1A41A

Type 1-topoisomerase catalytic fragment from vaccinia virus
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
230
structure length
221
Chain Sequence
NAKRDRIFVRVYNVMKRINCFINKNIKKSSTDSNYQLAVFMLMETMFFKENETVGLLTLKNKHIEISPDEIVIKFVGKDKVSHEFVVHKSNRLYKPLLKLTDDSSPEEFLFNKLSERKVYECIKQFGIRIKDLRTYGVNYTFLYNFWTNVKSISPLPSPKKLIALTIKQTAEVVGHTPSISKRAYMATTILEMVKDKNFLDVVSKTTFDEFLSIVVDHVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOPOISOMERASE I
publication title Conservation of structure and mechanism between eukaryotic topoisomerase I and site-specific recombinases.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Isomerase
total genus 72
structure length 221
sequence length 230
ec nomenclature ec 5.99.1.2: Transferred entry: 5.6.2.2.
pdb deposition date 1998-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.380 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Type 1-topoisomerase catalytic fragment, domain 2 1a41A02
3.90.15.10 Alpha Beta Alpha-Beta Complex Topoisomerase I; Chain A, domain 3 Topoisomerase I; Chain A, domain 3 1a41A01
1A35A 1SEUA 1EJ9A 1RR8C 2F4QA 1A41A 1LPQA 1A36A 1K4SA 1R49A 1K4TA 2H7GX 1T8IA 1NH3A 2B9SA 3IGCA 2H7FX 3M4AA 1SC7A 1RRJA 1TL8A 1A31A
chains in the Genus database with same CATH superfamily
2V3CC 4RD9A 1MQVA 2NUTB 256BA 4IWBA 5B3IA 2J46A 3M4CA 5KYUB 4G0HA 3LLKA 1PCXA 1G5ZA 3HKKA 1YDIA 2XLWA 3K1IC 5HV9A 4Q4ZF 1OKKA 4EBKA 4NTFA 3V5XA 3VM6A 5DQTA 1K4SA 4J7TA 1Q0MA 2H7GX 2QNLA 4C7OA 1BR2A 3AG3C 2ZXRA 3H2VA 2C03A 3X2QC 2P1AA 2OEXA 3QTHA 4XPYA 1ZVZA 3NMIA 3ZTMA 3PHF2 4BG0A 4JEAA 2R7TA 2AVKA 2HS5A 1RRJA 3JSEO 3U9MA 3EHNA 2C04A 2V26A 3C8ZA 1AVOB 1L3PA 2D4UA 4MS2A 3DI5A 2WVOA 3GM3A 2R7RA 2J0WA 4MTGA 4PFPA 1SR2A 1K04A 2HJMA 3ZDLA 3S90A 4C7OB 1HMDA 3U8PA 1PD1A 2ETSA 3CZ6A 1GS9A 3IQTA 3TD7A 4ANJA 1LVKA 3CQZA 3JT1A 4MVMA 2R7WA 2EIMC 2Q3TA 3GM1A 3O55A 1QSPA 4E7ZA 1BDJB 1E85A 3HLZA 3DE9A 3C7JA 3SNHA 3AGUA 3EPVA 1H9GA 2XL8A 4GQHA 1JPNA 1NLXA 2IYLD 2Z15A 1NZEA 2PBEA 1YAUO 4BEMJ 1PD0A 2YLGA 1APCA 3I5PA 3NMKA 4XLNF 3LNRA 5E33A 3IPMO 5FZTA 4IB4A 1AEPA 4MVQA 1D0YA 3S27A 2J9VA 3L0IA 2XXAA 3T6GB 2QY9A 3IEEA 5DS5A 1OXBA 3Q6NA 5A6BA 2FAPB 4JKVA 3FDQA 4DRJB 1TQGA 3DM5A 3JYHA 5DS4A 1E86A 4HFKB 1TR2A 2QTVA 2XLDA 2EINC 3K6BA 1K05A 1K40A 2A0BA 4LLEA 4N06A 3SEOA 3ZSUA 1GGQA 2ASRA 5T3WA 1FMVA 4BJ1A 2I15A 1VYKA 1EI7A 4F4BA 1A36A 5JLIA 3PCVA 2XXAB 3DWWA 4ULWA 2J7PA 3OEOA 4J30B 1RKEA 2Y3HA 3KPHA 2DYRC 1A7EA 1ZHZA 2JX0A 2VASA 2B0JA 3U8VA 4EUKB 4YJWA 4YN0B 3IQ6A 1YJGA 3C63A 4MTOA 1KTMA 5A69A 