1A41A

Type 1-topoisomerase catalytic fragment from vaccinia virus
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
230
structure length
221
Chain Sequence
b'NAKRDRIFVRVYNVMKRINCFINKNIKKSSTDSNYQLAVFMLMETMFFKENETVGLLTLKNKHIEISPDEIVIKFVGKDKVSHEFVVHKSNRLYKPLLKLTDDSSPEEFLFNKLSERKVYECIKQFGIRIKDLRTYGVNYTFLYNFWTNVKSISPLPSPKKLIALTIKQTAEVVGHTPSISKRAYMATTILEMVKDKNFLDVVSKTTFDEFLSIVVDHVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOPOISOMERASE I
publication title Conservation of structure and mechanism between eukaryotic topoisomerase I and site-specific recombinases.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Isomerase
total genus 72
structure length 221
sequence length 230
ec nomenclature ec 5.99.1.2: Transferred entry: 5.6.2.2.
pdb deposition date 1998-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.380 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Type 1-topoisomerase catalytic fragment, domain 2 1a41A02
3.90.15.10 Alpha Beta Alpha-Beta Complex Topoisomerase I; Chain A, domain 3 Topoisomerase I; Chain A, domain 3 1a41A01
1R49A 1A31A 1K4TA 2B9SA 1EJ9A 1SC7A 2H7FX 1T8IA 1A36A 3M4AA 1TL8A 1RR8C 1K4SA 1RRJA 1SEUA 2H7GX 3IGCA 2F4QA 1A35A 1A41A 1NH3A 1LPQA
chains in the Genus database with same CATH superfamily
1QVXA 1OW6A 4C3DA 3B0VC 1EI7A 4DXWA 4J7TA 3NMKA 2LD6A 1JRAA 2XS1A 1TFOB 3KYJA 5FZTA 3CZ6A 1OQCA 4P6IC 3TOMA 2HFIA 1H9TA 2KQ9A 5JSLA 2C04A 4JIOA 4CS8A 3W8IA 1QLEC 2XS8A 3Q7LA 4U5BE 4XPXA 1GQAA 4G7OF 1QZXA 1VLTA 1JPJA 3LS0A 2YL0A 2R05A 2OU6A 3POVA 4K7BA 4E0IA 2A0BA 3JZ0A 1ZVZA 1T01A 3LLIA 2JX0A 4ANJA 4DJ9A 1MNDA 2XLEA 3AG1C 2Y3HA 1A0BA 1WN0A 4O6MA 1QPUA 1HW1A 2XL6A 4U5DE 1YARO 3C63A 1W2WA 1HMOA 4XLPF 4NY3A 1GGQA 4OINF 3LAYA 2YVKA 2AVKA 1GM5A 3JRTA 5JT4A 4C7OB 3O55A 2V26A 2PNOA 3I5QA 1TWAA 3M1CB 4ULVA 1OCZC 2X0CA 2LCHA 1OKKA 3C8GB 1M2VB 2OEXA 3L8IA 1A7DA 3SNHA 3SXYA 2WVNA 1TR2A 1PV3A 2KNHA 3HNLA 3HTKC 3QW0A 4BJ5A 2I15A 2LP4A 1WATA 4IWBA 3X1OA 4B6IA 2UUHA 3NYJA 1KTMA 1I4YA 3FVYA 2MWQA 5KYNA 1Q0GA 3CSKA 5BQHA 5L0GA 1YDIA 2XXAA 1YA7O 1NSGB 4IB4A 1Z6AA 3GORA 4PJJA 1ZU4A 2HV7A 3ABKC 4MVMA 1ZU5A 4YN0B 2GWWA 1YZCA 3JCUQ 4XWJA 4C3EA 4I3MA 3ABLC 4O7GA 4XPYA 4BJ5C 3K7DA 5D92A 2KGOA 3F46A 3EGXB 3RKOF 3U3BA 2LK4A 2RD9A 4GYTA 4NTAA 3ZG1A 3B71A 1BR4A 3O10A 4JTDB 1A31A 1C02A 1RKEB 2XLWA 1TFKB 4CS7A 2XSEA 1M57C 2PF4E 2CNWD 3VYWA 3DE9A 1FNTc 1G8XA 4CSAA 3B0UX 3OWTA 1E85A 2HJMA 3FXHA 3US6A 2HUJA 3BRJA 3CAXA 2QE9A 2WB7A 3GM2A 5GPGB 1PD0A 3DE8A 1JPNA 3KYIA 5T3TA 1YAUO 4KNWA 3RQGA 5K0IA 4A4AA 