA 3CG3A 1YAEA 1MXWA 3OEMA 3EQ1A 1LFHA 5CM6A 1D9YA 1MQHA 4OFJA 1Z7ME 3OXNA 5JEIA 2THIA 5CBRA 3T93B 2DXRA 1D4NA 3CFXA 5H8QB 3L6GA 1S50A 4R74A 5TPAA 2HZLA 1EZ9A 3TQWA 2HZKA 2B3BA 1DPPA 2V84A 2HCAA 4R73A 2YPNA 4JWXA 1FQEA 5KCJB 4PFTA 4QSEA 1FTOA 2GHAA 5L8DA 2UYEA 1MG1A 5TP9B 2UVGA 1SQYA 4LQ2A 3ONMA 2BJJX 5DVIA 1PB9A 2UVIA 3KGCA 2XXVA 3KFMA 1WDNA 1SW1A 1UTBB 2HAUA 4OMBA 4BDRA 4EF1A 4LA9A 4XKQA 4R75A 3T96B 4F2QA 4GLIA 5EYFA 1A7LA 4BDNA 2FNCA 1GGGA 1OLAA 4RJZA 3FXUA 1JETA 2O7UA 4YKIA 1OIBA 4EQ7A 4EUOA 4C1UA 4ESXA 3QIMA 3FVNA 4NE4A 3PUWE 1J1NA 5LOMA 5A5XA 2UYFA 4OFLA 1A8EA 4OVJA 3LR1A 5I2NA 1MH4A 3MP8A 2CZLA 2PYYA 3HCQA 2I48A 2P2AA 4ZEKA 3HPIA 1MPCA 1UQWA 2I49A 3V8XB 4OTEA 1EZPA 3GXAA 2XXTA 1N7WA 4F31B 2OK2A 3FJMA 4F3PA 2HQ0A 4DIGA 2V3UA 4R72A 3TPAA 3TTMA 1R9QA 4P0IA 5AA2A 3LC8A 3PPQA 4NF8A 4DXUA 3PPRA 4YU0A 1O7TA 5KDTA 4U1ZA 1NNFA 5HBCA 1QULA 4LZ5A 1Y3PA 3IOWA 2IEEA 4XIGQ 4R6KA 2OWSA 1XOCA 2V25A 2Z8DA 4YZZA 2A5TA 4PFYA 2VOZA 1LAHE 1R6ZA 2NOOA 3Q25A 4RPNA 1LLSA 4EQBA 2Z22A 3FUZA 4NTLA 2ZYKA 1B5JA 4ZEFA 1H76A 3DP4A 1XVXA 3DELB 1I6QA 2Z8FA 1H3DA 3H3GA 4X48A 1FTMA 1O64A 1UTHA 3OO9A 3MVXA 3MBPA 1AOVA 5CMKA 1H45A 3I5OA 4ZECA 4OERA 2H9BA 4C0RA 1LBCA 1MM7A 5FTHA 4YMAA 2DWJA 1ELJA 3RQTA 2OBGA 3UGWA 2VGQA 4THIA 3D4CA 5DEXB 3S9LC 4IO2A 3O97A 4P11A 4OWDA 1SI0A 1MS7A 5CRYA 1B3EA 3BFUA 1IQ7A 1YPNA 5AA4A 2REGA 4KPTA 4F22A 1YTVA 3ZSFA 1Y4TA 3V83A 2ZMBA 4PE5B 2X7PA 1P1WA 3FASA 1US4A 3SESA 2O6AA 2WKYA 4RK9A 4ZDMA 4LZ7A 3B6QA 3QUFA 1FQCA 4H8JA 4MF3A 3TELA 3PUZE 1IIWA 1B7HA 3K6XA 4FAJA 3JYRA 1YCJA 1TXFA 4TOZA 1A8FA 1F9BA 1MQIA 2H98A 2RC9A 1DSNA 4LVQA 5I57B 1A55A 1USYH 5AA2D 2I4CA 2HAVA 3P7IA 3LSFB 2ZYNA 2I4BA 5FHMA 2XD3A 4OESA 5IKBA 3FVKA 1O63A 1NNPA 4QFKA 1VE4A 2OJTA 1FW0A 1CB6A 4G8NA 3S9MC 2HFBA 5KCJA 4POWA 3FVGA 2XXYA 5TP9A 2F5XA 4JWOA 3MVZA 1LAFE 3KOSA 3PPNA 4KYEA 4H5GA 1NNTA 3O66A 3RN8A 4OZ9A 3VVFA 1UTBA 4G8HA 3MP1A 4GOTA 3VXBA 4BDMA 3ILTB 3PGFA 1B1HA 2DWIA 2G29A 4NF5A 1ANFA 1VFDA 2NUVA 3IO4A 3SEVA 3ECRA 1TT1A 1VSOA 2QL3A 2Q88A 4QFLA 5K2XA 2HEUA 3SEXA 2UVJA 1LAGE 4GL0A 4YICA 5I58A 3E4RA 1JW4A 3ODBA 4P0GA 1MY4A 4YKKA 3RTWB 3PU5A 5AA3A 4GVOA 2O51A 1OQGA 2F78A 4H5FA 1OVTA 3R26A 3SKPA 1A54A 3R7XA 4G68C 4QSCA 4KHZE 4K3FA 3ZKKA 4YB6A 4N07A 1MY2A 3TTNA 4ONYA 3OO6A 3GLBA 3EHUA 4GF8A 4QFNA 1QUKA 3Q29A 1B51A 5HPQA 4IY5A 3IB2A 2F35A 2E0SA 3KSJA 3HHFA 5JK4A 5I59B 2H25A 2NVUB 2DE2A 2QRYA 2DYXA 3UK4A 3IK6B 4JSOA 2ZXTA 3G3KA 3H03A 4KR5A 4DLDA 2ONSA 3VLVA 3T9HB 1MY3A 2IA4A 3ZKLA 4ELOA 2O84X 3VFJA 2RKMA 4BDQA 3EHTA 1MY0A 2Y7IA 1R9LA 3OSRA 1HSJA 4OFOA 4KI0E 3EF7A 3U92A 2I6EA 4QFPA 3IORA 1D9VA 4ESWA 4F1VA 1S7YA 2I0BA 4ND9A 3H6WA 2GFEA 1DPEA 4JWYA 4F19A 1A99A 2RC7A 1XS5A 3CR9A 2DSFA 1P1QA 1LAXA 4ECFA 1Y3NA 5CBSA 4F3SA 3Q26A 3RT8A 2QS3A 5FTIA 1DTGA 3IX1A 3KBRA 3MZ9A 3FV2A 3A09A 1US5A 4YB7A 1R1NA 1P99A 4FE8A 3TDJA 3N94A 2DWAA 4X9TA 4H65A 3THIA 3IB0A 4LATA 2F7AA 5DEXA 2RCAA 4OYVA 4F3GA 3E13X 1M5DA 2QJEA 4Z0IA 1NFTA 4IO5A 3DM0A 2B3FA 3WAFA 3A3UA 4MBPA 2ABHA 1VFEA 5CMCA 1PB7A 2V93A 4G8MA 4NMYA 3HN0A 4DCYA 5B70A 4IO3A 2F6PA 4M4GA 3R6UA 1FQDA 2RF1A 3V5AA 4RA1A 4R6YA 1PB8A 4LQ5A 4NF4B 3JV9A 4RXLA 3UN6A 4HCYA 1Y9UA 3PMVA 4WXJA 3LSLA 4BLAA 2A5SA 1MPDA 1N7XA 4G77A 3G3JA 2I0CA 3FIRA 2Y84A 1HSLA 4U4SA 1B9JA 5I57A 3TTRA 3MJNA 2ZYOA 1ZJLA 2AL5A 2DP8A 3OO8A 1USYE 4I9DA 5ITPA 4I1DA 4DXBA 5JTYB 3RPWA 1AIVA 2KLFA 3LBSA 4DDDA 1OQHA 2DVCA 3A3CA 4E0WA 2XX9A 1WVJA 3FATA 3QAXA 1B3HA 1DTZA 3BKIB 1PC3A 3HV1A 1EU8A 4YKPA 2XXXA 1B32A 1SW4A 3RLFE 5DT6A 3VV5A 3VVDA 5FHNA 3O6HA 4EDPA 1MRPA 3AXFA 5J1DA 4F3BA 1GV8A 2ONRA 4NEDA 1BP5A 4JB7A 4LONB 3O28A 2NXOA 3QK6A 1ZBMA 2F34A 3S9NC 3CFZA 4QFOA 3CSGA 1MDQA 5H8HB 1AL3A 3OMBA 3VLUA 1RYXA 4MLQA 3FJGA 2REJA 2VD2A 2Z8EA 3H6TA 3O6IA 4EXLA 3IB1A 2RC8A 1OMPA 3T9XB 4UA8A 4H1XA 2XXWA 5CI5A 1Q1KA 2F6GA 1B5HA 2X26A 3IJXB 5I2KB 3TCGA 2B65A 1LFGA 2Y7WA 1AMFA 1D3KA 5I59A 2X7QA 4U1OA 1II5A 1I69A 2Q2AA 1B3FA 3TYHA 2Q9TA 1IITA 2D5WA 3GBBA 4I62A 3U1OA 1PDAA 2QMXA 3K6VA 4R6HA 1SYHA 4WEPA 2M8CA 3E9XA 1Z7NE 3FXQA 1SVXB 3PD8A 3QXMA 3QSLA 3K00A 4ZEDA 1MQDA 1NH7A 1QUJA 3TCFA 2Q2CA 5DTBA 5DVFA 3G7WA 3SETA 5H8FB 3MZBA 4AB5A 2Q89A 4HW8A 4GRKA 2VHAA 4IO4A 1DOTA 1SI1A 1WODA 3N6TA 1MQGA 1JVYA 2VP1A 3G3FA 1B4ZA 3RT6B 3KN8A 3MC2A 5F7VA 1ZIUA 4F2OA 2NWJA 3S4UA 1MXUA 3PUXE 3B7DA 2QMWA 1B46A 3FZVA 1N0TA 3FGSA 3UIFA 1XVYA 1TWYA 3MP6A 5H8QA 3TKDA 4RYAA 4FJPA 1GVCA 4ZEBA 2LAOA 4GXSB 3LSXA 5DYHA 1N3WA 4F18A 3RY3A 4N13A 4QSDA 4AQ4A 1RYOA 3C32A 3HHGA 4U23A 3O2AA 2F7CA 1DMBA 3D4GA 4IY6A 3TTLA 3T9UA 4IGTA 4IGRA 1T0KA 1ZLQA 4ZEIA 1NMUA 1IXIA 3N5LA 4KYSA 4YKJA 3W15C 1I6BA 4GXAA 4NF4A 3KOTA 3OO7A 2O1LA 2DXYA 4FECA 5ITOA 4NF8B 3FXRA 4X1DA 1PBQA 3M3LA 3IOUA 4GL8A 1P1UA 1N3XA 4DXCA 1B1XA 2XX7A 2QS2A 2ZYMA 3SEWA 4Q8RA 2AYSA 4QRZA 2CMOA 2O68A 3VVEA 2DOJA 1IXCA 2DVZA 2R9JA 3RUMA 1GR2A 2E1SA 3OENA 4U22A 1RKMA 3EN3A 5KZTA 4PQJA 1B5IA 1BLFA 3G3GA 4BDOA 5CC2A 2Y7KA 3VDFA 1JVXA 3UP9A 3K6WA 3O9PA 2H4IA 1B52A 2Y7RA 4EQ9A 1FTKA 5BUUA 1A40A 5I56B 3WAEA 2OLBA 1B0HA 1LSTA 1Q35A 3SERA 3K4UA 4JXIA 2DE3A 4ZE8A 3VLWA 1B0LA 4DCXA 1XHYA 5L9SA 3CIJA 4UACA
chains in the Genus database with same CATH superfamily
1P1NA 1ZTYA 3PPOA 3F11A 1QKBA 4PETA 3DP6A 3K6UA 4MHFA 3GZGA 3TEPA 1LBZA 1HSEA 3DP8A 5L9MA 1FPBA 3TFLA 1G0IA 2PBWA 3B6WA 3JZJA 5H8HA 3CRBA 4EXKA 2XXPA 4O3BA 4I8CA 3EHSA 1QVSA 4F29A 2P0SA 4ZS9A 2ZZVA 4Q0CA 5DVJA 1NNKA 3UA8A 3GBAA 1MPBA 2UVHA 4MH5A 2GHBA 2R6GE 2HPGA 2UXAA 1M5EA 3MVWA 3VE1B 3VXCA 1MXZA 3Q28A 2Q8JA 4QXDA 2VPOA 1FPEA 5F1QA 1NUXA 4WKMA 4HCWA 1FQBA 1NH8A 4R2BA 3ZS6A 4XTCQ 2QSXA 4FEBA 4XKNA 3LV0A 3W9VA 4MLVA 5EQ9A 3U93A 2V3QA 1GTKA 2PT2A 4HS7A 2Z23A 2DQVA 4OEVA 4FEDA 4OHNA 2XX8A 4HTGA 1LB9A 3M3FA 3IJOB 3CFLA 1XC1A 4KCDA 4OVSA 4LUBA 3MUQA 5M2VA 1URGA 4H0WA 4L17A 5H8FA 4DE8A 4KCCA 2Y7PA 1SBPA 3MZ1A 4NG7A 3G3IA 4GQOA 3IR1A 1QGXA 1LGBC 2QS4A 1NV5A 1B2HA 4QF9A 1B7UA 3N6UA 1MH3A 4O3CA 3GYYA 4FATA 1IXHA 1MXVA 4RY1A 4Q5TA 3BBRA 4NF5B 4BDLA 4QHQA 2W7YA 1DBZA 2RINA 3I3VA 4JBZA 2F7BA 2Y5LA 4R2FA 4U2RA 4NGUA 3G3HA 5T3JA 3EPEA 3PV0E 4PP0A 3N26A 1POY1 3H4ZA 5I58B 4I3EA 2FA7A 4LP2B 2FHYA 4U4XA 1NV0A 4YB5A 5H8NB 3MPKA 5ISUA 1PEBA 1URDA 3T66A 1B6HA 3H06B 3QYTA 2FIEA 2XXIA 1FTJA 2YLNA 3FD3A 4GWOA 3IOVA 3ILUB 2XXHA 1JQFA 2I3VA 5FHOA 2JJKA 1KA0A 1QJMA 2ZNSA 3OSQA 2ANJA 2I58A 2P1SA 2VD3A 1CNQA 1MM6A 2DS9A 4R9GA 2AL4A 3RPLB 2PMSA 4LZ8A 2PT1A 4NF6B 3W9WA 1UIVA 2XXQA 2XD2A 3T9VA 4KFQA 4KQPA 3HO7A 1EH3A 2O7IA 4JSDA 3KJTA 5ELVA 2RCBA 4N6KA 5F24A 1Y1MA 1SPIA 3SEUA 4KYDA 1LCTA 4XKPA 3IOTA 3CSBA 3K01A 1INPA 1FTLA 4IO7A 2OWTA 3QUJA 1IZ1A 1QKAA 3KG2A 4OVPA 3OELA 3CVGA 3QMFA 5DW8A 3BFTA 4G68B 1SW5A 1I6AA 4NWCA 2XXUA 2KR0A 1YZ0A 1FQFA 4N8YA 4OEUA 2FYIA 4O3AA 1QW0A 2ONKE 5AA1A 4FIMA 1VR5A 3PD9A 2H5YA 2XHDA 4Q30B 2OZZA 5I56A 1Y20A 4GD5A 4OQOA 4OXVA 1BIYA 1NKXA 4G2ZA 1QUIA 1FQAA 2ALUA 2AIXA 4X1BA 2O1MA 5L9OA 4OETA 5H8SA 5TU0A 1B4HA 5EHMA 3TAJA 3CI8A 4H67A 2CZHA 1YXIA 3DLNA 2I3WA 5CMMA 4H6DA 2O69A 3KC0A 1SYIA 4ELQA 4H46A 3KN7A 2XXRA 3TZAA 3FBPA 1FBDA 2ZNUA 3USDA 3Q27A 1ZMGA 4NX1A 4TLLB 4C1TA 1BKAA 1LB8A 1MY1A 3I6VA 4PFWA 5TPAB 4U21A 3T22A 3PMXA 1K9YA 3FJ7A 1IEJA 2HHMA 2GRVA 2PVUA 1VDWA 2V3TA 1H44A 3H7MA 1JNFA 3T0JA 4GFRA 3IO6A 4MNCA 1Y3QA 2QPQA 4F1UA 1CE2A 1MQJA 4MCOA 4RK2A 4F1YA 1JEUA 3SZPA 1IMBA 4H8IA 3C33A 3RTFB 3RNNA 3C31A 3O6GA 1M5FA 1UIUA 4OVRA 3KSXA 1YYZA 1NV2A 1EZOA 3U8QA 1BTJA 1ATGA 1BK4A 5EHSA 1IXGA 2F8DA 5ICQA 4IO6A 4MJOA 1M5CA 1N76A 1FPKA 1N84A 3MPLA 3S2VA 3H6UA 4F39A 4N8GA 2G93A 1LCFA 5A5XB 1B58A 1Y4CA 1IUDA 4JDFA 3MWBA 3OEKA 4M1VA 1JP4A 3LUYA 4EF2A 5HM4B 3PPPA 3PUVE 5I2NB 5ICTA 4GIZA 1MDP1 3PUYE 4WEDA 1NV4A 1LBBA 4N4UA 1NUWA 3U94A 1NUZA 2WEFA 3MVYA 5LTCA 1TFAA 3S9EA 3OOAA 4O7IA 5K2YA 5I84A 1SD3A 3HSTA 3KJ7A 4TLMB 2GH9A 1POTA 3FV1A 4O8MA 4MFIA 4R9FA 3MAMA 4ZE9A 3OD7A 1PBPA 1JW5A 3O29A 1URSA 5AA2B 3C4MA 3L6HA 2PX1A 2ZNTA 5KDTB 