3RVZA 5L0IA 2LP4A 1LS4A 4OD5A 4CJOA 1TWCA 2CYDA 4PFOA 1D1AA 3F46A 3HNKA 3MX3A 1HW1A 1A0BA 3Q6MA 4K7BA 4ER9A 1FAPB 4WGZA 2WB7A 4DXWA 2P61A 2JD3A 2NUPA 1PV3A 4Z9IA 4XPWA 3DXJF 4P9TA 4NY3A 1CGOA 4YL3A 4NC3A 4BJTA 3E9VA 3WODF 4JZAA 3ZQYA 3AQCA 2KSFA 4OIQF 4LDQA 5A6JA 1QZXA 2L6FA 2R05A 1R49A 1MMAA 2A0UA 2LD6A 2Y3DA 3LJBA 3LS0A 1C03A 3ZVRA 5AGFA 2HV7A 2LIGA 2MYSA 3UNGC 2CNWA 2F22A 2VCAA 4JTCB 3KH2A 3WG7C 2KC3A 2ZXOA 4CSAA 2OOCA 5BQGA 1LKXA 3NYLA 3B29A 4JCZA 1QVXA 3TJ6A 2DI3A 3QW0A 1ZHXA 1H6GA 2R25A 4LERA 4BJ6A 4CS8A 2HMZA 3QZCA 3I5QA 2M64A 1TL8A 1CPQA 5FCLA 1Y4CA 1DOVA 4CBEA 2LFFA 3C8GD 2AWYA 3R7CA 2OKUA 3K1IA 1V54C 1YARO 1VOMA 4YT8A 1I5NA 4YL0A 4JRZA 1NFOA 4OINF 4AL0A 2EPNA 4P9FA 4O6YA 5D92A 2H8AA 1C02A 2MHRA 2MWQA 4JJGA 4LDRA 4JCHA 2EPMX 4O7GA 3DKAA 5COMA 1NSGB 1GM5A 4JVSA 2NUTA 4D4NA 3EG9A 1T6IA 1HE9A 1Z23A 1QLEC 4KNWA 4R32A 1MMGA 2HSBA 2HZ8A 2ZXWC 4RBNA 4OIPF 2J9WA 2HFIA 3IGCA 2X51A 4U5CE 3DJUB 2PX3A 1N1CA 2KYHA 3LLIA 1D1CA 3NKEA 3EGDB 3EZIA 1OCOC 1BBHA 2UUIA 5COGA 2WVNA 4KC9A 1M2VA 2A1DD 5HSWA 1I4YA 3T6BA 4EBBA 3N24A 1YZCA 1ZYRF 2YEVA 1H7IA 1QQ3A 3GODA 3H2UA 2LCHA 2IXNA 2LSEA 1WWPA 1SEUA 2I8BA 2L6GA 4C3BA 3B0UX 3EG9B 3K7DA 5D91A 2XLEA 2A68F 2ICWG 2PNOA 4QDLA 3VRCA 2DB4A 3JCUQ 4WJ0A 2W45A 2HSQA 2J9BA 3EGXB 2R9RB 3HNLA 2WVQA 3KKBA 4MW8A 4B6IA 3RVYA 3LS1A 4MVSA 2PP4A 1VLTA 2L7AA 2OQMA 3F47A 1M2VB 1ST6A 2YWAA 1OXKA 1A7VA 3O10A 4HFFB 1Y6DA 1EQ1A 3M4AA 2L81A 4WGYA 3M4BA 3IQCA 5JRAA 2VCBA 1Q0FA 3UR3C 5L3VA 3US6A 2O9XA 4ZLCA 3TQOA 4N6CA 1J8YF 4ULVA 1OW6A 4DRIB 1A35A 2H7VC 2YLIA 1JOGA 2EILC 2R03A 4KNVA 4XWJA 1FTSA 1FNTc 1WTYA 3TULA 1Z6AA 2FFHA 2E87A 1OCCC 4BJ6C 2XL4A 3KMIA 1YYXA 5E2QA 1OCRC 1D0ZA 2IXMA 3RF3A 3SP1A 4EHPA 4XQ1A 4AK9A 2EIKC 4AE4B 2HV6A 4IRUA 1J8MF 3ABKC 4Q5SF 1HE1A 3S9OA 1W2WA 2A6HF 3LEVA 1I4ZA 2Y39A 3S28A 5IY5C 3PMRA 3GEIA 1LM3B 1EKYA 2L9JA 2UUHA 1IW7F 2IM8A 4JURI 5TJ5E 5L0GA 1LS1A 1M56C 2OCCC 1JPJA 2P7VA 3JZ0A 1ZW3A 3MLGA 1LIHA 4K1OA 1VK5A 3FOOA 5KYXB 2GDCA 5JT4A 3EQLF 4YWQA 1ZU5A 4MVRA 4NTAA 4U9EA 2H7OA 4LDKA 1A7DA 4JEBA 2LK4A 1HW2A 3DAGA 1JR8A 2B0HA 2HUJA 1MNDA 1IZMA 3DZAA 5T1DB 3I4UA 5EK0A 2WZGA 3FMSA 1E83A 4M63A 5L0FA 1Z7Qc 5EHHA 4YT5A 2YL0A 3ZG1A 1ORSC 4XLPF 4U5BE 3AGTA 3FHDA 4PJJA 1G4WR 3DD7A 3ZQVA 4XEVA 1FMWA 2B9SA 1T8IA 1NH3A 2FGYA 2BE5F 3KYJA 3CSKA 3IQ5A 1U6HA 1VLSA 2XM0A 1NFNA 4N6HA 2YL7A 3FXHA 4K0DA 4MQ9F 4U5HA 4ZLDA 1JAFA 3MYIA 4JC7A 4JJFA 4JTDB 1A31A 1QPUA 4DRHB 3NMJA 2AU5A 1G4US 3W8IA 2H7BA 1T6QA 2XRHA 3EH2A 2Q7RA 3UMIA 3JRTA 5CI9A 3A11A 4YT4A 2EIJC 1B68A 2EPOA 2G3KA 4O6MA 2A69F 