1A4AA

Azurin mutant with met 121 replaced by his, ph 6.5 crystal form, data collected at 16 degrees celsius
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
129
Chain Sequence
b'AQCEATIESNDAMQYDLKEMVVDKSCKQFTVHLKHVGKMAKSAMGHNWVLTKEADKEGVATDGMNAGLAQDYVKAGDTRVIAHTKVIGGGESDSVTFDVSKLTPGEAYAYFCSFPGHWAMHKGTLKLSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Rack-induced metal binding vs. flexibility: Met121His azurin crystal structures at different pH.
pubmed doi rcsb
source organism Achromobacter denitrificans
molecule tags Electron transport
total genus 29
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1a4aA00
5B7MA 2B3IA 1KBWA 3H56A 3NSYA 1IC0A 3WNJA 5I6OA 2GHZA 3FSAA 3QJVB 2JXMA 4BDVA 1NPJA 4EF3A 2J5WA 2UX6A 4GXFA 2H3XC 2QDVA 3RYMA 3T9WA 1ASPA 2CAKA 2FT7A 3JTBA 3WG7B 2GSMB 3S3BB 1PNDA 2VSKB 3V9EA 1WS7A 1V54B 4QKTA 1KDJA 1HFUA 1OF0A 1WA1X 3ASOB 3GDCA 1RCYA 3ZX1A 1TU2A 4AKPA 2BP0B 2J57A 1L9PA 1ILUA 1NDTA 1NIAA 4E9VA 2ZXWB 1B3IA 5B3SB 1AS8A 2VW7A 2ZONA 1ID2A 2EILB 2QPDB 3NP4A 2PPCA 2I7OA 2CCWA 1W6LA 1SF3A 2QT6A 4A66A 1MZYA 3T6WA 1RZPA 8PAZA 1AIZA 1ZDQA 2LLNA 1JOIA 2GB2A 5TK4A 3FSVA 2FJSA 1PZAA 4DP0X 3AY2A 1OE2A 1ET8A 3IN2A 2HXAA 4KNTA 4N4YB 2PPAA 4M3HA 5B1BB 1NIBA 1W8EA 3NJJA 3EH3B 1A3ZA 1CYWA 1PLCA 1E67A 2BP0A 3ABKB 2E86A 3WI9A 1ASOA 2YXVA 1AZUA 5F7AA 3PPSA 4MFHA 1J5DA 1ETJA 2UXGA 3OM3B 2OJ1A 1JZGA 2ZWNA 3FQYA 3T6ZA 2UX7A 1AZNA 1OOWA 1SF5A 1KYAA 4YSQA 4KO6A 2FWLB 1J9SA 2UXTA 2VM3A 1AS7A 1E65A 2IDSA 7PAZA 2XVBA 4G7QB 1A65A 2YAQA 2VSMB 1KCWA 5B1AB 4DP9X 1KBVA 4FAAB 5B7EA 1WAEA 5I5JA 1ZV2A 4PAZA 3FYEB 1QHQA 5B7FA 1CYXA 5IY5B 4YSDA 4A67A 1W6WA 4KO9A 1X9UA 1AQ8A 3AW5A 3FPXA 3X1NA 1SNRA 1HAUA 2BZCA 2PPFA 4KOCA 1NIEA 5B1JA 4DPBX 3MBWB 3KW8A 2IDTA 4UANA 5TK2A 4G71B 1I53A 2PP7A 2W88A 7PCYA 2XYBA 3EF4A 4YSEA 2BWIA 1UATA 2YAEA 5PCYA 1NTDA 2JKWA 4AKOA 1J9TA 3G5WA 2IDQA 4AI7A 2FQGA 3NSFA 1A4AA 1AOZA 4KNSA 3UAEA 1ZIBA 3TBCA 1A4CA 3NJFA 3TU6A 1WA2X 3H4FA 3NYKA 1PMYA 4HIPA 2W8CA 1AANA 2A3TA 4DP4X 2GC7C 1TKWA 3ZBMA 2GI0A 1OV8A 3L45A 2UXVA 3NJHA 6PCYA 1SHXA 2XX1A 4KOBA 4BK5C 3NT0A 3AG4B 3NSCA 3PAZA 2HLEB 3IN0A 3SQRA 1IKOP 3TA4D 3CZUB 3OD3A 1E30A 1KV7A 4CSZA 1J9QA 2TSAA 4UF7C 1L9TA 2QDWA 2DY2A 1PZCA 4X4KA 3FQ2A 3FSWA 2EIMB 3SBPA 2IDUA 2OV0A 2X88A 4E9SA 1R1CA 1V10A 1JVOA 1ILSA 1NZRA 2BO0A 5EHFA 2AVFA 3CDZB 2I7SA 3FT0A 3UGEA 3X1GA 1RKRA 3X1BA 2DV6A 2R7EB 5B1JC 2FNWA 1FWXA 3KW7A 1NIDA 4YSCA 1GS6X 1PY0A 4YSTA 2P80A 2PLTA 3ABLB 4YVNA 3QJTB 4CSPA 2XV2A 5ANHA 1M57B 1QNIA 4P5SA 1AZRA 4YSAA 3GYRA 1GY2A 2CJ3A 3PXLA 4YSSA 3TBBA 3CVDA 3EH5B 2WSDA 4E9TA 3OQRA 4E9QA 4DP5X 3QJRB 3CDZA 6PAZA 2R7EA 4E9WA 5E9NA 3S3CB 2BP8B 2WO2B 2PCFA 1BAWA 1BXVA 1AG0A 4AX3A 3HB3B 2FT8A 4UAHA 4DP2X 1A4BA 2H5UA 3IEAA 2FTAA 3ZIYA 2HZHA 1BYPA 2IH8A 4A2DA 2BW5A 2FQEA 4ZK8A 4YSPA 4A2HA 4JKNA 2DWTA 3AG3B 1EHKB 4HCGA 1ZDSA 2IDFA 2VW4A 3WIAA 4G72B 3IE9A 2QPEB 4HZ1A 3NJIA 3AG1B 1OE1A 2BP8A 2IH9A 5PAZA 5AFAA 4DP1X 4HCFA 2I85A 1GR7A 3AZUA 1BQ5A 3CVCA 4WTQA 3SBQA 1JXGA 5LDUA 1JXFA 1WS8A 3S3DB 1XB6A 3FPYA 1GS8A 1IUZA 3S8FB 3EH4B 5I6KA 4GP8B 4HCIA 4NB7A 4E9RA 4ENZA 2TSBA 4M4RB 1FA4A 2YAFA 1PF3A 4GYBA 4W9ZA 2CALA 3ABGA 2FQFA 1L9SA 2J55A 1JZJA 1BEXA 5D4IA 1BQKA 4JHVA 2Y1AA 4F2EA 1JERA 1JZFA 2AANA 1SFHA 3V9CA 2IWEA 1OCOB 1PAZA 3DTUB 1E5YA 4KO7A 4F7KA 3H4HA 5B1KA 1IBZA 2GC4C 1YLBB 4W1TA 3U25A 1OCZB 3FS9A 2BWDA 3FU8A 4TXVB 4DP7X 3AG2B 2XU9A 2XXFA 2J56A 5FC9A 2VM4A 1N68A 1XMEB 3FU7B 3QJQB 4YSUA 2H47C 1GW0A 4Q89A 1AZCA 1E5ZA 3WKQA 