1A41A

Type 1-topoisomerase catalytic fragment from vaccinia virus
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
230
structure length
221
Chain Sequence
NAKRDRIFVRVYNVMKRINCFINKNIKKSSTDSNYQLAVFMLMETMFFKENETVGLLTLKNKHIEISPDEIVIKFVGKDKVSHEFVVHKSNRLYKPLLKLTDDSSPEEFLFNKLSERKVYECIKQFGIRIKDLRTYGVNYTFLYNFWTNVKSISPLPSPKKLIALTIKQTAEVVGHTPSISKRAYMATTILEMVKDKNFLDVVSKTTFDEFLSIVVDHVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conservation of structure and mechanism between eukaryotic topoisomerase I and site-specific recombinases.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Isomerase
molecule keywords TOPOISOMERASE I
total genus 72
structure length 221
sequence length 230
ec nomenclature ec 5.99.1.2: Transferred entry: 5.6.2.2.
pdb deposition date 1998-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.380 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Type 1-topoisomerase catalytic fragment, domain 2 1a41A02
3.90.15.10 Alpha Beta Alpha-Beta Complex Topoisomerase I; Chain A, domain 3 Topoisomerase I; Chain A, domain 3 1a41A01
1RRJA 1LPQA 1K4TA 1NH3A 2H7FX 1K4SA 1SC7A 2B9SA 1TL8A 1T8IA 1A36A 3M4AA 1A31A 1A35A 3IGCA 1RR8C 1A41A 2F4QA 2H7GX 1EJ9A 1SEUA 1R49A
chains in the Genus database with same CATH superfamily
3M79A 1M2VA 2HSBA 2LFDA 3EH2A 1QSPA 2Q7RA 2ZXRA 4JEBA 3NMKA 3OWTA 4LDQA 2F22A 3JYHA 3FAPB 1I4YA 4G0HA 1OXKA 1OXBA 4ONSA 3FMSA 3U8PA 3PHF2 3EJNA 5A6JA 2KK1A 3V5XA 4P9FA 2LQGA 4J32B 4XEVA 4EWCA 4PK4A 4CS8C 4J7YA 1YLMA 2A6HF 1VB5A 1TWHA 5JS5A 4ANJA 1IW7F 1FNTc 1BBHA 5IY5C 5L0DA 2NUPB 2XLWA 3TOLA 4IGGA 3QZCA 3L34A 1MNDA 1E85A 4I44A 2Y39A 4BPMA 4XLPF 3KPHA 1M6TA 3KYJA 2AWYA 3DZAA 3SYNA 4EBBA 1EQ1A 3HJCA 3HKKA 1S7ZA 2EPMX 2H7BA 2OEXA 2ZXWC 3JRMO 4J7TA 5L0JA 2DI3A 4DRIB 3GORA 2Q9CA 3QMKA 4MVOA 4NC3A 1ZHZA 4YL0A 3WG7C 3JRTA 3JSZA 2L6FA 1JPNA 3DJNB 2GAQA 2R7SA 2V26A 1A7VA 2PNOA 2NG1A 3RQEA 5KYXA 1SYQA 3C8GA 4JTCB 1FMWA 2NPUA 1V4AA 2LSEA 1Q0MA 2GWWA 3W8IA 5HV9A 3CSKA 2A0UA 5JRAA 4E18A 2B9SA 2ZD9A 2EINC 4DVZA 3LEVA 3G4XA 2A1DD 1UFBA 3O55A 1ORSC 1YAUO 4JJGA 4Z9IA 5KYNA 1JMWA 3GWLA 4C3BA 1JOGA 3R2PA 1LPEA 4ULWA 4AL1A 2A69F 2R7UA 1TQGA 2Z15A 1XWJA 3DE8A 4RDAA 3KYIA 2H7GX 3AQBA 3DI5A 1W2WA 1WWPA 2AWCA 4BJ5A 5KYWA 2QTVA 2M64A 2WL8A 4FWVA 2J0XA 5AGFA 1UG7A 1VLTA 3S27A 5JP7A 1M56C 1NFOA 1O5HA 3DM9B 4H4KC 4Q5SF 4KC9A 5B3IA 2E87A 1HY5A 2WZLA 4N4WA 3BRJA 2CNWA 3GM1A 5KYUA 3ABMC 4CDVA 1VYIA 2P0NA 1BR4A 2QNLA 4HEAJ 2P61A 2PBEA 4U5EE 1HMDA 1LI7A 2NUTA 1ZHTA 3PMRA 4NTFA 4YT5A 1LS4A 4E17A 4C7OA 