2AP3A 4IGGA 4NTBA 3SXKA 1O87A 3HTKC 5F5HA 4Z9HA 1NBBA 1L7CA 5L0DA 3PDMP 1YA9A 5DS6A 3L1MA 1KNYA 1KU2A 1VTMP 2J7PD 3BRJA 1XZPA 2XS8A 3U0CA 4J32B 2QLAA 3U5SA 4OIRF 5KYWB 2GFHA 2CW0F 4CIPA 4O6NA 2QUPA 1ZW2A 3T9OA 3DMDA 3L8IA 4L6RA 2BC5A 3QMKA 2HJ3A 1TFKB 2Y3BA 1RCPA 3GWLA 3VAYA 1OR2A 3NG1A 2WL8A 3JRMO 3W8HA 4CS7A 5BQHA 5L3QA 2Q9BA 3EHMA 4HEAJ 2IXPA 3ZTZA 2P6VA 1UG7A 1TKNA 5BQIA 1MMNA 3OA1A 4RDAA 1Q0DA 1MNEA 1RJ9B 3LUTB 4YL1A 3HNJA 1WGWA 4PACA 3RYLA 1LPEA 3EGDA 2R02A 2Q9AA 2YKZA 3ZWIA 1O3UA 3SXZA 3AQBA 4E7SA 1M2OA 2BL2A 2WZFA 2ZXPA 1EA8A 1WN0A 2OJQA 2CNWD 3LNMB 3RW0A 4JTAB 5JP7A 5BUOA 2M4EA 3U9JA 1Z3IX 2NPUA 3K66A 4DBRA 2KNHA 1F1MA 3C8GB 4DOZA 2PX0A 3NYJA 3O39A 4Q7CA 1YA7O 5A6KA 5L0HA 2H7FX 4EKWA 4PJMA 3EGXA 1SC7A 3UMKA 5JVEA 1T9KA 4CDVA 4P6IC 2YL3A 4E0HA 4PJLA 3Q7LA 2R7VA 2IXOA 4WABA 1VB5A 2XLHA 2OEVA 2CDQA 3RIPA 3TJ5A 4ONSA 3QVYA 2R7SA 1UFBA 4CIHA 3AG2C 1OCZC 1BZ4A 3TK0A 1SF8A 2YLDA 4PR9A 4MNDA 1XWJA 1V74B 4GYTA 5E3CA 2KQ9A 4JE9A 4MVOA 4MVZA 3B71A 3HJCA 2IBFA 2R7OA 3U2MA 3HNIA 5T3TA 3GWNA 3RQGA 3AJMA 4FWVA 2Y3GA 1E2XA 3GANA 1NG1A 4IAOA 3MYFA 2YRFA 3ASOC 4IARA 3RQEA 4DVZA 4XEFA 4OIOF 4BJ5C 4U5EE 4CX9A 3EH1A 4QI2A 2G3VA 4N4WA 3N0TA 4AE4A 1RMVA 3T6JA 3BEHA 3U3FA 1OQCA 1ORJA 3AOUA 4I1OB 1XZQA 4I1MA 3FAJA 4MVUA 4QI0A 1OW8A 1CPRA 3G4ZA 4EWCA 3G4XA 2L6HA 1SZIA 1LE4A 1EJ9A 4EIYA 1D1BA 2D5RB 2XL6A 4H54A 5DLJA 1RXQA 4W8KA 1E84A 1OR3A 5COFA 1OKKD 3ABMC 3DAFA 5KYXA 1M6TA 3DE8A 3SXYA 5B3SC 2HMQA 4W8PA 3JSZA 2J9UA 3NYMA 1H9TA 2XSEA 2OU6A 1T01A 3TOMA 1NU9C 3GEEA 1TWAA 2AWCA 1ZZPA 4J7YA 4BEJA 4C3EA 3S29A 5KYNA 3RFYA 1Q0GA 3QVZA 1SYQA 1V55C 3DM9B 2R7QA 3ABLC 2G62A 2YHSA 3DJNB 3L8JA 4JW1A 4NCQA 4U9DA 2VC9A 2XS1A 3M15A 3NRHA 5F28E 4E17A 1JMWA 3V5ZA 4AX2A 2ZD9A 3O6XA 3JYYA 4E18A 4MW3A 4CS9C 5B1BC 4G7HF 2TMVP 4CDAA 3GORA 3UMHA 1CGNA 2J8WA 4IJJA 4O79A 1RKCA 1U0BB 2IOQA 4CJGA 2EPLX 1R5ID 1A41A 3WHNA 3W4YA 2EPKX 3POVA 1ZHYA 2CGEA 3ZC4A 2R7UA 4XEKA 2P0NA 1K4TA 1G8XA 4BPMA 3AG4C 3RQFA 4D4XA 4DJ9A 3B0PA 2J45A 2XLVA 4PJNA 3GEHA 4X0RA 3UGPA 4A4AA 1WASA 5JS5A 1FFTC 1CGME 1FR0A 2PF4E 1OW7A 3WAQA 3TOLA 4U5GA 5CIVA 3B9QA 1TWGA 4IAQA 5A6BD 3U3BA 1FFHA 1HY5A 2LQGA 4DBQA 4AL1A 3QW1A 2W4BA 5KYWA 4PK4A 5A6AA 3KL4A 3E70C 4G78A 4UDVA 3LESA 1V4AA 1LI5A 3NDBB 3T4RA 3GM2A 1Z5ZA 2WZLA 3UGOA 1Z63A 4CDYA 1O5HA 1T5OA 2GAQA 2Q4FA 3H65A 4CS8C 1U89A 4FX5A 4H4KC 2Y69C 2GA0A 2RD9A 3K33A 3VF0A 3B0VC 5AC5A 4Z9JA 2JPUA 1VYIA 3L34A 1RJ9A 1YLMA 3A9CA 3M1CB 1Q0KA 3W2WA 1ZU4A 4HE8D 2LFDA 5F5FA 3V5YA 2KGOA 3ITFA 2OG2A 3SXMA 1D0XA 4C3DA 1YVIA 4KI2A 4XTKA 3RKOF 