1A41A

Type 1-topoisomerase catalytic fragment from vaccinia virus
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
230
structure length
221
Chain Sequence
NAKRDRIFVRVYNVMKRINCFINKNIKKSSTDSNYQLAVFMLMETMFFKENETVGLLTLKNKHIEISPDEIVIKFVGKDKVSHEFVVHKSNRLYKPLLKLTDDSSPEEFLFNKLSERKVYECIKQFGIRIKDLRTYGVNYTFLYNFWTNVKSISPLPSPKKLIALTIKQTAEVVGHTPSISKRAYMATTILEMVKDKNFLDVVSKTTFDEFLSIVVDHVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOPOISOMERASE I
publication title Conservation of structure and mechanism between eukaryotic topoisomerase I and site-specific recombinases.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Isomerase
total genus 72
structure length 221
sequence length 230
ec nomenclature ec 5.99.1.2: Transferred entry: 5.6.2.2.
pdb deposition date 1998-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.380 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Type 1-topoisomerase catalytic fragment, domain 2 1a41A02
3.90.15.10 Alpha Beta Alpha-Beta Complex Topoisomerase I; Chain A, domain 3 Topoisomerase I; Chain A, domain 3 1a41A01
2F4QA 1SC7A 1RR8C 2H7FX 1RRJA 1R49A 1A36A 3IGCA 1K4TA 1NH3A 2H7GX 2B9SA 1TL8A 1A35A 1A31A 1A41A 3M4AA 1T8IA 1SEUA 1LPQA 1EJ9A 1K4SA
chains in the Genus database with same CATH superfamily
2EPOA 2IOQA 4MVRA 4YL3A 3O10A 1ORYA 1PD1A 1XWJA 1U89A 3UMIA 1ZHTA 2XLWA 3EPVA 4GYTA 2X51A 2FAPB 4NCQA 3UMKA 4F4BA 2XXAB 3VF0A 4EBJA 2VC9A 3T6BA 3Q6NA 2R7RA 4BPMA 2AVKA 4HE8D 5JVEA 4JCZA 2CNWA 4WABA 1PCXA 4U5HA 3K66A 2VB6A 3EFOB 1KU2A 1Q0GA 3C7JA 2W4MA 2WVQA 3QTHA 1CPQA 3HNKA 3T6GB 1YZCA 1LIHA 1LKXA 4BJ6C 2EIJC 2A1DD 4MVOA 2G62A 1FTSA 2G3VA 1UFBA 2IXPA 2NG1A 3RH3A 2OEXA 1ST6A 2J8WA 2Y69C 4K0DA 4XEFA 5COFA 3UR3C 3WODF 4PR9A 5A6KA 2L6GA 3KL4A 1QZXA 2QY9A 1H9TA 5AGFA 3N2ZB 3FMSA 3EH2A 4NTBA 2R03A 1ZHYA 4OIRF 1TWGA 2I8BA 2HV6A 5K0IA 3HNLA 4JTDB 4UDVA 3U2MA 4XPYA 5CI9A 2Y3HA 3EHMA 2H8AA 2R9RB 3JCUQ 1Z7Qc 2DGJA 3IPMO 3LUTB 2W9YA 3T4RA 3U3BA 5DS6A 4JRZA 1CGNA 1T9KA 5JS5A 2QUPA 1Q0FA 5F28E 1HE9A 3G4ZA 3H2VA 3UGPA 4YWQA 2B9SA 1TWHA 3O39A 1T6QA 4E18A 1BR4A 2Q4FA 3K7DA 4I1MA 3ABKC 2J45A 4G0HA 4JTCB 3QW0A 4E0HA 4CBEA 4C3BA 2MWQA 4MVSA 4YN0B 3R7CA 4WGZA 4JURI 2VCAA 2BE5F 2D5RB 4XLNF 1YA9A 5L0GA 3TQOA 3E9VA 2Y3GA 1ZHZA 1OCOC 2JPUA 2YWAA 3B71A 3AG1C 1LS1A 2ASRA 2EINC 4Z9IA 1VK5A 2J46A 1Q0MA 2IM8A 3KH2A 3RVYA 3AJMA 1HE1A 1Q0KA 4RD9A 4Z9HA 3VRCA 4Q4ZF 1L3PA 4KC9A 1LI7A 4CIHA 5KYYA 5TJ5E 4JZAA 2OJED 2ETSA 2Y39A 2CYDA 2Q00A 3K1HA 4IARA 3HKKA 3U3FA 4CS8A 1SR2A 2XL8A 3ABMC 3AG3C 2OOCA 4LDRA 