4BEMJ 2YL7A 2J9VA 1NLXA 2GA0A 2M4EA 3T6JA 4IAOA 4MVUA 5L0FA 4KNWA 3IQ6A 4P6IC 4XTKA 4NCQA 2IYLD 5D91A 2XSEA 1GQAA 4PJJA 1D0XA 1CPQA 4O79A 4C3DA 1ORYA 3UMKA 1J8MF 2JX0A 4DBQA 4DBRA 1OW7A 3B0VC 2HKVA 2OQMA 1L7CA 1WGWA 1ZHXA 2B0JA 2XXAA 1VTMP 1U0BB 3CEXA 1LPQA 4AL0A 256BA 1T9KA 1AEPA 3I5PA 2IBFA 3WAQA 4I1MA 3NYLA 2H7FX 2ZPAA 1LKXA 2LFFA 3K6BA 4N06A 3C8GB 3K7DA 3MBGA 3PCVA 4W8KA 3US6A 1K40A 4KBLA 5T1DB 3LS0A 2P7VA 3M4AA 2AVKA 3S28A 2LP4A 5E3CA 2XS8A 4FESA 3EGXA 4DJ9A 2YEVA 1T6QA 3EZHA 5T3TA 1DOWA 1ZZPA 1U6HA 4QI2A 5AC5A 3SXZA 4RD9A 2WZGA 4BJTA 2HJ3A 4LDKA 2Y69C 3ZQYA 2NSFA 3AG1C 2VCBA 3DM5A 1HMOA 3H2UA 1HE1A 2R02A 4MW3A 4PJLA 4IB4A 1M2OA 1OCRC 2PX0A 3AQCA 2G3VA 3M1CB 4JZAA 3POVA 2J46A 2X51A 3DD7A 2XL8A 3RQGA 1TFKB 3DMDA 4DRHB 4ZLCA 1TWCA 1ZW3A 3FHDA 4JCHA 3KMIA 3K1IC 4NTAA 1OKKD 2QUPA 1GM5A 1A7DA 3AGTA 1LE4A 2J45A 2LIGA 3NG1A 3NYJA 2KSFA 3AG2C 4LACB 5KYXB 4X0RA 1Z6AA 4O7GA 2R7TA 5TJ5E 3EGDA 5A6KA 4L6RA 3U3FA 1TKNA 3VYWA 3KKBA 1YZAA 4CJOA 3DWWA 2VCAA 1A35A 4RBNA 3ASOC 4BJ1A 3RFYA 4A2NB 1CGME 2BL2A 1A0BA 2J8WA 2CCYA 3VAYA 1PCXA 3DAGA 3EG9A 4OD5A 1YDIA 3NKEA 4PJMA 1H9GA 3RKOF 4CS9A 1BR1A 4U5BE 4CIPA 3EHNA 2XL4A 2AU5A 3UR3C 3G4ZA 3ZWIA 3FAJA 2L6GA 2EIMC 2OKUA 5D92A 1QKRA 2YHSA 4NTBA 2CYDA 4CJGA 3U8VA 1D0ZA 2A0BA 2XLVA 4NQFA 4CSAA 4W8PA 1WOLA 1YVIA 3QTHA 2CW0F 1SF8A 1Z5ZA 2FFHA 5L0IA 3C62A 2MYSA 4FAPB 1BDJB 4YT4A 4PFOA 1H7IA 2XLMA 1C03A 2RSEB 4U5HA 4MVMA 2WB7A 5CI8A 4IARA 4C7OB 2R7OA 3LAYA 1XZPA 1VMAA 3JZ0A 2GFHA 4OIQF 2IXOA 5L0HA 4OD4A 4G7HF 3LNRA 4EKWA 4OIOF 4YT2A 2JD3A 1E2XA 3TJ5A 2OJED 4XPYA 4AE4A 4HFFB 2R7XA 3AJMA 3U2MA 2IOQA 1HW1A 3AGUA 1KNYA 2YLIA 1O3UA 4ULVA 3ZG1A 4E0HA 5A6AA 4OIPF 4XPWA 3IEEA 3LUTB 1OW8A 1BZ4A 1VOMA 2KYHA 3EQLF 4IWBA 1LVKA 4J30B 1E86A 1Z63A 4JVSA 2MWQA 1NFNA 1VYKA 3NKDA 3ZQVA 3T9OA 3T6BA 3RW0A 3QW1A 4PFPA 3GWNA 1V74B 2OG2A 2UUIA 3A9CA 4CDAA 4XEKA 5DS5A 1RMVA 1D1BA 3K1IA 1JAFA 2EIKC 2PFDA 1SEUA 2HS5A 4MVQA 3SXYA 2VASA 2W45A 4YL3A 3UNGC 3QVZA 2GDCA 5L3QA 3NDBB 2R05A 1WATA 4DOZA 3JT1A 4YN0B 1A7EA 1Q0GA 4LERA 2LD6A 2PP4A 5GPGB 2X0CA 4E0IA 1I4ZA 3B29A 1Q0DA 1QLEC 4GEHA 3M4BA 3SEOA 3UMHA 5L0CA 4XEFA 4MS2A 3ECSA 2HV7A 1WASA 2ASRA 1WTYA 2QE9A 1EA8A 2ZXPA 3LS1A 3T6GB 3U5SA 4EBJA 4MTFA 3C18A 4BG0A 1NG1A 1LI5A 1NU7D 1OR2A 4P9TA 2VB6A 1OW6A 3V5YA 5DS6A 1HW2A 3ZTZA 3EPVA 4EBKA 2WVNA 4Z9HA 1Q0KA 2Y3DA 2G3KA 2PX3A 1RR8C 3WHNA 3B0UX 1G5ZA 4GQHA 3V7OA 1ZVZA 3C8ZA 1APCA 5BQHA 2L7AA 4Q7CA 4JE9A 4PJNA 3N24A 3NMIA 3K1HA 4DRJB 3HNLA 1M2VB 2HMZA 2YLDA 3IPMO 3NYMA 3AOUA 4K7BA 3U3BA 4AE4B 1G8XA 1VLSA 1HE9A 