2KJGA 1S05A 2VB6A 3CEXA 4DVYP 5GPGB 3NKDA 3K1HA 5B1AC 2XLOA 3C8GA 2VH3A 3FVYA 2Q9CA 3ASNC 4KBLA 4LACB 5DQZA 4FAPB 1RKEB 2R7XA 2A6EF 2YZSA 2YQYA 2F4QA 3W2VA 1ORYA 2W4MA 1BR4A 3IHUA 1T6UA 4XPXA 2XLMA 4U5DE 1MMDA 2GWWA 4G7ZF 3LEOA 5JUAA 2NG1A 4MTFA 3SZRA 2DYSC 1YYJA 3MBGA 1AUEA 4BJ5A 1M57C 2XM4A 1TFOB 3R2PA 1LE2A 5L0JA 4YK5A 4YT2A 3G50A 1YZAA 5CI8A 4I44A 3SYNA 4U5FE 3JTLO 2NUPB 3MFNA 3Q7GA 2KW3C 2VCCA 2X0CA 1BR1A 1TWHA 2NSFA 1S7ZA 4JIOA 2CCYA 1ZHWA 4G7OF 4OD4A 4FESA 2W9YA 3LAYA 5JSLA 2YVKA 3M79A 4I3MA 5KYYA 3EZHA 3AG1C 3ZIBA 1SMYF 1R4TA 1LI7A 4E0IA 1RR8C 1VMAA 4LLCA 1QKRA 3FAPB 1C17M 5E3AA 1HMOA 3ATPA 3EFOA 3KYIA 3EJNA 2HKVA 1LPQA 5DVWA 4A2NB 3VYWA 2J0XA 3CAXA 1NU7D 5KYUA 5K0IA 3ECSA 5EGYA 1WOLA 2YL1A 3J06A 1ZHTA 3OWTA 5L0CA 3C62A 2RSEB 2ZPAA 4EBJA 2QE9A 5KYYB 1WATA 4GEHA 3V7OA 5AC4A 4CSAC 3X1OA 2KK1A 1GQAA 2DGJA 3RH3A 4NQFA 3C18A 3FOPA 1DOWA 2Q00A 2PFDA 3U2LA 3N2ZB 4CS9A 3EFOB 3S0XA 1JRAA 3S84A 2OJED 2NSGA
chains in the Genus database with same CATH topology
1A35A 1SEUA 1EJ9A 1RR8C 2F4QA 1A41A 1LPQA 1A36A 1K4SA 1R49A 1K4TA 2H7GX 1T8IA 1NH3A 2B9SA 3IGCA 2H7FX 3M4AA 1SC7A 1RRJA 1TL8A 1A31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A35 A;  1SEU A;  1EJ9 A;  1RR8 C;  2F4Q A;  1A41 A;  1LPQ A;  1A36 A;  1K4S A;  1R49 A;  1K4T A;  2H7G X;  1T8I A;  1NH3 A;  2B9S A;  3IGC A;  2H7F X;  3M4A A;  1SC7 A;  1RRJ A;  1TL8 A;  1A31 A; 
#chains in the Genus database with same CATH topology
 2V3C C;  4RD9 A;  1MQV A;  2NUT B;  256B A;  4IWB A;  5B3I A;  2J46 A;  3M4C A;  5KYU B;  4G0H A;  3LLK A;  1PCX A;  1G5Z A;  3HKK A;  1YDI A;  2XLW A;  3K1I C;  5HV9 A;  4Q4Z F;  1OKK A;  4EBK A;  4NTF A;  3V5X A;  3VM6 A;  5DQT A;  1K4S A;  4J7T A;  1Q0M A;  2H7G X;  2QNL A;  4C7O A;  1BR2 A;  3AG3 C;  2ZXR A;  3H2V A;  2C03 A;  3X2Q C;  2P1A A;  2OEX A;  3QTH A;  4XPY A;  1ZVZ A;  3NMI A;  3ZTM A;  3PHF 2;  4BG0 A;  4JEA A;  2R7T A;  2AVK A;  2HS5 A;  1RRJ A;  3JSE O;  3U9M A;  3EHN A;  2C04 A;  2V26 A;  3C8Z A;  1AVO B;  1L3P A;  2D4U A;  4MS2 A;  3DI5 A;  2WVO A;  3GM3 A;  2R7R A;  2J0W A;  4MTG A;  4PFP A;  1SR2 A;  1K04 A;  2HJM A;  3ZDL A;  3S90 A;  4C7O B;  1HMD A;  3U8P A;  1PD1 A;  2ETS A;  3CZ6 A;  1GS9 A;  3IQT A;  3TD7 A;  4ANJ A;  1LVK A;  3CQZ A;  3JT1 A;  4MVM A;  2R7W A;  2EIM C;  2Q3T A;  3GM1 A;  3O55 A;  1QSP A;  4E7Z A;  1BDJ B;  1E85 A;  3HLZ A;  3DE9 A;  3C7J A;  3SNH A;  3AGU A;  3EPV A;  1H9G A;  2XL8 A;  4GQH A;  1JPN A;  1NLX A;  2IYL D;  2Z15 A;  1NZE A;  2PBE A;  1YAU O;  4BEM J;  1PD0 