1A41A

Type 1-topoisomerase catalytic fragment from vaccinia virus
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
230
structure length
221
Chain Sequence
NAKRDRIFVRVYNVMKRINCFINKNIKKSSTDSNYQLAVFMLMETMFFKENETVGLLTLKNKHIEISPDEIVIKFVGKDKVSHEFVVHKSNRLYKPLLKLTDDSSPEEFLFNKLSERKVYECIKQFGIRIKDLRTYGVNYTFLYNFWTNVKSISPLPSPKKLIALTIKQTAEVVGHTPSISKRAYMATTILEMVKDKNFLDVVSKTTFDEFLSIVVDHVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conservation of structure and mechanism between eukaryotic topoisomerase I and site-specific recombinases.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Isomerase
molecule keywords TOPOISOMERASE I
total genus 72
structure length 221
sequence length 230
ec nomenclature ec 5.99.1.2: Transferred entry: 5.6.2.2.
pdb deposition date 1998-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.380 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Type 1-topoisomerase catalytic fragment, domain 2 1a41A02
3.90.15.10 Alpha Beta Alpha-Beta Complex Topoisomerase I; Chain A, domain 3 Topoisomerase I; Chain A, domain 3 1a41A01
1K4TA 2F4QA 1TL8A 1LPQA 1R49A 1EJ9A 1SEUA 1A41A 2B9SA 3IGCA 3M4AA 1A31A 1RR8C 1A35A 2H7GX 1SC7A 1RRJA 1A36A 1NH3A 1T8IA 2H7FX 1K4SA
chains in the Genus database with same CATH superfamily
4K0DA 4WABA 3GANA 3K66A 2VH3A 3NYLA 5F5HA 3W8HA 3L8JA 2W45A 4XLNF 3FAJA 1FNTc 2R02A 3VRCA 1J8MF 1FMWA 2ZXWC 4EBKA 1U89A 2NUPB 4U9DA 5DS5A 1SEUA 2LK4A 3MLGA 4EBBA 3A11A 4C3EA 3U2LA 2J9WA 2J7PD 2LCHA 5HSWA 3M4AA 1VLTA 4O6YA 2R7VA 2PFDA 1Q0FA 1VOMA 1ZHTA 1BDJB 2YVKA 4M63A 3GORA 2H8AA 1T01A 5BQIA 2VCCA 3T9OA 3ZDLA 4J7TA 1NH3A 1LS4A 3U0CA 1VB5A 1BR1A 1E2XA 3M79A 5BQGA 4MVRA 1YZCA 5JP7A 2VB6A 3NKDA 4Z9IA 2F4QA 3V5XA 2GAQA 4RDAA 2ICWG 2R7XA 4QI2A 2WVOA 5BQHA 2FGYA 4MVSA 1VLSA 1C03A 1KTMA 3DE8A 2IOQA 3F46A 4FAPB 3B71A 1FTSA 3CQZA 4XEVA 4AK9A 2YWAA 1O3UA 4Q7CA 1Z5ZA 5DVWA 3HTKC 4BEMJ 1LVKA 4MW8A 2EPKX 3TK0A 1HW2A 2MHRA 3ASNC 4KI2A 1SZIA 4OD5A 3DM5A 3VAYA 2CGEA 2XLWA 3JYHA 1KNYA 2HMZA 1D0YA 3N2ZB 1D0ZA 1M2VA 4W8PA 1NG1A 3ZC4A 1LS1A 1B68A 3R7CA 4DVZA 2KJGA 2YL1A 1GM5A 3EHNA 5L0HA 3MYIA 4OIQF 4G78A 3V7OA 3WODF 4H4KC 5BUOA 1APCA 4RD9A 4DJ9A 4PJLA 3H65A 2L9JA 3EHMA 4O7GA 2DYRC 4DRJB 5AGFA 3S29A 2IXNA 2P7VA 3TULA 3QW0A 1D1BA 4E0IA 2R9RB 3U9JA 1ZW3A 3HJCA 3C8GD 4MQ9F 4LERA 4PJMA 2WVNA 3ZTMA 2D4UA 2CDQA 1EA8A 4CJGA 1XZPA 2OOCA 4GQHA 1OXKA 4JEBA 3RQEA 1H7IA 2HS5A 4K7BA 5AC4A 1LE4A 3S90A 4JTCB 1ZZPA 1HY5A 3NRHA 5A6BA 1C17M 1OQCA 1T6UA 4WJ0A 2H7FX 5EGYA 3UGOA 2W4MA 4HEAJ 3B0PA 2YZSA 1EI7A 