4ZZAA 4TQUQ 4DZ1A 4PFUA 3MW0A 3U72A 1XT8A 1B05A 3M3KA 4PDDA 2ESNA 2R71A 5AE4A 2KQZA 5IZ3B 1FCKA 2F97A 1M5BA 1JW1A 2A5TB 2D21A 5A5LA 2XWKA 2QFLA 1JEVA 5H8NA 2DE4A 3TCHA 3TMGA 1DCUA 2YJPA 3C9HA 3EKIA 5JTYA 3K0VA 5I5PA 1KWHA 4YAHX 1B7ZA 3C34A 3SDFA 3H6VA 3KZGA 4ELRA 3KEIA 1RDZA 5IAIA 1P1OA 3V89B 2HXWA 3RGYA 1OVBA 4G61A 4N6PA 3RPLA 1UTHB 1B40A 4MIJA 3E3KA 5BWJA 4NF6A 3LSWA 3SEYA 4IB2A 1FPDA 1S9TA 4NWDA 1NL5A 3UORA 3TTKA 3IFAA 4G4PA 1N04A 4N17A 3K02A 3MQ9A 1H43A 1SW2A 1B3LA 2VT5A 3FVOA 1AH5A 1Y1ZA 4FORA 4GWXA 4ELPA 4Z7EA 4POXA 4ZZEA 1MXYA 2D3IA 4OENA 1SDXA 2MKZA 1TFDA 3K2DA 2QS1A 3IL1B 2H99A 5IZ1A 3K1NA 3TUSA 2P3VA 4NF0A 4KD5A 4RNSA 4XXUA 1NV1A 3KN3A 4G68A 3M8UA 1LFIA 5AA4B 3C35A 4OA4A 1MXXA 5ESYA 3IAZA 1EYKA 3PMWA 2F36A 1OLCA 4XKRA 1FPIA 5CMBA 4YMBA 5I2KA 2DWHA 4ISUA 3K1PA 1LEVA 3B6TA 2OCUA 3TODA 5EQAA 3CG1A 4AB6A 3C36A 1L5TA 4RPOA 1ZKBA 1B3GA 4E0XA 1ZU0A 3K1MA 3TQLA 5B7DA 3CG3A 1YAEA 1MXWA 3OEMA 4QBAA 3EQ1A 1LFHA 5CM6A 1D9YA 2FIXA 1MQHA 4OFJA 1Z7ME 3OXNA 5JEIA 2B4MA 2THIA 5CBRA 4P1LA 3T93B 2DXRA 1D4NA 3CFXA 5H8QB 3L6GA 4PC9A 1S50A 4MNPA 4R74A 5TPAA 2HZLA 1EZ9A 3TQWA 2HZKA 2B3BA 2QVRA 1DPPA 2V84A 2HCAA 4R73A 4JVDA 2YPNA 4JWXA 1FQEA 5KCJB 4PFTA 4QSEA 3B50A 1FTOA 2GHAA 5L8DA 2UYEA 1MG1A 5TP9B 2UVGA 1SQYA 4LQ2A 3ONMA 2BJJX 5DVIA 1PB9A 2UVIA 3KGCA 2XXVA 4HE1A 3KFMA 1WDNA 1SW1A 3FXBA 1UTBB 2R8TA 2HAUA 3B8BA 1RDXA 4OMBA 4BDRA 4EF1A 4LA9A 4XKQA 4R75A 3T96B 4F2QA 4GLIA 4JVIA 5EYFA 1A7LA 4BDNA 4PTKA 2FNCA 1GGGA 1OLAA 4RJZA 2V4CA 3FXUA 1JETA 2DDKA 2O7UA 4YKIA 1OIBA 4EQ7A 4EUOA 4C1UA 4ESXA 3QIMA 3FVNA 4NE4A 3PUWE 1J1NA 4PBHA 5LOMA 5A5XA 2FBPA 2CEXA 2UYFA 4OFLA 1A8EA 4OVJA 3LR1A 5I2NA 1MH4A 3MP8A 2CZLA 2PYYA 3HCQA 2I48A 4P3LA 2P2AA 4ZEKA 3HPIA 1MPCA 1UQWA 2I49A 3V8XB 4OTEA 1EZPA 3GXAA 1K9ZA 2XXTA 1IMAA 2WYKA 1N7WA 4F31B 2OK2A 3FJMA 4F3PA 2HQ0A 4DIGA 2V3UA 4R72A 3TPAA 3TTMA 1R9QA 4P0IA 5I3SA 5AA2A 3LC8A 4O7MA 2L5VA 3PPQA 4NF8A 4DXUA 3PPRA 4YU0A 2XWIA 4GWWA 1LBVA 1O7TA 5KDTA 4U1ZA 1NNFA 5HBCA 1QULA 4LZ5A 1Y3PA 3IOWA 2IEEA 4XIGQ 4R6KA 2OWSA 1XOCA 2V25A 2Z8DA 5IZ3A 4YZZA 2A5TA 3KC1A 4PFYA 1FPGA 2VOZA 1LAHE 1R6ZA 2NOOA 3Q25A 4RPNA 1LLSA 4EQBA 4OANA 1RDYA 5J16A 2Z22A 3FUZA 4NTLA 2ZYKA 1B5JA 4ZEFA 4GWSA 1H76A 3DP4A 1XVXA 3DELB 1I6QA 2Z8FA 1H3DA 3H3GA 4X48A 1FTMA 1O64A 4PAIA 1UTHA 3OO9A 4GX4A 5EYGA 3MVXA 3MBPA 1AOVA 5CMKA 1H45A 3I5OA 4ZECA 4PCDA 4OERA 2H9BA 2OX3A 1IMCA 4C0RA 1LBCA 1MM7A 5FTHA 4YMAA 2DWJA 1ELJA 3RQTA 1FRPA 2OBGA 4PF8A 5IGAA 4PFIA 3UGWA 2VGQA 1NUYA 4THIA 3D4CA 5DEXB 3S9LC 4IO2A 3O97A 4P11A 4PGPA 4OWDA 1SI0A 4P47A 1MS7A 4P56A 5CRYA 3ROJA 1B3EA 3BFUA 4GWUA 2B4LA 1IQ7A 1YPNA 5AA4A 2REGA 4KPTA 4F22A 1YTVA 5ET8A 1FBCA 3ZSFA 1Y4TA 4NN3A 3V83A 1KZ8A 2ZMBA 4PE5B 2X7PA 1P1WA 3FASA 1US4A 3SESA 5IZZA 2O6AA 2WKYA 4RK9A 4ZDMA 2PCRA 4LZ7A 3B6QA 3QUFA 1FQCA 4MEVA 4H8JA 4MF3A 2F3BA 3TELA 3PUZE 1IIWA 1B7HA 3K6XA 4FAJA 3JYRA 4GWYA 1YCJA 1TXFA 4JVCA 2GQ1A 4TOZA 1A8FA 1G0HA 1F9BA 1MQIA 2H98A 1NV6A 2RC9A 1DSNA 4LVQA 5I57B 1A55A 4N91A 4PBQA 1USYH 5AA2D 2I4CA 1FBGA 2HAVA 3P7IA 3LSFB 4PDHA 2ZYNA 2I4BA 5FHMA 2XD3A 4OESA 5IKBA 3FVKA 1O63A 1NNPA 1IMDA 4PF6A 4QFKA 1VE4A 2OJTA 1FW0A 1CB6A 4G8NA 3S9MC 2HFBA 5KCJA 4POWA 3FVGA 2XXYA 3U65A 5TP9A 2F5XA 4JWOA 3MVZA 1LAFE 3KOSA 3PPNA 4KYEA 4H5GA 1NNTA 3O66A 3RN8A 4OZ9A 4PGNA 3VVFA 1UTBA 4G8HA 3MP1A 4GOTA 3VXBA 2CEYA 4BDMA 3CHGA 3ILTB 3PGFA 1B1HA 2DWIA 2G29A 4NF5A 1ANFA 1VFDA 2NUVA 3IO4A 3SEVA 3ECRA 1TT1A 1VSOA 2QL3A 3BIGA 2Q88A 4QFLA 5K2XA 4N81A 2HEUA 3T1BA 3SEXA 2UVJA 1LAGE 4GL0A 4YICA 5I58A 2Y5KA 3E4RA 1JW4A 3ODBA 4P0GA 1MY4A 4YKKA 3RTWB 3PU5A 5AA3A 1NI9A 4GVOA 2O51A 1OQGA 2F78A 4H5FA 2Q74A 1OVTA 3R26A 4I3YA 3SKPA 1A54A 3R7XA 4G68C 4QSCA 4KHZE 3ISPA 4K3FA 3ZKKA 4YB6A 3MYUA 4N07A 1MY2A 3TTNA 4ONYA 3OO6A 3GLBA 3EHUA 4GF8A 4QFNA 1QUKA 3Q29A 1B51A 5HPQA 4IY5A 3IB2A 2F35A 2E0SA 3KSJA 3HHFA 5JK4A 5I59B 2H25A 2NVUB 4P9KA 2DE2A 2QRYA 2DYXA 3UK4A 4HE0A 3IK6B 4JSOA 2ZXTA 3G3KA 3H03A 4KR5A 4DLDA 2ONSA 3VLVA 3T9HB 1MY3A 2IA4A 3ZKLA 4ELOA 2O84X 3VFJA 2RKMA 4BDQA 3EHTA 1MY0A 2Y7IA 1R9LA 1LBYA 3OSRA 1HSJA 4OFOA 4KI0E 5LDZA 3EF7A 3U92A 2I6EA 4QFPA 3IORA 1D9VA 4ESWA 4F1VA 1S7YA 2I0BA 4ND9A 3H6WA 2GFEA 4HE2A 1DPEA 4JWYA 4F19A 1A99A 2RC7A 1XS5A 3CR9A 2DSFA 1P1QA 1LAXA 4ECFA 1Y3NA 5CBSA 4F3SA 3Q26A 1FBEA 3RT8A 2QS3A 5FTIA 1NV3A 1DTGA 3IX1A 3KBRA 3MZ9A 3A29A 3FV2A 3E78A 3A09A 1US5A 5EQ7A 4YB7A 1R1NA 1P99A 2BJIA 4FE8A 2QVVA 3TDJA 3N94A 1FSAA 2DWAA 4X9TA 4H65A 2WYPA 3THIA 3IB0A 4LATA 2F7AA 4PAKA 5DEXA 2RCAA 4OYVA 2WBDA 4F3GA 3E13X 1M5DA 2QJEA 4Z0IA 1NFTA 4IO5A 3DM0A 2B3FA 3WAFA 3A3UA 4MBPA 2ABHA 1VFEA 2WBBA 5CMCA 1PB7A 2V93A 2FVZA 4G8MA 4NMYA 3HN0A 4P1EA 4XEQA 4DCYA 5B70A 4DI4B 4IO3A 2F6PA 5ET5A 4M4GA 3R6UA 1FQDA 4KXPA 2RF1A 3V5AA 4RA1A 4R6YA 1PB8A 4LQ5A 4NF4B 3JV9A 4RXLA 3HFUA 3UN6A 4HCYA 1Y9UA 4LN5A 3PMVA 4MX6A 1NV7A 4WXJA 3LSLA 4BLAA 2A5SA 1MPDA 1N7XA 4G77A 4HXVA 3G3JA 1LBWA 2I0CA 4AS5A 3FIRA 2Y84A 1HSLA 4U4SA 1B9JA 5I57A 3TTRA 2F3DA 3MJNA 1FBFA 2ZYOA 1ZJLA 2AL5A 2DP8A 3OO8A 4GWZA 1USYE 4I9DA 3KBZA 4X8RA 4NQ8A 4N6DA 5EYHA 5IM2A 2XWVA 5ITPA 4I1DA 4DXBA 5JTYB 3RPWA 1AIVA 2KLFA 3LBSA 4DDDA 1D9QA 1OQHA 2DVCA 3A3CA 3BIHA 1FPLA 4E0WA 2XX9A 1WVJA 3FATA 3QAXA 1B3HA 1DTZA 3BKIB 1PC3A 3HV1A 1EU8A 4YKPA 1FPJA 2XXXA 1B32A 1SW4A 3RLFE 3RYDA 5DT6A 3VV5A 3VVDA 4XF5A 5FHNA 3O6HA 4EDPA 1MRPA 1Q9DA 3AXFA 1EYIA 4F3BA 1GV8A 5J1DA 2ONRA 4GX3A 4NEDA 3E79A 1BP5A 2XXKA 4JB7A 4LONB 2QVUA 3O28A 4I40A 2NXOA 3QK6A 1ZBMA 2F34A 3S9NC 3CFZA 4QFOA 3CSGA 1MDQA 5H8HB 2CZIA 1AL3A 3OMBA 3VLUA 1RYXA 4MLQA 3FJGA 2REJA 2VD2A 2Z8EA 3H6TA 3O6IA 4EXLA 3IB1A 1AWBA 2RC8A 1OMPA 3T9XB 4UA8A 4H1XA 2XXWA 5CI5A 2VPNA 1Q1KA 2F6GA 1B5HA 2X26A 3IJXB 5I2KB 3TCGA 2B65A 1LFGA 2WX9A 2Y7WA 1AMFA 1D3KA 5EQ8A 1IMEA 5I59A 2X7QA 4U1OA 1II5A 1I69A 2Q2AA 1B3FA 3TYHA 2Q9TA 1IITA 3IFCA 2D5WA 2OWZA 3GBBA 4I62A 4FBPA 1KA1A 3U1OA 1PDAA 2QMXA 3K6VA 4R6HA 1SYHA 4WEPA 4AS4A 2M8CA 3E9XA 2PFYA 1Z7NE 3FXQA 1SVXB 3PD8A 3QXMA 4MNIA 3QSLA 3K00A 4ZEDA 1MQDA 1NH7A 1QUJA 4PFBA 4XFEA 3TCFA 2Q2CA 5DTBA 1DK4A 2XA5A 3D1RA 5DVFA 2P3NA 3G7WA 3SETA 5H8FB 1FJ6A 3MZBA 5FBPA 4AB5A 2Q89A 4HW8A 4GRKA 2VHAA 4IO4A 1DOTA 1SI1A 4PAFA 4PFRA 1WODA 3N6TA 1MQGA 4N15A 1JVYA 2VP1A 3G3FA 1B4ZA 3RT6B 3KN8A 3MC2A 5F7VA 1FPFA 4X04A 1ZIUA 4F2OA 1FBHA 2NWJA 3S4UA 5ET7A 1MXUA 3PUXE 3B7DA 2QMWA 1B46A 3FZVA 1N0TA 3FGSA 3UIFA 2Q8MA 1XVYA 1TWYA 3MP6A 5H8QA 4DI3D 4GBVA 3TKDA 4RYAA 4FJPA 1GVCA 3PTYA 4ZEBA 2LAOA 4GXSB 3LSXA 2CZKA 5DYHA 1N3WA 4F18A 4GX6A 4NAPA 3RY3A 2PFZA 4N13A 4MAGA 2ZZXA 4QSDA 4AQ4A 1RYOA 3C32A 3HHGA 4U23A 3O2AA 2F7CA 1DMBA 3D4GA 4IY6A 3TTLA 1XI6A 3T9UA 4IGTA 4IGRA 1T0KA 4IR8A 1ZLQA 3NOHA 4ZEIA 1NMUA 1IXIA 5I7IA 3N5LA 4KYSA 4YKJA 3W15C 1I6BA 4GXAA 4NF4A 4UABA 3KOTA 3OO7A 2O1LA 2DXYA 4GBWA 2HXRA 4FECA 4OVQA 4H45A 5ITOA 4NF8B 3FXRA 4X1DA 1PBQA 3M3LA 3IOUA 2XWOA 4GL8A 1P1UA 1N3XA 4DXCA 1B1XA 4OVTA 2XX7A 2QS2A 2ZYMA 3SEWA 4Q8RA 2AYSA 4QRZA 2CMOA 2O68A 3VVEA 1IMFA 2DOJA 1IXCA 2DVZA 2R9JA 4P8BA 3RUMA 1GR2A 2E1SA 3OENA 4U22A 1RKMA 3EN3A 5KZTA 4PQJA 1B5IA 1BLFA 3G3GA 4BDOA 5CC2A 1FBPA 2Y7KA 3VDFA 1FTAA 1JVXA 3UP9A 3K6WA 3O9PA 2H4IA 1B52A 2Y7RA 4EQ9A 1FTKA 5BUUA 1A40A 5I56B 3MSTA 3WAEA 2OLBA 4NHBA 3LUZA 1FJ9A 1B0HA 1EYJA 1LSTA 1Q35A 4PE3A 2ZZWA 3SERA 5ET6A 3K4UA 4JXIA 2DE3A 4ZE8A 4O94A 3VLWA 1LBXA 4MMPA 1B0LA 4DCXA 1XHYA 5L9SA 3CIJA 4UACA
chains in the Genus database with same CATH topology