2MYSA 1HMDA 1O5HA 2ICWG 2FGYA 3F47A 3MYFA 2F4QA 1H6GA 1A35A 2YLDA 5AC5A 3Q7GA 1ORJA 2LFFA 3SXKA 3ZDLA 3S84A 3AG4C 1L3PA 1SF8A 1Y6DA 2XLHA 2B0JA 5BQGA 3UNGC 1DOWA 3FMSA 3I4UA 5DS5A 3H2VA 4H4KC 2A6HF 5L0FA 4MTFA 1Z3IX 4K1OA 1SC7A 1NU7D 2J8WA 1Q0KA 3HKKA 2YHSA 3MX3A 3RFYA 3QTHA 2BL2A 1V4AA 3RQFA 4CJOA 4C7OA 1BBHA 2Q7RA 2J7PA 2QUPA 4EKWA 1H9GA 1WTYA 3T6JA 2IXOA 3C8GA 3N0TA 1M2VA 1VTMP 3ATPA 1EA8A 1MMGA 2CNWA 2L9JA 3CQZA 2J45A 2H7GX 2QLAA 1Q0FA 4EBBA 3ZWIA 4AK9A 1QSPA 3R2PA 4LDQA 1U89A 2WZLA 3VRCA 3HNJA 2D4UA 2J9WA 3V5YA 1E2XA 2L7AA 2R02A 1FR0A 2WZFA 4JURI 3SXZA 2IOQA 2R7TA 1ORYA 1Q0MA 2OJQA 2Q3TA 1N1CA 4MVQA 3PCVA 4KNVA 4LDRA 4CDYA 1M6TA 4E18A 3DJNB 4XTKA 1MNEA 4EIYA 5E3CA 4DBRA 5A6BA 1J8MF 4FX5A 3SYNA 3EH2A 2HMQA 1YYXA 4O79A 5KYWB 1A36A 3EGXA 4JTAB 1WASA 5L0CA 3U2LA 4DRIB 1IW7F 5HV9A 2W45A 3S27A 3MLGA 4CBEA 1WGWA 1LS1A 3JYYA 3NG1A 1MMNA 4YT4A 1V54C 4LLEA 3NMJA 4XEKA 3U3FA 1SEUA 2HZ8A 1TWGA 4XPWA 1E83A 4HE8D 1HE9A 5T1DB 1RCPA 4IJJA 3UGPA 2EIKC 5IY5C 5A69A 1HW2A 2IXNA 4E0HA 3S29A 1M2OA 2AP3A 3Q6MA 1KU2A 2GAQA 1NH3A 3U9MA 5DLJA 3OA1A 1JAFA 1LVKA 4BJ6C 1LE4A 2JPUA 3RIPA 5DQZA 5JS5A 4XQ1A 4X0RA 5L0DA 1Z5ZA 1ZZPA 2EPOA 2R7UA 4N06A 1Z7Qc 5JRAA 1NLXA 3VF0A 2R7XA 2NG1A 4G0HA 2YL7A 3UMKA 2QY9A 2VB6A 2G3KA 2GFHA 3GANA 4MVOA 3VAYA 2R7VA 2P1AA 2UUIA 2ZXRA 3JT1A 3TK0A 5JVEA 1FMWA 1HE1A 3TULA 1JMWA 4HEAJ 1O3UA 3U5SA 4CX9A 4G7HF 3TOLA 2NUTB 3ITFA 3V7OA 4QI2A 4DVZA 4L6RA 4EUKB 3QW1A 2ZXPA 4JC7A 4KC9A 2I8BA 4JCHA 2YL3A 3QVYA 2R7WA 2Q9CA 1MMDA 3RH3A 3EGDB 3ABMC 1MQVA 3DWWA 4U5EE 4OIOF 4J30B 5AC4A 4WABA 3EHNA 3N24A 3EHMA 1V55C 2C03A 1ZW2A 2HS5A 3JSEO 4M63A 5F5FA 4NTBA 2H7OA 4MW3A 2YZSA 5D91A 1LI7A 4AL1A 3DAGA 3NKEA 4Q7CA 2Y3GA 1PCXA 4IGGA 4LERA 3WHNA 3C8ZA 1RMVA 4W8KA 3U8PA 4CDVA 2JD3A 4KBLA 2VCCA 1K04A 5L3VA 1K4SA 4AL0A 3NMIA 2OJED 2G62A 2R7RA 3U0CA 3E70C 1YYJA 2DYRC 3NYMA 1I4ZA 1NG1A 5KYWA 4K0DA 3EZHA 4GQHA 1OXBA 3AGUA 1NBBA 2Q4FA 1VK5A 3UGOA 3EPVA 2NSFA 4BPMA 4G78A 5DVWA 3LEOA 4O6YA 4HFKB 3HLZA 2M64A 1H7IA 3PMRA 3T6BA 1E84A 3EZIA 1BZ4A 4IRUA 1LPEA 1FFTC 2CCYA 4JW1A 1G4US 2HSBA 4EBJA 2B9SA 2J7PD 4D4XA 3HJCA 1OXKA 4YL3A 1VOMA 4DVYP 4E7ZA 1YVIA 3C8GD 3EH1A 3ZTZA 2A0UA 1C17M 1FMVA 4JE9A 3B0PA 1Y4CA 4CIPA 3U9JA 2O9XA 4XEFA 4OD5A 2DYSC 3DM5A 1D0YA 3U8VA 1AEPA 1T6QA 5COGA 3IQ5A 2J46A 2IM8A 2YLGA 2LFDA 3NRHA 1RRJA 3HNKA 1S05A 2G3VA 2NUPB 2YLIA 1SZIA 3HNIA 5L3QA 2Y39A 5CI8A 1K05A 1JOGA 1E86A 3RF3A 3B29A 4I1OB 1WOLA 2PX3A 2Y3BA 3ASOC 3GM3A 2RSEB 3JYHA 4CIHA 2OQMA 2NUTA 4CDAA 5CIVA 4RDAA 3G4XA 3IQCA 3Q6NA 4QI0A 2KJGA 2WZGA 1CGOA 