2AVKA 2KSFA 2MWQA 2HV6A 1G4US 5JLIA 2J0XA 4AE4A 3SXMA 3C63A 3SP1A 5JS5A 1CPQA 3L8IA 2XM0A 1V55C 3LS0A 5DLJA 2ETSA 1RCPA 5KYXA 4C7OB 1GQAA 1QPUA 4DBRA 1KU2A 4JTAB 5KYXB 5AC5A 1TKNA 2YQYA 2ZXPA 3LLKA 4NTBA 2EPLX 3RIPA 2MYSA 1U6HA 3GODA 2R7TA 4O6MA 3RVYA 1RR8C 2OJQA 2PF4E 1YA7O 4KNVA 2H7VC 2V26A 4MVQA 1BR2A 3U8PA 3T6BA 3AG3C 3MBGA 1W2WA 1YDIA 1DOVA 3QZCA 1PCXA 2QUPA 5E3AA 3TOLA 2RD9A 2Q00A 2JPUA 4N4WA 2OEVA 3ECSA 2QTVA 1T9KA 4MTOA 2Z15A 3IHUA 3KKBA 1A7DA 3BRJA 4CBEA 1LIHA 1RMVA 5L0GA 4CS9A 4MTGA 2YHSA 3U3FA 3X1OA 4NC3A 3ITFA 2HZ8A 3N0TA 4GEHA 3JRTA 1I4ZA 4NTAA 5COFA 2KYHA 5EHHA 1TWHA 1TWGA 3CZ6A 3Q6MA 3R2PA 3O6XA 2O9XA 2J46A 3LEOA 1D1CA 2R7OA 5K0IA 4C3BA 4O79A 4XEFA 1XZQA 3C7JA 2PNOA 1NFOA 3B9QA 4NY3A 1AUEA 1YJGA 1JOGA 2NUPA 3EZHA 4XTKA 4PJJA 4F4BA 1XWJA 3Q7GA 2A0BA 2DYSC 1J8YF 2W4BA 1A7VA 3EJNA 1MMDA 2Q9BA 3EH1A 3MX3A 4OD4A 3JCUQ 1O5HA 4CS7A 3HLZA 4BJTA 3B0VC 1VTMP 5JRAA 1T6QA 4I1MA 4U5GA 2ZD9A 4ULWA 4YT5A 3RF3A 3PDMP 4I44A 1S7ZA 5L0CA 3DI5A 4BJ5C 2XXAB 5KYWB 4ZLDA 3AQCA 3DJUB 1NU9C 1M2OA 4MW3A 3I4UA 4XPWA 2KC3A 5FCLA 4EWCA 1LPQA 2ZXOA 3E9VA 3EFOA 1D0XA 1G5ZA 3LESA 4MVZA 4E18A 4YT8A 4Q5SF 3L1MA 4CIHA 5L3QA 1WATA 4HFKB 1TL8A 3ZQVA 4J32B 4BJ6A 4D4NA 1CGME 1LE2A 4YL1A 4BEJA 1FFHA 2HMQA 2PBEA 1R5ID 3IQ6A 4IARA 2I15A 3QTHA 2IYLD 1A35A 5JUAA 1OCOC 4U5BE 2AP3A 5L3VA 3CEXA 2VCAA 3W2VA 3ZQYA 4A2NB 5L0IA 2Y3BA 2YLIA 3GEIA 2KW3C 3LNMB 2P1AA 3X2QC 4EUKB 3B0UX 4B6IA 3V5YA 1QKRA 2Q9AA 5L0JA 1SYQA 2EPNA 1FR0A 2EIJC 1MQVA 2YLDA 1UFBA 2L6HA 3I5PA 4N06A 1T5OA 2WVQA 1NZEA 2XL4A 2XLDA 3EQLF 3S27A 2XS1A 3ASOC 2HSBA 1I5NA 4NCQA 2LP4A 2R7QA 3K1IA 3V5ZA 2WL8A 4XQ1A 1TFOB 2AWCA 3ABKC 1ZHXA 3AG4C 4ULVA 3H2UA 3AG1C 4DOZA 1YARO 2B9SA 1OR3A 3IGCA 1NSGB 1OCZC 2XSEA 3G4XA 1G8XA 4AL1A 1Q0GA 4Q4ZF 4Z9JA 2R7SA 4BJ1A 1IZMA 3KYIA 3Q6NA 3GWNA 3JRMO 4LDKA 4IB4A 5TJ5E 3CSKA 1WOLA 4KBLA 4ZLCA 1Z63A 2TMVP 4AX2A 4ER9A 2Q4FA 4JE9A 1D1AA 1NFNA 4OIRF 4E7SA 4G7OF 2LFDA 2YL0A 3PMRA 3AQBA 1Z7Qc 1N1CA 4JCZA 4ANJA 4PACA 1HE9A 2A0UA 3EGXA 2Y39A 2NPUA 3EGDB 1JRAA 1ZYRF 5COMA 5E3CA 2YKZA 1JMWA 1YLMA 3WAQA 4P6IC 2EIKC 1OW7A 4OIPF 3RYLA 3QW1A 4AE4B 4E17A 1E84A 4JRZA 2BC5A 2IM8A 2A1DD 3ABLC 4I1OB 4YL3A 4DVYP 3TOMA 3C18A 3KMIA 1PD1A 5T1DB 2DGJA 2J0WA 4I3MA 2P0NA 2XM4A 3IQTA 5E2QA 2J9UA 2FAPB 3JT1A 1OR2A 1V74B 3U3BA 4MVMA 2GWWA 2LIGA 3NYJA 1VYKA 3AG2C 3C8GA 1RJ9A 1ZVZA 3EH2A 2HFIA 3IQ5A 3RKOF 1MMGA 1O87A 3NYMA 1BR4A 1K05A 3FAPB 2R7RA 2XLOA 4JKVA 1ZU4A 3JSZA 4CDYA 5F5FA 3OWTA 4XPYA 1HMOA 2E87A 3UNGC 2RSEB 3WG7C 1VMAA 4MS2A 3RVZA 3OEOA 3JSEO 1VYIA 4FX5A 3EG9A 