1P1NA 1ZTYA 3PPOA 3F11A 1QKBA 4PETA 3DP6A 3K6UA 3GZGA 3TEPA 1HSEA 3DP8A 5L9MA 3TFLA 2PBWA 3B6WA 3JZJA 5H8HA 3CRBA 4EXKA 2XXPA 4O3BA 4I8CA 3EHSA 1QVSA 4F29A 2P0SA 4ZS9A 4Q0CA 5DVJA 1NNKA 3UA8A 3GBAA 1MPBA 2UVHA 4MH5A 2GHBA 2R6GE 2UXAA 1M5EA 3MVWA 3VE1B 3VXCA 1MXZA 3Q28A 2Q8JA 5F1QA 4WKMA 4HCWA 1FQBA 1NH8A 4R2BA 3ZS6A 4XTCQ 2QSXA 4FEBA 4XKNA 3W9VA 4MLVA 3U93A 2V3QA 1GTKA 2PT2A 4HS7A 2Z23A 2DQVA 4OEVA 4FEDA 4OHNA 2XX8A 4HTGA 1LB9A 3M3FA 3IJOB 3CFLA 1XC1A 4KCDA 4LUBA 3MUQA 5M2VA 1URGA 4H0WA 4L17A 5H8FA 4DE8A 4KCCA 2Y7PA 1SBPA 3MZ1A 3G3IA 4GQOA 3IR1A 1LGBC 2QS4A 1B2HA 4QF9A 1B7UA 3N6UA 1MH3A 4O3CA 4FATA 1IXHA 1MXVA 4RY1A 4Q5TA 3BBRA 4NF5B 4BDLA 4QHQA 2W7YA 2RINA 3I3VA 4JBZA 2F7BA 4R2FA 4U2RA 3G3HA 3EPEA 3PV0E 4PP0A 3N26A 1POY1 3H4ZA 5I58B 2FA7A 4LP2B 4U4XA 4YB5A 5H8NB 3MPKA 5ISUA 1PEBA 1URDA 3T66A 1B6HA 3H06B 3QYTA 2XXIA 1FTJA 2YLNA 3FD3A 4GWOA 3IOVA 3ILUB 2XXHA 1JQFA 2I3VA 5FHOA 1QJMA 2ZNSA 3OSQA 2ANJA 2I58A 2P1SA 2VD3A 1MM6A 2DS9A 4R9GA 2AL4A 2PMSA 4LZ8A 2PT1A 4NF6B 3W9WA 1UIVA 2XXQA 2XD2A 3T9VA 4KFQA 4KQPA 3HO7A 1EH3A 2O7IA 4JSDA 3KJTA 5ELVA 2RCBA 1Y1MA 3SEUA 4KYDA 1LCTA 4XKPA 3IOTA 3CSBA 3K01A 1FTLA 4IO7A 2OWTA 3QUJA 1IZ1A 1QKAA 3KG2A 3OELA 3CVGA 3BFTA 4G68B 1SW5A 1I6AA 4NWCA 2XXUA 1FQFA 4OEUA 2FYIA 4O3AA 1QW0A 2ONKE 5AA1A 4FIMA 1VR5A 3PD9A 2H5YA 2XHDA 4Q30B 2OZZA 5I56A 1Y20A 4GD5A 4OQOA 4OXVA 1BIYA 1NKXA 4G2ZA 1QUIA 2ALUA 1FQAA 2AIXA 4X1BA 2O1MA 5L9OA 4OETA 5H8SA 5TU0A 1B4HA 5EHMA 3TAJA 3CI8A 4H67A 3DLNA 2I3WA 5CMMA 4H6DA 2O69A 1SYIA 4ELQA 3KN7A 2XXRA 3TZAA 2ZNUA 3USDA 3Q27A 1ZMGA 4TLLB 4C1TA 1BKAA 1LB8A 1MY1A 3I6VA 4PFWA 5TPAB 4U21A 3T22A 3PMXA 3FJ7A 1IEJA 2GRVA 2PVUA 2V3TA 1H44A 3H7MA 1JNFA 4GFRA 3IO6A 1Y3QA 2QPQA 4F1UA 1CE2A 1MQJA 4RK2A 4F1YA 1JEUA 4H8IA 3C33A 3RTFB 3RNNA 3C31A 3O6GA 1M5FA 1UIUA 3KSXA 1EZOA 3U8QA 1BTJA 1ATGA 5EHSA 1IXGA 2F8DA 5ICQA 4IO6A 1M5CA 1N76A 1N84A 3MPLA 3S2VA 3H6UA 4F39A 2G93A 1LCFA 5A5XB 1B58A 1Y4CA 1IUDA 4JDFA 3MWBA 3OEKA 4M1VA 3LUYA 4EF2A 5HM4B 3PPPA 3PUVE 5I2NB 5ICTA 4GIZA 1MDP1 3PUYE 4WEDA 1LBBA 3U94A 3MVYA 1TFAA 3S9EA 3OOAA 5K2YA 5I84A 1SD3A 3HSTA 3KJ7A 4TLMB 2GH9A 1POTA 3FV1A 4MFIA 4R9FA 3MAMA 4ZE9A 3OD7A 1PBPA 1JW5A 3O29A 1URSA 5AA2B 3C4MA 3L6HA 2PX1A 2ZNTA 5KDTB 4ZZAA 4TQUQ 4DZ1A 4PFUA 3MW0A 3U72A 1XT8A 1B05A 3M3KA 2ESNA 2R71A 5AE4A 1FCKA 2F97A 1M5BA 1JW1A 2A5TB 2D21A 1JEVA 5H8NA 2DE4A 3TCHA 3TMGA 2YJPA 3C9HA 5JTYA 3K0VA 1KWHA 4YAHX 1B7ZA 3C34A 3SDFA 3H6VA 3KZGA 4ELRA 3KEIA 5IAIA 1P1OA 3V89B 2HXWA 3RGYA 1OVBA 4N6PA 1UTHB 1B40A 3E3KA 5BWJA 4NF6A 3LSWA 3SEYA 4IB2A 1S9TA 4NWDA 1NL5A 3UORA 3TTKA 4G4PA 1N04A 3K02A 3MQ9A 1H43A 1SW2A 1B3LA 3FVOA 1AH5A 1Y1ZA 4FORA 4ELPA 4Z7EA 4POXA 4ZZEA 1MXYA 2D3IA 4OENA 1SDXA 1TFDA 3K2DA 2QS1A 3IL1B 2H99A 3K1NA 3TUSA 4KD5A 4RNSA 4XXUA 3KN3A 4G68A 3M8UA 1LFIA 5AA4B 3C35A 1MXXA 3IAZA 3PMWA 2F36A 1OLCA 4XKRA 5CMBA 4YMBA 5I2KA 2DWHA 4ISUA 3K1PA 3B6TA 2OCUA 3TODA 3CG1A 4AB6A 3C36A 1L5TA 4RPOA 1ZKBA 1B3GA 4E0XA 1ZU0A 3K1MA 3TQLA 5B7DA 3CG3A 1YAEA 1MXWA 3OEMA 3EQ1A 1LFHA 5CM6A 1D9YA 1MQHA 4OFJA 1Z7ME 3OXNA 5JEIA 2THIA 5CBRA 3T93B 2DXRA 1D4NA 3CFXA 5H8QB 3L6GA 1S50A 4R74A 5TPAA 2HZLA 1EZ9A 3TQWA 2HZKA 2B3BA 1DPPA 2V84A 2HCAA 4R73A 2YPNA 4JWXA 1FQEA 5KCJB 4PFTA 4QSEA 1FTOA 2GHAA 5L8DA 2UYEA 1MG1A 5TP9B 2UVGA 1SQYA 4LQ2A 3ONMA 2BJJX 5DVIA 1PB9A 2UVIA 3KGCA 2XXVA 3KFMA 1WDNA 1SW1A 1UTBB 2HAUA 4OMBA 4BDRA 4EF1A 4LA9A 4XKQA 4R75A 3T96B 4F2QA 4GLIA 5EYFA 1A7LA 4BDNA 2FNCA 1GGGA 1OLAA 4RJZA 3FXUA 1JETA 2O7UA 4YKIA 1OIBA 4EQ7A 4EUOA 4C1UA 4ESXA 3QIMA 3FVNA 4NE4A 3PUWE 1J1NA 5LOMA 5A5XA 2UYFA 4OFLA 1A8EA 4OVJA 3LR1A 5I2NA 1MH4A 3MP8A 2CZLA 2PYYA 3HCQA 2I48A 2P2AA 4ZEKA 3HPIA 1MPCA 1UQWA 2I49A 3V8XB 4OTEA 1EZPA 3GXAA 2XXTA 1N7WA 4F31B 2OK2A 3FJMA 4F3PA 2HQ0A 4DIGA 2V3UA 4R72A 3TPAA 3TTMA 1R9QA 4P0IA 5AA2A 3LC8A 3PPQA 4NF8A 4DXUA 3PPRA 4YU0A 1O7TA 5KDTA 4U1ZA 1NNFA 5HBCA 1QULA 4LZ5A 1Y3PA 3IOWA 2IEEA 4XIGQ 4R6KA 2OWSA 1XOCA 2V25A 2Z8DA 4YZZA 2A5TA 4PFYA 2VOZA 1LAHE 1R6ZA 2NOOA 3Q25A 4RPNA 1LLSA 4EQBA 2Z22A 3FUZA 4NTLA 2ZYKA 1B5JA 4ZEFA 1H76A 3DP4A 1XVXA 3DELB 1I6QA 2Z8FA 1H3DA 3H3GA 4X48A 1FTMA 1O64A 1UTHA 3OO9A 3MVXA 3MBPA 1AOVA 5CMKA 1H45A 3I5OA 4ZECA 4OERA 2H9BA 4C0RA 1LBCA 1MM7A 5FTHA 4YMAA 2DWJA 1ELJA 3RQTA 2OBGA 3UGWA 2VGQA 4THIA 3D4CA 5DEXB 3S9LC 4IO2A 3O97A 4P11A 4OWDA 1SI0A 1MS7A 5CRYA 1B3EA 3BFUA 1IQ7A 1YPNA 5AA4A 2REGA 4KPTA 4F22A 1YTVA 3ZSFA 1Y4TA 3V83A 2ZMBA 4PE5B 2X7PA 1P1WA 3FASA 1US4A 3SESA 2O6AA 2WKYA 4RK9A 4ZDMA 4LZ7A 3B6QA 3QUFA 1FQCA 4H8JA 4MF3A 3TELA 3PUZE 1IIWA 1B7HA 3K6XA 4FAJA 3JYRA 1YCJA 1TXFA 4TOZA 1A8FA 1F9BA 1MQIA 2H98A 2RC9A 1DSNA 4LVQA 5I57B 1A55A 1USYH 5AA2D 2I4CA 2HAVA 3P7IA 3LSFB 2ZYNA 2I4BA 5FHMA 2XD3A 4OESA 5IKBA 3FVKA 1O63A 1NNPA 4QFKA 1VE4A 2OJTA 1FW0A 1CB6A 4G8NA 3S9MC 2HFBA 5KCJA 4POWA 3FVGA 2XXYA 5TP9A 2F5XA 4JWOA 3MVZA 1LAFE 3KOSA 3PPNA 4KYEA 4H5GA 1NNTA 3O66A 3RN8A 4OZ9A 3VVFA 1UTBA 4G8HA 3MP1A 4GOTA 3VXBA 4BDMA 3ILTB 3PGFA 1B1HA 2DWIA 2G29A 4NF5A 1ANFA 1VFDA 2NUVA 3IO4A 3SEVA 3ECRA 1TT1A 1VSOA 2QL3A 2Q88A 4QFLA 5K2XA 2HEUA 3SEXA 2UVJA 1LAGE 4GL0A 4YICA 5I58A 3E4RA 1JW4A 3ODBA 4P0GA 1MY4A 4YKKA 3RTWB 3PU5A 5AA3A 4GVOA 2O51A 1OQGA 2F78A 4H5FA 1OVTA 3R26A 3SKPA 1A54A 3R7XA 4G68C 4QSCA 4KHZE 4K3FA 3ZKKA 4YB6A 4N07A 1MY2A 3TTNA 4ONYA 3OO6A 3GLBA 3EHUA 4GF8A 4QFNA 1QUKA 3Q29A 1B51A 5HPQA 4IY5A 3IB2A 2F35A 2E0SA 3KSJA 3HHFA 5JK4A 5I59B 2H25A 2NVUB 2DE2A 2QRYA 2DYXA 3UK4A 3IK6B 4JSOA 2ZXTA 3G3KA 3H03A 4KR5A 4DLDA 2ONSA 3VLVA 3T9HB 1MY3A 2IA4A 3ZKLA 4ELOA 2O84X 3VFJA 2RKMA 4BDQA 3EHTA 1MY0A 2Y7IA 1R9LA 3OSRA 1HSJA 4OFOA 4KI0E 3EF7A 3U92A 2I6EA 4QFPA 3IORA 1D9VA 4ESWA 4F1VA 1S7YA 2I0BA 4ND9A 3H6WA 2GFEA 1DPEA 4JWYA 4F19A 1A99A 2RC7A 1XS5A 3CR9A 2DSFA 1P1QA 1LAXA 4ECFA 1Y3NA 5CBSA 4F3SA 3Q26A 3RT8A 2QS3A 5FTIA 1DTGA 3IX1A 3KBRA 3MZ9A 3FV2A 3A09A 1US5A 4YB7A 1R1NA 1P99A 4FE8A 3TDJA 3N94A 2DWAA 4X9TA 4H65A 3THIA 3IB0A 4LATA 2F7AA 5DEXA 2RCAA 4OYVA 4F3GA 3E13X 1M5DA 2QJEA 4Z0IA 1NFTA 4IO5A 3DM0A 2B3FA 3WAFA 3A3UA 4MBPA 2ABHA 1VFEA 5CMCA 1PB7A 2V93A 4G8MA 4NMYA 3HN0A 4DCYA 5B70A 4IO3A 2F6PA 4M4GA 3R6UA 1FQDA 2RF1A 3V5AA 4RA1A 4R6YA 1PB8A 4LQ5A 4NF4B 3JV9A 4RXLA 3UN6A 4HCYA 1Y9UA 3PMVA 4WXJA 3LSLA 4BLAA 2A5SA 1MPDA 1N7XA 4G77A 3G3JA 2I0CA 3FIRA 2Y84A 1HSLA 4U4SA 1B9JA 5I57A 3TTRA 3MJNA 2ZYOA 1ZJLA 2AL5A 2DP8A 3OO8A 1USYE 4I9DA 5ITPA 4I1DA 4DXBA 5JTYB 3RPWA 1AIVA 2KLFA 3LBSA 4DDDA 1OQHA 2DVCA 3A3CA 4E0WA 2XX9A 1WVJA 3FATA 3QAXA 1B3HA 1DTZA 3BKIB 1PC3A 3HV1A 1EU8A 4YKPA 2XXXA 1B32A 1SW4A 3RLFE 5DT6A 3VV5A 3VVDA 5FHNA 3O6HA 4EDPA 1MRPA 3AXFA 5J1DA 4F3BA 1GV8A 2ONRA 4NEDA 1BP5A 4JB7A 4LONB 3O28A 2NXOA 3QK6A 1ZBMA 2F34A 3S9NC 3CFZA 4QFOA 3CSGA 1MDQA 5H8HB 1AL3A 3OMBA 3VLUA 1RYXA 4MLQA 3FJGA 2REJA 2VD2A 2Z8EA 3H6TA 3O6IA 4EXLA 3IB1A 2RC8A 1OMPA 3T9XB 4UA8A 4H1XA 2XXWA 5CI5A 1Q1KA 2F6GA 1B5HA 2X26A 3IJXB 5I2KB 3TCGA 2B65A 1LFGA 2Y7WA 1AMFA 1D3KA 5I59A 2X7QA 4U1OA 1II5A 1I69A 2Q2AA 1B3FA 3TYHA 2Q9TA 1IITA 2D5WA 3GBBA 4I62A 3U1OA 1PDAA 2QMXA 3K6VA 4R6HA 1SYHA 4WEPA 2M8CA 3E9XA 1Z7NE 3FXQA 1SVXB 3PD8A 3QXMA 3QSLA 3K00A 4ZEDA 1MQDA 1NH7A 1QUJA 3TCFA 2Q2CA 5DTBA 5DVFA 3G7WA 3SETA 5H8FB 3MZBA 4AB5A 2Q89A 4HW8A 4GRKA 2VHAA 4IO4A 1DOTA 1SI1A 1WODA 3N6TA 1MQGA 1JVYA 2VP1A 3G3FA 1B4ZA 3RT6B 3KN8A 3MC2A 5F7VA 1ZIUA 4F2OA 2NWJA 3S4UA 1MXUA 3PUXE 3B7DA 2QMWA 1B46A 3FZVA 1N0TA 3FGSA 3UIFA 1XVYA 1TWYA 3MP6A 5H8QA 3TKDA 4RYAA 4FJPA 1GVCA 4ZEBA 2LAOA 4GXSB 3LSXA 5DYHA 1N3WA 4F18A 3RY3A 4N13A 4QSDA 4AQ4A 1RYOA 3C32A 3HHGA 4U23A 3O2AA 2F7CA 1DMBA 3D4GA 4IY6A 3TTLA 3T9UA 4IGTA 4IGRA 1T0KA 1ZLQA 4ZEIA 1NMUA 1IXIA 3N5LA 4KYSA 4YKJA 3W15C 1I6BA 4GXAA 4NF4A 3KOTA 3OO7A 2O1LA 2DXYA 4FECA 5ITOA 4NF8B 3FXRA 4X1DA 1PBQA 3M3LA 3IOUA 4GL8A 1P1UA 1N3XA 4DXCA 1B1XA 2XX7A 2QS2A 2ZYMA 3SEWA 4Q8RA 2AYSA 4QRZA 2CMOA 2O68A 3VVEA 2DOJA 1IXCA 2DVZA 2R9JA 3RUMA 1GR2A 2E1SA 3OENA 4U22A 1RKMA 3EN3A 5KZTA 4PQJA 1B5IA 1BLFA 3G3GA 4BDOA 5CC2A 2Y7KA 3VDFA 1JVXA 3UP9A 3K6WA 3O9PA 2H4IA 1B52A 2Y7RA 4EQ9A 1FTKA 5BUUA 1A40A 5I56B 3WAEA 2OLBA 1B0HA 1LSTA 1Q35A 3SERA 3K4UA 4JXIA 2DE3A 4ZE8A 3VLWA 1B0LA 4DCXA 1XHYA 5L9SA 3CIJA 4UACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P1N A;  1ZTY A;  3PPO A;  3F11 A;  1QKB A;  4PET A;  3DP6 A;  3K6U A;  3GZG A;  3TEP A;  1HSE A;  3DP8 A;  5L9M A;  3TFL A;  2PBW A;  3B6W A;  3JZJ A;  5H8H A;  3CRB A;  4EXK A;  