2EIJB 9PCYA 3CVBA 2MRYA 1JVLA 1NIFA 2DYSB 3PLYA 3TASA 1A8ZA 3QJSB 4PCYA 4Q8BA 1XB8A 2HX8A 4HHWA 1JZIA 1M56B 2IAAC 1AZBA 3MX0B 1IBYA 1PNCA 3ABMB 3N2JA 4RH4A 4G7RB 1TEGA 2XX0A 3FU7A 5I26A 3NJLA 3T6VA 3NSDA 1J5CA 2JFCA 3FSZA 4A2GA 1BXAA 1PLAA 2YQBA 5I5IA 4A68A 1OE3A 1KGYE 2RACA 2GBAA 4G7SB 1AAJA 5AZUA 4F2FA 2X87A 4GP5B 2PPDA 3PAVA 4HALA 2WO3B 4KNUA 4E9YA 1NWPA 2XV0A 2FQDA 3NJMA 1J9RA 2PP8A 4AZUA 4A2FA 5I6PA 2B08A 3JT2A 3DKHA 1VLXA 2Q9OA 1ET7A 1MG3C 3WKPA 1SDDB 1XB3A 3IBOA 3UAAA 3FYIB 1L9RA 1BQRA 1PCSA 3DIVA 1M9WA 1PZBA 3NJGA 4K9JA 3FU9A 2XWZA 2CBPA 2PP9A 1MZZA 2AFNA 4YSOA 2UXFA 3BQVA 1CURA 4DP8X 5I5MA 1HAWA 1NPNA 2XV3A 4QLWA 2BW4A 3QPKA 2HX7A 3UADA 3OMNB 2XUWA 2VW6A 4KO5A 1ZIAA 2YAPA 2EINB 5I6NA 1BYOA 1SFDA 1SDDA 3ERXA 3GXUB 4DP6X 3CG8A 2YARA 4DPCX 4BXVA 2VN3A 2ZOOA 1GS7A 3EHBB 1N70A 1KDIA 2XLLA 5I6LA 1JXDA 2BZ7A 1DZ0A 4HHGA 3C75A 1ET5A 3SBRA 1MG2C 3D12B 4YVUA 1NINA 3X1FA 1SHWA 2AZUA 4WKXA 4L0PB 4FA7B 1EZLA 2DWSA 1V55B 2YAOA 2GIMA 1CUOA 2OCCB 1WA0X 1ZPUA 2MTAA 3BVDB 1NWOA 3QJUB 3QQXA 4DPAX 1MDAA 3FQ1A 5F7BA 4N8UA 3ZDWA 3NJNA 5A7EA 2DYRB 1AACA 3T71A 2AZAA 3X1EA 1AG6A 2HX9A 3ASNB 2IWFA 2XXGA 3PAUA 4HAKA 5D4HA 3T6XA 5AKRA 4YL4A 1PLBA 1SJMA 4YSRA 3UABA 4BWTA 4E9XA 1L9QA 2YAMA 1TEFA 3HEIB 3S8GB 5D4JA 1GSKA 1L9OA 1OCCB 2CUAA 4G70B 4NAJA 4GP4B 4JHUA 2BHFA 4BWUA 5I6MA 1JZEA 2P80D 2YAHA 1GYCA 1T5KA 5I28A 1F56A 1KCBA 1AR1B 4GY4A 1ADWA 3NP3A 2Y69B 2N0MA 4NERA 1QLEB 2PPEA 1CC3A 2YXWA 1RZQA 2PCYA 2IWKA 3X2QB 4AKQA 3UACA 4P5RA 1NICA 4A2EA 1BXUA 2Q5BA 4BDVB 2HRGA 4BXSV 2VMJA 1X9RA 2HRHA 3WNIA 1OCRB 1FFTB 3OMAB 2EIKB 4BWWA 2NRDA 1AS6A 1URIA 1ASQA 3N55A 3OMIB 3NJKA 2FT6A 3PCYA 1GY1A 1JZHA 1DYZA
chains in the Genus database with same CATH superfamily
4ZDHB 1OSZB 2ICES 4N68A 4XOAA 3FSAA 4Z7UE 4QTFA 1MHPH 2HUEA 3RWIB 2UX6A 1IGCH 4YK4B 2OMWB 3EYOB 3RYMA 2FT7A 1RQ5A 3QUMB 2KHAA 3TTSA 4Q6IB 3SGJC 2DD8L 1V54B 4JY6B 4PRPB 5DJ6B 3ZL2A 1HK6A 3K8LA 3RG1C 4IBYA 4OZHA 1DJYA 1LK2B 3ESUF 4NPJA 3Q6GL 4I1PA 1QFOA 1TZHB 1ILUA 2CMRL 2PTTA 1EGJH 1NCGA 4MMYA 4OLYL 4PD4K 4PN6A 4ZPTA 4ALAL 2AJZB 2VW7A 3HC3H 1YDPA 1SHSA 2EILB 4KK5C 3RL2B 3U4EB 3BN3B 4Y16C 2BNQA 3GHEL 5L2KA 1LP9E 4JFXA 5KSBA 2VCOA 4ELMF 3KD4A 4Q9BA 4XCYA 2LLNA 2PO6B 4JR9H 1GYWA 1IIKA 5DD1H 4DP0X 3HZYA 3L7FB 5A2IH 2WXFA 3CFKB 5I71C 1IGML 5CS7A 1JN6B 2FCBA 3N40F 3QCVH 4XR8C 3LS4H 5MEPB 2W38A 3BC9A 2NYZA 4N5EC 5C0BD 4FQLL 4KAQL 4CVZA 1F4YH 4XHQA 3VXUE 4RBPH 3DX9A 3QQ9C 3WI9A 2GKIA 4N0YH 3SPJA 3PYCA 2WLJA 4JHZA 1QW8A 2NY0B 1IC4L 1SY6H 3ECVA 3BGFB 4GKLA 1MN4A 4JGNA 3P3YA 3CGTA 3MMEB 4OSUH 4IS6B 3TA3D 2ADIA 4HPYH 1TO4A 2JELL 5J9PA 3I6KA 3QQDA 2QTVA 1KCLA 4Q4IA 4PP2A 5DQDL 3FB6B 4Y1SA 5DDHA 4HD9A 5K93A 4ZAKC 5ANMB 4JFEE 4AV0A 4TNFA 3VMOA 2YK1H 5I5JA 5I8CA 3H85A 3O8XA 3P40A 4XC3L 2KDYA 2CUMA 4MKTA 4LLDB 3OJ2C 1KNOB 1YYCA 1H8NA 1CIDA 1RZJL 5FKPB 4J1UA 3WGUB 4RMRA 2CIIB 4JGJA 3CTTA 1U92B 5IUCA 5KUKA 4Z9KB 3BFQG 4A67A 1IEBA 4NBYB 4FKEA 2V2TA 3QDJE 4IRJA 4KV5F 3SDCD 2BNRD 1H3PH 1F4AA 3PS6A 3TPUA 1FYTA 3VI4B 1NLDL 1OB1B 2D9CA 3MV9D 2YFOA 1SNRA 5KANI 5E8OA 4S1DD 2EECA 1FAIH 3U7YH 4U1JA 5C07B 2UZYB 3TBTB 1XF4B 1EEYA 5IB1A 5JIMA 5AG9A 4CN1A 1MCCA 2Y1VA 5CLYA 1T2XA 3PWPE 3EF4A 4N20A 1VENA 4YSEA 2C9QA 1CZ8L 2YBRA 1DBML 4IGBA 3SDAB 5PCYA 2EDXA 3PQYB 3PV6B 2XN9E 1QBBA 4KJWD 5D1QC 2K4AA 1BJ1H 4G1EB 4S1SL 3ZTCC 1E5AA 2HA1A 1A4AA 3UAEA 5I1DB 3VQ2C 3TU6A 1MWOA 4M93C 5C6TL 3JTSB 2KKQA 1Y1DA 2Y7SA 2VLKE 3F6LA 1XT5A 2DLTA 4K3EL 1ZVYA 2CK0H 3QR1A 1SGKA 4N87A 1UCBL 1Z66A 3HS0B 4XH2A 2OTUB 3IXTA 5IROD 3LH8A 1VGKB 2W65B 3D52A 1KWGA 4F57L 2C3HA 2HCZX 4HEPA 3AAZA 1HNYA 2JCWA 2UY6A 4GRMA 3D51A 4PJ7F 2EDJA 1O75A 2F8XC 1EBPA 4FDWA 1I7TB 2PCPB 5DUMH 4L1TA 1NGXA 4AK1A 1P7BA 2J2ZB 5FM8A 3KG5A 3KPMA 4XP6L 2V17L 3RTQD 3X11A 3L48A 5EBGA 4YDVB 5T3XL 3TBSA 3H9SE 3X13B 4LNRB 3VW3L 1LE5B 1Q4NX 2G4EA 5GS0H 1CE1H 3LZQA 1YEIL 5EMYA 1NCWH 1BQLH 3KWWB 1WT5C 2CO6B 5TF0A 3WN6A 1TO5A 4P3CH 1NCOA 2DBJA 4YSTA 3V5KB 1CDGA 2BOCB 2HFTA 1EAJA 1G7MA 2B16A 1D6VL 3D85A 3VDAA 5HHNA 4PY7A 2BVOA 1OXYA 3GUFA 2P8LB 1G1CA 3WMPA 1I7ZB 2O6PA 43C9A 3OSKA 3D6GA 3N85L 3PHQA 1WISA 3LH2L 1HKFA 4YSSA 4LFHD 2FEEL 4YEFA 4Q74A 3ULUE 1Z1WA 1I3UA 1HX0A 4RGND 1WAAF 3C60B 3C2SA 2QVKA 4PRBA 5GRVL 3UBXA 1IKNA 1EZVX 4P9HL 4D3CL 4PGEA 2CM6A 5E1AA 4AYBA 1MQKH 5E4AA 3UC0H 1I3RA 4ZXBA 2PCFA 3GI9H 3B4NA 1CT8B 3WKML 4PJHA 5DHVB 5J6SA 5IB3B 1PSKH 2A38A 3K0WA 2ATAA 3S5LA 2DIBA 2X9ZA 1RZ8B 4XXDA 1JDDA 4OLEA 2Q6WB 2JNZA 2GJPA 3F5WB 4PW3A 1TFHA 2EVFA 4A04A 1P1VA 2WZPD 2WKGA 1J9CT 5C08D 4NGHL 3C6LC 3WSQL 3WGVB 3D3VA 4ZI8A 4FHBD 2XACC 3HI6L 1GZQB 1DQLH 3S3DB 3UGXA 3BDXA 5JXEA 3WD5H 4FYSA 4WTWA 4LVEA 4D7BA 2CO3A 3FN3A 3RZCD 3P4OA 4PV8A 5CEZL 2JB5L 2XVKA 3ABGA 1ZVSA 3VFWA 4FTVD 3ZKSD 3ZRFC 2X4PB 1N12A 3ZSTA 5E5MB 5LBSL 1QFWL 1TJHL 4PRNB 4ZOCA 2DEWX 3V4PL 4F8PA 3KXFE 4KK8C 3M8OL 2Y1AA 3BQUD 3MBEC 1F6AB 3PY9A 4IIQB 4TF4A 2ZKHL 3O6FC 3QI9B 4XPFH 3LDBB 5AOKA 1WICA 4NAMA 5IJBC 2FUQA 3RNQA 4J3OH 3TWCL 2GC4C 3HG2A 1BFOB 3V4UH 4HZLA 1KMGA 1BVKB 2V37A 3MLYL 4PJXA 5FHAL 4M5ZH 5FEBA 3F6IA 1BBDL 1SPDA 3B83A 1PGRB 3APDA 2KPWA 3G04B 2O26U 1AZCA 2EIJB 3FQ4A 2NY1C 3BLPX 5H94A 1IQWH 3ZTJH 4PJGF 3PLYA 3FU5A 4FNLL 3UTSB 3V6ZB 2HKFL 4GQ9L 5JIIA 2EE0A 3K8KA 1NCTA 3ETBF 3OLGA 2ORBL 3VA6A 4G8IA 1C8PA 4JPVL 5EUKA 3EDJA 3LZOA 4L8SB 5AL0A 4MXWL 3VGAB 1D5MA 1D7CA 1HNFA 4AK2A 4P5MB 1IBYA 3V4VH 2VRKA 2VR9A 1U8JA 3L5HA 2XX0A 4DFIA 3DROA 4MX7B 4MAUH 1KBGL 1MAJA 1GW6A 2X1QA 4JFDD 1IM3A 4QYAA 2NCEA 4G9FE 3UYOD 4XAKE 1LO0L 4WI5A 3IFPB 3K6OA 1C5BH 1U95A 4Z95H 2CZNA 2X6VA 1R5WA 3IU3A 1XCXA 2OJEB 2OW6A 2E7HA 1GOFA 2FD6L 1KN2L 2CLRB 3N0PB 2VAAA 3HPJB 4YDNA 5IVZA 2Z8VC 4FL4B 4KNUA 2RIKA 3ZR6A 4E9YA 1VEMA 4ZO9A 1GJUA 5F0MB 4EZKA 1S7VB 2ZCKH 5SWZE 4UQBA 1VAHA 2EUVA 1X6NA 2A83A 2VTFA 4B96A 1KPRA 2IAMB 2TRHA 3C5SA 5AVZB 1U6AH 4A63A 4HUUB 3E8VA 4LLMB 2YD9A 5H35A 3DKHA 1E9PB 1KJ2L 4NZJA 1IVLA 1HCZA 1LK3H 1XB3A 2IJ0C 4G5ZH 5I1IH 3R0MA 2X2UA 4WFEE 1NL0L 2O5XL 2WKLA 5AW2B 3PL6D 2XG5B 3TT3H 1DHKA 4HG4J 3HA0A 5F96L 5LQBL 4OZGF 2N59A 3TA3C 2DS4A 1OPOA 2GJRA 3PP3K 4K3DL 3K2UL 3OKDB 4HQQL 1JDAA 5EA0L 4F91B 1MJ8H 3FF8A 1JF1A 4JZJA 2CDFB 2UZIH 3VFSB 2YAPA 3NTCH 4AC4A 4YFLI 2EYTB 3FT3A 3QFJE 3GXPA 1SDDA 1DQKA 2BX5A 2XJKA 2WNKA 3D30A 2NNFA 2ZF9A 1S46A 5AOLA 5ENWA 3O6MH 1CBJA 3CZFB 4HOZA 1OT1A 4JCMA 3SCMB 4RFEB 4AVHA 2W9DH 1D6EB 3ZJAA 1Y6MR 1QKZL 3O3DB 4QRRD 2CJUL 3D0VB 5ISZB 3MR9A 1UA3A 3VWJD 1MG2C 4NCDA 2PYED 3QCUL 2A73A 3KR3L 3P30L 4YC2C 2W07A 3SDCC 3MROB 3QEQB 3MQIA 1U0QA 4JB9L 4Z3FA 2G9KA 4G83A 1KGCD 4YLQT 5C0FB 4S1DC 2WC7A 1NBYB 3NPSB 3TBWB 3F2LA 1F3JB 4FE9A 4KFZC 4YHIB 4F15B 1S7WA 1JAEA 3ALPA 4NUMA 1DZBA 5GGSB 3G6AA 1FO0L 3K2KA 3UABA 2XWCA 1PLBA 4FD0A 1JZ2A 3GT6A 3MVSA 2QTEA 4KJWC 4ODVL 5CM1A 3Q5YA 2VQTA 4Y5VC 4OCWL 3VI3B 4KMQA 1NEZA 1FF5A 1G0YR 1U8QA 3CFTA 1XTMA 5MP6L 3VYPA 5FUCC 2YIHA 4C54A 2ID5A 3OAUL 4GP4B 4BWUA 1JZEA 2YAHA 5G2NA 4UIKL 2RALA 4M3JA 1RULL 1T5KA 3S0PA 3IKKA 3NIFE 2HFEA 3S3JA 2A9CA 4HLEA 2MHAB 1OGAB 4P8QA 4XE5B 4WDIA 3VXMB 5IROC 4XMTA 4V1DD 3GJFA 