2KW3C 2MHRA 2Y3BA 3U9MA 3W4YA 1K05A 1L3PA 1K04A 2XL6A 3ITFA 3FOOA 3M15A 3OA1A 3UGOA 5F5FA 4N6CA 2EPOA 4FX5A 1VK5A 2Q9AA 2XLHA 3LLKA 3U9JA 3HTKC 3VRCA 2XLOA 1TL8A 5JSLA 2YQYA 5DVWA 3RIPA 1T8IA 3C63A 4K1OA 1A36A 3TJ6A 2L9JA 3GM2A 5FZTA 5A6BD 4A4AA 5E33A 4AK9A 2NUPA 1XZQA 2C03A 2R25A 3H2VA 4Z9JA 2EIJC 1EJ9A 4JURI 2OOCA 4XPXA 3SNHA 5L0GA 1LIHA 1MMDA 1T01A 1YYXA 2YLGA 3QW0A 1Z7Qc 3S0XA 2HJMA 4ZLDA 1R4TA 3SP1A 3B0PA 5E3AA 2YVKA 3Q6NA 3WODF 5FCLA 1QQ3A 3B9QA 1OR3A 5COGA 1NSGB 1FFHA 1YZCA 3IHUA 3O10A 4G7ZF 1K4TA 4E7SA 3JSEO 1H9TA 2KGOA 3K33A 2J7PA 3HNJA 3L8IA 4CS7A 4UDVA 4KI2A 1LE2A 1U89A 1ZHWA 1ZU4A 2YL3A 1OKKA 3DKAA 4CBEA 1D0YA 1SMYF 2J9BA 3FOPA 2HV6A 3IQCA 2LK4A 2YZSA 3K66A 3X2QC 3GANA 2TMVP 4WGZA 4M63A 1MQVA 2WZFA 4CS9C 1TFOB 1A41A 3RYLA 2I15A 3S9OA 1QZXA 4D4NA 5AC4A 5KYUB 2F4QA 1Z23A 3FDQA 1AUEA 3GODA 4YL1A 3AG3C 1RJ9A 3ZIBA 3O6XA 4G78A 5KYWB 4JKVA 4OIRF 4LLCA 2YWAA 4JEAA 3DE9A 3RVYA 4E7ZA 3HLZA 4CX9A 1D1AA 4DVYP 4OINF 1C02A 4KNVA 1GGQA 2VCCA 4MNDA 5EGYA 2WVQA 4LDRA 2L6HA 4YWQA 2W4MA 1FFTC 1NBBA 4U5CE 2KC3A 1V55C 2B0HA 2CGEA 1WN0A 2A68F 2L81A 3A11A 2H8AA 3FXHA 4JCZA 4JTDB 4YJWA 5COMA 1LS1A 4BJ5C 4U5DE 3S84A 5A6BA 2XLEA 3NMJA 1SR2A 4JW1A 2HZ8A 3GM3A 4XWJA 5E2QA 1LM3B 2FGYA 3TULA 2Q00A 1YYJA 2HUJA 2R7VA 2NUTB 2XRHA 3EG9B 3J06A 1TWGA 5A69A 1MMGA 1RRJA 1NU9C 1MNEA 3S90A 2DGJA 2ICWG 4HFKB 4MTOA 5DQZA 3C7JA 4CDYA 4BJ6C 1YARO 2I8BA 2VH3A 1ZHYA 2XLDA 3VF0A 5JT4A 5HSWA 3T4RA 2QY9A 4Q4ZF 3KH2A 5L3VA 1SC7A 3Q7LA 1ORJA 2W9YA 3GEIA 4MTGA 1MMNA 1QPUA 4D4XA 3ABKC 2BC5A 2D4UA 2CNWD 2G62A 3DJUB 4MQ9F 4MVZA 2KNHA 5BQGA 1PD1A 2ZXOA 1IZMA 3BEHA 3W2WA 3LNMB 5KYYA 1ZU5A 1CGOA 2KJGA 1EI7A 1KU2A 1BR2A 2OCCC 4K0DA 1ZYRF 3ZDLA 4CIHA 3N0TA 3PDMP 4IRUA 3ZC4A 2JPUA 2XM4A 3DXJF 3MX3A 2R7QA 2D5RB 5CI9A 1F1MA 3CQZA 1PD0A 2HMQA 1T6IA 3LESA 4I1OB 4MVRA 4U5FE 2H7VC 3E70C 5K0IA 2LCHA 4C3EA 3L8JA 2HFIA 3MFNA 2W4BA 4JTAB 3EH1A 5KYYB 3I5QA 3HNKA 5EHHA 4H54A 1G4WR 3B71A 4EIYA 1KTMA 2UUHA 1N1CA 2ETSA 2OU6A 3RVZA 3CAXA 4R32A 1S05A 2Y3HA 1GS9A 1CGNA 3OEOA 5BQIA 2OJQA 1ZW2A 1QVXA 4U5GA 1OCZC 4CSAC 3NRHA 1E84A 4YK5A 3EFOA 4BEJA 1EKYA 5B1AC 5BUOA 1JRAA 2EILC 1NZEA 1R49A 3O39A 3I4UA 5CIVA 4O6MA 3JYYA 3U0CA 3MYIA 4WGYA 1PV3A 1D1CA 2Q3TA 1R5ID 3W8HA 2Q9BA 2EPLX 1J8YF 1V54C 2PF4E 3EHMA 3EGXB 4JRZA 4WABA 1FTSA 4XQ1A 5DS4A 3U2LA 3VM6A 4JJFA 2IXMA 3UMIA 3ASNC 3MLGA 3RH3A 1FAPB 3EZIA 2XS1A 1TWAA 3EGDB 3MYFA 1B68A 2FAPB 1K4SA 3ZVRA 1C17M 4ER9A 3ZTMA 2R03A 3FVYA 2OEVA 3LLIA 2DB4A 5F28E 4XLNF 1M57C 1MMAA 3L0IA 1FR0A 4AX2A 4WJ0A 3R7CA 3N2ZB 3X1OA 5EK0A 