2XXP A;  4O3B A;  4I8C A;  3EHS A;  1QVS A;  4F29 A;  2P0S A;  4ZS9 A;  4Q0C A;  5DVJ A;  1NNK A;  3UA8 A;  3GBA A;  1MPB A;  2UVH A;  4MH5 A;  2GHB A;  2R6G E;  2UXA A;  1M5E A;  3MVW A;  3VE1 B;  3VXC A;  1MXZ A;  3Q28 A;  2Q8J A;  5F1Q A;  4WKM A;  4HCW A;  1FQB A;  1NH8 A;  4R2B A;  3ZS6 A;  4XTC Q;  2QSX A;  4FEB A;  4XKN A;  3W9V A;  4MLV A;  3U93 A;  2V3Q A;  1GTK A;  2PT2 A;  4HS7 A;  2Z23 A;  2DQV A;  4OEV A;  4FED A;  4OHN A;  2XX8 A;  4HTG A;  1LB9 A;  3M3F A;  3IJO B;  3CFL A;  1XC1 A;  4KCD A;  4LUB A;  3MUQ A;  5M2V A;  1URG A;  4H0W A;  4L17 A;  5H8F A;  4DE8 A;  4KCC A;  2Y7P A;  1SBP A;  3MZ1 A;  3G3I A;  4GQO A;  3IR1 A;  1LGB C;  2QS4 A;  1B2H A;  4QF9 A;  1B7U A;  3N6U A;  1MH3 A;  4O3C A;  4FAT A;  1IXH A;  1MXV A;  4RY1 A;  4Q5T A;  3BBR A;  4NF5 B;  4BDL A;  4QHQ A;  2W7Y A;  2RIN A;  3I3V A;  4JBZ A;  2F7B A;  4R2F A;  4U2R A;  3G3H A;  3EPE A;  3PV0 E;  4PP0 A;  3N26 A;  1POY 1;  3H4Z A;  5I58 B;  2FA7 A;  4LP2 B;  4U4X A;  4YB5 A;  5H8N B;  3MPK A;  5ISU A;  1PEB A;  1URD A;  3T66 A;  1B6H A;  3H06 B;  3QYT A;  2XXI A;  1FTJ A;  2YLN A;  3FD3 A;  4GWO A;  3IOV A;  3ILU B;  2XXH A;  1JQF A;  2I3V A;  5FHO A;  1QJM A;  2ZNS A;  3OSQ A;  2ANJ A;  2I58 A;  2P1S A;  2VD3 A;  1MM6 A;  2DS9 A;  4R9G A;  2AL4 A;  2PMS A;  4LZ8 A;  2PT1 A;  4NF6 B;  3W9W A;  1UIV A;  2XXQ A;  2XD2 A;  3T9V A;  4KFQ A;  4KQP A;  3HO7 A;  1EH3 A;  2O7I A;  4JSD A;  3KJT A;  5ELV A;  2RCB A;  1Y1M A;  3SEU A;  4KYD A;  1LCT A;  4XKP A;  3IOT A;  3CSB A;  3K01 A;  1FTL A;  4IO7 A;  2OWT A;  3QUJ A;  1IZ1 A;  1QKA A;  3KG2 A;  3OEL A;  3CVG A;  3BFT A;  4G68 B;  1SW5 A;  1I6A A;  4NWC A;  2XXU A;  1FQF A;  4OEU A;  2FYI A;  4O3A A;  1QW0 A;  2ONK E;  5AA1 A;  4FIM A;  1VR5 A;  3PD9 A;  2H5Y A;  2XHD A;  4Q30 B;  2OZZ A;  5I56 A;  1Y20 A;  4GD5 A;  4OQO A;  4OXV A;  1BIY A;  1NKX A;  4G2Z A;  1QUI A;  2ALU A;  1FQA A;  2AIX A;  4X1B A;  2O1M A;  5L9O A;  4OET A;  5H8S A;  5TU0 A;  1B4H A;  5EHM A;  3TAJ A;  3CI8 A;  4H67 A;  3DLN A;  2I3W A;  5CMM A;  4H6D A;  2O69 A;  1SYI A;  4ELQ A;  3KN7 A;  2XXR A;  3TZA A;  2ZNU A;  3USD A;  3Q27 A;  1ZMG A;  4TLL B;  4C1T A;  1BKA A;  1LB8 A;  1MY1 A;  3I6V A;  4PFW A;  5TPA B;  4U21 A;  3T22 A;  3PMX A;  3FJ7 A;  1IEJ A;  2GRV A;  2PVU A;  2V3T A;  1H44 A;  3H7M A;  1JNF A;  4GFR A;  3IO6 A;  1Y3Q A;  2QPQ A;  4F1U A;  1CE2 A;  1MQJ A;  4RK2 A;  4F1Y A;  1JEU A;  4H8I A;  3C33 A;  3RTF B;  3RNN A;  3C31 A;  3O6G A;  1M5F A;  1UIU A;  3KSX A;  1EZO A;  3U8Q A;  1BTJ A;  1ATG A;  5EHS A;  1IXG A;  2F8D A;  5ICQ A;  4IO6 A;  1M5C A;  1N76 A;  1N84 A;  3MPL A;  3S2V A;  3H6U A;  4F39 A;  2G93 A;  1LCF A;  5A5X B;  1B58 A;  1Y4C A;  1IUD A;  4JDF A;  3MWB A;  3OEK A;  4M1V A;  3LUY A;  4EF2 A;  5HM4 B;  3PPP A;  3PUV E;  5I2N B;  5ICT A;  4GIZ A;  1MDP 1;  3PUY E;  4WED A;  1LBB A;  3U94 A;  3MVY A;  1TFA A;  3S9E A;  3OOA A;  5K2Y A;  5I84 A;  1SD3 A;  3HST A;  3KJ7 A;  4TLM B;  2GH9 A;  1POT A;  3FV1 A;  4MFI A;  4R9F A;  3MAM A;  4ZE9 A;  3OD7 A;  1PBP A;  1JW5 A;  3O29 A;  1URS A;  5AA2 B;  3C4M A;  3L6H A;  2PX1 A;  2ZNT A;  5KDT B;  4ZZA A;  4TQU Q;  4DZ1 A;  4PFU A;  3MW0 A;  3U72 A;  1XT8 A;  1B05 A;  3M3K A;  2ESN A;  2R71 A;  5AE4 A;  1FCK A;  2F97 A;  1M5B A;  1JW1 A;  2A5T B;  2D21 A;  1JEV A;  5H8N A;  2DE4 A;  3TCH A;  3TMG A;  2YJP A;  3C9H A;  5JTY A;  3K0V A;  1KWH A;  4YAH X;  1B7Z A;  3C34 A;  3SDF A;  3H6V A;  3KZG A;  4ELR A;  3KEI A;  5IAI A;  1P1O A;  3V89 B;  2HXW A;  3RGY A;  1OVB A;  4N6P A;  1UTH B;  1B40 A;  3E3K A;  5BWJ A;  4NF6 A;  3LSW A;  3SEY A;  4IB2 A;  1S9T A;  4NWD A;  1NL5 A;  3UOR A;  3TTK A;  4G4P A;  1N04 A;  3K02 A;  3MQ9 A;  1H43 A;  1SW2 A;  1B3L A;  3FVO A;  1AH5 A;  1Y1Z A;  4FOR A;  4ELP A;  4Z7E A;  4POX A;  4ZZE A;  1MXY A;  2D3I A;  4OEN A;  1SDX A;  1TFD A;  3K2D A;  2QS1 A;  3IL1 B;  2H99 A;  3K1N A;  3TUS A;  4KD5 A;  4RNS A;  4XXU A;  3KN3 A;  4G68 A;  3M8U A;  1LFI A;  5AA4 B;  3C35 A;  1MXX A;  3IAZ A;  3PMW A;  2F36 A;  1OLC A;  4XKR A;  5CMB A;  4YMB A;  5I2K A;  2DWH A;  4ISU A;  3K1P A;  3B6T A;  2OCU A;  3TOD A;  3CG1 A;  4AB6 A;  3C36 A;  1L5T A;  4RPO A;  1ZKB A;  1B3G A;  4E0X A;  1ZU0 A;  3K1M A;  3TQL A;  5B7D A;  3CG3 A;  1YAE A;  1MXW A;  3OEM A;  3EQ1 A;  1LFH A;  5CM6 A;  1D9Y A;  1MQH A;  4OFJ A;  1Z7M E;  3OXN A;  5JEI A;  2THI A;  5CBR A;  3T93 B;  2DXR A;  1D4N A;  3CFX A;  5H8Q B;  3L6G A;  1S50 A;  4R74 A;  5TPA A;  2HZL A;  1EZ9 A;  3TQW A;  2HZK A;  2B3B A;  1DPP A;  2V84 A;  2HCA A;  4R73 A;  2YPN A;  4JWX A;  1FQE A;  5KCJ B;  4PFT A;  4QSE A;  1FTO A;  2GHA A;  5L8D A;  2UYE A;  1MG1 A;  5TP9 B;  2UVG A;  1SQY A;  4LQ2 A;  3ONM A;  2BJJ X;  5DVI A;  1PB9 A;  2UVI A;  3KGC A;  2XXV A;  3KFM A;  1WDN A;  1SW1 A;  1UTB B;  2HAU A;  4OMB A;  4BDR A;  4EF1 A;  4LA9 A;  4XKQ A;  4R75 A;  3T96 B;  4F2Q A;  4GLI A;  5EYF A;  1A7L A;  4BDN A;  2FNC A;  1GGG A;  1OLA A;  4RJZ A;  3FXU A;  1JET A;  2O7U A;  4YKI A;  1OIB A;  4EQ7 A;  4EUO A;  4C1U A;  4ESX A;  3QIM A;  3FVN A;  4NE4 A;  3PUW E;  1J1N A;  5LOM A;  5A5X A;  2UYF A;  4OFL A;  1A8E A;  4OVJ A;  3LR1 A;  5I2N A;  1MH4 A;  3MP8 A;  2CZL A;  2PYY A;  3HCQ A;  2I48 A;  2P2A A;  4ZEK A;  3HPI A;  1MPC A;  1UQW A;  2I49 A;  3V8X B;  4OTE A;  1EZP A;  3GXA A;  2XXT A;  1N7W A;  4F31 B;  2OK2 A;  3FJM A;  4F3P A;  2HQ0 A;  4DIG A;  2V3U A;  4R72 A;  3TPA A;  3TTM A;  1R9Q A;  4P0I A;  5AA2 A;  3LC8 A;  3PPQ A;  4NF8 A;  4DXU A;  3PPR A;  4YU0 A;  1O7T A;  5KDT A;  4U1Z A;  1NNF A;  5HBC A;  1QUL A;  4LZ5 A;  1Y3P A;  3IOW A;  2IEE A;  4XIG Q;  4R6K A;  2OWS A;  1XOC A;  2V25 A;  2Z8D A;  4YZZ A;  2A5T A;  4PFY A;  2VOZ A;  1LAH E;  1R6Z A;  2NOO A;  3Q25 A;  4RPN A;  1LLS A;  4EQB A;  2Z22 A;  3FUZ A;  4NTL A;  2ZYK A;  1B5J A;  4ZEF A;  1H76 A;  3DP4 A;  1XVX A;  3DEL B;  1I6Q A;  2Z8F A;  1H3D A;  3H3G A;  4X48 A;  1FTM A;  1O64 A;  1UTH A;  3OO9 A;  3MVX A;  3MBP A;  1AOV A;  5CMK A;  1H45 A;  3I5O A;  4ZEC A;  4OER A;  2H9B A;  4C0R A;  1LBC A;  1MM7 A;  5FTH A;  4YMA A;  2DWJ A;  1ELJ A;  3RQT A;  2OBG A;  3UGW A;  2VGQ A;  4THI A;  3D4C A;  5DEX B;  3S9L C;  4IO2 A;  3O97 A;  4P11 A;  4OWD A;  1SI0 A;  1MS7 A;  5CRY A;  1B3E A;  3BFU A;  1IQ7 A;  1YPN A;  5AA4 A;  2REG A;  4KPT A;  4F22 A;  1YTV A;  3ZSF A;  1Y4T A;  3V83 A;  2ZMB A;  4PE5 B;  2X7P A;  1P1W A;  3FAS A;  1US4 A;  3SES A;  2O6A A;  2WKY A;  4RK9 A;  4ZDM A;  4LZ7 A;  3B6Q A;  3QUF A;  1FQC A;  4H8J A;  4MF3 A;  3TEL A;  3PUZ E;  1IIW A;  1B7H A;  3K6X A;  4FAJ A;  3JYR A;  1YCJ A;  1TXF A;  4TOZ A;  1A8F A;  1F9B A;  1MQI A;  2H98 A;  2RC9 A;  1DSN A;  4LVQ A;  5I57 B;  1A55 A;  1USY H;  5AA2 D;  2I4C A;  2HAV A;  3P7I A;  3LSF B;  2ZYN A;  2I4B A;  5FHM A;  2XD3 A;  4OES A;  5IKB A;  3FVK A;  1O63 A;  1NNP A;  4QFK A;  1VE4 A;  2OJT A;  1FW0 A;  1CB6 A;  4G8N A;  3S9M C;  2HFB A;  5KCJ A;  4POW A;  3FVG A;  2XXY A;  5TP9 A;  2F5X A;  4JWO A;  3MVZ A;  1LAF E;  3KOS A;  3PPN A;  4KYE A;  4H5G A;  1NNT A;  3O66 A;  3RN8 A;  4OZ9 A;  3VVF A;  1UTB A;  4G8H A;  3MP1 A;  4GOT A;  3VXB A;  4BDM A;  3ILT B;  3PGF A;  1B1H A;  2DWI A;  2G29 A;  4NF5 A;  1ANF A;  1VFD A;  2NUV A;  3IO4 A;  3SEV A;  3ECR A;  1TT1 A;  1VSO A;  2QL3 A;  2Q88 A;  4QFL A;  5K2X A;  2HEU A;  3SEX A;  2UVJ A;  1LAG E;  4GL0 A;  4YIC A;  5I58 A;  3E4R A;  1JW4 A;  3ODB A;  4P0G A;  1MY4 A;  4YKK A;  3RTW B;  3PU5 A;  5AA3 A;  4GVO A;  2O51 A;  1OQG A;  2F78 A;  4H5F A;  1OVT A;  3R26 A;  3SKP A;  1A54 A;  3R7X A;  4G68 C;  4QSC A;  4KHZ E;  4K3F A;  3ZKK A;  4YB6 A;  4N07 A;  1MY2 A;  3TTN A;  4ONY A;  3OO6 A;  3GLB A;  3EHU A;  4GF8 A;  4QFN A;  1QUK A;  3Q29 A;  1B51 A;  5HPQ A;  4IY5 A;  3IB2 A;  2F35 A;  2E0S A;  3KSJ A;  3HHF