3RFYA 3LESA 2L9JA 3FAJA 3FXHA 2FGYA 3TOMA 4XLPF 3PDMP 2OEVA 2G3KA 1MNDA 2AU5A 2A6HF 2ZXPA 3TJ5A 4NY3A 1L7CA 4OD4A 3GANA 4BJ5A 4DXWA 4YL1A 2UUIA 3M4CA 4JKVA 3TOLA 2HS5A 3KYIA 2XLMA 4P6IC 4RBNA 3HLZA 2QNLA 2HSQA 1OW8A 2YVKA 1SMYF 2J7PD 3E70C 3NYMA 4HFFB 4G78A 1HY5A 3ATPA 4O6NA 4J7TA 1EQ1A 2ZXOA 2LFDA 3LJBA 2A6EF 1OCZC 3JTLO 3TULA 1K05A 5B1BC 4U5BE 1RJ9A 1TL8A 3ZQVA 2ZPAA 4OINF 1OW6A 2XLEA 1MQVA 2LK4A 1BZ4A 4PFPA 1YYXA 2R02A 1K04A 3AGTA 4EKWA 1OR3A 3U8VA 1OXBA 1K4SA 4I44A 2NUPA 1RMVA 1YARO 4J32B 3S27A 2RSEB 3EJNA 3KKBA 2DI3A 4JC7A 2WVOA 2R7QA 1FFHA 3NMJA 2H7BA 1PD0A 1C03A 3SZRA 4CDYA 4I1OB 3OWTA 3HTKC 4GQHA 3ZDLA 1MMGA 4ZLCA 3NKEA 3SYNA 4MVQA 1NU9C 2A0BA 1WTYA 1K4TA 3H2UA 1C17M 1JR8A 1NH3A 1I5NA 4MW8A 1NSGB 5DQTA 3GM1A 3EG9B 3FOOA 4XQ1A 1O3UA 2ICWG 3WHNA 3L0IA 1D1CA 1HW1A 2J9UA 3MYIA 4CSAC 4X0RA 1Z3IX 1JMWA 1Z23A 2PP4A 2PX0A 4IWBA 2P0NA 3L34A 3UNGC 2KQ9A 5AC5A 4E7SA 2R7TA 1G8XA 1H6GA 2DYSC 2Q9CA 3ZTMA 3IQ6A 2CGEA 5KYXB 1APCA 1NFNA 4O7GA 4AK9A 1FMVA 4AL1A 1SC7A 4W8PA 4JCHA 1CGME 1A7EA 1JPJA 1M2VB 2LSEA 4IB4A 3OEOA 4MVMA 3O6XA 1B68A 5JLIA 3NYJA 2L81A 3K1IA 3CSKA 5DLJA 1I4ZA 3TD7A 2D4UA 5JSLA 4AE4A 4C7OA 2R7SA 2Q9BA 3GM2A 1D1BA 1J8YF 1MMNA 3WG7C 5IY5C 3QZCA 3LEOA 1LS4A 4E0IA 4BEJA 2F22A 1NG1A 1KNYA 5L0HA 2HV7A 2IXNA 2NSFA 4QI0A 2IBFA 4R32A 4CS9A 3M4AA 2R05A 3QVZA 4MS2A 2XM4A 2HFIA 3IQTA 3C18A 4NQFA 1G4US 4CDAA 4DRIB 2NUPB 2PX3A 3NG1A 4ULWA 1LPQA 3B0PA 3Q6MA 2WZFA 1VYKA 2YKZA 2L6HA 3HJCA 1D0YA 3HNJA 2KW3C 3FDQA 1F1MA 5BQGA 4A2NB 4KI2A 1DOVA 2P1AA 4LDQA 1T01A 2J9BA 5F5HA 4YT4A 2H7OA 3ASNC 4OIPF 2KYHA 2EPNA 3ASOC 3GEEA 2MYSA 3LS0A 4OD5A 3SXYA 4ER9A 1FNTc 4ZLDA 4BJTA 1EKYA 1RKCA 2WZGA 3C8GA 3AOUA 3JT1A 4IAQA 2LQGA 3UGOA 3S9OA 3V5XA 4BEMJ 4LLEA 4HFKB 2W45A 4FESA 2R25A 3DJUB 3M79A 5L0CA 3L8IA 1ORJA 3DJNB 2LD6A 1YAUO 4PJNA 4B6IA 3S0XA 2XLHA 3DWWA 2KNHA 2OU6A 4JEBA 1ZYRF 4EBBA 4YL0A 3SEOA 2Q9AA 4XPWA 1A0BA 1E83A 1LE4A 3FHDA 3I5PA 4JEAA 3W8HA 3DKAA 4AE4B 4EHPA 4C7OB 4J7YA 3LLKA 2IYLD 2J0XA 4AX2A 2NSGA 1NFOA 1V54C 1OQCA 4CJOA 4PK4A 4DBRA 2PBEA 4CS7A 3DE8A 2GAQA 4NC3A 3IEEA 1TFOB 5EK0A 5AC4A 2LFFA 2HSBA 4JJFA 1JRAA 2EPLX 4XEKA 2OKUA 1UG7A 2YLDA 3UMHA 1YDIA 1AEPA 3RYLA 3ZC4A 1N1CA 1D0XA 3AG4C 3CEXA 3RF3A 4BJ6A 5COMA 5E3CA 3SXMA 2FFHA 4JJGA 4KBLA 1SF8A 4DRJB 1Y4CA 1QKRA 1SEUA 2A69F 1LVKA 2EPMX 1R5ID 3HNIA 2YLGA 1G4WR 3IHUA 4MVUA 3SNHA 4PJJA 4AL0A 3ZG1A 3EH1A 2J7PA 4C3DA 2YHSA 1E2XA 1BDJB 3W2VA 3NMKA 3JSZA 3NKDA 2L7AA 3C8GB 1LI5A 3LAYA 2XLOA 4PJLA 5L0IA 4PFOA 3EQLF 4DOZA 2Z15A 3MBGA 5L0JA 1E85A 5E33A 3S90A 2H7GX 4I3MA 