2YL0A 3ZSUA 2DYSC 2J9WA 3EFOB 4EUKB 1H6GA 2C04A 4IAQA 1OCOC 4QI0A 1RKEA 2RD9A 1RKEB 1YA9A 3JCUQ 2XXAB 4DXWA 1Y4CA 3RQFA 2J9UA 3LEOA 2KQ9A 4PR9A 2HSQA 2EPNA 4JC7A 2YKZA 2EPKX 3L1MA 4G7OF 1Z3IX 5JLIA 2J0WA 1RCPA 3QVYA 3TOMA 3ABLC 2QLAA 1NH3A 3UGPA 3SZRA 2H7OA 3F46A 2Q4FA 1O87A 3G50A 5B1BC 1RXQA 1DOVA 1JPJA 2J7PD 2IXNA 5DLJA 4NY3A 4U9EA 2WVOA 1Y6DA 2DYRC 2YL1A 3E9VA 3SXKA 4YT8A 4HE8D 3IGCA 1OCCC 2IM8A 3F47A 3GEEA 3GEHA 3CZ6A 3KL4A 1RKCA 1I5NA 3IQ5A 4F4BA 1CPRA 2YRFA 1AVOB 3V5ZA 3ATPA 5T3WA 2R7RA 4O6NA 2IXPA 2AP3A 3RF3A 3SXMA 4EHPA 2O9XA 2XM0A 1TR2A 2NSGA 5JVEA 1YA7O 3Q7GA 4N6HA 3C8GD 4B6IA 5DQTA 1G4US 2R9RB 4QDLA 3H65A 4PACA 3M4CA 1RJ9B 5JUAA 2R7WA 5F5HA 4IJJA 4CS8A 3DAFA 1SZIA 1T5OA 1OQCA 2P1AA 3TD7A 4I3MA 3TK0A 3Q6MA 3IQTA 2V3CC 2Y3GA 4JIOA 1YJGA 4O6YA 1A31A 2CDQA 2VC9A 4MW8A 5COFA 5B3SC 1E83A 1ST6A 3LJBA 1T6UA 1JR8A 3JTLO 2BE5F 2P6VA 2A6EF 3AG4C 1FMVA 4LLEA 4U9DA 3TQOA 3HNIA 1Q0FA 4GYTA 3W2VA 4MVSA 4BJ6A 3S29A
chains in the Genus database with same CATH topology
1RRJA 1LPQA 1K4TA 1NH3A 2H7FX 1K4SA 1SC7A 2B9SA 1TL8A 1T8IA 1A36A 3M4AA 1A31A 1A35A 3IGCA 1RR8C 1A41A 2F4QA 2H7GX 1EJ9A 1SEUA 1R49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RRJ A;  1LPQ A;  1K4T A;  1NH3 A;  2H7F X;  1K4S A;  1SC7 A;  2B9S A;  1TL8 A;  1T8I A;  1A36 A;  3M4A A;  1A31 A;  1A35 A;  3IGC A;  1RR8 C;  1A41 A;  2F4Q A;  2H7G X;  1EJ9 A;  1SEU A;  1R49 A; 
#chains in the Genus database with same CATH topology
 3M79 A;  1M2V A;  2HSB A;  2LFD A;  3EH2 A;  1QSP A;  2Q7R A;  2ZXR A;  4JEB A;  3NMK A;  3OWT A;  4LDQ A;  2F22 A;  3JYH A;  3FAP B;  1I4Y A;  4G0H A;  1OXK A;  1OXB A;  4ONS A;  3FMS A;  3U8P A;  3PHF 2;  3EJN A;  5A6J A;  2KK1 A;  3V5X A;  4P9F A;  2LQG A;  4J32 B;  4XEV A;  4EWC A;  4PK4 A;  4CS8 C;  4J7Y A;  1YLM A;  2A6H F;  1VB5 A;  1TWH A;  5JS5 A;  4ANJ A;  1IW7 F;  1FNT c;  1BBH A;  5IY5 C;  5L0D A;  2NUP B;  2XLW A;  3TOL A;  4IGG A;  3QZC A;  3L34 A;  1MND A;  1E85 A;  4I44 A;  2Y39 A;  4BPM A;  4XLP F;  3KPH A;  1M6T A;  3KYJ A;  2AWY A;  3DZA A;  3SYN A;  4EBB A;  1EQ1 A;  3HJC A;  3HKK A;  1S7Z A;  2EPM X;  2H7B A;  2OEX A;  2ZXW C;  3JRM O;  4J7T A;  5L0J A;  2DI3 A;  4DRI B;  3GOR A;  2Q9C A;  3QMK A;  4MVO A;  4NC3 A;  1ZHZ A;  4YL0 A;  3WG7 C;  3JRT A;  3JSZ A;  2L6F A;  1JPN A;  3DJN B;  2GAQ A;  2R7S A;  2V26 A;  1A7V A;  2PNO A;  2NG1 A;  3RQE A;  5KYX A;  1SYQ A;  3C8G A;  4JTC B;  1FMW A;  2NPU A;  1V4A A;  2LSE A;  1Q0M A;  2GWW A;  3W8I A;  5HV9 A;  3CSK A;  2A0U A;  5JRA A;  4E18 A;  2B9S