4O6NA 3KL4A 3WODF 2EPLX 2GA0A 5DS6A 2EPKX 2QTVA 3B9QA 4MNDA 5L0JA 3M4BA 1FTSA 1D1BA 1ZHTA 1XZQA 1CGNA 2AU5A 3EGDA 1SYQA 4FWVA 4JEAA 5B1AC 2EIMC 2HKVA 2QNLA 2H7FX 1VMAA 2DB4A 3N2ZB 2P0NA 2XL8A 3SXMA 3ZTMA 4U5HA 3FOPA 3LLKA 2A69F 4Z9HA 4AE4B 4XEVA 4MVSA 3DM9B 4YT5A 4U9DA 3RW0A 4UDVA 3TJ6A 5JP7A 2B0HA 3OEOA 5AGFA 4W8PA 1EKYA 3GODA 2YRFA 3IQ6A 1YZAA 3TD7A 3AG3C 4MW8A 3BEHA 2J9UA 1A41A 3C62A 4YJWA 4EWCA 4PFPA 1PD1A 3FOOA 3S0XA 1HY5A 4BEMJ 3EJNA 1T5OA 1TKNA 5E33A 1R49A 2HJ3A 2TMVP 3FAPB 2W4MA 1J8YF 1M56C 2VASA 4WGZA 5JLIA 4CJGA 2H7BA 1VB5A 1RJ9B 3RYLA 1LS4A 4OIQF 1U6HA 1TL8A 4BJ6A 3M4CA 3X2QC 1U0BB 1ZHXA 3K66A 1SR2A 4DRJB 3W2VA 1RKEA 5EGYA 5TJ5E 4NQFA 3AJMA 3M15A 2VCBA 1D0ZA 4JTCB 4PJMA 4RBNA 3RVZA 1TWHA 2PX0A 4Q4ZF 1YA9A 4ULWA 3KMIA 5DQTA 4YL1A 2DI3A 3K1HA 3U2MA 2Z15A 3QVZA 1Z63A 3SZRA 4BG0A 3LNMB 3MYIA 4MTGA 4C3BA 3LJBA 4N4WA 3ZQVA 4DBQA 2ZD9A 4CS9C 2NUPA 4U5GA 3L0IA 3ZQYA 4AX2A 3ZSUA 2ZPAA 3DMDA 1RKCA 1LM3B 4J7YA 3S28A 2X51A 3AQBA 1DOVA 5E2QA 3W2WA 3GWLA 3WAQA 2EPNA 2YWAA 1NFNA 1OCRC 2F22A 1T6UA 3MFNA 3IEEA 2M4EA 4GEHA 2V3CC 4RD9A 1AVOB 5B1BC 1QQ3A 4PJLA 1O87A 2AWCA 4JZAA 4QDLA 4U5CE 5BUOA 2J0WA 2ETSA 3FDQA 1D1CA 2A68F 2XLVA 3RQEA 4JCZA 3PDMP 3J06A 5A6AA 2A6EF 3DAFA 5COMA 2ZXWC 1APCA 2W9YA 3TJ5A 2AWYA 1LE2A 4H54A 3DI5A 2L6GA 2YKZA 3SP1A 1OW8A 1K4TA 4U5FE 4Q5SF 3UR3C 3H65A 2XLMA 2IXMA 4P9TA 3CEXA 1UFBA 3VM6A 3T4RA 4WJ0A 1T8IA 3K1IC 4WGYA 3IHUA 1OR2A 3M79A 2P61A 4MQ9F 3AQCA 1T9KA 4IARA 5F5HA 4YWQA 2J0XA 1K40A 5E3AA 3EG9B 2R9RB 3FHDA 1R5ID 3LS1A 3V5ZA 1RJ9A 3L8JA 1YLMA 4ZLDA 1IZMA 2L6FA 2P6VA 2OEVA 3GEHA 3V5XA 5KYYB 2XLDA 2XRHA 5A6BD 3LUTB 3GM1A 4CS8C 1CPQA 4MVUA 5B3SC 3DJUB 1NFOA 4IAQA 2KYHA 4IAOA 1VYIA 2W4BA 3L1MA 3LNRA 2KSFA 2FAPB 4N6CA 3C18A 1LIHA 3W4YA 3RVYA 4DOZA 1F1MA 2J9BA 3NDBB 2KK1A 5KYXB 3K33A 1RXQA 4D4NA 1BR1A 1Z23A 2LIGA 4ONSA 4PACA 4YK5A 2Q9AA 3ASNC 3JRMO 4J32B 4OD4A 5JUAA 1ZHYA 2A1DD 2KC3A 4JVSA 2LSEA 2XM0A 3C7JA 3NYLA 4YL0A 4ZLCA 4MVZA 3A9CA 2HSQA 2ZXOA 2IXPA 3AGTA 2XM4A 1JR8A 3IQTA 1ZYRF 5FCLA 1ZHZA 4FAPB 4JEBA 1ZHWA 1OW7A 3JTLO 4XLNF 2PFDA 4YT8A 3T9OA 4N6HA 1SMYF 4EHPA 4LACB 1B68A 4P9FA 5COFA 3WG7C 1LPQA 2NSGA 2XLOA 4EBKA 4MVRA 3H2UA 3DZAA 1LI5A 1NU9C 2L6HA 2VH3A 2H8AA 2WVQA 1OCOC 3FAJA 3K6BA 3NKDA 4NC3A 3SEOA 1A7EA 4BEJA 2R7SA 3DXJF 2IBFA 2WL8A 1QKRA 1UG7A 3S90A 1A7VA 3ECSA 5F28E 4OIPF 3EFOB 4I44A 2BC5A 2CDQA 2H7VC 2Y3DA 2E87A 2Y69C 2Q9BA 4I1MA 3DKAA 1XWJA 4KI2A 3DD7A 4U9EA 5KYUB 2YQYA 1AUEA 1NZEA 4PJNA 2CW0F 1TWCA 1T6IA 1V74B 1D1AA 1D0XA 1VLSA 1YJGA 2YEVA 3AOUA 3KH2A 4MS2A 2XL4A 