2CBQA 3I50L 4XXWC 3JWNG 5EB9A 2HP4A 4Q2ZB 5KSAC 3GBMH 2HKHH 1XGUB 4FNRA 4X8XA 5DD0L 4Y4HB 4L5FL 5CHNA 3BWAA 4NZUH 3O4LB 5IMOA 15C8H 4JY5H 1NAMA 2DQUH 4HUKB 5E2UL 3FONB 2HRGA 2OMYA 2VMJA 5D6DC 1N6QL 5CD5D 3WNIA 1FE8H 1OCRB 2YJQA 3WKNA 1AXSB 2I32A 2Q3AA 1I3VA 3T0ED 2Z4TA 1PG7L 2VH5H 3GSNB 4URTB 5CSZA 5IB2B 4PS7A 1U21A 4FLOA 3QIWD 2J12B 4N9OB 2EO9A 3AC0A 2H9GA 1ZA6A 4WU5A 1KTDA 1BEYH 1BVZA 3F7PC 3WS3B 3QR0A 1MELA 1JK9A 3FUKA 5I6XC 4TL4A 4M6OL 1DQDH 4P06A 4Z7OF 2YJLA 1D3CA 1GGBL 5K9JH 2H4EA 5T3XD 2YC1A 1U3YA 3JTBA 4KK6D 2KC0A 3MRRA 4RGNC 5ECJE 4LBEA 4TQEL 3KPRA 1MI5A 4M7ZC 1X4YA 1DVQA 3NEEA 3A24A 2IQAA 2MCG1 3V5HA 1SJXA 4NQXB 1RCYA 4HT1H 4G8GB 1QASA 3HMXA 2Y7NA 2APSA 2VITB 3TJEL 1UZ6E 3AUWB 4PJ6A 2ZXBA 2ZONA 5HXMA 1JGDB 3P4LA 4PJ9D 2PPCA 3U82B 3LMJH 4I13B 1XBRA 4HEMA 1NCAL 1QPPA 1OSYA 8PAZA 2X4QB 2VJ8A 3DX6B 4X83A 5KVDL 2H41A 4OZHF 3AXHA 1A14H 4AENB 3SPVB 2W94A 2PXYC 2CRMA 3VTAA 4KQ0A 4G6JL 1G7HB 1OB0A 2X2HA 4FMVA 3SYCA 4R26H 1IGYB 3K4AA 2VAJA 5KSBF 3MZGB 3RTLA 3FBKA 1JYNA 3U1SL 1GCYA 2EXWD 3EXJA 2IFFH 4JQXA 3PPSA 4WZ9A 1CLYH 3KL5A 5EC2A 3RDTA 2HVJA 4J3OF 2CR0A 2VWEE 2DM3A 2R1WA 4PRHB 3TIDA 2DWEB 4H1LA 1KSRA 4ZS7H 3VXTB 2E75C 5A2CA 3VD4A 1MW1A 4B60A 4NOBA 4BE6A 3HS8A 3DMMD 5I1EL 3BQUC 7PAZA 5BV7H 4JG5A 1KZQA 1YNKH 2B59B 2V7NA 1YMME 5AVUB 4G7QB 1S7QB 1XGTA 4PJFA 5D9SA 1EUUA 1MCSA 5B1AB 1AIFB 5TDOA 1M2VB 4JG0L 1P4BH 3DVIA 5EZOH 3EJRA 5GSRA 3O4OC 2WLLB 3SGKA 5D55A 5ESQA 5DSCB 5I1LB 2KMWA 1GC1C 2P52A 2D3NA 3EGDB 1JGVL 1NMAL 1O9ZA 4IRSB 2QKIB 3CHRA 5FB8A 2Q8BL 3BJ91 2ZYSA 4JDEB 3R8BB 5IB5B 2QSCL 5JXAH 32C2A 4R0LA 5FCSH 2BVUA 3EOTH 3L54A 4H8WL 4H20H 3EIFA 4JRXD 3VU2A 5HYJA 1I31A 1ZGLB 1TKWB 1E8YA 3WIIL 2ICEC 4PWHA 4IBTA 4M56A 3D05A 4HX1B 2XKSA 4JUTA 1N59B 3ECBB 1NCBL 1I1CA 2HJKA 1AGFB 2FQGA 1Y18A 3CFMA 4I0CC 1N5YL 4MJJA 1I7RB 1AOZA 4FQJL 2YPVL 3DX7A 2ZX8A 3RJDA 3QWOA 4M8VA 3WFEL 4ABQA 2QKSA 4M7JL 4PJ5E 4J6RH 2ERJC 4OKVA 3RGVA 3VXQB 3N40P 3QW9A 4AJWA 4BZ1A 3IFLL 1JNJA 3S7GA 3DDGA 3EHBC 2ARJQ 2QHRL 5KBKA 3MCKA 1Q72L 2O5YH 4UWQB 1E30A 2VLLB 1RUKH 2WIIB 2XBDA 5I1AB 3W5NA 5J1SC 4M5YH 4LP5A 3WOVA 2HT4C 5DFWH 3RDTD 1WFTA 2W0KA 3LPPA 3TJPA 4ALAC 4F8LA 2X1PA 3FQ2A 1BJMA 2R0ZH 2OM5A 3GSXA 4Z0XA 3LHPL 3Q48A 4GAYA 5DZ9A 3GMRB 3PL6C 3OHXC 1JVOA 3UTOA 4APXA 1DQML 4PREB 1E28A 4Q4EA 1KY7A 1HWWA 5IK3A 1TR7A 4NQQA 1A0QL 4XAWH 5GGRB 2IPUG 3FN9A 5ADPL 2LR4A 4XVUC 3KW7A 4BCYA 2IPKB 2R39A 1QWUA 3GJFH 2R2CA 4N90D 4XPGL 3G08B 2CXGA 1FNSL 3BFWA 4OTXH 4WI7A 2NW3A 1SMOA 2OFQA 4HGWB 5CINH 1BLNB 1ZS8A 3A4AA 5FYLL 1UFUA 1OCWL 2Z6FA 1RH8A 4FN0A 4HJ0D 3VM7A 1TTBA 1IARB 5FO8B 5GISH 3E8UH 2K7PA 3V0HA 1B4RA 1D7DA 3MOAH 5CJQH 4L05A 3VWJC 4Z3TA 1CL7H 1FVDB 3FO9B 4XOEA 5DI8B 4R6UA 4P46A 5I0VA 3ZE1E 4OGXH 4OIAA 5JOPD 5K1NA 1GJIA 5GS2H 2K6WA 2XKUA 5CWSB 1IE5A 1GKEA 4O02A 4HIIB 5DC0A 4UOZA 1N8ZB 2YSSA 4BKLB 4DP2X 3QRGH 4OBSA 3WUWG 5D1QE 5SX5K 3LPFA 2QFPA 4GMSH 2HPTA 5D6CB 1NA8A 4WI0B 2ZSWB 4TSAH 4ZK8A 3CPUA 5ADOL 4HV8B 1FRGH 2D7TH 4PJHF 4BH7A 3GD1C 3L17A 2W9EL 3N43F 5FGBA 1CBVL 4XN2A 1RZJC 4EVNA 1UA6H 4QF1B 3ARZA 2BP8A 4LQFH 4FJ6A 4MMZC 5FYKD 2N7SA 3FHEA 4AJYV 1CDJA 4N6RB 8FABB 4AC2A 4NP4H 5AVTB 3GK8H 5KBDA 2I07B 4DGWC 3HMXH 2IOOA 5JHDE 1I8LA 2W60B 4K3HA 4TSBH 1XR8A 1TG8A 4L3ED 5EIVA 1NEUA 4PJIA 4KX9A 1I9IL 4OD2B 3VXSA 5IHUL 1K3ZA 4Y8DC 4W9HC 2EXTA 1OHQA 3ARBA 3STLA 5DC4B 3GO1L 3HUJA 3IJHB 4P3DA 4W6WB 1MJ7L 5SV4A 1CLZH 1UXSB 3MA9L 1OAXL 2ESVD 3EYSL 5HDQH 3D0LB 3HZVA 1QD0A 1O7SA 2VDOB 5D2NB 4X80L 1KLUB 1MFEL 3B56A 7FABL 