A;  2ZD9 A;  2EIN C;  4DVZ A;  3LEV A;  3G4X A;  2A1D D;  1UFB A;  3O55 A;  1ORS C;  1YAU O;  4JJG A;  4Z9I A;  5KYN A;  1JMW A;  3GWL A;  4C3B A;  1JOG A;  3R2P A;  1LPE A;  4ULW A;  4AL1 A;  2A69 F;  2R7U A;  1TQG A;  2Z15 A;  1XWJ A;  3DE8 A;  4RDA A;  3KYI A;  2H7G X;  3AQB A;  3DI5 A;  1W2W A;  1WWP A;  2AWC A;  4BJ5 A;  5KYW A;  2QTV A;  2M64 A;  2WL8 A;  4FWV A;  2J0X A;  5AGF A;  1UG7 A;  1VLT A;  3S27 A;  5JP7 A;  1M56 C;  1NFO A;  1O5H A;  3DM9 B;  4H4K C;  4Q5S F;  4KC9 A;  5B3I A;  2E87 A;  1HY5 A;  2WZL A;  4N4W A;  3BRJ A;  2CNW A;  3GM1 A;  5KYU A;  3ABM C;  4CDV A;  1VYI A;  2P0N A;  1BR4 A;  2QNL A;  4HEA J;  2P61 A;  2PBE A;  4U5E E;  1HMD A;  1LI7 A;  2NUT A;  1ZHT A;  3PMR A;  4NTF A;  4YT5 A;  1LS4 A;  4E17 A;  4C7O A;  4BEM J;  2YL7 A;  2J9V A;  1NLX A;  2GA0 A;  2M4E A;  3T6J A;  4IAO A;  4MVU A;  5L0F A;  4KNW A;  3IQ6 A;  4P6I C;  4XTK A;  4NCQ A;  2IYL D;  5D91 A;  2XSE A;  1GQA A;  4PJJ A;  1D0X A;  1CPQ A;  4O79 A;  4C3D A;  1ORY A;  3UMK A;  1J8M F;  2JX0 A;  4DBQ A;  4DBR A;  1OW7 A;  3B0V C;  2HKV A;  2OQM A;  1L7C A;  1WGW A;  1ZHX A;  2B0J A;  2XXA A;  1VTM P;  1U0B B;  3CEX A;  1LPQ A;  4AL0 A;  256B A;  1T9K A;  1AEP A;  3I5P A;  2IBF A;  3WAQ A;  4I1M A;  3NYL A;  2H7F X;  2ZPA A;  1LKX A;  2LFF A;  3K6B A;  4N06 A;  3C8G B;  3K7D A;  3MBG A;  3PCV A;  4W8K A;  3US6 A;  1K40 A;  4KBL A;  5T1D B;  3LS0 A;  2P7V A;  3M4A A;  2AVK A;  3S28 A;  2LP4 A;  5E3C A;  2XS8 A;  4FES A;  3EGX A;  4DJ9 A;  2YEV A;  1T6Q A;  3EZH A;  5T3T A;  1DOW A;  1ZZP A;  1U6H A;  4QI2 A;  5AC5 A;  3SXZ A;  4RD9 A;  2WZG A;  4BJT A;  2HJ3 A;  4LDK A;  2Y69 C;  3ZQY A;  2NSF A;  3AG1 C;  2VCB A;  3DM5 A;  1HMO A;  3H2U A;  1HE1 A;  2R02 A;  4MW3 A;  4PJL A;  4IB4 A;  1M2O A;  1OCR C;  2PX0 A;  3AQC A;  2G3V A;  3M1C B;  4JZA A;  3POV A;  2J46 A;  2X51 A;  3DD7 A;  2XL8 A;  3RQG A;  1TFK B;  3DMD A;  4DRH B;  4ZLC A;  1TWC A;  1ZW3 A;  3FHD A;  4JCH A;  3KMI A;  3K1I C;  4NTA A;  1OKK D;  2QUP A;  1GM5 A;  1A7D A;  3AGT A;  1LE4 A;  2J45 A;  2LIG A;  3NG1 A;  3NYJ A;  2KSF A;  3AG2 C;  4LAC B;  5KYX B;  4X0R A;  1Z6A A;  4O7G A;  2R7T A;  5TJ5 E;  3EGD A;  5A6K A;  4L6R A;  3U3F A;  1TKN A;  3VYW A;  3KKB A;  1YZA A;  4CJO A;  3DWW A;  2VCA A;  1A35 A;  4RBN A;  3ASO C;  4BJ1 A;  3RFY A;  4A2N B;  1CGM E;  2BL2 A;  1A0B A;  2J8W A;  2CCY A;  3VAY A;  1PCX A;  3DAG A;  3EG9 A;  4OD5 A;  1YDI A;  3NKE A;  4PJM A;  1H9G A;  3RKO F;  4CS9 A;  1BR1 A;  4U5B E;  4CIP A;  3EHN A;  2XL4 A;  2AU5 