3ZVRA 4CSAC 3EQLF 3EG9A 2GDCA 2VC9A 3MBGA 2J9VA 3TQOA 1I5NA 3KKBA 2NPUA 1CPRA 5EK0A 4DRHB 1ST6A 1ORSC 3GEIA 3ZIBA 5KYYA 4JJGA 3A11A 3UMHA 5EHHA 3L34A 4R32A 5CI9A 4JRZA 3R7CA 2FFHA 4PFOA 4HFFB 3GEEA 2ASRA 2IYLD 2EPMX 2L81A 4FESA 2D5RB 4MTOA 3M4AA 3G4ZA 2MHRA 2P7VA 3LEVA 3JSZA 4E17A 4CS9A 1RR8C 3S9OA 3PHF2 3GWNA 256BA 5KYXA 2Q00A 5A6JA 5L0IA 1R4TA 1S7ZA 1BR2A 1L7CA 2R03A 4Z9IA 1KNYA 5BQIA 1TQGA 4PR9A 2DGJA 4OIRF 2KW3C 4ER9A 3IGCA 1Q0DA 4PK4A 2EIJC 2PBEA 3KPHA 4F4BA 2OOCA 1OCCC 2OG2A 4BJ1A 4NTFA 2R7OA 3I5PA 5B3IA 4NCQA 1G4WR 2EINC 1EJ9A 1WWPA 4Z9JA 1FAPB 2XXAB 3QMKA 3LESA 4G7ZF 1G5ZA 2HV6A 5L0HA 4A2NB 1MMAA 4E7SA 4BJTA 1C03A 1CGME 2WVOA 2HMZA 3E9VA 2R7QA 2BE5F 3O6XA 4JKVA 3UMIA 3W8HA 4JJFA 5DS4A 2LQGA 5T3WA 1LKXA 5HSWA 3G50A 2VCAA 2CYDA 1BDJB 3K1IA 2R25A 2PP4A 2EILC 3EFOA 3O39A 1ZW3A 1XZPA 4AE4A 3T6GB 5A6KA 1EQ1A 1OKKD 1VYKA 2CGEA 1OR3A 2YL1A 2OKUA 3AG2C 3IPMO 1GS9A 4LLCA 3QZCA 2OCCC 3ZC4A 4YT2A 4LDKA 5KYUA 1FFHA
chains in the Genus database with same CATH topology
1R49A 1A31A 1K4TA 2B9SA 1EJ9A 1SC7A 2H7FX 1T8IA 1A36A 3M4AA 1TL8A 1RR8C 1K4SA 1RRJA 1SEUA 2H7GX 3IGCA 2F4QA 1A35A 1A41A 1NH3A 1LPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R49 A;  1A31 A;  1K4T A;  2B9S A;  1EJ9 A;  1SC7 A;  2H7F X;  1T8I A;  1A36 A;  3M4A A;  1TL8 A;  1RR8 C;  1K4S A;  1RRJ A;  1SEU A;  2H7G X;  3IGC A;  2F4Q A;  1A35 A;  1A41 A;  1NH3 A;  1LPQ A; 
#chains in the Genus database with same CATH topology
 1QVX A;  1OW6 A;  4C3D A;  3B0V C;  1EI7 A;  4DXW A;  4J7T A;  3NMK A;  2LD6 A;  1JRA A;  2XS1 A;  1TFO B;  3KYJ A;  5FZT A;  3CZ6 A;  1OQC A;  4P6I C;  3TOM A;  2HFI A;  1H9T A;  2KQ9 A;  5JSL A;  2C04 A;  4JIO A;  4CS8 A;  3W8I A;  1QLE C;  2XS8 A;  3Q7L A;  4U5B E;  4XPX A;  1GQA A;  4G7O F;  1QZX A;  1VLT A;  1JPJ A;  3LS0 A;  2YL0 A;  2R05 A;  2OU6 A;  3POV A;  4K7B A;  4E0I A;  2A0B A;  3JZ0 A;  1ZVZ A;  1T01 A;  3LLI A;  2JX0 A;  4ANJ A;  4DJ9 A;  1MND A;  2XLE A;  3AG1 C;  2Y3H A;  1A0B A;  1WN0 A;  4O6M A;  1QPU A;  1HW1 A;  2XL6 A;  4U5D E;  1YAR O;  3C63 A;  1W2W A;  1HMO A;  4XLP F;  4NY3 A;  1GGQ A;  4OIN F;  3LAY A;  2YVK A;  2AVK A;  1GM5 A;  3JRT A;  5JT4 A;  4C7O B;  3O55 A;  2V26 A;  2PNO A;  3I5Q A;  1TWA A;  3M1C B;  4ULV A;  1OCZ C;  2X0C A;  2LCH A;  1OKK A;  3C8G B;  1M2V B;  2OEX A;  3L8I A;  1A7D A;  3SNH A;  3SXY A;  2WVN A;  1TR2 A;  1PV3 A;  2KNH A;  3HNL A;  3HTK C;  3QW0 A;  4BJ5 A;  2I15 A;  2LP4 A;  1WAT A;  4IWB A;  3X1O A;  4B6I A;  2UUH A;  3NYJ A;  1KTM A;  1I4Y A;  3FVY A;  2MWQ A;  5KYN A;  1Q0G A;  3CSK A;  5BQH A;  5L0G A;  1YDI A;  2XXA A;  1YA7 O;  1NSG B;  4IB4 A;  1Z6A A;  3GOR A;  4PJJ A;  1ZU4 A;  2HV7 A;  3ABK C;  4MVM A;  1ZU5 A;  4YN0 B;  2GWW A;  1YZC A;  3JCU Q;  4XWJ A;  4C3E A;  4I3M A;  3ABL C;  4O7G A;  4XPY A;  4BJ5 C;  3K7D A;  5D92 A;  2KGO A;  3F46 A;  3EGX B;  3RKO F;  3U3B A;  2LK4 A;  2RD9 A;  4GYT A;  4NTA A;  3ZG1 A;  3B71 A;  1BR4 A;  3O10 A;  4JTD B;  1A31 A;  1C02 A;  1RKE B;  2XLW A;  1TFK B;  4CS7 A;  2XSE A;  1M57 C;  2PF4 E;  2CNW D;  3VYW A;  3DE9 A;  1FNT c;  1G8X A;  4CSA A;  3B0U X;  3OWT A;  1E85 A;  2HJM A;  3FXH A;  3US6 A;  2HUJ A;  3BRJ A;  3CAX A;  2QE9 A;  2WB7 A;  3GM2 A;  5GPG B;  1PD0 A;  3DE8 A;  1JPN A;  3KYI A;  5T3T A;  1YAU O;  4KNW A;  3RQG A;  5K0I A;  4A4A A;  2MYS A;  1HMD A;  1O5H A;  2ICW G;  2FGY A;  3F47 A;  3MYF A;  2F4Q A;  1H6G A;  1A35 A;  2YLD A;  5AC5 A;  3Q7G A;  1ORJ A;  2LFF A;  3SXK A;  3ZDL A;  3S84 A;  3AG4 C;  1L3P A;  1SF8 A;  1Y6D A;  2XLH A;  2B0J A;  5BQG A;  3UNG C;  1DOW A;  3FMS A;  3I4U A;  5DS5 A;  3H2V A;  4H4K C;  2A6H F;  5L0F A;  4MTF A;  1Z3I X;  4K1O A;  1SC7 A;  1NU7 D;  2J8W A;  1Q0K A;  3HKK A;  2YHS A;  3MX3 A;  3RFY A;  3QTH A;  2BL2 A;  1V4A A;  3RQF A;  4CJO A;  4C7O A;  1BBH A;  2Q7R A;  2J7P A;  2QUP A;  4EKW A;  1H9G A;  1WTY A;  3T6J A;  2IXO A;  3C8G A;  3N0T A;  1M2V A;  1VTM P;  3ATP A;  1EA8 A;  1MMG A;  2CNW A;  2L9J A;  3CQZ A;  2J45 A;  2H7G X;  2QLA A;  1Q0F A;  4EBB A;  3ZWI A;  4AK9 A;  1QSP A;  3R2P A;  4LDQ A;  1U89 A;  2WZL A;  3VRC A;  3HNJ A;  2D4U A;  2J9W A;  3V5Y A;  1E2X A;  2L7A A;  2R02 A;  1FR0 A;  2WZF A;  4JUR I;  3SXZ A;  2IOQ A;  2R7T A;  1ORY A;  1Q0M A;  2OJQ A;  2Q3T A;  1N1C A;  4MVQ A;  3PCV A;  4KNV A;  4LDR A;  4CDY A;  1M6T A;  4E18 A;  3DJN B;  4XTK A;  1MNE A;  4EIY A;  5E3C A;  4DBR A;  5A6B A;  1J8M F;  4FX5 A;  3SYN A;  3EH2 A;  2HMQ A;  1YYX A;  4O79 A;  5KYW B;  1A36 A;  3EGX A;  4JTA B;  1WAS A;  5L0C A;  3U2L A;  4DRI B;  1IW7 F;  5HV9 A;  2W45 A;  3S27 A;  3MLG A;  4CBE A;  1WGW A;  1LS1 A;  3JYY A;  3NG1 A;  1MMN A;  4YT4 A;  1V54 C;  4LLE A;  3NMJ A;  4XEK A;  3U3F A;  1SEU A;  2HZ8 A;  1TWG A;  4XPW A;  1E83 A;  4HE8 D;  1HE9 A;  5T1D B;  1RCP A;  4IJJ A;  3UGP A;  2EIK C;  5IY5 C;  5A69 A;  1HW2 A;  2IXN A;  4E0H A;  3S29 A;  1M2O A;  2AP3 A;  3Q6M A;  1KU2 A;  2GAQ A;  1NH3 A;  3U9M A;  5DLJ A;  3OA1 A;  1JAF A;  1LVK A;  4BJ6 C;  1LE4 A;  2JPU A;  3RIP A;  5DQZ A;  5JS5 A;  4XQ1 A;  4X0R A;  5L0D A;  1Z5Z A;  1ZZP A;  2EPO