1A31A 3DAFA 2OG2A 2PFDA 3MLGA 5A6BA 3POVA 2GA0A 3FOPA 3ECSA 3EGXA 2KC3A 4CX9A 4H54A 2R7OA 1WN0A 5HV9A 3AGUA 2XLDA 4MTFA 4WGYA 4YJWA 1KTMA 2IXOA 4DBQA 1O87A 3KYJA 3W2WA 2ZD9A 4XTKA 3U9MA 5CIVA 4N6CA 2OCCC 4IGGA 2H7FX 5EHHA 1LM3B 3NYLA 1Z6AA 3JRMO 2W4BA 1FR0A 5CI8A 4XEVA 3C62A 4DVYP 3GWLA 5BQHA 4O6YA 1S05A 5JP7A 4ONSA 4E7ZA 5B3IA 3I4UA 1OCRC 2QE9A 3DZAA 4CIPA 3C8ZA 5COGA 3RQFA 2GWWA 1E86A 1YZAA 3H65A 4D4NA 3S84A 1ZU4A 2YZSA 3MX3A 3F47A 3QVYA 5KYYB 1A41A 2AWCA 3L1MA 4JVSA 1YVIA 2EILC 3EGDA 4M63A 3VM6A 2BL2A 1TWCA 2OQMA 3IQ5A 1OR2A 3M1CB 4YT8A 4FWVA 3RW0A 3B0UX 1BR1A 2KSFA 2LP4A 1C02A 4U5EE 3DAGA 2KGOA 3U8PA 3WAQA 2F4QA 1TQGA 2DB4A 4QDLA 3PHF2 5D91A 2XM0A 256BA 1E84A 1HMDA 3AQCA 2M64A 3LLIA 1ZHWA 1QSPA 3AQBA 3QMKA 2YL0A 3EZIA 1OW7A 4G7HF 2A68F 2ZXRA 3C63A 3U5SA 4MVZA 1M56C 4PJMA 2RD9A 4RDAA 5L3VA 3NRHA 4G7ZF 2HUJA 5KYWA 2R7UA 3GORA 2YL7A 2J9WA 5DS4A 3SXKA 5JUAA 3EGXB 1VYIA 5GPGB 3CQZA 1QLEC 1RJ9B 2XS8A 2P61A 3QW1A 3SXZA 1T8IA 4D4XA 2XS1A 3SP1A 3EHNA 2YEVA 1M57C 1ZU5A 1YYJA 1DOWA 3Q7LA 1R49A 1EJ9A 3BEHA 1T6IA 3VYWA 5BUOA 3U9JA 2DYRC 2XSEA 5A6AA 1OKKD 2I15A 3FAPB 2AWYA 1IZMA 1T6UA 2IXMA 2VH3A 2E87A 3B9QA 3KPHA 4MQ9F 1VTMP 4JW1A 1H9GA 2XL4A 2Q7RA 1XZQA 1EI7A 3EGDB 4H4KC 2VCCA 1GGQA 1WASA 4LACB 5L0FA 1BBHA 1CGOA 1VB5A 3O55A 5JRAA 1A35A 4K1OA 4N06A 5B1AC 3US6A 2GFHA 1FAPB 2NUTA 4QI2A 3FVYA 2OJQA 2PNOA 2XRHA 2CW0F 3PCVA 4P9TA 5FZTA 3ZWIA 1M2OA 1XZPA 3CZ6A 3VAYA 4WJ0A 3DE9A 3G50A 4EIYA 3ZIBA 4CSAA 3DI5A 2CNWD 3F46A 5KYUA 2YL3A 1A7DA 2VCBA 1LE2A 1JAFA 4O79A 4P9FA 4CS8C 4Q5SF 2YL1A 3X2QC 2CCYA 1ZW2A 2EIKC 3Q7GA 2EIMC 3RQGA 3X1OA 3DD7A 4EUKB 1OXKA 1RRJA 2P7VA 3JRTA 3DMDA 3T6JA 5DVWA 5DS5A 4EBKA 4BJ5C 4N4WA 5KYWB 1RKEA 1LPEA 3GWNA 4IRUA 1SYQA 4O6MA 2R7WA 4OIQF 1O5HA 3LNRA 4DRHB 3DM9B 1CPRA 2YQYA 3K33A 4LDKA 1SZIA 1W2WA 1VOMA 2AP3A 4MTGA 4NTFA 4U9DA 4N6HA 1AVOB 1MMAA 4J30B 4JIOA 5KYXA 2HZ8A 4MNDA 2GDCA 4W8KA 3BRJA 2C03A 2V26A 3ITFA 4C3EA 3A11A 3W8IA 4EWCA 3OA1A 1VLSA 1WGWA 2A0UA 3C8GD 4CDVA 2M4EA 3ZTZA 3LNMB 2H7VC 4IJJA 2UUHA 3CAXA 1A7VA 3LS1A 1QQ3A 1T5OA 2Y3DA 4XPXA 1D0ZA 3JYYA 3K6BA 5T3WA 2YLIA 4JE9A 2YRFA 4CS9C 3M4BA 2VASA 5DQZA 4K7BA 2Q3TA 2HMZA 1HMOA 3ZQYA 2MHRA 1A36A 3GEIA 3M15A 1QPUA 3U2LA 3ZVRA 3A9CA 1K40A 2EPKX 4ULVA 3B0VC 5F5FA 2HJ3A 1I4YA 2NUTB 3ZSUA 3IGCA 4YK5A 1ZW3A 3TK0A 3NDBB 2WL8A 3GEHA 2J9VA 4LERA 4MTOA 4YT5A 1PV3A 3V5ZA 4DJ9A 3JYHA 4KNVA 5D92A 3GODA 1AUEA 5E2QA 5KYUB 2R7XA 2L6FA 1GS9A 2LIGA 4PACA 3EZHA 3EG9A 3W4YA 1YA7O 1YLMA 2HMQA 4GEHA 1HW2A 1U0BB 3DXJF 4HEAJ 5A6JA 1Y6DA 2PF4E 3J06A 4U5DE 