A;  2YLG A;  1APC A;  3I5P A;  3NMK A;  4XLN F;  3LNR A;  5E33 A;  3IPM O;  5FZT A;  4IB4 A;  1AEP A;  4MVQ A;  1D0Y A;  3S27 A;  2J9V A;  3L0I A;  2XXA A;  3T6G B;  2QY9 A;  3IEE A;  5DS5 A;  1OXB A;  3Q6N A;  5A6B A;  2FAP B;  4JKV A;  3FDQ A;  4DRJ B;  1TQG A;  3DM5 A;  3JYH A;  5DS4 A;  1E86 A;  4HFK B;  1TR2 A;  2QTV A;  2XLD A;  2EIN C;  3K6B A;  1K05 A;  1K40 A;  2A0B A;  4LLE A;  4N06 A;  3SEO A;  3ZSU A;  1GGQ A;  2ASR A;  5T3W A;  1FMV A;  4BJ1 A;  2I15 A;  1VYK A;  1EI7 A;  4F4B A;  1A36 A;  5JLI A;  3PCV A;  2XXA B;  3DWW A;  4ULW A;  2J7P A;  3OEO A;  4J30 B;  1RKE A;  2Y3H A;  3KPH A;  2DYR C;  1A7E A;  1ZHZ A;  2JX0 A;  2VAS A;  2B0J A;  3U8V A;  4EUK B;  4YJW A;  4YN0 B;  3IQ6 A;  1YJG A;  3C63 A;  4MTO A;  1KTM A;  5A69 A;  3RVZ A;  5L0I A;  2LP4 A;  1LS4 A;  4OD5 A;  4CJO A;  1TWC A;  2CYD A;  4PFO A;  1D1A A;  3F46 A;  3HNK A;  3MX3 A;  1HW1 A;  1A0B A;  3Q6M A;  4K7B A;  4ER9 A;  1FAP B;  4WGZ A;  2WB7 A;  4DXW A;  2P61 A;  2JD3 A;  2NUP A;  1PV3 A;  4Z9I A;  4XPW A;  3DXJ F;  4P9T A;  4NY3 A;  1CGO A;  4YL3 A;  4NC3 A;  4BJT A;  3E9V A;  3WOD F;  4JZA A;  3ZQY A;  3AQC A;  2KSF A;  4OIQ F;  4LDQ A;  5A6J A;  1QZX A;  2L6F A;  2R05 A;  1R49 A;  1MMA A;  2A0U A;  2LD6 A;  2Y3D A;  3LJB A;  3LS0 A;  1C03 A;  3ZVR A;  5AGF A;  2HV7 A;  2LIG A;  2MYS A;  3UNG C;  2CNW A;  2F22 A;  2VCA A;  4JTC B;  3KH2 A;  3WG7 C;  2KC3 A;  2ZXO A;  4CSA A;  2OOC A;  5BQG A;  1LKX A;  3NYL A;  3B29 A;  4JCZ A;  1QVX A;  3TJ6 A;  2DI3 A;  3QW0 A;  1ZHX A;  1H6G A;  2R25 A;  4LER A;  4BJ6 A;  4CS8 A;  2HMZ A;  3QZC A;  3I5Q A;  2M64 A;  1TL8 A;  1CPQ A;  5FCL A;  1Y4C A;  1DOV A;  4CBE A;  2LFF A;  3C8G D;  2AWY A;  3R7C A;  2OKU A;  3K1I A;  1V54 C;  1YAR O;  1VOM A;  4YT8 A;  1I5N A;  4YL0 A;  4JRZ A;  1NFO A;  4OIN F;  4AL0 A;  2EPN A;  4P9F A;  4O6Y A;  5D92 A;  2H8A A;  1C02 A;  2MHR A;  2MWQ A;  4JJG A;  4LDR A;  4JCH A;  2EPM X;  4O7G A;  3DKA A;  5COM A;  1NSG B;  1GM5 A;  4JVS A;  2NUT A;  4D4N A;  3EG9 A;  1T6I A;  1HE9 A;  1Z23 A;  1QLE C;  4KNW A;  4R32 A;  1MMG A;  2HSB A;  2HZ8 A;  2ZXW C;  4RBN A;  4OIP F;  2J9W A;  2HFI A;  3IGC A;  2X51 A;  4U5C E;  3DJU B;  2PX3 A;  1N1C A;  2KYH A;  3LLI A;  1D1C A;  3NKE A;  3EGD B;  3EZI A;  1OCO C;  1BBH A;  2UUI A;  5COG A;  2WVN A;  4KC9 A;  1M2V A;  2A1D D;  5HSW A;  1I4Y A;  3T6B A;  4EBB A;  3N24 A;  1YZC A;  1ZYR F;  2YEV A;  1H7I A;  1QQ3 A;  3GOD A;  3H2U A;  2LCH A;  2IXN A;  2LSE A;  1WWP A;  1SEU A;  2I8B A;  2L6G A;  4C3B A;  3B0U