1NBBA 1ZW2A 2M4EA 4HFFB 1EJ9A 256BA 3RH3A 3UMIA 4JZAA 4IAQA 2NSFA 3QVYA 1MMAA 2CNWA 3HNJA 3DM9B 5A69A 1WASA 4EIYA 3G50A 2CCYA 4JJFA 2P6VA 1SR2A 4PJNA 3GEHA 3C62A 3QVZA 2V3CC 3AGUA 3UR3C 1YZAA 3SEOA 1FAPB 2YRFA 3O55A 5T3WA 4UDVA 1R49A 3I5QA 1QLEC 2OG2A 2GDCA 5KYUA 3W2WA 2GFHA 1QVXA 1RXQA 3IEEA 4P9TA 3DE9A 4PK4A 1K4SA 4FESA 4JVSA 1SF8A 1M6TA 3UGPA 1JAFA 1MNDA 2A6EF 5FZTA 3HKKA 4CS8C 3U5SA 2B0HA 5L0FA 5KYWA 2OJED 4BPMA 3ZIBA 4YT4A 4U5EE 2UUHA 2WZGA 4DRIB 1OKKD 4AL0A 5KYYA 3KYJA 2LQGA 2P61A 1QSPA 1TFKB 4CDVA 2GA0A 2L6FA 2NSGA 4RBNA 4MVOA 2KGOA 1ORYA 2VCBA 5D91A 5E33A 5B1AC 1OCCC 2HSQA 2CNWD 3UMKA 1OKKA 3G4ZA 5F28E 2I8BA 2J9BA 1ZHYA 3K6BA 4ONSA 2QE9A 2C03A 2IBFA 1BZ4A 4N6HA 5HV9A 1OW6A 1QZXA 1K4TA 1QQ3A 1Z3IX 1RKCA 4NQFA 4JJGA 1HE1A 3IQCA 1NLXA 4YL0A 4IAOA 1LKXA 3LLIA 3O39A 3B29A 4CSAA 2DI3A 3H2VA 1BBHA 1M57C 2JX0A 4J30B 3ZTZA 4QDLA 2YLGA 3A9CA 4U5CE 4CS8A 2F22A 3QMKA 1GGQA 2D5RB 2OCCC 5B3SC 1CGOA 4XLPF 1A7EA 1M56C 3JZ0A 2EILC 4U5DE 4PFPA 4YT2A 3ZWIA 1FMVA 3JTLO 4U5HA 1S05A 4IWBA 4WGZA 3S9OA 5JT4A 1G4WR 1GS9A 3GM2A 3GEEA 1Q0MA 4YJWA 3RFYA 4EBJA 4YWQA 1JPNA 2XRHA 1E83A 5T3TA 1YYXA 1K04A 3FVYA 4JTDB 3U9MA 4W8KA 3VM6A 4CSAC 2L6GA 1PD0A 1V54C 4H54A 4U5FE 2Q7RA 4LDQA 3EGDA 5JVEA 2HJ3A 1Q0KA 2EPMX 2PX0A 3TQOA 4A4AA 5CI9A 3J06A 4XWJA 1ZU5A 2ZPAA 4JIOA 2OEXA 1R4TA 5DS6A 2KQ9A 2Y69C 4XPXA 3EGXB 3DWWA 3RQFA 2HUJA 2IXOA 2M64A 3GWLA 2XS8A 1DOWA 1E85A 3GM3A 3SXZA 1K40A 1JR8A 3T6GB 4OIOF 1EQ1A 4E7ZA 3M1CB 4L6RA 4BJ5A 4C7OA 2OKUA 3AGTA 4JW1A 4PFOA 4MNDA 1RJ9B 1MNEA 4EHPA 3K33A 2A6HF 4GYTA 1WTYA 3C8ZA 3DKAA 2CYDA 1L3PA 3FOPA 2KK1A 3FXHA 3US6A 1SC7A 3KH2A 1WGWA 1F1MA 2YEVA 4JC7A 4CJOA 3POVA 1Z23A 4X0RA 3K7DA 2AWYA 4MTFA 5CIVA 2Y3HA 4LACB 3DMDA 4JCHA 4IJJA 1I4YA 2G3KA 4KC9A 2J9VA 3JYYA 1OXBA 3M4BA 3U2MA 1ZHWA 2OQMA 3FHDA 3S28A 1CPRA 1ZHZA 3LJBA 3ZSUA 4K1OA 3LEVA 1H9TA 1OW8A 1Y4CA 4CS9C 1YYJA 3DAGA 1AEPA 1VK5A 1LM3B 1UG7A 3GM1A 1A41A 3L0IA 2HJMA 3EG9B 1Z6AA 4XEKA 3TJ6A 5EK0A 5DQZA 1WWPA 3M4CA 3W8IA 4BJ6C 2HKVA 3ABMC 4CX9A 2Y3DA 2YL7A 4EKWA 4E0HA 2R25A 2R05A 3DXJF 3L34A 4HE8D 2B0JA 2VC9A 2H7GX 4O6NA 2QY9A 3T6JA 3U8VA 3ZG1A 1RRJA 2IXMA 3RW0A 3N24A 1SMYF 2ASRA 3SNHA 3LUTB 4MVUA 2YL3A 3IPMO 2LFFA 1FFTC 1YVIA 4CDAA 3ATPA 3Q7LA 4JURI 3T4RA 1A0BA 3NMIA 3EZIA 4DRHB 2AU5A 1ORSC 2QLAA 3EFOB 3KL4A 2XL6A 2W9YA 3SXYA 3HNKA 1PV3A 2L81A 2PP4A 4D4XA 5KYUB 3OA1A 3NDBB 2JD3A 5KYYB 2G62A 2XXAA 2QNLA 3LS1A 4IRUA 2NUTA 1CGNA 1T6IA 2IXPA 1HMDA 5GPGB 4DXWA 2KNHA 3EPVA 3NKEA 4BG0A 1TR2A 3S0XA 4FWVA 2CW0F 2NUTB 3HNIA 3FOOA 1LI7A 2WZFA 1JPJA 