2BC5A 1Q0DA 1RKEB 4IAOA 3V7OA 3ABLC 3AG2C 2B0HA 3RVZA 4FAPB 2X0CA 2CDQA 4A4AA 3I5QA 2C04A 1YJGA 2KK1A 4Q7CA 3V5YA 2R7VA 3K1IC 2JX0A 1M2VA 5E3AA 3RIPA 4JTAB 1ZZPA 3RKOF 4BG0A 1U6HA 3S29A 5BQIA 4U5GA 1NZEA 3DM5A 1ORSC 3L8JA 2XXAA 1V4AA 1WWPA 4E17A 3JSEO 3U0CA 1FMWA 1RXQA 3B29A 4MW3A 5HSWA 1EA8A 1G5ZA 3NMIA 1TWAA 3GM3A 1V74B 1Z5ZA 1H7IA 1JPNA 3EFOA 4DVZA 3KMIA 3G4XA 1RR8C 1TR2A 2Y3BA 1FFTC 4KNWA 2KJGA 4U5CE 1R4TA 2V3CC 1NU7D 4LLCA 5A6BD 1NLXA 1TKNA 2HKVA 4CJGA 5KYNA 2XL6A 1V55C 1WATA 2QTVA 1MNEA 1BR2A 1D1AA 1RCPA 2XLVA 4XWJA 4Z9JA 1OCCC 5A69A 4G7OF 4ANJA 2J0WA 1GM5A 5T1DB 2P6VA 1M6TA 3MYFA 4U9EA 1TFKB 4FX5A 1MMDA 2HJMA 4OIOF 1JOGA 2WZLA 4NTAA 3N0TA 5T3TA 4YT2A 1VLTA 2O9XA 3MFNA 3N24A 4U5FE 5JT4A 3JZ0A 1Z63A 3PMRA 3R2PA 2ZXWC 1ZHXA 2WVNA 5L3QA 2QLAA 1NBBA 2WB7A 2TMVP 5FCLA 1WOLA 2B0JA 1GQAA 1OKKA 2LCHA 2NPUA 3TJ6A 3RQEA 4BJ1A 3IQCA 3S28A 3LEVA 5EGYA 1J8MF 1IW7F 5L0DA 5B3SC 3T9OA 1VMAA 1ZVZA 2JD3A 1S7ZA 4L6RA 1QVXA
chains in the Genus database with same CATH topology
2F4QA 1SC7A 1RR8C 2H7FX 1RRJA 1R49A 1A36A 3IGCA 1K4TA 1NH3A 2H7GX 2B9SA 1TL8A 1A35A 1A31A 1A41A 3M4AA 1T8IA 1SEUA 1LPQA 1EJ9A 1K4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4Q A;  1SC7 A;  1RR8 C;  2H7F X;  1RRJ A;  1R49 A;  1A36 A;  3IGC A;  1K4T A;  1NH3 A;  2H7G X;  2B9S A;  1TL8 A;  1A35 A;  1A31 A;  1A41 A;  3M4A A;  1T8I A;  1SEU A;  1LPQ A;  1EJ9 A;  1K4S A; 
#chains in the Genus database with same CATH topology
 2EPO A;  2IOQ A;  4MVR A;  4YL3 A;  3O10 A;  1ORY A;  1PD1 A;  1XWJ A;  1U89 A;  3UMI A;  1ZHT A;  2XLW A;  3EPV A;  4GYT A;  2X51 A;  2FAP B;  4NCQ A;  3UMK A;  4F4B A;  2XXA B;  3VF0 A;  4EBJ A;  2VC9 A;  3T6B A;  3Q6N A;  2R7R A;  4BPM A;  2AVK A;  4HE8 D;  5JVE A;  4JCZ A;  2CNW A;  4WAB A;  1PCX A;  4U5H A;  3K66 A;  2VB6 A;  3EFO B;  1KU2 A;  1Q0G A;  3C7J A;  2W4M A;  2WVQ A;  3QTH A;  1CPQ A;  3HNK A;  3T6G B;  1YZC A;  1LIH A;  1LKX A;  4BJ6 C;  2EIJ C;  2A1D D;  4MVO A;  2G62 A;  1FTS A;  2G3V A;  1UFB A;  2IXP A;  2NG1 A;  3RH3 A;  2OEX A;  1ST6 A;  2J8W A;  2Y69 C;  4K0D A;  4XEF A;  5COF A;  3UR3 C;  3WOD F;  4PR9 A;  5A6K A;  2L6G A;  3KL4 A;  1QZX A;  2QY9 A;  1H9T A;  5AGF A;  3N2Z B;  3FMS A;  3EH2 A;  4NTB A;  2R03 A;  1ZHY A;  4OIR F;  1TWG A;  2I8B A;  2HV6 A;  5K0I A;  3HNL A;  4JTD B;  4UDV A;  3U2M A;  4XPY A;  5CI9 A;  2Y3H A;  3EHM A;  2H8A A;  2R9R B;  3JCU Q;  1Z7Q c;  2DGJ A;  3IPM O;  3LUT B;  2W9Y A;  3T4R A;  3U3B A;  5DS6 A;  4JRZ A;  1CGN A;  1T9K A;  5JS5 A;  2QUP A;  1Q0F A;  5F28 