X;  3EG9 B;  3K7D A;  5D91 A;  2XLE A;  2A68 F;  2ICW G;  2PNO A;  4QDL A;  3VRC A;  2DB4 A;  3JCU Q;  4WJ0 A;  2W45 A;  2HSQ A;  2J9B A;  3EGX B;  2R9R B;  3HNL A;  2WVQ A;  3KKB A;  4MW8 A;  4B6I A;  3RVY A;  3LS1 A;  4MVS A;  2PP4 A;  1VLT A;  2L7A A;  2OQM A;  3F47 A;  1M2V B;  1ST6 A;  2YWA A;  1OXK A;  1A7V A;  3O10 A;  4HFF B;  1Y6D A;  1EQ1 A;  3M4A A;  2L81 A;  4WGY A;  3M4B A;  3IQC A;  5JRA A;  2VCB A;  1Q0F A;  3UR3 C;  5L3V A;  3US6 A;  2O9X A;  4ZLC A;  3TQO A;  4N6C A;  1J8Y F;  4ULV A;  1OW6 A;  4DRI B;  1A35 A;  2H7V C;  2YLI A;  1JOG A;  2EIL C;  2R03 A;  4KNV A;  4XWJ A;  1FTS A;  1FNT c;  1WTY A;  3TUL A;  1Z6A A;  2FFH A;  2E87 A;  1OCC C;  4BJ6 C;  2XL4 A;  3KMI A;  1YYX A;  5E2Q A;  1OCR C;  1D0Z A;  2IXM A;  3RF3 A;  3SP1 A;  4EHP A;  4XQ1 A;  4AK9 A;  2EIK C;  4AE4 B;  2HV6 A;  4IRU A;  1J8M F;  3ABK C;  4Q5S F;  1HE1 A;  3S9O A;  1W2W A;  2A6H F;  3LEV A;  1I4Z A;  2Y39 A;  3S28 A;  5IY5 C;  3PMR A;  3GEI A;  1LM3 B;  1EKY A;  2L9J A;  2UUH A;  1IW7 F;  2IM8 A;  4JUR I;  5TJ5 E;  5L0G A;  1LS1 A;  1M56 C;  2OCC C;  1JPJ A;  2P7V A;  3JZ0 A;  1ZW3 A;  3MLG A;  1LIH A;  4K1O A;  1VK5 A;  3FOO A;  5KYX B;  2GDC A;  5JT4 A;  3EQL F;  4YWQ A;  1ZU5 A;  4MVR A;  4NTA A;  4U9E A;  2H7O A;  4LDK A;  1A7D A;  4JEB A;  2LK4 A;  1HW2 A;  3DAG A;  1JR8 A;  2B0H A;  2HUJ A;  1MND A;  1IZM A;  3DZA A;  5T1D B;  3I4U A;  5EK0 A;  2WZG A;  3FMS A;  1E83 A;  4M63 A;  5L0F A;  1Z7Q c;  5EHH A;  4YT5 A;  2YL0 A;  3ZG1 A;  1ORS C;  4XLP F;  4U5B E;  3AGT A;  3FHD A;  4PJJ A;  1G4W R;  3DD7 A;  3ZQV A;  4XEV A;  1FMW A;  2B9S A;  1T8I A;  1NH3 A;  2FGY A;  2BE5 F;  3KYJ A;  3CSK A;  3IQ5 A;  1U6H A;  1VLS A;  2XM0 A;  1NFN A;  4N6H A;  2YL7 A;  3FXH A;  4K0D A;  4MQ9 F;  4U5H A;  4ZLD A;  1JAF A;  3MYI A;  4JC7 A;  4JJF A;  4JTD B;  1A31 A;  1QPU A;  4DRH B;  3NMJ A;  2AU5 A;  1G4U S;  3W8I A;  2H7B A;  1T6Q A;  2XRH A;  3EH2 A;  2Q7R A;  3UMI A;  3JRT A;  5CI9 A;  3A11 A;  4YT4 A;  2EIJ C;  1B68 A;  2EPO A;  2G3K A;  4O6M A;  2A69 F;  2AP3 A;  4IGG A;  4NTB A;  3SXK A;  1O87 A;  3HTK C;  5F5H A;  4Z9H A;  1NBB A;  1L7C A;  5L0D A;  3PDM P;  1YA9 A;  5DS6 A;  3L1M A;  1KNY A;  1KU2 A;  1VTM P;  2J7P D;  3BRJ A;  1XZP A;  2XS8 A;  3U0C A;  4J32 B;  2QLA A;  3U5S A;  4OIR F;  5KYW B;  2GFH A;  2CW0 F;  4CIP A;  4O6N A;  2QUP A;  1ZW2 A;  3T9O A;  3DMD A;  3L8I A;  4L6R A;  2BC5 A;  3QMK A;  2HJ3 A;  1TFK B;  2Y3B A;  1RCP A;  3GWL A;  3VAY A;  1OR2 A;  3NG1 A;  2WL8 A;  3JRM O;  3W8H A;  4CS7 