1TWAA 2LSEA 1A31A 2EIMC 3TD7A 1YAUO 3CAXA 1OCRC 1H6GA 2PX3A 2WZLA 2Q9CA 4WGYA 2A69F 2G3VA 2J7PA 2Y3GA 1TWCA 1NU7D 2R03A 5B1BC 5A6KA 4P9FA 5KYNA 3SZRA 4YN0B 1T8IA 5A6AA 3KPHA 4G7ZF 2ZXRA 1Y6DA 4G0HA 2XLMA 5IY5C 3LNRA 2XLEA 4R32A 2EINC 1M2VB 3FMSA 1RKEB 1HW1A 1U0BB 1LPEA 4CIPA 3DJNB 2L7AA 2Q3TA 1V4AA 1RKEA 5L0DA 3NMKA 1MMNA 2XL8A 4LLCA 5CI8A 5A6JA 4G7HF 2UUIA 4NTFA 3UMHA 3BEHA 3DAFA 3S84A 5DQTA 2OU6A 4JEAA 2BL2A 3MFNA 3DZAA 4J7YA 4KNWA 1TQGA 2R7WA 2J45A 3K1IC 1AVOB 3TJ5A 3WHNA 1IW7F 3O10A 3K1HA 2R7UA 3E70C 4YK5A 1A36A 2EPOA 3HNLA 2H7OA 4QI0A 4DBQA 2NG1A 5D92A 2A68F 3SYNA 3DD7A 1H9GA 1YA9A 3VYWA 3ZVRA 4LLEA 3LAYA 3RQGA 5B3IA 3W4YA 2C04A 3MYFA 3F47A 1Q0DA 4OINF 2VASA 3VF0A 3SXKA 2XLVA 3PHF2 4C3DA 1LI5A 1E86A 2X51A 5JSLA 2BE5F 5A6BD 1L7CA 2DB4A 1WN0A 3C8GB 3NG1A 1ORJA 3PCVA 5COGA 2HV7A 4U9EA 2J8WA 2XLHA 3M15A 2LD6A 4N6CA 2FFHA 2H7BA 4Z9HA 1ST6A 3AOUA 1EKYA 1C02A 3FDQA 3AJMA 4IGGA 4LDRA 2WB7A 5DS4A 3NMJA 2X0CA 4PR9A
chains in the Genus database with same CATH topology
1K4TA 2F4QA 1TL8A 1LPQA 1R49A 1EJ9A 1SEUA 1A41A 2B9SA 3IGCA 3M4AA 1A31A 1RR8C 1A35A 2H7GX 1SC7A 1RRJA 1A36A 1NH3A 1T8IA 2H7FX 1K4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4T A;  2F4Q A;  1TL8 A;  1LPQ A;  1R49 A;  1EJ9 A;  1SEU A;  1A41 A;  2B9S A;  3IGC A;  3M4A A;  1A31 A;  1RR8 C;  1A35 A;  2H7G X;  1SC7 A;  1RRJ A;  1A36 A;  1NH3 A;  1T8I A;  2H7F X;  1K4S A; 
#chains in the Genus database with same CATH topology
 4K0D A;  4WAB A;  3GAN A;  3K66 A;  2VH3 A;  3NYL A;  5F5H A;  3W8H A;  3L8J A;  2W45 A;  4XLN F;  3FAJ A;  1FNT c;  2R02 A;  3VRC A;  1J8M F;  1FMW A;  2ZXW C;  4EBK A;  1U89 A;  2NUP B;  4U9D A;  5DS5 A;  1SEU A;  2LK4 A;  3MLG A;  4EBB A;  3A11 A;  4C3E A;  3U2L A;  2J9W A;  2J7P D;  2LCH A;  5HSW A;  3M4A A;  1VLT A;  4O6Y A;  2R7V A;  2PFD A;  1Q0F A;  1VOM A;  1ZHT A;  1BDJ B;  2YVK A;  4M63 A;  3GOR A;  2H8A A;  1T01 A;  5BQI A;  2VCC A;  3T9O A;  3ZDL A;  4J7T A;  1NH3 A;  1LS4 A;  3U0C A;  1VB5 A;  1BR1 A;  1E2X A;  3M79 A;  5BQG A;  4MVR A;  1YZC A;  5JP7 A;  2VB6 A;  3NKD A;  4Z9I A;  2F4Q A;  3V5X A;  2GAQ A;  4RDA A;  2ICW G;  2R7X A;  4QI2 A;  2WVO A;  5BQH A;  2FGY A;  4MVS A;  1VLS A;  1C03 A;  1KTM A;  3DE8 A;  2IOQ A;  3F46 A;  4FAP B;  3B71 A;  1FTS A;  3CQZ A;  4XEV A;  4AK9 A;  2YWA A;  1O3U A;  4Q7C A;  1Z5Z A;  5DVW A;  3HTK C;  4BEM J;  1LVK A;  4MW8 A;  2EPK X;  3TK0 A;  1HW2 A;  2MHR A;  3ASN C;  4KI2 A;  1SZI A;  4OD5 A;  3DM5 A;  3VAY A;  2CGE A;  2XLW A;  3JYH A;  1KNY A;  2HMZ A;  1D0Y A;  3N2Z B;  1D0Z A;  1M2V A;  4W8P A;  1NG1 A;  3ZC4 A;  1LS1 A;  1B68 A;  3R7C A;  4DVZ A;  2KJG A;  2YL1 A;  1GM5 A;  3EHN A;  5L0H A;  3MYI A;  4OIQ F;  4G78 A;  3V7O A;  3WOD F;  4H4K C;  5BUO A;  1APC A;  4RD9 A;  4DJ9 A;  4PJL A;  3H65 A;  2L9J A;  3EHM A;  4O7G A;  2DYR C;  4DRJ B;  5AGF A;  3S29 A;  2IXN A;  2P7V A;  3TUL A;  3QW0 A;  1D1B A;  4E0I A;  2R9R B;  3U9J A;  1ZW3 A;  3HJC A;  3C8G D;  4MQ9 F;  4LER A;  4PJM A;  2WVN A;  3ZTM A;  2D4U A;  2CDQ A;  1EA8 A;  4CJG A;  1XZP A;  2OOC A;  4GQH A;  1OXK A;  4JEB A;  3RQE A;  1H7I A;  2HS5 A;  4K7B A;  5AC4 A;  1LE4 A;  3S90 A;  4JTC B;  1ZZP A;  1HY5 A;  3NRH A;  5A6B A;  1C17 M;  1OQC A;  1T6U A;  4WJ0 A;  2H7F X;  5EGY A;  3UGO A;  2W4M A;  4HEA J;  3B0P A;  2YZS A;  1EI7 A;  2AVK A;  2KSF A;  2MWQ A;  2HV6 A;  1G4U S;  5JLI A;  2J0X A;  4AE4 A;  3SXM A;  3C63 A;  3SP1 A;  5JS5 A;  1CPQ A;  3L8I A;  2XM0 A;  1V55 C;  3LS0 A;  5DLJ A;  2ETS A;  1RCP A;  5KYX A;  4C7O B;  1GQA A;  1QPU A;  4DBR A;  1KU2 A;  4JTA B;  5KYX B;  5AC5 A;  1TKN A;  2YQY A;  2ZXP A;  3LLK A;  4NTB A;  2EPL X;  3RIP A;  2MYS A;  1U6H A;  3GOD A;  2R7T A;  4O6M A;  3RVY A;  1RR8 C;  2OJQ A;  2PF4 E;  1YA7 O;  4KNV A;  2H7V C;  2V26 A;  4MVQ A;  1BR2 A;  3U8P A;  3T6B A;  3AG3 C;  3MBG A;  1W2W A;  1YDI A;  1DOV A;  3QZC A;  1PCX A;  2QUP A;  5E3A A;  3TOL A;  2RD9 A;  2Q00 A;  2JPU A;  4N4W A;  2OEV A;  3ECS A;  2QTV A;  1T9K A;  4MTO A;  2Z15 A;  3IHU A;  3KKB A;  1A7D A;  3BRJ A;  4CBE A;  1LIH A;  1RMV A;  5L0G A;  4CS9 A;  4MTG A;  2YHS A;  3U3F A;  3X1O A;  4NC3 A;  3ITF A;  2HZ8 A;  3N0T A;  4GEH A;  3JRT A;  1I4Z A;  4NTA A;  5COF A;  2KYH A;  5EHH A;  1TWH A;  1TWG A;  3CZ6 A;  3Q6M A;  3R2P A;  3O6X A;  2O9X A;  2J46 A;  3LEO A;  1D1C A;  2R7O A;  5K0I A;  4C3B A;  4O79 A;  4XEF A;  1XZQ A;  3C7J A;  2PNO A;  1NFO A;  3B9Q A;  4NY3 A;  1AUE A;  1YJG A;  1JOG A;  2NUP A;  3EZH A;  4XTK A;  4PJJ A;  4F4B A;  1XWJ A;  3Q7G A;  2A0B A;  2DYS C;  1J8Y F;  2W4B A;  1A7V A;  3EJN A;  1MMD A;  2Q9B A;  3EH1 A;  3MX3 A;  4OD4 A;  3JCU Q;  1O5H A;  4CS7 A;  3HLZ A;  4BJT A;  3B0V C;  1VTM P;  5JRA A;  1T6Q A;  4I1M A;  4U5G A;  2ZD9 A;  4ULW A;  4YT5 A;  3RF3 A;  3PDM P;  4I44 A;  1S7Z A;  5L0C A;  3DI5 A;  4BJ5 C;  2XXA B;  5KYW B;  4ZLD A;  3AQC A;  3DJU B;  1NU9 C;  1M2O A;  4MW3 A;  3I4U A;  4XPW A;  2KC3 A;  5FCL A;  4EWC A;  1LPQ A;  2ZXO A;  3E9V A;  3EFO A;  1D0X A;  1G5Z A;  3LES A;  4MVZ A;  4E18 A;  4YT8 A;  4Q5S F;  3L1M A;  4CIH A;  5L3Q A;  1WAT