E;  1HE9 A;  3G4Z A;  3H2V A;  3UGP A;  4YWQ A;  2B9S A;  1TWH A;  3O39 A;  1T6Q A;  4E18 A;  1BR4 A;  2Q4F A;  3K7D A;  4I1M A;  3ABK C;  2J45 A;  4G0H A;  4JTC B;  3QW0 A;  4E0H A;  4CBE A;  4C3B A;  2MWQ A;  4MVS A;  4YN0 B;  3R7C A;  4WGZ A;  4JUR I;  2VCA A;  2BE5 F;  2D5R B;  4XLN F;  1YA9 A;  5L0G A;  3TQO A;  3E9V A;  2Y3G A;  1ZHZ A;  1OCO C;  2JPU A;  2YWA A;  3B71 A;  3AG1 C;  1LS1 A;  2ASR A;  2EIN C;  4Z9I A;  1VK5 A;  2J46 A;  1Q0M A;  2IM8 A;  3KH2 A;  3RVY A;  3AJM A;  1HE1 A;  1Q0K A;  4RD9 A;  4Z9H A;  3VRC A;  4Q4Z F;  1L3P A;  4KC9 A;  1LI7 A;  4CIH A;  5KYY A;  5TJ5 E;  4JZA A;  2OJE D;  2ETS A;  2Y39 A;  2CYD A;  2Q00 A;  3K1H A;  4IAR A;  3HKK A;  3U3F A;  4CS8 A;  1SR2 A;  2XL8 A;  3ABM C;  3AG3 C;  2OOC A;  4LDR A;  3RFY A;  3LES A;  2L9J A;  3FAJ A;  3FXH A;  2FGY A;  3TOM A;  4XLP F;  3PDM P;  2OEV A;  2G3K A;  1MND A;  2AU5 A;  2A6H F;  2ZXP A;  3TJ5 A;  4NY3 A;  1L7C A;  4OD4 A;  3GAN A;  4BJ5 A;  4DXW A;  4YL1 A;  2UUI A;  3M4C A;  4JKV A;  3TOL A;  2HS5 A;  3KYI A;  2XLM A;  4P6I C;  4RBN A;  3HLZ A;  2QNL A;  2HSQ A;  1OW8 A;  2YVK A;  1SMY F;  2J7P D;  3E70 C;  3NYM A;  4HFF B;  4G78 A;  1HY5 A;  3ATP A;  4O6N A;  4J7T A;  1EQ1 A;  2ZXO A;  2LFD A;  3LJB A;  2A6E F;  1OCZ C;  3JTL O;  3TUL A;  1K05 A;  5B1B C;  4U5B E;  1RJ9 A;  1TL8 A;  3ZQV A;  2ZPA A;  4OIN F;  1OW6 A;  2XLE A;  1MQV A;  2LK4 A;  1BZ4 A;  4PFP A;  1YYX A;  2R02 A;  1K04 A;  3AGT A;  4EKW A;  1OR3 A;  3U8V A;  1OXB A;  1K4S A;  4I44 A;  2NUP A;  1RMV A;  1YAR O;  4J32 B;  3S27 A;  2RSE B;  3EJN A;  3KKB A;  2DI3 A;  4JC7 A;  2WVO A;  2R7Q A;  1FFH A;  3NMJ A;  2H7B A;  1PD0 A;  1C03 A;  3SZR A;  4CDY A;  4I1O B;  3OWT A;  3HTK C;  4GQH A;  3ZDL A;  1MMG A;  4ZLC A;  3NKE A;  3SYN A;  4MVQ A;  1NU9 C;  2A0B A;  1WTY A;  1K4T A;  3H2U A;  1C17 M;  1JR8 A;  1NH3 A;  1I5N A;  4MW8 A;  1NSG B;  5DQT A;  3GM1 A;  3EG9 B;  3FOO A;  4XQ1 A;  1O3U A;  2ICW G;  3WHN A;  3L0I A;  1D1C A;  1HW1 A;  2J9U A;  3MYI A;  4CSA C;  4X0R A;  1Z3I X;  1JMW A;  1Z23 A;  2PP4 A;  2PX0 A;  4IWB A;  2P0N A;  3L34 A;  3UNG C;  2KQ9 A;  5AC5 A;  4E7S A;  2R7T A;  1G8X A;  1H6G A;  2DYS C;  2Q9C A;  3ZTM A;  3IQ6 A;  2CGE A;  5KYX B;  1APC A;  1NFN A;  4O7G A;  4AK9 A;  1FMV A;  4AL1 A;  1SC7 A;  4W8P A;  4JCH A;  1CGM E;  1A7E A;  1JPJ A;  1M2V B;  2LSE A;  4IB4 A;  3OEO A;  4MVM A;  3O6X A;  1B68 A;  5JLI A;  3NYJ A;  2L81 A;  3K1I A;  3CSK A;  5DLJ A;  1I4Z A;  3TD7 A;  2D4U A;  5JSL A;  4AE4 A;  4C7O A;  2R7S A;  2Q9B