A;  5JK4 A;  5I59 B;  2H25 A;  2NVU B;  2DE2 A;  2QRY A;  2DYX A;  3UK4 A;  3IK6 B;  4JSO A;  2ZXT A;  3G3K A;  3H03 A;  4KR5 A;  4DLD A;  2ONS A;  3VLV A;  3T9H B;  1MY3 A;  2IA4 A;  3ZKL A;  4ELO A;  2O84 X;  3VFJ A;  2RKM A;  4BDQ A;  3EHT A;  1MY0 A;  2Y7I A;  1R9L A;  3OSR A;  1HSJ A;  4OFO A;  4KI0 E;  3EF7 A;  3U92 A;  2I6E A;  4QFP A;  3IOR A;  1D9V A;  4ESW A;  4F1V A;  1S7Y A;  2I0B A;  4ND9 A;  3H6W A;  2GFE A;  1DPE A;  4JWY A;  4F19 A;  1A99 A;  2RC7 A;  1XS5 A;  3CR9 A;  2DSF A;  1P1Q A;  1LAX A;  4ECF A;  1Y3N A;  5CBS A;  4F3S A;  3Q26 A;  3RT8 A;  2QS3 A;  5FTI A;  1DTG A;  3IX1 A;  3KBR A;  3MZ9 A;  3FV2 A;  3A09 A;  1US5 A;  4YB7 A;  1R1N A;  1P99 A;  4FE8 A;  3TDJ A;  3N94 A;  2DWA A;  4X9T A;  4H65 A;  3THI A;  3IB0 A;  4LAT A;  2F7A A;  5DEX A;  2RCA A;  4OYV A;  4F3G A;  3E13 X;  1M5D A;  2QJE A;  4Z0I A;  1NFT A;  4IO5 A;  3DM0 A;  2B3F A;  3WAF A;  3A3U A;  4MBP A;  2ABH A;  1VFE A;  5CMC A;  1PB7 A;  2V93 A;  4G8M A;  4NMY A;  3HN0 A;  4DCY A;  5B70 A;  4IO3 A;  2F6P A;  4M4G A;  3R6U A;  1FQD A;  2RF1 A;  3V5A A;  4RA1 A;  4R6Y A;  1PB8 A;  4LQ5 A;  4NF4 B;  3JV9 A;  4RXL A;  3UN6 A;  4HCY A;  1Y9U A;  3PMV A;  4WXJ A;  3LSL A;  4BLA A;  2A5S A;  1MPD A;  1N7X A;  4G77 A;  3G3J A;  2I0C A;  3FIR A;  2Y84 A;  1HSL A;  4U4S A;  1B9J A;  5I57 A;  3TTR A;  3MJN A;  2ZYO A;  1ZJL A;  2AL5 A;  2DP8 A;  3OO8 A;  1USY E;  4I9D A;  5ITP A;  4I1D A;  4DXB A;  5JTY B;  3RPW A;  1AIV A;  2KLF A;  3LBS A;  4DDD A;  1OQH A;  2DVC A;  3A3C A;  4E0W A;  2XX9 A;  1WVJ A;  3FAT A;  3QAX A;  1B3H A;  1DTZ A;  3BKI B;  1PC3 A;  3HV1 A;  1EU8 A;  4YKP A;  2XXX A;  1B32 A;  1SW4 A;  3RLF E;  5DT6 A;  3VV5 A;  3VVD A;  5FHN A;  3O6H A;  4EDP A;  1MRP A;  3AXF A;  5J1D A;  4F3B A;  1GV8 A;  2ONR A;  4NED A;  1BP5 A;  4JB7 A;  4LON B;  3O28 A;  2NXO A;  3QK6 A;  1ZBM A;  2F34 A;  3S9N C;  3CFZ A;  4QFO A;  3CSG A;  1MDQ A;  5H8H B;  1AL3 A;  3OMB A;  3VLU A;  1RYX A;  4MLQ A;  3FJG A;  2REJ A;  2VD2 A;  2Z8E A;  3H6T A;  3O6I A;  4EXL A;  3IB1 A;  2RC8 A;  1OMP A;  3T9X B;  4UA8 A;  4H1X A;  2XXW A;  5CI5 A;  1Q1K A;  2F6G A;  1B5H A;  2X26 A;  3IJX B;  5I2K B;  3TCG A;  2B65 A;  1LFG A;  2Y7W A;  1AMF A;  1D3K A;  5I59 A;  2X7Q A;  4U1O A;  1II5 A;  1I69 A;  2Q2A A;  1B3F A;  3TYH A;  2Q9T A;  1IIT A;  2D5W A;  3GBB A;  4I62 A;  3U1O A;  1PDA A;  2QMX A;  3K6V A;  4R6H A;  1SYH A;  4WEP A;  2M8C A;  3E9X A;  1Z7N E;  3FXQ A;  1SVX B;  3PD8 A;  3QXM A;  3QSL A;  3K00 A;  4ZED A;  1MQD A;  1NH7 A;  1QUJ A;  3TCF A;  2Q2C A;  5DTB A;  5DVF A;  3G7W A;  3SET A;  5H8F B;  3MZB A;  4AB5 A;  2Q89 A;  4HW8 A;  4GRK A;  2VHA A;  4IO4 A;  1DOT A;  1SI1 A;  1WOD A;  3N6T A;  1MQG A;  1JVY A;  2VP1 A;  3G3F A;  1B4Z A;  3RT6 B;  3KN8 A;  3MC2 A;  5F7V A;  1ZIU A;  4F2O A;  2NWJ A;  3S4U A;  1MXU A;  3PUX E;  3B7D A;  2QMW A;  1B46 A;  3FZV A;  1N0T A;  3FGS A;  3UIF A;  1XVY A;  1TWY A;  3MP6 A;  5H8Q A;  3TKD A;  4RYA A;  4FJP A;  1GVC A;  4ZEB A;  2LAO A;  4GXS B;  3LSX A;  5DYH A;  1N3W A;  4F18 A;  3RY3 A;  4N13 A;  4QSD A;  4AQ4 A;  1RYO A;  3C32 A;  3HHG A;  4U23 A;  3O2A A;  2F7C A;  1DMB A;  3D4G A;  4IY6 A;  3TTL A;  3T9U A;  4IGT A;  4IGR A;  1T0K A;  1ZLQ A;  4ZEI A;  1NMU A;  1IXI A;  3N5L A;  4KYS A;  4YKJ A;  3W15 C;  1I6B A;  4GXA A;  4NF4 A;  3KOT A;  3OO7 A;  2O1L A;  2DXY A;  4FEC A;  5ITO A;  4NF8 B;  3FXR A;  4X1D A;  1PBQ A;  3M3L A;  3IOU A;  4GL8 A;  1P1U A;  1N3X A;  4DXC A;  1B1X A;  2XX7 A;  2QS2 A;  2ZYM A;  3SEW A;  4Q8R A;  2AYS A;  4QRZ A;  2CMO A;  2O68 A;  3VVE A;  2DOJ A;  1IXC A;  2DVZ A;  2R9J A;  3RUM A;  1GR2 A;  2E1S A;  3OEN A;  4U22 A;  1RKM A;  3EN3 A;  5KZT A;  4PQJ A;  1B5I A;  1BLF A;  3G3G A;  4BDO A;  5CC2 A;  2Y7K A;  3VDF A;  1JVX A;  3UP9 A;  3K6W A;  3O9P A;  2H4I A;  1B52 A;  2Y7R A;  4EQ9 A;  1FTK A;  5BUU A;  1A40 A;  5I56 B;  3WAE A;  2OLB A;  1B0H A;  1LST A;  1Q35 A;  3SER A;  3K4U A;  4JXI A;  2DE3 A;  4ZE8 A;  3VLW A;  1B0L A;  4DCX A;  1XHY A;  5L9S A;  3CIJ A;  4UAC A; 
#chains in the Genus database with same CATH topology
 1P1N A;  1ZTY A;  3PPO A;  3F11 A;  1QKB A;  4PET A;  3DP6 A;  3K6U A;  4MHF A;  3GZG A;  3TEP A;  1LBZ A;  1HSE A;  3DP8 A;  5L9M A;  1FPB A;  3TFL A;  1G0I A;  2PBW A;  3B6W A;  3JZJ A;  5H8H A;  3CRB A;  4EXK A;  2XXP A;  4O3B A;  4I8C A;  3EHS A;  1QVS A;  4F29 A;  2P0S A;  4ZS9 A;  2ZZV A;  4Q0C A;  5DVJ A;  1NNK A;  3UA8 A;  3GBA A;  1MPB A;  2UVH A;  4MH5 A;  2GHB A;  2R6G E;  2HPG A;  2UXA A;  1M5E A;  3MVW A;  3VE1 B;  3VXC A;  1MXZ A;  3Q28 A;  2Q8J A;  4QXD A;  2VPO A;  1FPE A;  5F1Q A;  1NUX A;  4WKM A;  4HCW A;  1FQB A;  1NH8 A;  4R2B A;  3ZS6 A;  4XTC Q;  2QSX A;  4FEB A;  4XKN A;  3LV0 A;  3W9V A;  4MLV A;  5EQ9 A;  3U93 A;  2V3Q A;  1GTK A;  2PT2 A;  4HS7 A;  2Z23 A;  2DQV A;  4OEV A;  4FED A;  4OHN A;  2XX8 A;  4HTG A;  1LB9 A;  3M3F A;  3IJO B;  3CFL A;  1XC1 A;  4KCD A;  4OVS A;  4LUB A;  3MUQ A;  5M2V A;  1URG A;  4H0W A;  4L17 A;  5H8F A;  4DE8 A;  4KCC A;  2Y7P A;  1SBP A;  3MZ1 A;  4NG7 A;  3G3I A;  4GQO A;  3IR1 A;  1QGX A;  1LGB C;  2QS4 A;  1NV5 A;  1B2H A;  4QF9 A;  1B7U A;  3N6U A;  1MH3 A;  4O3C A;  3GYY A;  4FAT A;  1IXH A;  1MXV A;  4RY1 A;  4Q5T A;  3BBR A;  4NF5 B;  4BDL A;  4QHQ A;  2W7Y A;  1DBZ A;  2RIN A;  3I3V A;  4JBZ A;  2F7B A;  2Y5L A;  4R2F A;  4U2R A;  4NGU A;  3G3H A;  5T3J A;  3EPE A;  3PV0 E;  4PP0 A;  3N26 A;  1POY 1;  3H4Z A;  5I58 B;  4I3E A;  2FA7 A;  4LP2 B;  2FHY A;  4U4X A;  1NV0 A;  4YB5 A;  5H8N B;  3MPK A;  5ISU A;  1PEB A;  1URD A;  3T66 A;  1B6H A;  3H06 B;  3QYT A;  2FIE A;  2XXI A;  1FTJ A;  2YLN A;  3FD3 A;  4GWO A;  3IOV A;  3ILU B;  2XXH A;  1JQF A;  2I3V A;  5FHO A;  2JJK A;  1KA0 A;  1QJM A;  2ZNS A;  3OSQ A;  2ANJ A;  2I58 A;  2P1S A;  2VD3 A;  1CNQ A;  1MM6 A;  2DS9 A;  4R9G A;  2AL4 A;  3RPL B;  2PMS A;  4LZ8 A;  2PT1 A;  4NF6 B;  3W9W A;  1UIV A;  2XXQ A;  2XD2 A;  3T9V A;  4KFQ A;  4KQP A;  3HO7 A;  1EH3 A;  2O7I A;  4JSD A;  3KJT A;  5ELV A;  2RCB A;  4N6K A;  5F24 A;  1Y1M A;  1SPI A;  3SEU A;  4KYD A;  1LCT A;  4XKP A;  3IOT A;  3CSB A;  3K01 A;  1INP A;  1FTL A;  4IO7 A;  2OWT A;  3QUJ A;  1IZ1 A;  1QKA A;  3KG2 A;  4OVP A;  3OEL A;  3CVG A;  3QMF A;  5DW8 A;  3BFT A;  4G68 B;  1SW5 A;  1I6A A;  4NWC A;  2XXU A;  2KR0 A;  1YZ0 A;  1FQF A;  4N8Y A;  4OEU A;  2FYI A;  4O3A A;  1QW0 A;  2ONK E;  5AA1 A;  4FIM A;  1VR5 A;  3PD9 A;  2H5Y A;  2XHD A;  4Q30 B;  2OZZ A;  5I56 A;  1Y20 A;  4GD5 A;  4OQO A;  4OXV A;  1BIY A;  1NKX A;  4G2Z A;  1QUI A;  1FQA A;  2ALU A;  2AIX A;  4X1B A;  2O1M A;  5L9O A;  4OET A;  5H8S A;  5TU0 A;  1B4H A;  5EHM A;  3TAJ A;  3CI8 A;  4H67 A;  2CZH A;  1YXI A;  3DLN A;  2I3W A;  5CMM A;  4H6D A;  2O69 A;  3KC0 A;  1SYI A;  4ELQ A;  4H46 A;  3KN7 A;  2XXR A;  3TZA A;  3FBP A;  1FBD A;  2ZNU A;  3USD A;  3Q27 A;  1ZMG A;  4NX1 A;  4TLL B;  4C1T A;  1BKA A;  1LB8 A;  1MY1 A;  3I6V A;  4PFW A;  5TPA B;  4U21 A;  3T22 A;  3PMX A;  1K9Y A;  3FJ7 A;  1IEJ A;  2HHM A;  2GRV A;  2PVU A;  1VDW A;  2V3T A;  1H44 A;  3H7M A;  1JNF A;  3T0J A;  4GFR A;  3IO6 A;  4MNC A;  1Y3Q A;  2QPQ A;  4F1U A;  1CE2 A;  1MQJ A;  4MCO A;  4RK2 A;  4F1Y A;  1JEU A;  3SZP A;  1IMB A;  4H8I A;  3C33 A;  3RTF B;  3RNN A;  3C31 A;  3O6G A;  1M5F A;  1UIU A;  4OVR A;  3KSX A;  1YYZ A;  1NV2 A;  1EZO A;  3U8Q A;  1BTJ A;  1ATG A;  1BK4 A;  5EHS A;  1IXG A;  2F8D A;  5ICQ A;  4IO6 A;  4MJO A;  1M5C A;  1N76 A;  1FPK A;  1N84 A;  3MPL A;  3S2V A;  3H6U A;  4F39 A;  4N8G A;  2G93 A;  1LCF A;  5A5X B;  1B58 A;  1Y4C A;  1IUD A;  4JDF A;  3MWB A;  3OEK A;  4M1V A;  1JP4 A;  3LUY A;  4EF2 A;  5HM4 B;  3PPP A;  3PUV E;  5I2N B;  5ICT A;  4GIZ A;  1MDP 1;  3PUY E;  4WED A;  1NV4 A;  1LBB A;  4N4U