A;  4HFK B;  1TL8 A;  3ZQV A;  4J32 B;  4BJ6 A;  4D4N A;  1CGM E;  1LE2 A;  4YL1 A;  4BEJ A;  1FFH A;  2HMQ A;  2PBE A;  1R5I D;  3IQ6 A;  4IAR A;  2I15 A;  3QTH A;  2IYL D;  1A35 A;  5JUA A;  1OCO C;  4U5B E;  2AP3 A;  5L3V A;  3CEX A;  2VCA A;  3W2V A;  3ZQY A;  4A2N B;  5L0I A;  2Y3B A;  2YLI A;  3GEI A;  2KW3 C;  3LNM B;  2P1A A;  3X2Q C;  4EUK B;  3B0U X;  4B6I A;  3V5Y A;  1QKR A;  2Q9A A;  5L0J A;  1SYQ A;  2EPN A;  1FR0 A;  2EIJ C;  1MQV A;  2YLD A;  1UFB A;  2L6H A;  3I5P A;  4N06 A;  1T5O A;  2WVQ A;  1NZE A;  2XL4 A;  2XLD A;  3EQL F;  3S27 A;  2XS1 A;  3ASO C;  2HSB A;  1I5N A;  4NCQ A;  2LP4 A;  2R7Q A;  3K1I A;  3V5Z A;  2WL8 A;  4XQ1 A;  1TFO B;  2AWC A;  3ABK C;  1ZHX A;  3AG4 C;  4ULV A;  3H2U A;  3AG1 C;  4DOZ A;  1YAR O;  2B9S A;  1OR3 A;  3IGC A;  1NSG B;  1OCZ C;  2XSE A;  3G4X A;  1G8X A;  4AL1 A;  1Q0G A;  4Q4Z F;  4Z9J A;  2R7S A;  4BJ1 A;  1IZM A;  3KYI A;  3Q6N A;  3GWN A;  3JRM O;  4LDK A;  4IB4 A;  5TJ5 E;  3CSK A;  1WOL A;  4KBL A;  4ZLC A;  1Z63 A;  2TMV P;  4AX2 A;  4ER9 A;  2Q4F A;  4JE9 A;  1D1A A;  1NFN A;  4OIR F;  4E7S A;  4G7O F;  2LFD A;  2YL0 A;  3PMR A;  3AQB A;  1Z7Q c;  1N1C A;  4JCZ A;  4ANJ A;  4PAC A;  1HE9 A;  2A0U A;  3EGX A;  2Y39 A;  2NPU A;  3EGD B;  1JRA A;  1ZYR F;  5COM A;  5E3C A;  2YKZ A;  1JMW A;  1YLM A;  3WAQ A;  4P6I C;  2EIK C;  1OW7 A;  4OIP F;  3RYL A;  3QW1 A;  4AE4 B;  4E17 A;  1E84 A;  4JRZ A;  2BC5 A;  2IM8 A;  2A1D D;  3ABL C;  4I1O B;  4YL3 A;  4DVY P;  3TOM A;  3C18 A;  3KMI A;  1PD1 A;  5T1D B;  2DGJ A;  2J0W A;  4I3M A;  2P0N A;  2XM4 A;  3IQT A;  5E2Q A;  2J9U A;  2FAP B;  3JT1 A;  1OR2 A;  1V74 B;  3U3B A;  4MVM A;  2GWW A;  2LIG A;  3NYJ A;  1VYK A;  3AG2 C;  3C8G A;  1RJ9 A;  1ZVZ A;  3EH2 A;  2HFI A;  3IQ5 A;  3RKO F;  1MMG A;  1O87 A;  3NYM A;  1BR4 A;  1K05 A;  3FAP B;  2R7R A;  2XLO A;  4JKV A;  1ZU4 A;  3JSZ A;  4CDY A;  5F5F A;  3OWT A;  4XPY A;  1HMO A;  2E87 A;  3UNG C;  2RSE B;  3WG7 C;  1VMA A;  4MS2 A;  3RVZ A;  3OEO A;  3JSE O;  1VYI A;  4FX5 A;  3EG9 A;  1NBB A;  1ZW2 A;  2M4E A;  4HFF B;  1EJ9 A;  256B A;  3RH3 A;  3UMI A;  4JZA A;  4IAQ A;  2NSF A;  3QVY A;  1MMA A;  2CNW A;  3HNJ A;  3DM9 B;  5A69 A;  1WAS A;  4EIY A;  3G50 A;  2CCY A;  4JJF A;  2P6V A;  1SR2 A;  4PJN A;  3GEH A;  3C62 A;  3QVZ A;  2V3C C;  3AGU A;  3UR3 C;  1YZA A;  3SEO A;  1FAP B;  2YRF A;  3O55 A;  5T3W A;  4UDV A;  1R49 A;  3I5Q A;  1QLE C;  2OG2 A;  2GDC A;  5KYU A;  3W2W A;  2GFH A;  1QVX A;  1RXQ A;  3IEE A;  4P9T A;  3DE9 A;  4PK4 