A;  3GM2 A;  1D1B A;  1J8Y F;  1MMN A;  3WG7 C;  5IY5 C;  3QZC A;  3LEO A;  1LS4 A;  4E0I A;  4BEJ A;  2F22 A;  1NG1 A;  1KNY A;  5L0H A;  2HV7 A;  2IXN A;  2NSF A;  4QI0 A;  2IBF A;  4R32 A;  4CS9 A;  3M4A A;  2R05 A;  3QVZ A;  4MS2 A;  2XM4 A;  2HFI A;  3IQT A;  3C18 A;  4NQF A;  1G4U S;  4CDA A;  4DRI B;  2NUP B;  2PX3 A;  3NG1 A;  4ULW A;  1LPQ A;  3B0P A;  3Q6M A;  2WZF A;  1VYK A;  2YKZ A;  2L6H A;  3HJC A;  1D0Y A;  3HNJ A;  2KW3 C;  3FDQ A;  1F1M A;  5BQG A;  4A2N B;  4KI2 A;  1DOV A;  2P1A A;  4LDQ A;  1T01 A;  2J9B A;  5F5H A;  4YT4 A;  2H7O A;  3ASN C;  4OIP F;  2KYH A;  2EPN A;  3ASO C;  3GEE A;  2MYS A;  3LS0 A;  4OD5 A;  3SXY A;  4ER9 A;  1FNT c;  4ZLD A;  4BJT A;  1EKY A;  1RKC A;  2WZG A;  3C8G A;  3AOU A;  3JT1 A;  4IAQ A;  2LQG A;  3UGO A;  3S9O A;  3V5X A;  4BEM J;  4LLE A;  4HFK B;  2W45 A;  4FES A;  2R25 A;  3DJU B;  3M79 A;  5L0C A;  3L8I A;  1ORJ A;  3DJN B;  2LD6 A;  1YAU O;  4PJN A;  4B6I A;  3S0X A;  2XLH A;  3DWW A;  2KNH A;  2OU6 A;  4JEB A;  1ZYR F;  4EBB A;  4YL0 A;  3SEO A;  2Q9A A;  4XPW A;  1A0B A;  1E83 A;  1LE4 A;  3FHD A;  3I5P A;  4JEA A;  3W8H A;  3DKA A;  4AE4 B;  4EHP A;  4C7O B;  4J7Y A;  3LLK A;  2IYL D;  2J0X A;  4AX2 A;  2NSG A;  1NFO A;  1V54 C;  1OQC A;  4CJO A;  4PK4 A;  4DBR A;  2PBE A;  4CS7 A;  3DE8 A;  2GAQ A;  4NC3 A;  3IEE A;  1TFO B;  5EK0 A;  5AC4 A;  2LFF A;  2HSB A;  4JJF A;  1JRA A;  2EPL X;  4XEK A;  2OKU A;  1UG7 A;  2YLD A;  3UMH A;  1YDI A;  1AEP A;  3RYL A;  3ZC4 A;  1N1C A;  1D0X A;  3AG4 C;  3CEX A;  3RF3 A;  4BJ6 A;  5COM A;  5E3C A;  3SXM A;  2FFH A;  4JJG A;  4KBL A;  1SF8 A;  4DRJ B;  1Y4C A;  1QKR A;  1SEU A;  2A69 F;  1LVK A;  2EPM X;  1R5I D;  3HNI A;  2YLG A;  1G4W R;  3IHU A;  4MVU A;  3SNH A;  4PJJ A;  4AL0 A;  3ZG1 A;  3EH1 A;  2J7P A;  4C3D A;  2YHS A;  1E2X A;  1BDJ B;  3W2V A;  3NMK A;  3JSZ A;  3NKD A;  2L7A A;  3C8G B;  1LI5 A;  3LAY A;  2XLO A;  4PJL A;  5L0I A;  4PFO A;  3EQL F;  4DOZ A;  2Z15 A;  3MBG A;  5L0J A;  1E85 A;  5E33 A;  3S90 A;  2H7G X;  4I3M A;  1A31 A;  3DAF A;  2OG2 A;  2PFD A;  3MLG A;  5A6B A;  3POV A;  2GA0 A;  3FOP A;  3ECS A;  3EGX A;  2KC3 A;  4CX9 A;  4H54 A;  2R7O A;  1WN0 A;  5HV9 A;  3AGU A;  2XLD A;  4MTF A;  4WGY A;  4YJW A;  1KTM A;  2IXO A;  4DBQ A;  1O87 A;  3KYJ A;  3W2W A;  2ZD9 A;  4XTK A;  3U9M A;  5CIV A;  4N6C A;  2OCC C;  4IGG A;  2H7F X;  5EHH A;  1LM3 B;  3NYL A;  1Z6A A;  3JRM O;  2W4B A;  1FR0 A;  5CI8 A;  4XEV A;  3C62 A;  4DVY P;  3GWL A;  5BQH A;  4O6Y A;  1S05 A;  5JP7 