A;  1NUW A;  3U94 A;  1NUZ A;  2WEF A;  3MVY A;  5LTC A;  1TFA A;  3S9E A;  3OOA A;  4O7I A;  5K2Y A;  5I84 A;  1SD3 A;  3HST A;  3KJ7 A;  4TLM B;  2GH9 A;  1POT A;  3FV1 A;  4O8M A;  4MFI A;  4R9F A;  3MAM A;  4ZE9 A;  3OD7 A;  1PBP A;  1JW5 A;  3O29 A;  1URS A;  5AA2 B;  3C4M A;  3L6H A;  2PX1 A;  2ZNT A;  5KDT B;  4ZZA A;  4TQU Q;  4DZ1 A;  4PFU A;  3MW0 A;  3U72 A;  1XT8 A;  1B05 A;  3M3K A;  4PDD A;  2ESN A;  2R71 A;  5AE4 A;  2KQZ A;  5IZ3 B;  1FCK A;  2F97 A;  1M5B A;  1JW1 A;  2A5T B;  2D21 A;  5A5L A;  2XWK A;  2QFL A;  1JEV A;  5H8N A;  2DE4 A;  3TCH A;  3TMG A;  1DCU A;  2YJP A;  3C9H A;  3EKI A;  5JTY A;  3K0V A;  5I5P A;  1KWH A;  4YAH X;  1B7Z A;  3C34 A;  3SDF A;  3H6V A;  3KZG A;  4ELR A;  3KEI A;  1RDZ A;  5IAI A;  1P1O A;  3V89 B;  2HXW A;  3RGY A;  1OVB A;  4G61 A;  4N6P A;  3RPL A;  1UTH B;  1B40 A;  4MIJ A;  3E3K A;  5BWJ A;  4NF6 A;  3LSW A;  3SEY A;  4IB2 A;  1FPD A;  1S9T A;  4NWD A;  1NL5 A;  3UOR A;  3TTK A;  3IFA A;  4G4P A;  1N04 A;  4N17 A;  3K02 A;  3MQ9 A;  1H43 A;  1SW2 A;  1B3L A;  2VT5 A;  3FVO A;  1AH5 A;  1Y1Z A;  4FOR A;  4GWX A;  4ELP A;  4Z7E A;  4POX A;  4ZZE A;  1MXY A;  2D3I A;  4OEN A;  1SDX A;  2MKZ A;  1TFD A;  3K2D A;  2QS1 A;  3IL1 B;  2H99 A;  5IZ1 A;  3K1N A;  3TUS A;  2P3V A;  4NF0 A;  4KD5 A;  4RNS A;  4XXU A;  1NV1 A;  3KN3 A;  4G68 A;  3M8U A;  1LFI A;  5AA4 B;  3C35 A;  4OA4 A;  1MXX A;  5ESY A;  3IAZ A;  1EYK A;  3PMW A;  2F36 A;  1OLC A;  4XKR A;  1FPI A;  5CMB A;  4YMB A;  5I2K A;  2DWH A;  4ISU A;  3K1P A;  1LEV A;  3B6T A;  2OCU A;  3TOD A;  5EQA A;  3CG1 A;  4AB6 A;  3C36 A;  1L5T A;  4RPO A;  1ZKB A;  1B3G A;  4E0X A;  1ZU0 A;  3K1M A;  3TQL A;  5B7D A;  3CG3 A;  1YAE A;  1MXW A;  3OEM A;  4QBA A;  3EQ1 A;  1LFH A;  5CM6 A;  1D9Y A;  2FIX A;  1MQH A;  4OFJ A;  1Z7M E;  3OXN A;  5JEI A;  2B4M A;  2THI A;  5CBR A;  4P1L A;  3T93 B;  2DXR A;  1D4N A;  3CFX A;  5H8Q B;  3L6G A;  4PC9 A;  1S50 A;  4MNP A;  4R74 A;  5TPA A;  2HZL A;  1EZ9 A;  3TQW A;  2HZK A;  2B3B A;  2QVR A;  1DPP A;  2V84 A;  2HCA A;  4R73 A;  4JVD A;  2YPN A;  4JWX A;  1FQE A;  5KCJ B;  4PFT A;  4QSE A;  3B50 A;  1FTO A;  2GHA A;  5L8D A;  2UYE A;  1MG1 A;  5TP9 B;  2UVG A;  1SQY A;  4LQ2 A;  3ONM A;  2BJJ X;  5DVI A;  1PB9 A;  2UVI A;  3KGC A;  2XXV A;  4HE1 A;  3KFM A;  1WDN A;  1SW1 A;  3FXB A;  1UTB B;  2R8T A;  2HAU A;  3B8B A;  1RDX A;  4OMB A;  4BDR A;  4EF1 A;  4LA9 A;  4XKQ A;  4R75 A;  3T96 B;  4F2Q A;  4GLI A;  4JVI A;  5EYF A;  1A7L A;  4BDN A;  4PTK A;  2FNC A;  1GGG A;  1OLA A;  4RJZ A;  2V4C A;  3FXU A;  1JET A;  2DDK A;  2O7U A;  4YKI A;  1OIB A;  4EQ7 A;  4EUO A;  4C1U A;  4ESX A;  3QIM A;  3FVN A;  4NE4 A;  3PUW E;  1J1N A;  4PBH A;  5LOM A;  5A5X A;  2FBP A;  2CEX A;  2UYF A;  4OFL A;  1A8E A;  4OVJ A;  3LR1 A;  5I2N A;  1MH4 A;  3MP8 A;  2CZL A;  2PYY A;  3HCQ A;  2I48 A;  4P3L A;  2P2A A;  4ZEK A;  3HPI A;  1MPC A;  1UQW A;  2I49 A;  3V8X B;  4OTE A;  1EZP A;  3GXA A;  1K9Z A;  2XXT A;  1IMA A;  2WYK A;  1N7W A;  4F31 B;  2OK2 A;  3FJM A;  4F3P A;  2HQ0 A;  4DIG A;  2V3U A;  4R72 A;  3TPA A;  3TTM A;  1R9Q A;  4P0I A;  5I3S A;  5AA2 A;  3LC8 A;  4O7M A;  2L5V A;  3PPQ A;  4NF8 A;  4DXU A;  3PPR A;  4YU0 A;  2XWI A;  4GWW A;  1LBV A;  1O7T A;  5KDT A;  4U1Z A;  1NNF A;  5HBC A;  1QUL A;  4LZ5 A;  1Y3P A;  3IOW A;  2IEE A;  4XIG Q;  4R6K A;  2OWS A;  1XOC A;  2V25 A;  2Z8D A;  5IZ3 A;  4YZZ A;  2A5T A;  3KC1 A;  4PFY A;  1FPG A;  2VOZ A;  1LAH E;  1R6Z A;  2NOO A;  3Q25 A;  4RPN A;  1LLS A;  4EQB A;  4OAN A;  1RDY A;  5J16 A;  2Z22 A;  3FUZ A;  4NTL A;  2ZYK A;  1B5J A;  4ZEF A;  4GWS A;  1H76 A;  3DP4 A;  1XVX A;  3DEL B;  1I6Q A;  2Z8F A;  1H3D A;  3H3G A;  4X48 A;  1FTM A;  1O64 A;  4PAI A;  1UTH A;  3OO9 A;  4GX4 A;  5EYG A;  3MVX A;  3MBP A;  1AOV A;  5CMK A;  1H45 A;  3I5O A;  4ZEC A;  4PCD A;  4OER A;  2H9B A;  2OX3 A;  1IMC A;  4C0R A;  1LBC A;  1MM7 A;  5FTH A;  4YMA A;  2DWJ A;  1ELJ A;  3RQT A;  1FRP A;  2OBG A;  4PF8 A;  5IGA A;  4PFI A;  3UGW A;  2VGQ A;  1NUY A;  4THI A;  3D4C A;  5DEX B;  3S9L C;  4IO2 A;  3O97 A;  4P11 A;  4PGP A;  4OWD A;  1SI0 A;  4P47 A;  1MS7 A;  4P56 A;  5CRY A;  3ROJ A;  1B3E A;  3BFU A;  4GWU A;  2B4L A;  1IQ7 A;  1YPN A;  5AA4 A;  2REG A;  4KPT A;  4F22 A;  1YTV A;  5ET8 A;  1FBC A;  3ZSF A;  1Y4T A;  4NN3 A;  3V83 A;  1KZ8 A;  2ZMB A;  4PE5 B;  2X7P A;  1P1W A;  3FAS A;  1US4 A;  3SES A;  5IZZ A;  2O6A A;  2WKY A;  4RK9 A;  4ZDM A;  2PCR A;  4LZ7 A;  3B6Q A;  3QUF A;  1FQC A;  4MEV A;  4H8J A;  4MF3 A;  2F3B A;  3TEL A;  3PUZ E;  1IIW A;  1B7H A;  3K6X A;  4FAJ A;  3JYR A;  4GWY A;  1YCJ A;  1TXF A;  4JVC A;  2GQ1 A;  4TOZ A;  1A8F A;  1G0H A;  1F9B A;  1MQI A;  2H98 A;  1NV6 A;  2RC9 A;  1DSN A;  4LVQ A;  5I57 B;  1A55 A;  4N91 A;  4PBQ A;  1USY H;  5AA2 D;  2I4C A;  1FBG A;  2HAV A;  3P7I A;  3LSF B;  4PDH A;  2ZYN A;  2I4B A;  5FHM A;  2XD3 A;  4OES A;  5IKB A;  3FVK A;  1O63 A;  1NNP A;  1IMD A;  4PF6 A;  4QFK A;  1VE4 A;  2OJT A;  1FW0 A;  1CB6 A;  4G8N A;  3S9M C;  2HFB A;  5KCJ A;  4POW A;  3FVG A;  2XXY A;  3U65 A;  5TP9 A;  2F5X A;  4JWO A;  3MVZ A;  1LAF E;  3KOS A;  3PPN A;  4KYE A;  4H5G A;  1NNT A;  3O66 A;  3RN8 A;  4OZ9 A;  4PGN A;  3VVF A;  1UTB A;  4G8H A;  3MP1 A;  4GOT A;  3VXB A;  2CEY A;  4BDM A;  3CHG A;  3ILT B;  3PGF A;  1B1H A;  2DWI A;  2G29 A;  4NF5 A;  1ANF A;  1VFD A;  2NUV A;  3IO4 A;  3SEV A;  3ECR A;  1TT1 A;  1VSO A;  2QL3 A;  3BIG A;  2Q88 A;  4QFL A;  5K2X A;  4N81 A;  2HEU A;  3T1B A;  3SEX A;  2UVJ A;  1LAG E;  4GL0 A;  4YIC A;  5I58 A;  2Y5K A;  3E4R A;  1JW4 A;  3ODB A;  4P0G A;  1MY4 A;  4YKK A;  3RTW B;  3PU5 A;  5AA3 A;  1NI9 A;  4GVO A;  2O51 A;  1OQG A;  2F78 A;  4H5F A;  2Q74 A;  1OVT A;  3R26 A;  4I3Y A;  3SKP A;  1A54 A;  3R7X A;  4G68 C;  4QSC A;  4KHZ E;  3ISP A;  4K3F A;  3ZKK A;  4YB6 A;  3MYU A;  4N07 A;  1MY2 A;  3TTN A;  4ONY A;  3OO6 A;  3GLB A;  3EHU A;  4GF8 A;  4QFN A;  1QUK A;  3Q29 A;  1B51 A;  5HPQ A;  4IY5 A;  3IB2 A;  2F35 A;  2E0S A;  3KSJ A;  3HHF A;  5JK4 A;  5I59 B;  2H25 A;  2NVU B;  4P9K A;  2DE2 A;  2QRY A;  2DYX A;  3UK4 A;  4HE0 A;  3IK6 B;  4JSO A;  2ZXT A;  3G3K A;  3H03 A;  4KR5 A;  4DLD A;  2ONS A;  3VLV A;  3T9H B;  1MY3 A;  2IA4 A;  3ZKL A;  4ELO A;  2O84 X;  3VFJ A;  2RKM A;  4BDQ A;  3EHT A;  1MY0 A;  2Y7I A;  1R9L A;  1LBY A;  3OSR A;  1HSJ A;  4OFO A;  4KI0 E;  5LDZ A;  3EF7 A;  3U92 A;  2I6E A;  4QFP A;  3IOR A;  1D9V A;  4ESW A;  4F1V A;  1S7Y A;  2I0B A;  4ND9 A;  3H6W A;  2GFE A;  4HE2 A;  1DPE A;  4JWY A;  4F19 A;  1A99 A;  2RC7 A;  1XS5 A;  3CR9 A;  2DSF A;  1P1Q A;  1LAX A;  4ECF A;  1Y3N A;  5CBS A;  4F3S A;  3Q26 A;  1FBE A;  3RT8 A;  2QS3 A;  5FTI A;  1NV3 A;  1DTG A;  3IX1 A;  3KBR A;  3MZ9 A;  3A29 A;  3FV2 A;  3E78 A;  3A09 A;  1US5 A;  5EQ7 A;  4YB7 A;  1R1N A;  1P99 A;  2BJI A;  4FE8 A;  2QVV A;  3TDJ A;  3N94 A;  1FSA A;  2DWA A;  4X9T A;  4H65 A;  2WYP A;  3THI A;  3IB0 A;  4LAT A;  2F7A A;  4PAK A;  5DEX A;  2RCA A;  4OYV A;  2WBD A;  4F3G A;  3E13 X;  1M5D A;  2QJE A;  4Z0I A;  1NFT A;  4IO5 A;  3DM0 A;  2B3F A;  3WAF A;  3A3U A;  4MBP A;  2ABH A;  1VFE A;  2WBB A;  5CMC A;  1PB7 A;  2V93 A;  2FVZ A;  4G8M A;  4NMY A;  3HN0 A;  4P1E A;  4XEQ A;  4DCY A;  5B70 A;  4DI4 B;  4IO3 A;  2F6P A;  5ET5 A;  4M4G A;  3R6U A;  1FQD A;  4KXP A;  2RF1 A;  3V5A A;  4RA1 A;  4R6Y A;  1PB8 A;  4LQ5 A;  4NF4 B;  3JV9 A;  4RXL A;  3HFU A;  3UN6 A;  4HCY A;  1Y9U A;  4LN5 A;  3PMV A;  4MX6 A;  1NV7 A;  4WXJ A;  3LSL A;  4BLA A;  2A5S A;  1MPD A;  1N7X A;  4G77 A;  4HXV A;  3G3J A;  1LBW A;  2I0C A;  4AS5 A;  3FIR A;  2Y84 A;  1HSL A;  4U4S A;  1B9J A;  5I57 A;  3TTR A;  2F3D A;  3MJN A;  1FBF A;  2ZYO A;  1ZJL A;  2AL5 A;  2DP8 A;  3OO8 A;  4GWZ A;  1USY E;  