A;  1K4S A;  4FES A;  4JVS A;  1SF8 A;  1M6T A;  3UGP A;  1JAF A;  1MND A;  2A6E F;  5FZT A;  3HKK A;  4CS8 C;  3U5S A;  2B0H A;  5L0F A;  5KYW A;  2OJE D;  4BPM A;  3ZIB A;  4YT4 A;  4U5E E;  2UUH A;  2WZG A;  4DRI B;  1OKK D;  4AL0 A;  5KYY A;  3KYJ A;  2LQG A;  2P61 A;  1QSP A;  1TFK B;  4CDV A;  2GA0 A;  2L6F A;  2NSG A;  4RBN A;  4MVO A;  2KGO A;  1ORY A;  2VCB A;  5D91 A;  5E33 A;  5B1A C;  1OCC C;  2HSQ A;  2CNW D;  3UMK A;  1OKK A;  3G4Z A;  5F28 E;  2I8B A;  2J9B A;  1ZHY A;  3K6B A;  4ONS A;  2QE9 A;  2C03 A;  2IBF A;  1BZ4 A;  4N6H A;  5HV9 A;  1OW6 A;  1QZX A;  1K4T A;  1QQ3 A;  1Z3I X;  1RKC A;  4NQF A;  4JJG A;  1HE1 A;  3IQC A;  1NLX A;  4YL0 A;  4IAO A;  1LKX A;  3LLI A;  3O39 A;  3B29 A;  4CSA A;  2DI3 A;  3H2V A;  1BBH A;  1M57 C;  2JX0 A;  4J30 B;  3ZTZ A;  4QDL A;  2YLG A;  3A9C A;  4U5C E;  4CS8 A;  2F22 A;  3QMK A;  1GGQ A;  2D5R B;  2OCC C;  5B3S C;  1CGO A;  4XLP F;  1A7E A;  1M56 C;  3JZ0 A;  2EIL C;  4U5D E;  4PFP A;  4YT2 A;  3ZWI A;  1FMV A;  3JTL O;  4U5H A;  1S05 A;  4IWB A;  4WGZ A;  3S9O A;  5JT4 A;  1G4W R;  1GS9 A;  3GM2 A;  3GEE A;  1Q0M A;  4YJW A;  3RFY A;  4EBJ A;  4YWQ A;  1JPN A;  2XRH A;  1E83 A;  5T3T A;  1YYX A;  1K04 A;  3FVY A;  4JTD B;  3U9M A;  4W8K A;  3VM6 A;  4CSA C;  2L6G A;  1PD0 A;  1V54 C;  4H54 A;  4U5F E;  2Q7R A;  4LDQ A;  3EGD A;  5JVE A;  2HJ3 A;  1Q0K A;  2EPM X;  2PX0 A;  3TQO A;  4A4A A;  5CI9 A;  3J06 A;  4XWJ A;  1ZU5 A;  2ZPA A;  4JIO A;  2OEX A;  1R4T A;  5DS6 A;  2KQ9 A;  2Y69 C;  4XPX A;  3EGX B;  3DWW A;  3RQF A;  2HUJ A;  2IXO A;  2M64 A;  3GWL A;  2XS8 A;  1DOW A;  1E85 A;  3GM3 A;  3SXZ A;  1K40 A;  1JR8 A;  3T6G B;  4OIO F;  1EQ1 A;  4E7Z A;  3M1C B;  4L6R A;  4BJ5 A;  4C7O A;  2OKU A;  3AGT A;  4JW1 A;  4PFO A;  4MND A;  1RJ9 B;  1MNE A;  4EHP A;  3K33 A;  2A6H F;  4GYT A;  1WTY A;  3C8Z A;  3DKA A;  2CYD A;  1L3P A;  3FOP A;  2KK1 A;  3FXH A;  3US6 A;  1SC7 A;  3KH2 A;  1WGW A;  1F1M A;  2YEV A;  4JC7 A;  4CJO A;  3POV A;  1Z23 A;  4X0R A;  3K7D A;  2AWY A;  4MTF A;  5CIV A;  2Y3H A;  4LAC B;  3DMD A;  4JCH A;  4IJJ A;  1I4Y A;  2G3K A;  4KC9 A;  2J9V A;  3JYY A;  1OXB A;  3M4B A;  3U2M A;  1ZHW A;  2OQM A;  3FHD A;  3S28 A;  1CPR A;  1ZHZ A;  3LJB A;  3ZSU A;  4K1O A;  3LEV A;  1H9T A;  1OW8 A;  1Y4C A;  4CS9 C;  1YYJ A;  3DAG A;  1AEP A;  1VK5 A;  1LM3 B;  1UG7 A;  3GM1 A;  1A41 A;  3L0I A;  2HJM A;  3EG9 B;  1Z6A A;  4XEK A;  3TJ6 A;  5EK0 A;  5DQZ A;  1WWP A;  3M4C A;  3W8I A;  4BJ6 C;  2HKV A;  3ABM C;  4CX9 A;  2Y3D