5D72H 1A9EB 5CD5C 3CFDB 4KKBD 4YIQB 3HE7A 1F4WL 4BFJA 3CPLA 4MNHB 3T0EC 2F7PA 2BH0A 3MV7A 2Y07H 4ODHH 4UT6A 5AW9B 5IWLA 1EUTA 3DOHA 2EYSB 3D25B 1BFSA 4XNBA 3ETBJ 1S7UB 4D7PA 7CGTA 4DEWA 4KZCA 4H25B 5DZNA 4H1LH 2EADA 5ESAB 3SE3A 3TASA 3MGTB 2NXZC 4JJHA 4U7SA 4YGVB 4IQHA 2D7OA 2Q86A 4PJXF 5D1ZD 1JZIA 1JGEA 4QHKJ 1S9VB 1GVIA 4TLUA 4LXFA 2AEPL 1MCPH 4ZUSA 3MYJB 4KK6C 4R4NC 2A9DA 3N42B 3UZVB 1CFSB 3FTXA 3O11A 5CCHE 3WIFA 2YLHA 2P5WB 3G6DH 5BS0B 1QSFB 5INCB 1DJXA 3TVMA 2YN5A 5T1DL 3IGFA 3LNIA 4L4JA 4ZNCD 3L4XA 3D1MC 5DR5L 4ZTOL 3QWNA 2GAZB 2IWGA 3TCLB 3VFPA 4I0KA 1GSMA 4R90H 2H2PD 2H32B 4JQVC 3K74B 4F7CA 4JFOB 1OK8A 4APQA 4CGTA 4JZNA 2NQCA 1SBSL 3WXVL 4Z77B 1Q9WA 4N24A 3ZGIA 3CXDL 2BXYA 4NFBA 1SVCP 2XV0A 2WBKA 2XQBL 5SX5H 3ARGC 4P9HC 4F93B 1MCHA 3I02B 5TGBB 3VXRB 4AZUA 3WTTA 2AXFA 1TQSA 2GW5A 1RZKL 2KZWA 2Z1PA 1AC6A 5IFAL 4P5TA 5BUAA 4LOVA 3N41B 2XT1B 3VRJB 5JTWA 3DIFB 4KKCC 2XWXA 4MJ6A 4P2RE 4YHPA 1A21A 4PM1A 3FU9A 3GXMA 3ARBD 2XBTA 3ZK0A 3CQPA 1G7PB 1M53A 3B3BA 3DJTA 1J7VR 2E9BA 5FYKH 1I1AA 3PDGA 1DVFC 4I4WB 5D7JA 4ODSL 3OZKA 3VH8A 4UDTB 2ZPKL 3N3EA 3RB5A 3UMTA 2BSSB 4N0UE 1HAWA 4BZ1H 1KENL 4F1ZA 4RGOH 3DMMC 1ZHNA 4WWKA 1K8IA 1EGJL 1U3ZA 3HZMB 1BVLA 2DW5A 5L2JA 12E8L 2P3YA 3E9UA 5SWSD 5C0CD 4FQHA 4Z7WE 3E9TA 1AP2A 4OGZA 4AM0Q 1QBLL 4DAGH 3QRLA 2J1WA 4JFHE 5D1XA 4EIZC 2V2XB 1BIHA 3KM2A 1SXBA 5I73C 4JR9L 3O6LH 4WEBH 3WTVA 3PGDA 1X6LA 2YD4A 4QRQB 1X5JA 2JJVA 5LB1A 1GS7A 4LLAA 1P4IL 2ARJB 4LLUB 3C75A 4HU8A 2R4SH 3MOQA 3MRLB 5JW5B 1FL5A 1HDMA 2AZUA 3ARFD 1F4YL 1K2DB 5EU6B 4CC4A 2APTA 1UB6A 4IEFA 1SJEB 1PFCA 5CF3A 3OAZK 4PMFA 2H2SC 4JO2L 4ONOA 1DLFH 2UYLA 3E6HB 4O51B 4Y7MA 4DPAX 2ZKYA 5E8NB 3QAQA 3T71A 4JG1H 4MNGE 3TVMD 1MVFA 2ARWA 2IWFA 3QG7H 2XXGA 5I1HL 5IHHA 4L0YA 2DJUA 1HILB 4D8PA 4E41D 5ICYB 4O2CA 1TEFA 2LOEA 2GTWB 1FBIH 4WSGA 1JZ4A 3KCPA 5I6MA 3KEDA 1WEJL 4FLRA 4YJZL 4O02H 3MXWL 4RX4D 4NJAL 3HG1D 5C0BE 1DVYA 4GAGL 3GXIA 2B20A 4WW2B 2BINA 3DTDA 4UI2A 1ZSDA 2AEWA 1R3HB 1E0OB 2XWTB 4IU3B 3WTUA 3B7RL 2XHNA 3W9DA 1WFMA 1ITCA 3P3SA 2WSKA 1TITA 2PCYA 2NYKA 1VZHA 5EN2B 1DN0B 3ULSA 1EHLL 4WWOA 3DUUB 4DVBB 5AD0A 3HMWH 2I69A 1VEOA 4A2EA 1LDSA 2Q5BA 2YPKB 3E3QC 2E9JA 2D03H 5DVMA 1R3LB 4BXSV 4PV1C 2V8LA 3FCTB 2AJUH 1KTKE 3MLWH 1A3QA 3GMOA 5IW6B 1AGCB 3WAJA 1HHHB 4XRCA 1WWBX 5HGDB 3BO8B 4MJHA 5ABDE 2PNDA 4QDGA 2BC4A 1VJSA 1LNUB 4KZEL 4NKQB 4JGMA 4HFUL 1Y6NR 2X05A 3SKNA 3CV5A 3QDGA 3HFMH 2MPVA 1ERNA 3QHFH 2Z0UA 3L2LA 3NSYA 5I6OA 2VL5A 4WNSA 2VDLH 5TE6L 4MJIB 4ZUVB 2BSTA 1JNLH 5IFJB 2JXMA 2R29L 4ADJA 4U05A 3B2UD 5F7DA 2X9YA 5KYWA 2QDVA 2BNRE 1U4EA 3JT0A 4JMNA 3VJ6B 3CX2A 1T1ZB 1LQSR 1T2QL 3MV9E 4G7VH 5HHXL 3V9EA 2R4RH 4Q0XH 1RZIA 2X3AA 1KLGA 1MCRA 4IMLA 1G7LA 3KPQA 3I84A 5AOIA 4DVRL 1OGTB 1HT6A 2ZOUA 4MQSB 1A7RL 3WFHB 3Q3GA 1ZHBB 1H6UA 5HTSA 3V4LA 3NRFA 2VLJB 4AKPA 4G82A 4ZDHA 1OSZA 3KPLB 2VNCA 1Q1JL 4JL1A 1HEZB 1KCUL 1ID2A 1OARH 4KPHH 3UJTH 3RWIA 3AS0A 3DJ9A 3QXAB 1YNLL 1QWHA 5C9JB 2JK5B 2OMWA 3CMOL 3EYOA 3IJSB 1NCWL 2AJXH 4ES9A 3OAZH 5AENA 3QUMA 2Q1EA 3LIUA 1JOIA 2RQ8A 3PREA 4GO9A 4Q6IA 3GRGA 4JY6A 2LW3A 4PRPA 1OE2A 5DJ6A 2PPAA 4X4XB 1Y0LB 5FFGA 4FQ2L 4NCC2 1UZGA 1LK2A 5F9DC 3UMNA 4QTHB 1DE4B 3EH3B 4Z0BH 1TZHA 2CK2A 2F19L 3OKYA 2AJZA 1SXZA 1Z9OA 5EOCJ 2XQYG 3RL2A 4XN8A 3P73B 3QS3A 1YG9A 3RURA 3U4EA 1OSPL 2A4EA 1TMCB 3VFTB 5BMFL 2R56L 3L5IA 2PO6A 3T6ZA 3MLPA 4Z3GA 2FYVA 2RQEA 4YSQA 3L7FA 3CFKA 5F0LB 2FWLB 1FPTH 1JN6A 3RY6C 2BHYA 4JFVA 1OGSA 1UD4A 3VCLB 5MEPA 1P7HL 3QEGL 2NY4B 1H5BC 4FJYA 