A;  3UR3 C;  3G4Z A;  3ZWI A;  3FAJ A;  2L6G A;  2EIM C;  2OKU A;  5D92 A;  1QKR A;  2YHS A;  4NTB A;  2CYD A;  4CJG A;  3U8V A;  1D0Z A;  2A0B A;  2XLV A;  4NQF A;  4CSA A;  4W8P A;  1WOL A;  1YVI A;  3QTH A;  2CW0 F;  1SF8 A;  1Z5Z A;  2FFH A;  5L0I A;  3C62 A;  2MYS A;  4FAP B;  1BDJ B;  4YT4 A;  4PFO A;  1H7I A;  2XLM A;  1C03 A;  2RSE B;  4U5H A;  4MVM A;  2WB7 A;  5CI8 A;  4IAR A;  4C7O B;  2R7O A;  3LAY A;  1XZP A;  1VMA A;  3JZ0 A;  2GFH A;  4OIQ F;  2IXO A;  5L0H A;  4OD4 A;  4G7H F;  3LNR A;  4EKW A;  4OIO F;  4YT2 A;  2JD3 A;  1E2X A;  3TJ5 A;  2OJE D;  4XPY A;  4AE4 A;  4HFF B;  2R7X A;  3AJM A;  3U2M A;  2IOQ A;  1HW1 A;  3AGU A;  1KNY A;  2YLI A;  1O3U A;  4ULV A;  3ZG1 A;  4E0H A;  5A6A A;  4OIP F;  4XPW A;  3IEE A;  3LUT B;  1OW8 A;  1BZ4 A;  1VOM A;  2KYH A;  3EQL F;  4IWB A;  1LVK A;  4J30 B;  1E86 A;  1Z63 A;  4JVS A;  2MWQ A;  1NFN A;  1VYK A;  3NKD A;  3ZQV A;  3T9O A;  3T6B A;  3RW0 A;  3QW1 A;  4PFP A;  3GWN A;  1V74 B;  2OG2 A;  2UUI A;  3A9C A;  4CDA A;  4XEK A;  5DS5 A;  1RMV A;  1D1B A;  3K1I A;  1JAF A;  2EIK C;  2PFD A;  1SEU A;  2HS5 A;  4MVQ A;  3SXY A;  2VAS A;  2W45 A;  4YL3 A;  3UNG C;  3QVZ A;  2GDC A;  5L3Q A;  3NDB B;  2R05 A;  1WAT A;  4DOZ A;  3JT1 A;  4YN0 B;  1A7E A;  1Q0G A;  4LER A;  2LD6 A;  2PP4 A;  5GPG B;  2X0C A;  4E0I A;  1I4Z A;  3B29 A;  1Q0D A;  1QLE C;  4GEH A;  3M4B A;  3SEO A;  3UMH A;  5L0C A;  4XEF A;  4MS2 A;  3ECS A;  2HV7 A;  1WAS A;  2ASR A;  1WTY A;  2QE9 A;  1EA8 A;  2ZXP A;  3LS1 A;  3T6G B;  3U5S A;  4EBJ A;  4MTF A;  3C18 A;  4BG0 A;  1NG1 A;  1LI5 A;  1NU7 D;  1OR2 A;  4P9T A;  2VB6 A;  1OW6 A;  3V5Y A;  5DS6 A;  1HW2 A;  3ZTZ A;  3EPV A;  4EBK A;  2WVN A;  4Z9H A;  1Q0K A;  2Y3D A;  2G3K A;  2PX3 A;  1RR8 C;  3WHN A;  3B0U X;  1G5Z A;  4GQH A;  3V7O A;  1ZVZ A;  3C8Z A;  1APC A;  5BQH A;  2L7A A;  4Q7C A;  4JE9 A;  4PJN A;  3N24 A;  3NMI A;  3K1H A;  4DRJ B;  3HNL A;  1M2V B;  2HMZ A;  2YLD A;  3IPM O;  3NYM A;  3AOU A;  4K7B A;  3U3B A;  4AE4 B;  1G8X A;  1VLS A;  1HE9 A;  2KW3 C;  2MHR A;  2Y3B A;  3U9M A;  3W4Y A;  1K05 A;  1L3P A;  1K04 A;  2XL6 A;  3ITF A;  3FOO A;  3M15 A;  3OA1 A;  3UGO A;  5F5F A;  4N6C A;  2EPO A;  4FX5 A;  1VK5 A;  2Q9A A;  2XLH A;  3LLK A;  3U9J A;  3HTK C;  3VRC A;  2XLO A;  1TL8 A;  5JSL A;  2YQY A;  5DVW A;  3RIP A;  1T8I A;  3C63 A;  4K1O A;  1A36 A;  3TJ6 A;  2L9J A;  3GM2 A;  5FZT A;  5A6B D;  4A4A A;  5E33 A;  4AK9 A;  2NUP A;  1XZQ A;  2C03 A;  2R25 A;  3H2V A;  4Z9J A;  2EIJ C;  1EJ9 A;  4JUR