A;  2R7U A;  4N06 A;  1Z7Q c;  5JRA A;  1NLX A;  3VF0 A;  2R7X A;  2NG1 A;  4G0H A;  2YL7 A;  3UMK A;  2QY9 A;  2VB6 A;  2G3K A;  2GFH A;  3GAN A;  4MVO A;  3VAY A;  2R7V A;  2P1A A;  2UUI A;  2ZXR A;  3JT1 A;  3TK0 A;  5JVE A;  1FMW A;  1HE1 A;  3TUL A;  1JMW A;  4HEA J;  1O3U A;  3U5S A;  4CX9 A;  4G7H F;  3TOL A;  2NUT B;  3ITF A;  3V7O A;  4QI2 A;  4DVZ A;  4L6R A;  4EUK B;  3QW1 A;  2ZXP A;  4JC7 A;  4KC9 A;  2I8B A;  4JCH A;  2YL3 A;  3QVY A;  2R7W A;  2Q9C A;  1MMD A;  3RH3 A;  3EGD B;  3ABM C;  1MQV A;  3DWW A;  4U5E E;  4OIO F;  4J30 B;  5AC4 A;  4WAB A;  3EHN A;  3N24 A;  3EHM A;  1V55 C;  2C03 A;  1ZW2 A;  2HS5 A;  3JSE O;  4M63 A;  5F5F A;  4NTB A;  2H7O A;  4MW3 A;  2YZS A;  5D91 A;  1LI7 A;  4AL1 A;  3DAG A;  3NKE A;  4Q7C A;  2Y3G A;  1PCX A;  4IGG A;  4LER A;  3WHN A;  3C8Z A;  1RMV A;  4W8K A;  3U8P A;  4CDV A;  2JD3 A;  4KBL A;  2VCC A;  1K04 A;  5L3V A;  1K4S A;  4AL0 A;  3NMI A;  2OJE D;  2G62 A;  2R7R A;  3U0C A;  3E70 C;  1YYJ A;  2DYR C;  3NYM A;  1I4Z A;  1NG1 A;  5KYW A;  4K0D A;  3EZH A;  4GQH A;  1OXB A;  3AGU A;  1NBB A;  2Q4F A;  1VK5 A;  3UGO A;  3EPV A;  2NSF A;  4BPM A;  4G78 A;  5DVW A;  3LEO A;  4O6Y A;  4HFK B;  3HLZ A;  2M64 A;  1H7I A;  3PMR A;  3T6B A;  1E84 A;  3EZI A;  1BZ4 A;  4IRU A;  1LPE A;  1FFT C;  2CCY A;  4JW1 A;  1G4U S;  2HSB A;  4EBJ A;  2B9S A;  2J7P D;  4D4X A;  3HJC A;  1OXK A;  4YL3 A;  1VOM A;  4DVY P;  4E7Z A;  1YVI A;  3C8G D;  3EH1 A;  3ZTZ A;  2A0U A;  1C17 M;  1FMV A;  4JE9 A;  3B0P A;  1Y4C A;  4CIP A;  3U9J A;  2O9X A;  4XEF A;  4OD5 A;  2DYS C;  3DM5 A;  1D0Y A;  3U8V A;  1AEP A;  1T6Q A;  5COG A;  3IQ5 A;  2J46 A;  2IM8 A;  2YLG A;  2LFD A;  3NRH A;  1RRJ A;  3HNK A;  1S05 A;  2G3V A;  2NUP B;  2YLI A;  1SZI A;  3HNI A;  5L3Q A;  2Y39 A;  5CI8 A;  1K05 A;  1JOG A;  1E86 A;  3RF3 A;  3B29 A;  4I1O B;  1WOL A;  2PX3 A;  2Y3B A;  3ASO C;  3GM3 A;  2RSE B;  3JYH A;  4CIH A;  2OQM A;  2NUT A;  4CDA A;  5CIV A;  4RDA A;  3G4X A;  3IQC A;  3Q6N A;  4QI0 A;  2KJG A;  2WZG A;  1CGO A;  4O6N A;  3KL4 A;  3WOD F;  2EPL X;  2GA0 A;  5DS6 A;  2EPK X;  2QTV A;  3B9Q A;  4MND A;  5L0J A;  3M4B A;  1FTS A;  1D1B A;  1ZHT A;  1XZQ A;  1CGN A;  2AU5 A;  3EGD A;  1SYQ A;  4FWV A;  4JEA A;  5B1A C;  2EIM C;  2HKV A;  2QNL A;  2H7F X;  1VMA A;  2DB4 A;  3N2Z B;  2P0N A;  2XL8 A;  3SXM A;  3ZTM A;  4U5H A;  3FOP A;  3LLK A;  2A69 F;  4Z9H A;  4AE4 B;  4XEV A;  4MVS A;  3DM9 B;  4YT5 A;  4U9D A;  3RW0 A;  4UDV A;  3TJ6 A;  5JP7 A;  2B0H A;  3OEO A;  5AGF