A;  2YL7 A;  4EKW A;  4E0H A;  2R25 A;  2R05 A;  3DXJ F;  3L34 A;  4HE8 D;  2B0J A;  2VC9 A;  2H7G X;  4O6N A;  2QY9 A;  3T6J A;  3U8V A;  3ZG1 A;  1RRJ A;  2IXM A;  3RW0 A;  3N24 A;  1SMY F;  2ASR A;  3SNH A;  3LUT B;  4MVU A;  2YL3 A;  3IPM O;  2LFF A;  1FFT C;  1YVI A;  4CDA A;  3ATP A;  3Q7L A;  4JUR I;  3T4R A;  1A0B A;  3NMI A;  3EZI A;  4DRH B;  2AU5 A;  1ORS C;  2QLA A;  3EFO B;  3KL4 A;  2XL6 A;  2W9Y A;  3SXY A;  3HNK A;  1PV3 A;  2L81 A;  2PP4 A;  4D4X A;  5KYU B;  3OA1 A;  3NDB B;  2JD3 A;  5KYY B;  2G62 A;  2XXA A;  2QNL A;  3LS1 A;  4IRU A;  2NUT A;  1CGN A;  1T6I A;  2IXP A;  1HMD A;  5GPG B;  4DXW A;  2KNH A;  3EPV A;  3NKE A;  4BG0 A;  1TR2 A;  3S0X A;  4FWV A;  2CW0 F;  2NUT B;  3HNI A;  3FOO A;  1LI7 A;  2WZF A;  1JPJ A;  1TWA A;  2LSE A;  1A31 A;  2EIM C;  3TD7 A;  1YAU O;  3CAX A;  1OCR C;  1H6G A;  2PX3 A;  2WZL A;  2Q9C A;  4WGY A;  2A69 F;  2G3V A;  2J7P A;  2Y3G A;  1TWC A;  1NU7 D;  2R03 A;  5B1B C;  5A6K A;  4P9F A;  5KYN A;  3SZR A;  4YN0 B;  1T8I A;  5A6A A;  3KPH A;  4G7Z F;  2ZXR A;  1Y6D A;  4G0H A;  2XLM A;  5IY5 C;  3LNR A;  2XLE A;  4R32 A;  2EIN C;  1M2V B;  3FMS A;  1RKE B;  1HW1 A;  1U0B B;  1LPE A;  4CIP A;  3DJN B;  2L7A A;  2Q3T A;  1V4A A;  1RKE A;  5L0D A;  3NMK A;  1MMN A;  2XL8 A;  4LLC A;  5CI8 A;  5A6J A;  4G7H F;  2UUI A;  4NTF A;  3UMH A;  3BEH A;  3DAF A;  3S84 A;  5DQT A;  2OU6 A;  4JEA A;  2BL2 A;  3MFN A;  3DZA A;  4J7Y A;  4KNW A;  1TQG A;  2R7W A;  2J45 A;  3K1I C;  1AVO B;  3TJ5 A;  3WHN A;  1IW7 F;  3O10 A;  3K1H A;  2R7U A;  3E70 C;  4YK5 A;  1A36 A;  2EPO A;  3HNL A;  2H7O A;  4QI0 A;  4DBQ A;  2NG1 A;  5D92 A;  2A68 F;  3SYN A;  3DD7 A;  1H9G A;  1YA9 A;  3VYW A;  3ZVR A;  4LLE A;  3LAY A;  3RQG A;  5B3I A;  3W4Y A;  2C04 A;  3MYF A;  3F47 A;  1Q0D A;  4OIN F;  2VAS A;  3VF0 A;  3SXK A;  2XLV A;  3PHF 2;  4C3D A;  1LI5 A;  1E86 A;  2X51 A;  5JSL A;  2BE5 F;  5A6B D;  1L7C A;  2DB4 A;  1WN0 A;  3C8G B;  3NG1 A;  1ORJ A;  3PCV A;  5COG A;  2HV7 A;  4U9E A;  2J8W A;  2XLH A;  3M15 A;  2LD6 A;  4N6C A;  2FFH A;  2H7B A;  4Z9H A;  1ST6 A;  3AOU A;  1EKY A;  1C02 A;  3FDQ A;  3AJM A;  4IGG A;  4LDR A;  2WB7 A;  5DS4 A;  3NMJ A;  2X0C A;  4PR9 A; 
#chains in the Genus database with same CATH homology
 1K4T A;  2F4Q A;  1TL8 A;  1LPQ A;  1R49 A;  1EJ9 A;  1SEU A;  1A41 A;  2B9S A;  3IGC A;  3M4A A;  1A31 A;  1RR8 C;  1A35 A;  2H7G X;  1SC7 A;  1RRJ A;  1A36 A;  1NH3 A;  1T8I A;  2H7F X;  1K4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...