I;  2OOC A;  4XPX A;  3SNH A;  5L0G A;  1LIH A;  1MMD A;  1T01 A;  1YYX A;  2YLG A;  3QW0 A;  1Z7Q c;  3S0X A;  2HJM A;  4ZLD A;  1R4T A;  3SP1 A;  3B0P A;  5E3A A;  2YVK A;  3Q6N A;  3WOD F;  5FCL A;  1QQ3 A;  3B9Q A;  1OR3 A;  5COG A;  1NSG B;  1FFH A;  1YZC A;  3IHU A;  3O10 A;  4G7Z F;  1K4T A;  4E7S A;  3JSE O;  1H9T A;  2KGO A;  3K33 A;  2J7P A;  3HNJ A;  3L8I A;  4CS7 A;  4UDV A;  4KI2 A;  1LE2 A;  1U89 A;  1ZHW A;  1ZU4 A;  2YL3 A;  1OKK A;  3DKA A;  4CBE A;  1D0Y A;  1SMY F;  2J9B A;  3FOP A;  2HV6 A;  3IQC A;  2LK4 A;  2YZS A;  3K66 A;  3X2Q C;  3GAN A;  2TMV P;  4WGZ A;  4M63 A;  1MQV A;  2WZF A;  4CS9 C;  1TFO B;  1A41 A;  3RYL A;  2I15 A;  3S9O A;  1QZX A;  4D4N A;  5AC4 A;  5KYU B;  2F4Q A;  1Z23 A;  3FDQ A;  1AUE A;  3GOD A;  4YL1 A;  3AG3 C;  1RJ9 A;  3ZIB A;  3O6X A;  4G78 A;  5KYW B;  4JKV A;  4OIR F;  4LLC A;  2YWA A;  4JEA A;  3DE9 A;  3RVY A;  4E7Z A;  3HLZ A;  4CX9 A;  1D1A A;  4DVY P;  4OIN F;  1C02 A;  4KNV A;  1GGQ A;  2VCC A;  4MND A;  5EGY A;  2WVQ A;  4LDR A;  2L6H A;  4YWQ A;  2W4M A;  1FFT C;  1NBB A;  4U5C E;  2KC3 A;  1V55 C;  2B0H A;  2CGE A;  1WN0 A;  2A68 F;  2L81 A;  3A11 A;  2H8A A;  3FXH A;  4JCZ A;  4JTD B;  4YJW A;  5COM A;  1LS1 A;  4BJ5 C;  4U5D E;  3S84 A;  5A6B A;  2XLE A;  3NMJ A;  1SR2 A;  4JW1 A;  2HZ8 A;  3GM3 A;  4XWJ A;  5E2Q A;  1LM3 B;  2FGY A;  3TUL A;  2Q00 A;  1YYJ A;  2HUJ A;  2R7V A;  2NUT B;  2XRH A;  3EG9 B;  3J06 A;  1TWG A;  5A69 A;  1MMG A;  1RRJ A;  1NU9 C;  1MNE A;  3S90 A;  2DGJ A;  2ICW G;  4HFK B;  4MTO A;  5DQZ A;  3C7J A;  4CDY A;  4BJ6 C;  1YAR O;  2I8B A;  2VH3 A;  1ZHY A;  2XLD A;  3VF0 A;  5JT4 A;  5HSW A;  3T4R A;  2QY9 A;  4Q4Z F;  3KH2 A;  5L3V A;  1SC7 A;  3Q7L A;  1ORJ A;  2W9Y A;  3GEI A;  4MTG A;  1MMN A;  1QPU A;  4D4X A;  3ABK C;  2BC5 A;  2D4U A;  2CNW D;  2G62 A;  3DJU B;  4MQ9 F;  4MVZ A;  2KNH A;  5BQG A;  1PD1 A;  2ZXO A;  1IZM A;  3BEH A;  3W2W A;  3LNM B;  5KYY A;  1ZU5 A;  1CGO A;  2KJG A;  1EI7 A;  1KU2 A;  1BR2 A;  2OCC C;  4K0D A;  1ZYR F;  3ZDL A;  4CIH A;  3N0T A;  3PDM P;  4IRU A;  3ZC4 A;  2JPU A;  2XM4 A;  3DXJ F;  3MX3 A;  2R7Q A;  2D5R B;  5CI9 A;  1F1M A;  3CQZ A;  1PD0 A;  2HMQ A;  1T6I A;  3LES A;  4I1O B;  4MVR A;  4U5F E;  2H7V C;  3E70 C;  5K0I A;  2LCH A;  4C3E A;  3L8J A;  2HFI A;  3MFN A;  2W4B A;  4JTA B;  3EH1 A;  5KYY B;  3I5Q A;  3HNK A;  5EHH A;  4H54 A;  1G4W R;  3B71 A;  4EIY A;  1KTM A;  2UUH A;  1N1C A;  2ETS A;  2OU6 A;  3RVZ A;  3CAX A;  4R32 A;  1S05 A;  2Y3H A;  1GS9 A;  1CGN