A;  4W8P A;  1EKY A;  3GOD A;  2YRF A;  3IQ6 A;  1YZA A;  3TD7 A;  3AG3 C;  4MW8 A;  3BEH A;  2J9U A;  1A41 A;  3C62 A;  4YJW A;  4EWC A;  4PFP A;  1PD1 A;  3FOO A;  3S0X A;  1HY5 A;  4BEM J;  3EJN A;  1T5O A;  1TKN A;  5E33 A;  1R49 A;  2HJ3 A;  2TMV P;  3FAP B;  2W4M A;  1J8Y F;  1M56 C;  2VAS A;  4WGZ A;  5JLI A;  4CJG A;  2H7B A;  1VB5 A;  1RJ9 B;  3RYL A;  1LS4 A;  4OIQ F;  1U6H A;  1TL8 A;  4BJ6 A;  3M4C A;  3X2Q C;  1U0B B;  1ZHX A;  3K66 A;  1SR2 A;  4DRJ B;  3W2V A;  1RKE A;  5EGY A;  5TJ5 E;  4NQF A;  3AJM A;  3M15 A;  2VCB A;  1D0Z A;  4JTC B;  4PJM A;  4RBN A;  3RVZ A;  1TWH A;  2PX0 A;  4Q4Z F;  1YA9 A;  4ULW A;  3KMI A;  5DQT A;  4YL1 A;  2DI3 A;  3K1H A;  3U2M A;  2Z15 A;  3QVZ A;  1Z63 A;  3SZR A;  4BG0 A;  3LNM B;  3MYI A;  4MTG A;  4C3B A;  3LJB A;  4N4W A;  3ZQV A;  4DBQ A;  2ZD9 A;  4CS9 C;  2NUP A;  4U5G A;  3L0I A;  3ZQY A;  4AX2 A;  3ZSU A;  2ZPA A;  3DMD A;  1RKC A;  1LM3 B;  4J7Y A;  3S28 A;  2X51 A;  3AQB A;  1DOV A;  5E2Q A;  3W2W A;  3GWL A;  3WAQ A;  2EPN A;  2YWA A;  1NFN A;  1OCR C;  2F22 A;  1T6U A;  3MFN A;  3IEE A;  2M4E A;  4GEH A;  2V3C C;  4RD9 A;  1AVO B;  5B1B C;  1QQ3 A;  4PJL A;  1O87 A;  2AWC A;  4JZA A;  4QDL A;  4U5C E;  5BUO A;  2J0W A;  2ETS A;  3FDQ A;  1D1C A;  2A68 F;  2XLV A;  3RQE A;  4JCZ A;  3PDM P;  3J06 A;  5A6A A;  2A6E F;  3DAF A;  5COM A;  2ZXW C;  1APC A;  2W9Y A;  3TJ5 A;  2AWY A;  1LE2 A;  4H54 A;  3DI5 A;  2L6G A;  2YKZ A;  3SP1 A;  1OW8 A;  1K4T A;  4U5F E;  4Q5S F;  3UR3 C;  3H65 A;  2XLM A;  2IXM A;  4P9T A;  3CEX A;  1UFB A;  3VM6 A;  3T4R A;  4WJ0 A;  1T8I A;  3K1I C;  4WGY A;  3IHU A;  1OR2 A;  3M79 A;  2P61 A;  4MQ9 F;  3AQC A;  1T9K A;  4IAR A;  5F5H A;  4YWQ A;  2J0X A;  1K40 A;  5E3A A;  3EG9 B;  2R9R B;  3FHD A;  1R5I D;  3LS1 A;  3V5Z A;  1RJ9 A;  3L8J A;  1YLM A;  4ZLD A;  1IZM A;  2L6F A;  2P6V A;  2OEV A;  3GEH A;  3V5X A;  5KYY B;  2XLD A;  2XRH A;  5A6B D;  3LUT B;  3GM1 A;  4CS8 C;  1CPQ A;  4MVU A;  5B3S C;  3DJU B;  1NFO A;  4IAQ A;  2KYH A;  4IAO A;  1VYI A;  2W4B A;  3L1M A;  3LNR A;  2KSF A;  2FAP B;  4N6C A;  3C18 A;  1LIH A;  3W4Y A;  3RVY A;  4DOZ A;  1F1M A;  2J9B A;  3NDB B;  2KK1 A;  5KYX B;  3K33 A;  1RXQ A;  4D4N A;  1BR1 A;  1Z23 A;  2LIG A;  4ONS A;  4PAC A;  4YK5 A;  2Q9A A;  3ASN C;  3JRM O;  4J32 B;  4OD4 A;  5JUA A;  1ZHY A;  2A1D D;  2KC3 A;  4JVS A;  2LSE A;  2XM0 A;  3C7J A;  3NYL A;  4YL0 A;  4ZLC A;  4MVZ A;  3A9C A;  2HSQ A;  2ZXO A;  2IXP A;  3AGT A;  2XM4 A;  1JR8 A;  3IQT A;  1ZYR F;  5FCL