4I9D A;  3KBZ A;  4X8R A;  4NQ8 A;  4N6D A;  5EYH A;  5IM2 A;  2XWV A;  5ITP A;  4I1D A;  4DXB A;  5JTY B;  3RPW A;  1AIV A;  2KLF A;  3LBS A;  4DDD A;  1D9Q A;  1OQH A;  2DVC A;  3A3C A;  3BIH A;  1FPL A;  4E0W A;  2XX9 A;  1WVJ A;  3FAT A;  3QAX A;  1B3H A;  1DTZ A;  3BKI B;  1PC3 A;  3HV1 A;  1EU8 A;  4YKP A;  1FPJ A;  2XXX A;  1B32 A;  1SW4 A;  3RLF E;  3RYD A;  5DT6 A;  3VV5 A;  3VVD A;  4XF5 A;  5FHN A;  3O6H A;  4EDP A;  1MRP A;  1Q9D A;  3AXF A;  1EYI A;  4F3B A;  1GV8 A;  5J1D A;  2ONR A;  4GX3 A;  4NED A;  3E79 A;  1BP5 A;  2XXK A;  4JB7 A;  4LON B;  2QVU A;  3O28 A;  4I40 A;  2NXO A;  3QK6 A;  1ZBM A;  2F34 A;  3S9N C;  3CFZ A;  4QFO A;  3CSG A;  1MDQ A;  5H8H B;  2CZI A;  1AL3 A;  3OMB A;  3VLU A;  1RYX A;  4MLQ A;  3FJG A;  2REJ A;  2VD2 A;  2Z8E A;  3H6T A;  3O6I A;  4EXL A;  3IB1 A;  1AWB A;  2RC8 A;  1OMP A;  3T9X B;  4UA8 A;  4H1X A;  2XXW A;  5CI5 A;  2VPN A;  1Q1K A;  2F6G A;  1B5H A;  2X26 A;  3IJX B;  5I2K B;  3TCG A;  2B65 A;  1LFG A;  2WX9 A;  2Y7W A;  1AMF A;  1D3K A;  5EQ8 A;  1IME A;  5I59 A;  2X7Q A;  4U1O A;  1II5 A;  1I69 A;  2Q2A A;  1B3F A;  3TYH A;  2Q9T A;  1IIT A;  3IFC A;  2D5W A;  2OWZ A;  3GBB A;  4I62 A;  4FBP A;  1KA1 A;  3U1O A;  1PDA A;  2QMX A;  3K6V A;  4R6H A;  1SYH A;  4WEP A;  4AS4 A;  2M8C A;  3E9X A;  2PFY A;  1Z7N E;  3FXQ A;  1SVX B;  3PD8 A;  3QXM A;  4MNI A;  3QSL A;  3K00 A;  4ZED A;  1MQD A;  1NH7 A;  1QUJ A;  4PFB A;  4XFE A;  3TCF A;  2Q2C A;  5DTB A;  1DK4 A;  2XA5 A;  3D1R A;  5DVF A;  2P3N A;  3G7W A;  3SET A;  5H8F B;  1FJ6 A;  3MZB A;  5FBP A;  4AB5 A;  2Q89 A;  4HW8 A;  4GRK A;  2VHA A;  4IO4 A;  1DOT A;  1SI1 A;  4PAF A;  4PFR A;  1WOD A;  3N6T A;  1MQG A;  4N15 A;  1JVY A;  2VP1 A;  3G3F A;  1B4Z A;  3RT6 B;  3KN8 A;  3MC2 A;  5F7V A;  1FPF A;  4X04 A;  1ZIU A;  4F2O A;  1FBH A;  2NWJ A;  3S4U A;  5ET7 A;  1MXU A;  3PUX E;  3B7D A;  2QMW A;  1B46 A;  3FZV A;  1N0T A;  3FGS A;  3UIF A;  2Q8M A;  1XVY A;  1TWY A;  3MP6 A;  5H8Q A;  4DI3 D;  4GBV A;  3TKD A;  4RYA A;  4FJP A;  1GVC A;  3PTY A;  4ZEB A;  2LAO A;  4GXS B;  3LSX A;  2CZK A;  5DYH A;  1N3W A;  4F18 A;  4GX6 A;  4NAP A;  3RY3 A;  2PFZ A;  4N13 A;  4MAG A;  2ZZX A;  4QSD A;  4AQ4 A;  1RYO A;  3C32 A;  3HHG A;  4U23 A;  3O2A A;  2F7C A;  1DMB A;  3D4G A;  4IY6 A;  3TTL A;  1XI6 A;  3T9U A;  4IGT A;  4IGR A;  1T0K A;  4IR8 A;  1ZLQ A;  3NOH A;  4ZEI A;  1NMU A;  1IXI A;  5I7I A;  3N5L A;  4KYS A;  4YKJ A;  3W15 C;  1I6B A;  4GXA A;  4NF4 A;  4UAB A;  3KOT A;  3OO7 A;  2O1L A;  2DXY A;  4GBW A;  2HXR A;  4FEC A;  4OVQ A;  4H45 A;  5ITO A;  4NF8 B;  3FXR A;  4X1D A;  1PBQ A;  3M3L A;  3IOU A;  2XWO A;  4GL8 A;  1P1U A;  1N3X A;  4DXC A;  1B1X A;  4OVT A;  2XX7 A;  2QS2 A;  2ZYM A;  3SEW A;  4Q8R A;  2AYS A;  4QRZ A;  2CMO A;  2O68 A;  3VVE A;  1IMF A;  2DOJ A;  1IXC A;  2DVZ A;  2R9J A;  4P8B A;  3RUM A;  1GR2 A;  2E1S A;  3OEN A;  4U22 A;  1RKM A;  3EN3 A;  5KZT A;  4PQJ A;  1B5I A;  1BLF A;  3G3G A;  4BDO A;  5CC2 A;  1FBP A;  2Y7K A;  3VDF A;  1FTA A;  1JVX A;  3UP9 A;  3K6W A;  3O9P A;  2H4I A;  1B52 A;  2Y7R A;  4EQ9 A;  1FTK A;  5BUU A;  1A40 A;  5I56 B;  3MST A;  3WAE A;  2OLB A;  4NHB A;  3LUZ A;  1FJ9 A;  1B0H A;  1EYJ A;  1LST A;  1Q35 A;  4PE3 A;  2ZZW A;  3SER A;  5ET6 A;  3K4U A;  4JXI A;  2DE3 A;  4ZE8 A;  4O94 A;  3VLW A;  1LBX A;  4MMP A;  1B0L A;  4DCX A;  1XHY A;  5L9S A;  3CIJ A;  4UAC A; 
#chains in the Genus database with same CATH homology
 1P1N A;  1ZTY A;  3PPO A;  3F11 A;  1QKB A;  4PET A;  3DP6 A;  3K6U A;  3GZG A;  3TEP A;  1HSE A;  3DP8 A;  5L9M A;  3TFL A;  2PBW A;  3B6W A;  3JZJ A;  5H8H A;  3CRB A;  4EXK A;  2XXP A;  4O3B A;  4I8C A;  3EHS A;  1QVS A;  4F29 A;  2P0S A;  4ZS9 A;  4Q0C A;  5DVJ A;  1NNK A;  3UA8 A;  3GBA A;  1MPB A;  2UVH A;  4MH5 A;  2GHB A;  2R6G E;  2UXA A;  1M5E A;  3MVW A;  3VE1 B;  3VXC A;  1MXZ A;  3Q28 A;  2Q8J A;  5F1Q A;  4WKM A;  4HCW A;  1FQB A;  1NH8 A;  4R2B A;  3ZS6 A;  4XTC Q;  2QSX A;  4FEB A;  4XKN A;  3W9V A;  4MLV A;  3U93 A;  2V3Q A;  1GTK A;  2PT2 A;  4HS7 A;  2Z23 A;  2DQV A;  4OEV A;  4FED A;  4OHN A;  2XX8 A;  4HTG A;  1LB9 A;  3M3F A;  3IJO B;  3CFL A;  1XC1 A;  4KCD A;  4LUB A;  3MUQ A;  5M2V A;  1URG A;  4H0W A;  4L17 A;  5H8F A;  4DE8 A;  4KCC A;  2Y7P A;  1SBP A;  3MZ1 A;  3G3I A;  4GQO A;  3IR1 A;  1LGB C;  2QS4 A;  1B2H A;  4QF9 A;  1B7U A;  3N6U A;  1MH3 A;  4O3C A;  4FAT A;  1IXH A;  1MXV A;  4RY1 A;  4Q5T A;  3BBR A;  4NF5 B;  4BDL A;  4QHQ A;  2W7Y A;  2RIN A;  3I3V A;  4JBZ A;  2F7B A;  4R2F A;  4U2R A;  3G3H A;  3EPE A;  3PV0 E;  4PP0 A;  3N26 A;  1POY 1;  3H4Z A;  5I58 B;  2FA7 A;  4LP2 B;  4U4X A;  4YB5 A;  5H8N B;  3MPK A;  5ISU A;  1PEB A;  1URD A;  3T66 A;  1B6H A;  3H06 B;  3QYT A;  2XXI A;  1FTJ A;  2YLN A;  3FD3 A;  4GWO A;  3IOV A;  3ILU B;  2XXH A;  1JQF A;  2I3V A;  5FHO A;  1QJM A;  2ZNS A;  3OSQ A;  2ANJ A;  2I58 A;  2P1S A;  2VD3 A;  1MM6 A;  2DS9 A;  4R9G A;  2AL4 A;  2PMS A;  4LZ8 A;  2PT1 A;  4NF6 B;  3W9W A;  1UIV A;  2XXQ A;  2XD2 A;  3T9V A;  4KFQ A;  4KQP A;  3HO7 A;  1EH3 A;  2O7I A;  4JSD A;  3KJT A;  5ELV A;  2RCB A;  1Y1M A;  3SEU A;  4KYD A;  1LCT A;  4XKP A;  3IOT A;  3CSB A;  3K01 A;  1FTL A;  4IO7 A;  2OWT A;  3QUJ A;  1IZ1 A;  1QKA A;  3KG2 A;  3OEL A;  3CVG A;  3BFT A;  4G68 B;  1SW5 A;  1I6A A;  4NWC A;  2XXU A;  1FQF A;  4OEU A;  2FYI A;  4O3A A;  1QW0 A;  2ONK E;  5AA1 A;  4FIM A;  1VR5 A;  3PD9 A;  2H5Y A;  2XHD A;  4Q30 B;  2OZZ A;  5I56 A;  1Y20 A;  4GD5 A;  4OQO A;  4OXV A;  1BIY A;  1NKX A;  4G2Z A;  1QUI A;  2ALU A;  1FQA A;  2AIX A;  4X1B A;  2O1M A;  5L9O A;  4OET A;  5H8S A;  5TU0 A;  1B4H A;  5EHM A;  3TAJ A;  3CI8 A;  4H67 A;  3DLN A;  2I3W A;  5CMM A;  4H6D A;  2O69 A;  1SYI A;  4ELQ A;  3KN7 A;  2XXR A;  3TZA A;  2ZNU A;  3USD A;  3Q27 A;  1ZMG A;  4TLL B;  4C1T A;  1BKA A;  1LB8 A;  1MY1 A;  3I6V A;  4PFW A;  5TPA B;  4U21 A;  3T22 A;  3PMX A;  3FJ7 A;  1IEJ A;  2GRV A;  2PVU A;  2V3T A;  1H44 A;  3H7M A;  1JNF A;  4GFR A;  3IO6 A;  1Y3Q A;  2QPQ A;  4F1U A;  1CE2 A;  1MQJ A;  4RK2 A;  4F1Y A;  1JEU A;  4H8I A;  3C33 A;  3RTF B;  3RNN A;  3C31 A;  3O6G A;  1M5F A;  1UIU A;  3KSX A;  1EZO A;  3U8Q A;  1BTJ A;  1ATG A;  5EHS A;  1IXG A;  2F8D A;  5ICQ A;  4IO6 A;  1M5C A;  1N76 A;  1N84 A;  3MPL A;  3S2V A;  3H6U A;  4F39 A;  2G93 A;  1LCF A;  5A5X B;  1B58 A;  1Y4C A;  1IUD A;  4JDF A;  3MWB A;  3OEK A;  4M1V A;  3LUY A;  4EF2 A;  5HM4 B;  3PPP A;  3PUV E;  5I2N B;  5ICT A;  4GIZ A;  1MDP 1;  3PUY E;  4WED A;  1LBB A;  3U94 A;  3MVY A;  1TFA A;  3S9E A;  3OOA A;  5K2Y A;  5I84 A;  1SD3 A;  3HST A;  3KJ7 A;  4TLM B;  2GH9 A;  1POT A;  3FV1 A;  4MFI A;  4R9F A;  3MAM A;  4ZE9 A;  3OD7 A;  1PBP A;  1JW5 A;  3O29 A;  1URS A;  5AA2 B;  3C4M A;  3L6H A;  2PX1 A;  2ZNT A;  5KDT B;  4ZZA A;  4TQU Q;  4DZ1 A;  4PFU A;  3MW0 A;  3U72 A;  1XT8 A;  1B05 A;  3M3K A;  2ESN A;  2R71 A;  5AE4 A;  1FCK A;  2F97 A;  1M5B A;  1JW1 A;  2A5T B;  2D21 A;  1JEV A;  5H8N A;  2DE4 A;  3TCH A;  3TMG A;  2YJP A;  3C9H A;  5JTY A;  3K0V A;  1KWH A;  4YAH X;  1B7Z A;  3C34 A;  3SDF A;  3H6V A;  3KZG A;  4ELR A;  3KEI A;  5IAI A;  1P1O A;  3V89 B;  2HXW A;  3RGY A;  1OVB A;  4N6P A;  1UTH B;  1B40 A;  3E3K A;  5BWJ A;  4NF6 A;  3LSW A;  3SEY A;  4IB2 A;  1S9T A;  4NWD A;  1NL5 A;  3UOR A;  3TTK A;  4G4P A;  1N04 A;  3K02 A;  3MQ9 A;  1H43 A;  1SW2 A;  1B3L A;  3FVO A;  1AH5 A;  1Y1Z A;  4FOR A;  4ELP A;  4Z7E A;  4POX A;  4ZZE A;  1MXY A;  2D3I A;  4OEN A;  1SDX A;  1TFD A;  3K2D A;  2QS1 A;  3IL1 B;  2H99 A;  3K1N A;  3TUS A;  4KD5 A;  4RNS A;  4XXU A;  3KN3 A;  4G68 A;  3M8U A;  1LFI A;  5AA4 B;  3C35 A;  1MXX A;  3IAZ A;  3PMW A;  2F36 A;  1OLC A;  4XKR A;  5CMB A;  4YMB A;  5I2K A;  2DWH A;  4ISU A;  