A;  5BQH A;  5L3Q A;  2Q9B A;  3EHM A;  4HEA J;  2IXP A;  3ZTZ A;  2P6V A;  1UG7 A;  1TKN A;  5BQI A;  1MMN A;  3OA1 A;  4RDA A;  1Q0D A;  1MNE A;  1RJ9 B;  3LUT B;  4YL1 A;  3HNJ A;  1WGW A;  4PAC A;  3RYL A;  1LPE A;  3EGD A;  2R02 A;  2Q9A A;  2YKZ A;  3ZWI A;  1O3U A;  3SXZ A;  3AQB A;  4E7S A;  1M2O A;  2BL2 A;  2WZF A;  2ZXP A;  1EA8 A;  1WN0 A;  2OJQ A;  2CNW D;  3LNM B;  3RW0 A;  4JTA B;  5JP7 A;  5BUO A;  2M4E A;  3U9J A;  1Z3I X;  2NPU A;  3K66 A;  4DBR A;  2KNH A;  1F1M A;  3C8G B;  4DOZ A;  2PX0 A;  3NYJ A;  3O39 A;  4Q7C A;  1YA7 O;  5A6K A;  5L0H A;  2H7F X;  4EKW A;  4PJM A;  3EGX A;  1SC7 A;  3UMK A;  5JVE A;  1T9K A;  4CDV A;  4P6I C;  2YL3 A;  4E0H A;  4PJL A;  3Q7L A;  2R7V A;  2IXO A;  4WAB A;  1VB5 A;  2XLH A;  2OEV A;  2CDQ A;  3RIP A;  3TJ5 A;  4ONS A;  3QVY A;  2R7S A;  1UFB A;  4CIH A;  3AG2 C;  1OCZ C;  1BZ4 A;  3TK0 A;  1SF8 A;  2YLD A;  4PR9 A;  4MND A;  1XWJ A;  1V74 B;  4GYT A;  5E3C A;  2KQ9 A;  4JE9 A;  4MVO A;  4MVZ A;  3B71 A;  3HJC A;  2IBF A;  2R7O A;  3U2M A;  3HNI A;  5T3T A;  3GWN A;  3RQG A;  3AJM A;  4FWV A;  2Y3G A;  1E2X A;  3GAN A;  1NG1 A;  4IAO A;  3MYF A;  2YRF A;  3ASO C;  4IAR A;  3RQE A;  4DVZ A;  4XEF A;  4OIO F;  4BJ5 C;  4U5E E;  4CX9 A;  3EH1 A;  4QI2 A;  2G3V A;  4N4W A;  3N0T A;  4AE4 A;  1RMV A;  3T6J A;  3BEH A;  3U3F A;  1OQC A;  1ORJ A;  3AOU A;  4I1O B;  1XZQ A;  4I1M A;  3FAJ A;  4MVU A;  4QI0 A;  1OW8 A;  1CPR A;  3G4Z A;  4EWC A;  3G4X A;  2L6H A;  1SZI A;  1LE4 A;  1EJ9 A;  4EIY A;  1D1B A;  2D5R B;  2XL6 A;  4H54 A;  5DLJ A;  1RXQ A;  4W8K A;  1E84 A;  1OR3 A;  5COF A;  1OKK D;  3ABM C;  3DAF A;  5KYX A;  1M6T A;  3DE8 A;  3SXY A;  5B3S C;  2HMQ A;  4W8P A;  3JSZ A;  2J9U A;  3NYM A;  1H9T A;  2XSE A;  2OU6 A;  1T01 A;  3TOM A;  1NU9 C;  3GEE A;  1TWA A;  2AWC A;  1ZZP A;  4J7Y A;  4BEJ A;  4C3E A;  3S29 A;  5KYN A;  3RFY A;  1Q0G A;  3QVZ A;  1SYQ A;  1V55 C;  3DM9 B;  2R7Q A;  3ABL C;  2G62 A;  2YHS A;  3DJN B;  3L8J A;  4JW1 A;  4NCQ A;  4U9D A;  2VC9 A;  2XS1 A;  3M15 A;  3NRH A;  5F28 E;  4E17 A;  1JMW A;  3V5Z A;  4AX2 A;  2ZD9 A;  3O6X A;  3JYY A;  4E18 A;  4MW3 A;  4CS9 C;  5B1B C;  4G7H F;  2TMV P;  4CDA A;  3GOR A;  3UMH A;  1CGN A;  2J8W A;  4IJJ A;  4O79 A;  1RKC A;  1U0B B;  2IOQ A;  4CJG A;  2EPL X;  1R5I D;  1A41 A;  3WHN A;  3W4Y A;  2EPK X;  3POV A;  1ZHY A;  2CGE A;  3ZC4 A;  2R7U A;  4XEK A;  2P0N A;  1K4T A;  1G8X A;  4BPM A;  3AG4 C;  3RQF A;  4D4X A;  4DJ9 A;  3B0P A;  2J45 A;  2XLV A;  4PJN A;  3GEH A;  4X0R