A;  4ONS A;  4E7Z A;  5B3I A;  3I4U A;  1OCR C;  2QE9 A;  3DZA A;  4CIP A;  3C8Z A;  5COG A;  3RQF A;  2GWW A;  1E86 A;  1YZA A;  3H65 A;  4D4N A;  3S84 A;  1ZU4 A;  2YZS A;  3MX3 A;  3F47 A;  3QVY A;  5KYY B;  1A41 A;  2AWC A;  3L1M A;  4JVS A;  1YVI A;  2EIL C;  3EGD A;  4M63 A;  3VM6 A;  2BL2 A;  1TWC A;  2OQM A;  3IQ5 A;  1OR2 A;  3M1C B;  4YT8 A;  4FWV A;  3RW0 A;  3B0U X;  1BR1 A;  2KSF A;  2LP4 A;  1C02 A;  4U5E E;  3DAG A;  2KGO A;  3U8P A;  3WAQ A;  2F4Q A;  1TQG A;  2DB4 A;  4QDL A;  3PHF 2;  5D91 A;  2XM0 A;  256B A;  1E84 A;  1HMD A;  3AQC A;  2M64 A;  3LLI A;  1ZHW A;  1QSP A;  3AQB A;  3QMK A;  2YL0 A;  3EZI A;  1OW7 A;  4G7H F;  2A68 F;  2ZXR A;  3C63 A;  3U5S A;  4MVZ A;  1M56 C;  4PJM A;  2RD9 A;  4RDA A;  5L3V A;  3NRH A;  4G7Z F;  2HUJ A;  5KYW A;  2R7U A;  3GOR A;  2YL7 A;  2J9W A;  5DS4 A;  3SXK A;  5JUA A;  3EGX B;  1VYI A;  5GPG B;  3CQZ A;  1QLE C;  1RJ9 B;  2XS8 A;  2P61 A;  3QW1 A;  3SXZ A;  1T8I A;  4D4X A;  2XS1 A;  3SP1 A;  3EHN A;  2YEV A;  1M57 C;  1ZU5 A;  1YYJ A;  1DOW A;  3Q7L A;  1R49 A;  1EJ9 A;  3BEH A;  1T6I A;  3VYW A;  5BUO A;  3U9J A;  2DYR C;  2XSE A;  5A6A A;  1OKK D;  2I15 A;  3FAP B;  2AWY A;  1IZM A;  1T6U A;  2IXM A;  2VH3 A;  2E87 A;  3B9Q A;  3KPH A;  4MQ9 F;  1VTM P;  4JW1 A;  1H9G A;  2XL4 A;  2Q7R A;  1XZQ A;  1EI7 A;  3EGD B;  4H4K C;  2VCC A;  1GGQ A;  1WAS A;  4LAC B;  5L0F A;  1BBH A;  1CGO A;  1VB5 A;  3O55 A;  5JRA A;  1A35 A;  4K1O A;  4N06 A;  5B1A C;  3US6 A;  2GFH A;  1FAP B;  2NUT A;  4QI2 A;  3FVY A;  2OJQ A;  2PNO A;  2XRH A;  2CW0 F;  3PCV A;  4P9T A;  5FZT A;  3ZWI A;  1M2O A;  1XZP A;  3CZ6 A;  3VAY A;  4WJ0 A;  3DE9 A;  3G50 A;  4EIY A;  3ZIB A;  4CSA A;  3DI5 A;  2CNW D;  3F46 A;  5KYU A;  2YL3 A;  1A7D A;  2VCB A;  1LE2 A;  1JAF A;  4O79 A;  4P9F A;  4CS8 C;  4Q5S F;  2YL1 A;  3X2Q C;  2CCY A;  1ZW2 A;  2EIK C;  3Q7G A;  2EIM C;  3RQG A;  3X1O A;  3DD7 A;  4EUK B;  1OXK A;  1RRJ A;  2P7V A;  3JRT A;  3DMD A;  3T6J A;  5DVW A;  5DS5 A;  4EBK A;  4BJ5 C;  4N4W A;  5KYW B;  1RKE A;  1LPE A;  3GWN A;  4IRU A;  1SYQ A;  4O6M A;  2R7W A;  4OIQ F;  1O5H A;  3LNR A;  4DRH B;  3DM9 B;  1CPR A;  2YQY A;  3K33 A;  4LDK A;  1SZI A;  1W2W A;  1VOM A;  2AP3 A;  4MTG A;  4NTF A;  4U9D A;  4N6H A;  1AVO B;  1MMA A;  4J30 B;  4JIO A;  5KYX A;  2HZ8 A;  4MND A;  2GDC A;  4W8K A;  3BRJ A;  2C03 A;  2V26 A;  3ITF A;  4C3E A;  3A11 A;  3W8I A;  4EWC A;  3OA1 A;  1VLS A;  1WGW A;  2A0U A;  3C8G D;  4CDV A;  2M4E A;  3ZTZ A;  3LNM B;  2H7V C;  4IJJ A;  2UUH A;  3CAX A;  1A7V A;  3LS1 A;  1QQ3 A;  1T5O A;  2Y3D A;  4XPX A;  1D0Z A;  3JYY A;  3K6B A;  5T3W A;  2YLI A;  4JE9 A;  2YRF A;  4CS9 C;  3M4B A;  2VAS A;  5DQZ A;  4K7B A;  2Q3T A;  2HMZ A;  1HMO A;  3ZQY A;  2MHR A;  1A36 A;  3GEI A;  3M15 A;  1QPU A;  3U2L A;  3ZVR A;  3A9C A;  1K40 A;  2EPK X;  4ULV A;  3B0V C;  5F5F A;  2HJ3 A;  1I4Y A;  2NUT B;  3ZSU A;  3IGC A;  4YK5 A;  1ZW3 A;  3TK0 A;  3NDB B;  2WL8 A;  3GEH A;  2J9V A;  4LER A;  4MTO A;  4YT5 A;  1PV3 A;  3V5Z A;  4DJ9 A;  3JYH A;  4KNV A;  5D92 A;  3GOD A;  1AUE A;  5E2Q A;  5KYU B;  2R7X A;  2L6F A;  1GS9 A;  2LIG A;  4PAC A;  3EZH A;  3EG9 A;  3W4Y A;  1YA7 O;  1YLM A;  2HMQ A;  4GEH A;  1HW2 A;  1U0B B;  3DXJ F;  4HEA J;  5A6J A;  1Y6D A;  2PF4 E;  3J06 A;  4U5D E;  2BC5 A;  1Q0D A;  1RKE B;  4IAO A;  3V7O A;  3ABL C;  3AG2 C;  2B0H A;  3RVZ A;  4FAP B;  2X0C A;  2CDQ A;  4A4A A;  3I5Q A;  2C04 A;  1YJG A;  2KK1 A;  4Q7C A;  3V5Y A;  2R7V A;  3K1I C;  2JX0 A;  1M2V A;  5E3A A;  3RIP A;  4JTA B;  1ZZP A;  3RKO F;  4BG0 A;  1U6H A;  3S29 A;  5BQI A;  4U5G A;  1NZE A;  3DM5 A;  1ORS C;  3L8J A;  2XXA A;  1V4A A;  1WWP A;  4E17 A;  3JSE O;  3U0C A;  1FMW A;  1RXQ A;  3B29 A;  4MW3 A;  5HSW A;  1EA8 A;  1G5Z A;  3NMI A;  1TWA A;  3GM3 A;  1V74 B;  1Z5Z A;  1H7I A;  1JPN A;  3EFO A;  4DVZ A;  3KMI A;  3G4X A;  1RR8 C;  1TR2 A;  2Y3B A;  1FFT C;  4KNW A;  2KJG A;  4U5C E;  1R4T A;  2V3C C;  1NU7 D;  4LLC A;  5A6B D;  1NLX A;  1TKN A;  2HKV A;  4CJG A;  5KYN A;  2XL6 A;  1V55 C;  1WAT A;  2QTV A;  1MNE A;  1BR2 A;  1D1A A;  1RCP A;  2XLV A;  4XWJ A;  4Z9J A;  1OCC C;  5A69 A;  4G7O F;  4ANJ A;  2J0W A;  1GM5 A;  5T1D B;  2P6V A;  1M6T A;  3MYF A;  4U9E A;  1TFK B;  4FX5 A;  1MMD A;  2HJM A;  4OIO F;  1JOG A;  2WZL A;  4NTA A;  3N0T A;  5T3T A;  4YT2 A;  1VLT A;  2O9X A;  3MFN A;  3N24 A;  4U5F E;  5JT4 A;  3JZ0 A;  1Z63 A;  3PMR A;  3R2P A;  2ZXW C;  1ZHX A;  2WVN A;  5L3Q A;  2QLA A;  1NBB A;  2WB7 A;  2TMV P;  5FCL A;  1WOL A;  2B0J A;  1GQA A;  1OKK A;  2LCH A;  2NPU A;  3TJ6 A;  3RQE A;  4BJ1 A;  3IQC A;  3S28 A;  3LEV A;  5EGY A;  1J8M F;  1IW7 F;  5L0D A;  5B3S C;  3T9O A;  1VMA A;  1ZVZ A;  2JD3 A;  1S7Z A;  4L6R A;  1QVX A; 
#chains in the Genus database with same CATH homology
 2F4Q A;  1SC7 A;  1RR8 C;  2H7F X;  1RRJ A;  1R49 A;  1A36 A;  3IGC A;  1K4T A;  1NH3 A;  2H7G X;  2B9S A;  1TL8 A;  1A35 A;  1A31 A;  1A41 A;  3M4A A;  1T8I A;  1SEU A;  1LPQ A;  1EJ9 A;  1K4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...