3K1P A;  3B6T A;  2OCU A;  3TOD A;  3CG1 A;  4AB6 A;  3C36 A;  1L5T A;  4RPO A;  1ZKB A;  1B3G A;  4E0X A;  1ZU0 A;  3K1M A;  3TQL A;  5B7D A;  3CG3 A;  1YAE A;  1MXW A;  3OEM A;  3EQ1 A;  1LFH A;  5CM6 A;  1D9Y A;  1MQH A;  4OFJ A;  1Z7M E;  3OXN A;  5JEI A;  2THI A;  5CBR A;  3T93 B;  2DXR A;  1D4N A;  3CFX A;  5H8Q B;  3L6G A;  1S50 A;  4R74 A;  5TPA A;  2HZL A;  1EZ9 A;  3TQW A;  2HZK A;  2B3B A;  1DPP A;  2V84 A;  2HCA A;  4R73 A;  2YPN A;  4JWX A;  1FQE A;  5KCJ B;  4PFT A;  4QSE A;  1FTO A;  2GHA A;  5L8D A;  2UYE A;  1MG1 A;  5TP9 B;  2UVG A;  1SQY A;  4LQ2 A;  3ONM A;  2BJJ X;  5DVI A;  1PB9 A;  2UVI A;  3KGC A;  2XXV A;  3KFM A;  1WDN A;  1SW1 A;  1UTB B;  2HAU A;  4OMB A;  4BDR A;  4EF1 A;  4LA9 A;  4XKQ A;  4R75 A;  3T96 B;  4F2Q A;  4GLI A;  5EYF A;  1A7L A;  4BDN A;  2FNC A;  1GGG A;  1OLA A;  4RJZ A;  3FXU A;  1JET A;  2O7U A;  4YKI A;  1OIB A;  4EQ7 A;  4EUO A;  4C1U A;  4ESX A;  3QIM A;  3FVN A;  4NE4 A;  3PUW E;  1J1N A;  5LOM A;  5A5X A;  2UYF A;  4OFL A;  1A8E A;  4OVJ A;  3LR1 A;  5I2N A;  1MH4 A;  3MP8 A;  2CZL A;  2PYY A;  3HCQ A;  2I48 A;  2P2A A;  4ZEK A;  3HPI A;  1MPC A;  1UQW A;  2I49 A;  3V8X B;  4OTE A;  1EZP A;  3GXA A;  2XXT A;  1N7W A;  4F31 B;  2OK2 A;  3FJM A;  4F3P A;  2HQ0 A;  4DIG A;  2V3U A;  4R72 A;  3TPA A;  3TTM A;  1R9Q A;  4P0I A;  5AA2 A;  3LC8 A;  3PPQ A;  4NF8 A;  4DXU A;  3PPR A;  4YU0 A;  1O7T A;  5KDT A;  4U1Z A;  1NNF A;  5HBC A;  1QUL A;  4LZ5 A;  1Y3P A;  3IOW A;  2IEE A;  4XIG Q;  4R6K A;  2OWS A;  1XOC A;  2V25 A;  2Z8D A;  4YZZ A;  2A5T A;  4PFY A;  2VOZ A;  1LAH E;  1R6Z A;  2NOO A;  3Q25 A;  4RPN A;  1LLS A;  4EQB A;  2Z22 A;  3FUZ A;  4NTL A;  2ZYK A;  1B5J A;  4ZEF A;  1H76 A;  3DP4 A;  1XVX A;  3DEL B;  1I6Q A;  2Z8F A;  1H3D A;  3H3G A;  4X48 A;  1FTM A;  1O64 A;  1UTH A;  3OO9 A;  3MVX A;  3MBP A;  1AOV A;  5CMK A;  1H45 A;  3I5O A;  4ZEC A;  4OER A;  2H9B A;  4C0R A;  1LBC A;  1MM7 A;  5FTH A;  4YMA A;  2DWJ A;  1ELJ A;  3RQT A;  2OBG A;  3UGW A;  2VGQ A;  4THI A;  3D4C A;  5DEX B;  3S9L C;  4IO2 A;  3O97 A;  4P11 A;  4OWD A;  1SI0 A;  1MS7 A;  5CRY A;  1B3E A;  3BFU A;  1IQ7 A;  1YPN A;  5AA4 A;  2REG A;  4KPT A;  4F22 A;  1YTV A;  3ZSF A;  1Y4T A;  3V83 A;  2ZMB A;  4PE5 B;  2X7P A;  1P1W A;  3FAS A;  1US4 A;  3SES A;  2O6A A;  2WKY A;  4RK9 A;  4ZDM A;  4LZ7 A;  3B6Q A;  3QUF A;  1FQC A;  4H8J A;  4MF3 A;  3TEL A;  3PUZ E;  1IIW A;  1B7H A;  3K6X A;  4FAJ A;  3JYR A;  1YCJ A;  1TXF A;  4TOZ A;  1A8F A;  1F9B A;  1MQI A;  2H98 A;  2RC9 A;  1DSN A;  4LVQ A;  5I57 B;  1A55 A;  1USY H;  5AA2 D;  2I4C A;  2HAV A;  3P7I A;  3LSF B;  2ZYN A;  2I4B A;  5FHM A;  2XD3 A;  4OES A;  5IKB A;  3FVK A;  1O63 A;  1NNP A;  4QFK A;  1VE4 A;  2OJT A;  1FW0 A;  1CB6 A;  4G8N A;  3S9M C;  2HFB A;  5KCJ A;  4POW A;  3FVG A;  2XXY A;  5TP9 A;  2F5X A;  4JWO A;  3MVZ A;  1LAF E;  3KOS A;  3PPN A;  4KYE A;  4H5G A;  1NNT A;  3O66 A;  3RN8 A;  4OZ9 A;  3VVF A;  1UTB A;  4G8H A;  3MP1 A;  4GOT A;  3VXB A;  4BDM A;  3ILT B;  3PGF A;  1B1H A;  2DWI A;  2G29 A;  4NF5 A;  1ANF A;  1VFD A;  2NUV A;  3IO4 A;  3SEV A;  3ECR A;  1TT1 A;  1VSO A;  2QL3 A;  2Q88 A;  4QFL A;  5K2X A;  2HEU A;  3SEX A;  2UVJ A;  1LAG E;  4GL0 A;  4YIC A;  5I58 A;  3E4R A;  1JW4 A;  3ODB A;  4P0G A;  1MY4 A;  4YKK A;  3RTW B;  3PU5 A;  5AA3 A;  4GVO A;  2O51 A;  1OQG A;  2F78 A;  4H5F A;  1OVT A;  3R26 A;  3SKP A;  1A54 A;  3R7X A;  4G68 C;  4QSC A;  4KHZ E;  4K3F A;  3ZKK A;  4YB6 A;  4N07 A;  1MY2 A;  3TTN A;  4ONY A;  3OO6 A;  3GLB A;  3EHU A;  4GF8 A;  4QFN A;  1QUK A;  3Q29 A;  1B51 A;  5HPQ A;  4IY5 A;  3IB2 A;  2F35 A;  2E0S A;  3KSJ A;  3HHF A;  5JK4 A;  5I59 B;  2H25 A;  2NVU B;  2DE2 A;  2QRY A;  2DYX A;  3UK4 A;  3IK6 B;  4JSO A;  2ZXT A;  3G3K A;  3H03 A;  4KR5 A;  4DLD A;  2ONS A;  3VLV A;  3T9H B;  1MY3 A;  2IA4 A;  3ZKL A;  4ELO A;  2O84 X;  3VFJ A;  2RKM A;  4BDQ A;  3EHT A;  1MY0 A;  2Y7I A;  1R9L A;  3OSR A;  1HSJ A;  4OFO A;  4KI0 E;  3EF7 A;  3U92 A;  2I6E A;  4QFP A;  3IOR A;  1D9V A;  4ESW A;  4F1V A;  1S7Y A;  2I0B A;  4ND9 A;  3H6W A;  2GFE A;  1DPE A;  4JWY A;  4F19 A;  1A99 A;  2RC7 A;  1XS5 A;  3CR9 A;  2DSF A;  1P1Q A;  1LAX A;  4ECF A;  1Y3N A;  5CBS A;  4F3S A;  3Q26 A;  3RT8 A;  2QS3 A;  5FTI A;  1DTG A;  3IX1 A;  3KBR A;  3MZ9 A;  3FV2 A;  3A09 A;  1US5 A;  4YB7 A;  1R1N A;  1P99 A;  4FE8 A;  3TDJ A;  3N94 A;  2DWA A;  4X9T A;  4H65 A;  3THI A;  3IB0 A;  4LAT A;  2F7A A;  5DEX A;  2RCA A;  4OYV A;  4F3G A;  3E13 X;  1M5D A;  2QJE A;  4Z0I A;  1NFT A;  4IO5 A;  3DM0 A;  2B3F A;  3WAF A;  3A3U A;  4MBP A;  2ABH A;  1VFE A;  5CMC A;  1PB7 A;  2V93 A;  4G8M A;  4NMY A;  3HN0 A;  4DCY A;  5B70 A;  4IO3 A;  2F6P A;  4M4G A;  3R6U A;  1FQD A;  2RF1 A;  3V5A A;  4RA1 A;  4R6Y A;  1PB8 A;  4LQ5 A;  4NF4 B;  3JV9 A;  4RXL A;  3UN6 A;  4HCY A;  1Y9U A;  3PMV A;  4WXJ A;  3LSL A;  4BLA A;  2A5S A;  1MPD A;  1N7X A;  4G77 A;  3G3J A;  2I0C A;  3FIR A;  2Y84 A;  1HSL A;  4U4S A;  1B9J A;  5I57 A;  3TTR A;  3MJN A;  2ZYO A;  1ZJL A;  2AL5 A;  2DP8 A;  3OO8 A;  1USY E;  4I9D A;  5ITP A;  4I1D A;  4DXB A;  5JTY B;  3RPW A;  1AIV A;  2KLF A;  3LBS A;  4DDD A;  1OQH A;  2DVC A;  3A3C A;  4E0W A;  2XX9 A;  1WVJ A;  3FAT A;  3QAX A;  1B3H A;  1DTZ A;  3BKI B;  1PC3 A;  3HV1 A;  1EU8 A;  4YKP A;  2XXX A;  1B32 A;  1SW4 A;  3RLF E;  5DT6 A;  3VV5 A;  3VVD A;  5FHN A;  3O6H A;  4EDP A;  1MRP A;  3AXF A;  5J1D A;  4F3B A;  1GV8 A;  2ONR A;  4NED A;  1BP5 A;  4JB7 A;  4LON B;  3O28 A;  2NXO A;  3QK6 A;  1ZBM A;  2F34 A;  3S9N C;  3CFZ A;  4QFO A;  3CSG A;  1MDQ A;  5H8H B;  1AL3 A;  3OMB A;  3VLU A;  1RYX A;  4MLQ A;  3FJG A;  2REJ A;  2VD2 A;  2Z8E A;  3H6T A;  3O6I A;  4EXL A;  3IB1 A;  2RC8 A;  1OMP A;  3T9X B;  4UA8 A;  4H1X A;  2XXW A;  5CI5 A;  1Q1K A;  2F6G A;  1B5H A;  2X26 A;  3IJX B;  5I2K B;  3TCG A;  2B65 A;  1LFG A;  2Y7W A;  1AMF A;  1D3K A;  5I59 A;  2X7Q A;  4U1O A;  1II5 A;  1I69 A;  2Q2A A;  1B3F A;  3TYH A;  2Q9T A;  1IIT A;  2D5W A;  3GBB A;  4I62 A;  3U1O A;  1PDA A;  2QMX A;  3K6V A;  4R6H A;  1SYH A;  4WEP A;  2M8C A;  3E9X A;  1Z7N E;  3FXQ A;  1SVX B;  3PD8 A;  3QXM A;  3QSL A;  3K00 A;  4ZED A;  1MQD A;  1NH7 A;  1QUJ A;  3TCF A;  2Q2C A;  5DTB A;  5DVF A;  3G7W A;  3SET A;  5H8F B;  3MZB A;  4AB5 A;  2Q89 A;  4HW8 A;  4GRK A;  2VHA A;  4IO4 A;  1DOT A;  1SI1 A;  1WOD A;  3N6T A;  1MQG A;  1JVY A;  2VP1 A;  3G3F A;  1B4Z A;  3RT6 B;  3KN8 A;  3MC2 A;  5F7V A;  1ZIU A;  4F2O A;  2NWJ A;  3S4U A;  1MXU A;  3PUX E;  3B7D A;  2QMW A;  1B46 A;  3FZV A;  1N0T A;  3FGS A;  3UIF A;  1XVY A;  1TWY A;  3MP6 A;  5H8Q A;  3TKD A;  4RYA A;  4FJP A;  1GVC A;  4ZEB A;  2LAO A;  4GXS B;  3LSX A;  5DYH A;  1N3W A;  4F18 A;  3RY3 A;  4N13 A;  4QSD A;  4AQ4 A;  1RYO A;  3C32 A;  3HHG A;  4U23 A;  3O2A A;  2F7C A;  1DMB A;  3D4G A;  4IY6 A;  3TTL A;  3T9U A;  4IGT A;  4IGR A;  1T0K A;  1ZLQ A;  4ZEI A;  1NMU A;  1IXI A;  3N5L A;  4KYS A;  4YKJ A;  3W15 C;  1I6B A;  4GXA A;  4NF4 A;  3KOT A;  3OO7 A;  2O1L A;  2DXY A;  4FEC A;  5ITO A;  4NF8 B;  3FXR A;  4X1D A;  1PBQ A;  3M3L A;  3IOU A;  4GL8 A;  1P1U A;  1N3X A;  4DXC A;  1B1X A;  2XX7 A;  2QS2 A;  2ZYM A;  3SEW A;  4Q8R A;  2AYS A;  4QRZ A;  2CMO A;  2O68 A;  3VVE A;  2DOJ A;  1IXC A;  2DVZ A;  2R9J A;  3RUM A;  1GR2 A;  2E1S A;  3OEN A;  4U22 A;  1RKM A;  3EN3 A;  5KZT A;  4PQJ A;  1B5I A;  1BLF A;  3G3G A;  4BDO A;  5CC2 A;  2Y7K A;  3VDF A;  1JVX A;  3UP9 A;  3K6W A;  3O9P A;  2H4I A;  1B52 A;  2Y7R A;  4EQ9 A;  1FTK A;  5BUU A;  1A40 A;  5I56 B;  3WAE A;  2OLB A;  1B0H A;  1LST A;  1Q35 A;  3SER A;  3K4U A;  4JXI A;  2DE3 A;  4ZE8 A;  3VLW A;  1B0L A;  4DCX A;  1XHY A;  5L9S A;  3CIJ A;  4UAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...