A;  3UGP A;  4A4A A;  1WAS A;  5JS5 A;  1FFT C;  1CGM E;  1FR0 A;  2PF4 E;  1OW7 A;  3WAQ A;  3TOL A;  4U5G A;  5CIV A;  3B9Q A;  1TWG A;  4IAQ A;  5A6B D;  3U3B A;  1FFH A;  1HY5 A;  2LQG A;  4DBQ A;  4AL1 A;  3QW1 A;  2W4B A;  5KYW A;  4PK4 A;  5A6A A;  3KL4 A;  3E70 C;  4G78 A;  4UDV A;  3LES A;  1V4A A;  1LI5 A;  3NDB B;  3T4R A;  3GM2 A;  1Z5Z A;  2WZL A;  3UGO A;  1Z63 A;  4CDY A;  1O5H A;  1T5O A;  2GAQ A;  2Q4F A;  3H65 A;  4CS8 C;  1U89 A;  4FX5 A;  4H4K C;  2Y69 C;  2GA0 A;  2RD9 A;  3K33 A;  3VF0 A;  3B0V C;  5AC5 A;  4Z9J A;  2JPU A;  1VYI A;  3L34 A;  1RJ9 A;  1YLM A;  3A9C A;  3M1C B;  1Q0K A;  3W2W A;  1ZU4 A;  4HE8 D;  2LFD A;  5F5F A;  3V5Y A;  2KGO A;  3ITF A;  2OG2 A;  3SXM A;  1D0X A;  4C3D A;  1YVI A;  4KI2 A;  4XTK A;  3RKO F;  2KJG A;  1S05 A;  2VB6 A;  3CEX A;  4DVY P;  5GPG B;  3NKD A;  3K1H A;  5B1A C;  2XLO A;  3C8G A;  2VH3 A;  3FVY A;  2Q9C A;  3ASN C;  4KBL A;  4LAC B;  5DQZ A;  4FAP B;  1RKE B;  2R7X A;  2A6E F;  2YZS A;  2YQY A;  2F4Q A;  3W2V A;  1ORY A;  2W4M A;  1BR4 A;  3IHU A;  1T6U A;  4XPX A;  2XLM A;  4U5D E;  1MMD A;  2GWW A;  4G7Z F;  3LEO A;  5JUA A;  2NG1 A;  4MTF A;  3SZR A;  2DYS C;  1YYJ A;  3MBG A;  1AUE A;  4BJ5 A;  1M57 C;  2XM4 A;  1TFO B;  3R2P A;  1LE2 A;  5L0J A;  4YK5 A;  4YT2 A;  3G50 A;  1YZA A;  5CI8 A;  4I44 A;  3SYN A;  4U5F E;  3JTL O;  2NUP B;  3MFN A;  3Q7G A;  2KW3 C;  2VCC A;  2X0C A;  1BR1 A;  1TWH A;  2NSF A;  1S7Z A;  4JIO A;  2CCY A;  1ZHW A;  4G7O F;  4OD4 A;  4FES A;  2W9Y A;  3LAY A;  5JSL A;  2YVK A;  3M79 A;  4I3M A;  5KYY A;  3EZH A;  3AG1 C;  3ZIB A;  1SMY F;  1R4T A;  1LI7 A;  4E0I A;  1RR8 C;  1VMA A;  4LLC A;  1QKR A;  3FAP B;  1C17 M;  5E3A A;  1HMO A;  3ATP A;  3EFO A;  3KYI A;  3EJN A;  2HKV A;  1LPQ A;  5DVW A;  4A2N B;  3VYW A;  2J0X A;  3CAX A;  1NU7 D;  5KYU A;  5K0I A;  3ECS A;  5EGY A;  1WOL A;  2YL1 A;  3J06 A;  1ZHT A;  3OWT A;  5L0C A;  3C62 A;  2RSE B;  2ZPA A;  4EBJ A;  2QE9 A;  5KYY B;  1WAT A;  4GEH A;  3V7O A;  5AC4 A;  4CSA C;  3X1O A;  2KK1 A;  1GQA A;  2DGJ A;  3RH3 A;  4NQF A;  3C18 A;  3FOP A;  1DOW A;  2Q00 A;  2PFD A;  3U2L A;  3N2Z B;  4CS9 A;  3EFO B;  3S0X A;  1JRA A;  3S84 A;  2OJE D;  2NSG A; 
#chains in the Genus database with same CATH homology
 1A35 A;  1SEU A;  1EJ9 A;  1RR8 C;  2F4Q A;  1A41 A;  1LPQ A;  1A36 A;  1K4S A;  1R49 A;  1K4T A;  2H7G X;  1T8I A;  1NH3 A;  2B9S A;  3IGC A;  2H7F X;  3M4A A;  1SC7 A;  1RRJ A;  1TL8 A;  1A31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...