5KS9E 5GZNA 1KG0B 1WZ1H 4KKBC 4DESA 2EDTA 5C0EB 2C1PB 1RURL 3CSFA 5KANG 3SKMB 4PYHA 4N2MA 1DL7L 1GTNA 4TPRH 3MMEA 1NKGA 3VE0B 4IS6A 1DQLL 4LRIC 2Y1YA 3FUMA 1A5FH 1BG1A 5K33A 3NIDF 1VEPA 3Q7JA 4PJFF 4RGNE 3WD5L 1RUAL 2K6YA 2GJ6B 3VUAA 3B9KC 2E7BA 3U7AA 1I8AA 3FB6A 4JRLA 3IMRA 1M7IB 5D1ZC 1PDKB 3O9WB 4WUKL 4UTBA 4S0TD 5ANMA 3B2PA 4X7CC 5AG8A 1UT9A 4JDVB 1HZLA 4GIPD 4XPFL 1UATA 1X5FA 3AREC 4LLDA 5C3TA 3NEXA 1KNOA 5FKPA 1PZ2A 5CUSH 2CKBB 2CIIA 1U92A 3CHPA 3QDMD 5HHVH 1I9JH 5C08E 3LQZB 3MRQB 3U4KA 3J07A 3V4UL 4LVNB 3VI4A 2H2PC 1CDBA 3IAPA 1OB1A 4PJAE 4HIPA 1AANA 2Y7OA 1ITBB 1I8KB 4ZUTB 3ZKMD 3GRWL 5C07A 2UZYA 3TBTA 1XF4A 2NX5B 4B97A 3QHZH 3FT9A 4DJMA 1YO4A 4JE0A 1JPGB 5D7HA 5JYLA 3PAZA 1IQWL 2V3FA 5AYUH 3IN0A 3SDAA 3D2UB 3PQYA 1AQKL 3PV6A 4OJAA 4FTVE 3SYPA 1RSYA 4G1EA 1G6RH 1J9QA 1NJ9B 1IE4A 4OZIE 5I1DA 4LPXA 3WLBB 4X4KA 5HHMD 3U9WA 2IDUA 3QO0B 3S35H 3JTSA 3KYNB 3VD2A 5CXPA 3BKYH 4D8OA 3HS0A 4KUZL 1QTYT 3HRZC 4XPBH 1VGKA 2N7AA 2W65A 5ICZB 4X9IA 3IT8D 1OQOA 2P9RA 1LDPL 1XGRB 4OCSH 1F2QA 3LN9A 3MLUH 2YUZA 5ANHA 1NGPH 4X99B 2LQRA 1I7TA 4OBRA 2PCPA 1WWWX 2BVQB 1FL6B 2RJMA 3F85A 2J2ZA 1JZ3A 4FXKC 5C0RH 2VXVH 2CJ3A 5FGCB 5IBUG 5K59E 5TH2B 1A6AB 3QR2A 4D0BB 2OP4H 4QGTA 3VGDA 4F1SA 3WUWB 4YDVA 3X13A 5INDB 4LNRA 1LE5A 1FNEB 1E4XL 1QI5A 3RZWA 3F58H 4CAGA 2QR0B 2C3VB 5B21A 4JRWA 3KWWA 2EEXA 2CO6A 4BINA 3WUZA 2X4SB 3V5KA 2BOCA 1MH5B 3QZLA 4JFDE 5HBBA 2HT3D 1CF8L 2P8LA 1I7ZA 4PIRF 4U31A 3FTZA 1R3IH 1S6NA 2BW5A 1Z5YD 2HAZA 3QGVA 1I8MB 5KJ7E 2AJSL 5B8CB 3AACA 4IKLA 4XNZB 5CGBA 1AH1A 1MJ8L 3C60A 3KL3A 5DWUL 2QPEB 4UOW0 1KLFB 2E4TA 4OGYH 4TUUA 4HCFA 2DMKA 1CT8A 4FYTA 1ZXKA 1ML0A 5DHVA 1H9VA 4ZNEA 5IB3A 3AT9A 1BZ9B 3O6ML 2FB4H 3FPYA 1OAKH 2DIAA 3S8FB 5HJGA 3KPSB 5F9OH 3SEPA 4I18C 1RZ8A 4XNYH 4ZPVB 5I0XA 2Q6WA 2E47A 4HYTB 2WM0A 2WQAA 3F5WA 2J55A 1TLKA 4AYGA 3S8WA 2FWUA 2YMXH 4P4KB 1IEAB 3OLIA 4JM2B 1JERA 2IWEA 1GZQA 2MCPH 2OL3B 4HU2A 4UV7H 1PJWA 3ZLQC 4PJIF 5L88L 5KYXB 3LEYH 2Y5TB 4AGOA 4BFBD 1OIOA 4HSAC 1OCZB 1A1MB 3EJYD 4ZSOE 2LTQB 4JN1H 1CXFA 1JCVA 2XETA 3HUJF 1ZJBA 3AQXA 2J56A 5EOTB 4JLRB 1A3LH 1PJ9A 3I9IA 2X4PA 2RMNA 1GIGH 4QNPE 1AC0A 5E5MA 3LS5H 4PRNA 1JPEA 5C09D 3CVBA 3DX8B 3PGFH 4W81A 4QRRE 3AQYA 2DYSB 4LSSH 3U6RA 1F6AA 4ONHB 4IIQA 4A7QA 3QI9A 2PYEE 5DHDA 4LOEA 4GG6E 1N9PA 2ZZUT 3UZEC 2FIRT 1KXVA 1KB5L 3IDYB 1YEFH 2AI0H 1BFOA 1W16A 2DKUA 3BUPA 4ZOAA 2P48B 3U0PB 1BVKA 4Z7UB 3GBML 3TTYA 1KGCE 3BPOB 1JGIA 1B0GB 3G04A 2LAAA 3LQAL 4EQ2A 2CSPA 3RFRA 3I2CL 1UEYA 3L9YA 4JY5L 2JFCA 3DYMA 4RESB 1YNTB 3UTSA 3V6ZA 2R2HB 2OMUB 1VFUA 4HK3J 1L7TL 1N3NB 2ZIDA 3B2DC 1MCNA 3WNLA 2VH5L 4OV6F 2JSFA 3FN0H 4L8SA 5J4MA 4F9LA 2ZNXA 4OF5A 3N1FC 5IVXE 4P5MA 5EDXA 1H3TA 5A1AA 2GT9B 4CMHB 4Y2DD 1JHTB 1N64H 4UTBH 2BIPA 4MX7A 1LP9B 5IHZB 3JT2A 2QZQA 1JRHH 1QFWI 4QRBA 3BN9D 4V1DE 5BZDB 5E2VH 1W72B 4K73A 2J72A 3IFPA 2Q76B 4HBQA 2DQHH 5K9JL 4W9DC 2OJZH 4LOFA 2NW2B 2Y22A 2OJEA 2P5ED 1GHFH 3N1MC 3GWJA 3CK0L 2CLRA 5CGTA 3KS0H 3HPJA 3KPOB 2MOVA 3VXUB 4DGIH 2WQVA 5DQJB 4JPWH 4CGUB 1S7VA 1FGVH 1J0IA 1P2CB 4TKWA 3QIBD 3AY4A 2F15A 3DOIA 4HT1L 2QSVA 5I5MA 1NLBH 4DIXA 1MFVA 2IAMA 3FULA 3T0EE 2BW4A 4KH2A 4HUUA 4IDLA 4LLMA 3U0WL 3VFMB 5C2UB 1P7QD 4WTZG 4XP5H 4MA1B 1E9PA 1YEKL 2EINB 3N1GC 1G4MA 2H6UA 1T0OA 2XN0A 3AGWA 4DK5A 3LKPB 1TCRB 5AOMA 3DUSB 4KKNA 4NZ8A 2C9AA 5AW0B 2XG5A 4OVVA 4DETA 4EXPX 2ICWJ 2XLLA 1JXDA 2ROXA 4JFEB 3W82A 1S78D 1JV5B 1F4XL 4R26L 5T3XE 4IRZL 4YVUA 1EFQA 3OKDA 4YZWA 3PP4L 4FLHA 2VGLM 2CRYA 4FA7B 2V5TA 2CDFA 3K3QA 