A;  3OEO A;  5BQI A;  2OJQ A;  1ZW2 A;  1QVX A;  4U5G A;  1OCZ C;  4CSA C;  3NRH A;  1E84 A;  4YK5 A;  3EFO A;  4BEJ A;  1EKY A;  5B1A C;  5BUO A;  1JRA A;  2EIL C;  1NZE A;  1R49 A;  3O39 A;  3I4U A;  5CIV A;  4O6M A;  3JYY A;  3U0C A;  3MYI A;  4WGY A;  1PV3 A;  1D1C A;  2Q3T A;  1R5I D;  3W8H A;  2Q9B A;  2EPL X;  1J8Y F;  1V54 C;  2PF4 E;  3EHM A;  3EGX B;  4JRZ A;  4WAB A;  1FTS A;  4XQ1 A;  5DS4 A;  3U2L A;  3VM6 A;  4JJF A;  2IXM A;  3UMI A;  3ASN C;  3MLG A;  3RH3 A;  1FAP B;  3EZI A;  2XS1 A;  1TWA A;  3EGD B;  3MYF A;  1B68 A;  2FAP B;  1K4S A;  3ZVR A;  1C17 M;  4ER9 A;  3ZTM A;  2R03 A;  3FVY A;  2OEV A;  3LLI A;  2DB4 A;  5F28 E;  4XLN F;  1M57 C;  1MMA A;  3L0I A;  1FR0 A;  4AX2 A;  4WJ0 A;  3R7C A;  3N2Z B;  3X1O A;  5EK0 A;  2YL0 A;  3ZSU A;  2DYS C;  2J9W A;  3EFO B;  4EUK B;  1H6G A;  2C04 A;  4IAQ A;  1OCO C;  4QI0 A;  1RKE A;  2RD9 A;  1RKE B;  1YA9 A;  3JCU Q;  2XXA B;  4DXW A;  1Y4C A;  3RQF A;  2J9U A;  3LEO A;  2KQ9 A;  4PR9 A;  2HSQ A;  2EPN A;  4JC7 A;  2YKZ A;  2EPK X;  3L1M A;  4G7O F;  1Z3I X;  5JLI A;  2J0W A;  1RCP A;  3QVY A;  3TOM A;  3ABL C;  2QLA A;  1NH3 A;  3UGP A;  3SZR A;  2H7O A;  3F46 A;  2Q4F A;  1O87 A;  3G50 A;  5B1B C;  1RXQ A;  1DOV A;  1JPJ A;  2J7P D;  2IXN A;  5DLJ A;  4NY3 A;  4U9E A;  2WVO A;  1Y6D A;  2DYR C;  2YL1 A;  3E9V A;  3SXK A;  4YT8 A;  4HE8 D;  3IGC A;  1OCC C;  2IM8 A;  3F47 A;  3GEE A;  3GEH A;  3CZ6 A;  3KL4 A;  1RKC A;  1I5N A;  3IQ5 A;  4F4B A;  1CPR A;  2YRF A;  1AVO B;  3V5Z A;  3ATP A;  5T3W A;  2R7R A;  4O6N A;  2IXP A;  2AP3 A;  3RF3 A;  3SXM A;  4EHP A;  2O9X A;  2XM0 A;  1TR2 A;  2NSG A;  5JVE A;  1YA7 O;  3Q7G A;  4N6H A;  3C8G D;  4B6I A;  5DQT A;  1G4U S;  2R9R B;  4QDL A;  3H65 A;  4PAC A;  3M4C A;  1RJ9 B;  5JUA A;  2R7W A;  5F5H A;  4IJJ A;  4CS8 A;  3DAF A;  1SZI A;  1T5O A;  1OQC A;  2P1A A;  3TD7 A;  4I3M A;  3TK0 A;  3Q6M A;  3IQT A;  2V3C C;  2Y3G A;  4JIO A;  1YJG A;  4O6Y A;  1A31 A;  2CDQ A;  2VC9 A;  4MW8 A;  5COF A;  5B3S C;  1E83 A;  1ST6 A;  3LJB A;  1T6U A;  1JR8 A;  3JTL O;  2BE5 F;  2P6V A;  2A6E F;  3AG4 C;  1FMV A;  4LLE A;  4U9D A;  3TQO A;  3HNI A;  1Q0F A;  4GYT A;  3W2V A;  4MVS A;  4BJ6 A;  3S29 A; 
#chains in the Genus database with same CATH homology
 1RRJ A;  1LPQ A;  1K4T A;  1NH3 A;  2H7F X;  1K4S A;  1SC7 A;  2B9S A;  1TL8 A;  1T8I A;  1A36 A;  3M4A A;  1A31 A;  1A35 A;  3IGC A;  1RR8 C;  1A41 A;  2F4Q A;  2H7G X;  1EJ9 A;  1SEU A;  1R49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...