A;  1ZHZ A;  4FAP B;  4JEB A;  1ZHW A;  1OW7 A;  3JTL O;  4XLN F;  2PFD A;  4YT8 A;  3T9O A;  4N6H A;  1SMY F;  4EHP A;  4LAC B;  1B68 A;  4P9F A;  5COF A;  3WG7 C;  1LPQ A;  2NSG A;  2XLO A;  4EBK A;  4MVR A;  3H2U A;  3DZA A;  1LI5 A;  1NU9 C;  2L6H A;  2VH3 A;  2H8A A;  2WVQ A;  1OCO C;  3FAJ A;  3K6B A;  3NKD A;  4NC3 A;  3SEO A;  1A7E A;  4BEJ A;  2R7S A;  3DXJ F;  2IBF A;  2WL8 A;  1QKR A;  1UG7 A;  3S90 A;  1A7V A;  3ECS A;  5F28 E;  4OIP F;  3EFO B;  4I44 A;  2BC5 A;  2CDQ A;  2H7V C;  2Y3D A;  2E87 A;  2Y69 C;  2Q9B A;  4I1M A;  3DKA A;  1XWJ A;  4KI2 A;  3DD7 A;  4U9E A;  5KYU B;  2YQY A;  1AUE A;  1NZE A;  4PJN A;  2CW0 F;  1TWC A;  1T6I A;  1V74 B;  1D1A A;  1D0X A;  1VLS A;  1YJG A;  2YEV A;  3AOU A;  3KH2 A;  4MS2 A;  2XL4 A;  3ZVR A;  4CSA C;  3EQL F;  3EG9 A;  2GDC A;  2VC9 A;  3MBG A;  2J9V A;  3TQO A;  1I5N A;  3KKB A;  2NPU A;  1CPR A;  5EK0 A;  4DRH B;  1ST6 A;  1ORS C;  3GEI A;  3ZIB A;  5KYY A;  4JJG A;  3A11 A;  3UMH A;  5EHH A;  3L34 A;  4R32 A;  5CI9 A;  4JRZ A;  3R7C A;  2FFH A;  4PFO A;  4HFF B;  3GEE A;  2ASR A;  2IYL D;  2EPM X;  2L81 A;  4FES A;  2D5R B;  4MTO A;  3M4A A;  3G4Z A;  2MHR A;  2P7V A;  3LEV A;  3JSZ A;  4E17 A;  4CS9 A;  1RR8 C;  3S9O A;  3PHF 2;  3GWN A;  256B A;  5KYX A;  2Q00 A;  5A6J A;  5L0I A;  1R4T A;  1S7Z A;  1BR2 A;  1L7C A;  2R03 A;  4Z9I A;  1KNY A;  5BQI A;  1TQG A;  4PR9 A;  2DGJ A;  4OIR F;  2KW3 C;  4ER9 A;  3IGC A;  1Q0D A;  4PK4 A;  2EIJ C;  2PBE A;  3KPH A;  4F4B A;  2OOC A;  1OCC C;  2OG2 A;  4BJ1 A;  4NTF A;  2R7O A;  3I5P A;  5B3I A;  4NCQ A;  1G4W R;  2EIN C;  1EJ9 A;  1WWP A;  4Z9J A;  1FAP B;  2XXA B;  3QMK A;  3LES A;  4G7Z F;  1G5Z A;  2HV6 A;  5L0H A;  4A2N B;  1MMA A;  4E7S A;  4BJT A;  1C03 A;  1CGM E;  2WVO A;  2HMZ A;  3E9V A;  2R7Q A;  2BE5 F;  3O6X A;  4JKV A;  3UMI A;  3W8H A;  4JJF A;  5DS4 A;  2LQG A;  5T3W A;  1LKX A;  5HSW A;  3G50 A;  2VCA A;  2CYD A;  1BDJ B;  3K1I A;  2R25 A;  2PP4 A;  2EIL C;  3EFO A;  3O39 A;  1ZW3 A;  1XZP A;  4AE4 A;  3T6G B;  5A6K A;  1EQ1 A;  1OKK D;  1VYK A;  2CGE A;  1OR3 A;  2YL1 A;  2OKU A;  3AG2 C;  3IPM O;  1GS9 A;  4LLC A;  3QZC A;  2OCC C;  3ZC4 A;  4YT2 A;  4LDK A;  5KYU A;  1FFH A; 
#chains in the Genus database with same CATH homology
 1R49 A;  1A31 A;  1K4T A;  2B9S A;  1EJ9 A;  1SC7 A;  2H7F X;  1T8I A;  1A36 A;  3M4A A;  1TL8 A;  1RR8 C;  1K4S A;  1RRJ A;  1SEU A;  2H7G X;  3IGC A;  2F4Q A;  1A35 A;  1A41 A;  1NH3 A;  1LPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...