4X9HA 3VFSA 4L3AA 1PEWA 1FUNA 1V55B 2DWSA 2IFFL 2EYTA 2Y25A 3EGXB 4EN3B 3HG5A 3QDJB 4N8UA 3CZFA 1HHIB 2ZTBA 2AZAA 3SCMA 4RFEA 5LAPA 1D6EA 4BQ8A 2VRAA 4N2HA 3O3DA 1LO5B 5FM5O 5B39G 3D0VA 4HAKA 5ISZA 3BPNB 3UTSD 3S5YA 3QUXC 1YNKL 2VL4A 2YAMA 4TLTA 3LZNA 3V0FA 3KWVA 4ICXA 4HIJB 3PWPB 2DQGH 3X3GH 4EDXB 4XODA 3VWKB 1LO4L 4NI3A 1YC7A 4I0PB 3MROA 3KMDA 2XN9B 1JPSL 4NAJA 3QEQA 1F41A 2VMDA 3MRKB 3S5ZA 1CN4A 1ONQB 5C0FA 4LASL 5DJCB 1NBYA 3TBWA 1YRKA 4M62H 3WTYA 3LNDA 3H42H 1F3JA 2V33A 3NP3A 4XB8A 4EOWL 3NFNB 4YHIA 2VLKB 5GGSA 5C0IB 3DBSA 2VLRD 1I8IB 4KWUA 1IAMA 3BZ5A 1E40A 3HCVB 5JXAL 5E9DD 2EUWA 1CGSH 2IWKA 2VO8A 3VI3A 3GHPA 4Z7VE 3MODH 1NICA 1HKLH 2E6QA 3ISYA 4XT1C 2DQEL 4WO4B 1OD7A 5DHVH 1W8NA 2YLKA 4ABUA 5EU4B 3E2HB 2BFGA 2MHAA 1OGAA 4LL1A 3WN5B 3VXMA 2XSKA 3AS1A 1OWWA 4XPHH 4W9CC 3H9SB 1RZKC 1XGUA 4NUGH 5D7LD 4Y4HA 5F3HB 5CGYD 1AO7E 1DYZA 1NCHA 1QYGH 2CPUA 5HPMB 1X9QA 1B6DA 3T5WA 3V0IA 2XTJD 3O4LA 1ED3B 5CEYB 3FONA 3QJOA 2VZOA 1ASPA 1AXSA 4OZ4B 1U2CA 2M2DA 2O5YL 4JRXE 1QFUL 2C7UB 3GSNA 1WS7A 5IB2A 1RIUL 25C8H 4QKTA 3ZYIA 4OCYH 2J8UE 3NUKA 3GDCA 3KGSA 5I8OL 1DJHA 1MW3A 3QISA 2D2CC 2HT3C 1OHZA 3WS3A 4GUCA 5BOJA 2OTWB 4AQ8C 3QFDB 2I7OA 3ZR5A 5TE4L 2AERT 4EI5B 4XAWL 1JFHA 3T6WA 1RZPA 2DI7A 3D87B 3ES6B 4KXDA 2DH3A 2LE9A 1PQZB 2E6JA 3OMZA 1LE9B 3AY2A 2EC9T 3ULVL 1GZHC 1RLWA 4K7PL 3MUUA 3QEQD 5CINL 5DZVA 4NQXA 1W8EA 4KKZA 3TN0C 1KFAH 4G8GA 3W0WD 4UTAA 3DI2B 2VITA 3QYCA 1A7QH 4HHAB 2WTOA 4WK0B 3ZIMA 3DHMA 1NAML 4LCUB 1JGDA 3MOAL 4A39A 3MXVL 5D1ZI 5E8PB 3Q5TA 4F3FB 1CL7L 1D7FA 4JBSA 1UUSA 2VZUA 3PHSA 2X4QA 3DX6A 4N26A 4XWGL 2EVHA 3CH8A 4AENA 2XZQL 4MAZA 1INEL 2LABA 4HJEA 4WY7L 3RY5A 1G7HA 1WFNA 2HG0A 2XA3A 4CN4A 1IGYA 4ENED 1U3NA 1BVOA 3MLVL 3LX9A 3KXFB 3QAZC 4TSAL 2HFGL 1F4HA 4UNTA 1JGUL 1U3HD 2OI9C 4DP9X 3CFIC 1UA6L 4XP9H 3G5XB 4PRHA 3UGUA 1ZLSL 2DWEA 3VXTA 3QORB 4WGKA 3U7WL 4U49A 2NMSA 3F83A 3HMXL 3D18B 1BM7A 2B59A 4K94H 1I3GL 1TJIH 4KO9A 5JOPE 1GRWA 1S7QA 2Y3NA 1CGVA 1AIFA 3ZDYE 4MMXB 3ZZQA 1M2VA 2BK8A 4NQUA 1QFHA 4LO9A 4OCXH 5LUMA 2WLLA 5DSCA 4RFOH 2YGOA 5I1LA 4RGMC 5HDQL 2AW2A 1QTSA 3EGDA 3DO7B 4IRSA 2QKIA 3SB3A 4RAVB 5GS1C 3QJHB 4W4OC 3P77B 4YPGB 4ZFQA 1KEMH 3P0GB 4JDEA 5D72L 2K4WA 5IB5A 3U6RB 2ZCLL 4G9FB 1X9LA 4DTGH 5IVNA 3SPHA 3SYOA 5FYKE 2WXOA 1N0XH 3TH2T 4BQ9A 3TCXA 4ODHL 3MRDB 1ZGLA 1TKWA 1OV8A 5IJKA 3LXUX 3TO4D 4HX1A 3WEAA 1N59A 2P28B 4L3EE 3VI4F 3ECBA 4FGMA 4ACPA 1QP1A 3MHZA 4ZTEA 2X4NB 3BN9C 5SWZB 4FULA 4N6QA 3QJFA 5BW7A 1AGFA 3GZPA 2NNAB 4GSQA 3QUZB 2NY6D 1I7RA 4FP8L 4HAFA 3FK3A 1PU0A 4IBSA 1MCIA 1AI1H 4RWYL 3SBPA 3T2NL 2X53A 3PU7A 2F74B 2ESVE 2OV0A 2X88A 3BUTA 4HCRL 4QRPD 5FM5M 4M5SA 4ZODA 5EF0A 2Y23A 3CC5B 4NN7C 3VXQA 4KKLD 3SQOH 4GSUA 5AW6B 2Q0ZX 5IBUB 1H0DB 4RA3A 3QIBC 2GEQA 2DV6A 1R0AH 1LYQA 3F7LA 2X42A 4DQAA 1RHFA 4J5VA 5I8KL 2VLLA 2WIIA 3VSQA 5I1AA 4M1DH 3FZUC 1U8NB 2F53D 4GKZB 1IU1A 4K5LA 5LCVA 2AQRA 1NCIA 3WY1A 4AVIA 3NAAH 4NXKA 3SBWA 3BE1L 2L04A 1JPFB 4W4NA 3GMRA 3QFJB 1DFBH 4BFKA 3O6KH 5DEJA 4PREA 1KJ3L 4PGDB 1G84A 2N56A 2B9BA 4I1NB 2Z31D 4TRPH 1IAIL 5GGRA 4A6YL 4KRLB 2IPKA 1DSYA 3RBSA 5KJRH 1J86A 1G1OA 4J4PC 3L3DB 5EIQA 1TVDA 3VSVA 3G08A 5J13C 3SYQA 4AX3A 3HB3B 4HGWA 2G4GA 4EAEA 4FA8A 1BLNA 5HHQB 2R9HD 2DPKA 1H9DA 2E7LA 3OX8B 4JFSA 3OB0K 5FECB 1K85A 4PU2A 5FYJU 1WQVT 5FO8A 4A2DA 5E0FA 1OTTD 1SOSA 3OXSB 2EE9A 1PG7X 2VO5A 1EHKB 1FVDA 3FO9A 2MKLC 3CFCH 3V10A 5DI8A 4HZ1A 2ZJSH 4MS8D 2DH2A 3GSNH 2I85A 2B2XL 5BJTB 2IIJA 5CWSA 5HPOA 4WCYL 1QO3B 4HIIA 3ZDZE 1N8ZA 4BKLA 1O9WA 1DUZB 5CZVH 5K9KB 1I9RH 35C8L 4GP8B 2AC0A 2ZWKA 4N8VG 4HUNB 2FR4B 5D6CA 1S7XB 2R4SL 3L9EA 1X5YA 4WI0A 4F92B 4PY8J 2XZCL 2ZSWA 1PX4A 1XO8A 5A6IA 2QGCA 4HV8A 4JO4H 1KJMB 2WGNB 3NIFB 3PWUB 1MVYA 5CZRA 4HK3N 3H0TB 4KDVA 3VGGA 5KVDE 1FLTX 4QF1A 5L0QB 3CHSA 4RZCB 2DBLH 2VXSH 3IFNL 2A6IB 3DARA 3OGCB 5CD3B 4XWOD 5FXCH 4N6RA 8FABA 3CVHL 4P3WA 1NFIB 2K8QA 2V5SA 5CU9A 5SWSE 1S5IL 2I07A 5C0CE 3T0WA 3FS9A 4WV1C 3SYAA 4UTAH 1DJSA 2W60A 3QG7L 4CMMB 2MOGA 4S1RL 1BFVH 2V5RA 1MFAL 4OD2A 1FBIL 3A21A 4K8RL 4F8TA 3IJHA 2I9TB 1JVLA 1N7MH 1BZOA 1UXSA 4YE0A 3D0LA 4LDOB 4O02L 1YEEH 3D48R 2XTJC 3EBIA 2ZUVA 3LY6A 4TV3A 5D2NA 1XSOA 5DD6B 1KLUA 1THAA 5H37G 2YD6A 1KTRL 4Y4KD 2IAAC 1A9EA 3CFDA 1OAYL 1JF5A 4YIQA 3GJEB 4MNHA 2FBRA 2VDML 4QEGA 4P2QD 3QRBA 4OLZL 3O8XC 3AWEA 4KRNA 3EO1B 4OV5B 2RCSL 2EYSA 3D25A 1S7UA 3CQQA 3GMNB 3HMWL 4XN9A 1M6UA 1MREH 3MGOB 4PS3A 4TQPA 4H25A 3OLDA 5ESAA 2KH2B 3JWOH 3MFGB 5I5IA 3MGTA 4Q6KA 3TH4T 4E41E 3MLWL 4YGVA 1KGYE 4NEHB 4QRTB 1H8SA 4LCIH 1S9VA 1JVKA 2DWXA 3BKCL 2JJSA 4F33B 4WTXA 5T1KB 3MYJA 1ZANL 3UZVA 1XR9B 4EMZA 4ERSH 3GMLB 1CFSA 4NM4H 4TVUA 2GY5A 4IGBC 3HG1E 3M86A 3CU7A 4BZYA 2P5WA 4MQTB 4U33A 5FW8A 3SHSA 4BV1A 5BS0A 2IXQB 1QSFA 5INCA 1QLFB 2HH0H 2UUDH 3L4CA 2FO1A 2RR3A 4JREC 3T8XB 2GAZA 3TCLA 4FG6D 2B0SH 2Y7LA 5JW4M 2H32A 3R18A 4A7SA 4JFOA 3INUH 2MFNA 4MVBD 1DSFL 4H0IA 3TPKA 1G9HA 4V11A 3V6OC 2HT2D 4P23C 2R2EB 3L3KB 4M43L 1TQVA 2WXHA 5E4EB 3SODB 3RA7H 4Z5RB 4LVOC 5CN3A 3WBDA 2C9PA 4M29A 2UXFA 5EORH 4UT6L 3C9NB 3UYPB 2FLBT 2G2PA 3I02A 5TGBA 1ZHLB 5HI5D 2H3NB 3VXRA 1NPNA 2XV3A 1BWWA 2R8SL 2RA1A 4R5XA 4ODBD 3MJ8B 3I74A 2AKRB 4RDQG 3TX4A 4KPHL 2AXGB 4K9EL 2VDKL 3MUHL 4JFPB 1MAKA 2YGVA 4XXCA 6TAAA 2NR6A 5D5ME 3VRJA 3DIFA 1U3HC 5G4OA 3ZO9A 4MHHI 5D71L 1GYAA 1OWRM 5I1CH 1YMMB 4FQXD 2FO4B 1G7PA 2IH1B 4K23H 5F71A 2IBGA 1OAUH 4U1NB 4I4WA 2W5PA 5L9DH 4UDTA 4R83A 3BLKA 2BSSA 2ZD0A 3GPSA 4J27A 5B39B 3VX0A 3HZMA 2Y6TE 2BPBA 3CNKA 1BX2B 1C5CH 4NQCE 5C6WH 3BUQA 1IJ9A 2VKWA 2QEJA 4N2GA 2V2XA 1NC2B 3IJYB 1UYWH 5KTEH 1U8MB 3BAXA 2HB0A 1J5OH 5LCVH 4QRQA 1D9KD 2X0UA 5AVYB 2IQ9L 1AG6A 1PAMA 1VPOL 2ARJA 4AMKH 4LLUA 3SE6A 4CADB 4LFHG 1WFIA 1ZD6A 4YL4A 3MRLA 1WTGT 2ZX5A 5JW5A 1EMTH 3LVTA 1A9VA 1CGTA 2UWEE 2X38A 3S8GB 5EU6A 1K2DA 1DBJL 2APWA 2YA2A 5GJSH 4RVBA 5D4JA 1SJEA 5EBWB 4PJCE 4AZ8B 1GSKA 4N22A 1HYRC 1CQYA 1KCVH 3MSPA 4JHUA 5CKGA 1WIOA 3E6HA 4O51A 3NBNA 5T8IA 4AQZA 2DMGA 5EEXA 2EICA 4NXSA 5EULV 5I71B 4RETB 4TPRL 5E8NA 1F3DJ 3ARDB 1I1FB 5BS0D 4R8WH 3TO4C 4F2ME 4PJ5B 3REVB 4FFZA 2ED9A 1MPAH 3NABL 4WNQB 1HILA 5CN1A 4A38A 3MOBL 5ICYA 1JYXA 2GTWA 3ULVD 4AKQA 2NY6C 2ZKWA 2X6AA 2DLIA 4LEEA 4EIUA 3D4CA 4LAQL 3MO1B 3T4AC 1AQDB 2FLRT 4G6FD 4FNPA 1X9RA 2XWBB 1ACYH 3Q1EA 3GINA 3QIUB 2VDRB 4KKLC 5MERB 3RAJH 1JHKH 4WW2A 1MCQA 1SLVA 4BWWA 1K4CB 4BFOA 2BP5M 2CBTA 3VI3F 5SX4H 1R3HA 2FX8H 2XWTA 4IU3A 1B9ZA 1I9JL 4QRUB 2MPAL 1YQVH 3MRCB 2GG1A 4ZAKB 4WHTB 1DN0A 5EN2A 4GUOA 1MIEH 3EDKA 4DVBA 3DUUA 1OTUC 5F1KC 5FO7B 2YPKA 4YXKH 4Z7QE 2JKIS 3L3OB 1DVSA 1R3LA 2H0EA 3VVWA 2FATH 3SGDI 3FCTA 5DLML 2EXYD 4I1RA 1CIUA 5IW6A 1AGCA 4GT0A 2K8MA 3QPXH 1SJVA 4XBMA 1HHHA 2ZWSA 5HGDA 3BO8A 1NGQL 4GI6A 1ZEAH 3CCHB 1G9MH 1LNUA 5SWQB 2D3VA 4U6VH 5DRXB 4XN7A 5DS1A 1QW9A 3IDXH 3BMWA 1A4KB 1TSHA 3CMGA 3S35L 3FH7A 3ZE1B 3GXNA 4KUCD 2R9HC 4MJIA 4ZUVA 3GUTB 3L4VA 3V0GA 5IFJA 2XIDA 3QDME 1IX2A 4A66A 4MRCA 4FKHA 1OTTC 3QC5X 3VJ6A 2E27H 3EW3B 1ZDQA 5D1QB 3ZHDA 1T1ZA 5ITFB 4OFIA 4TUJB 5GRYA 4DKEH 3MC0A 2YRPA 1B6UA 1KYDA 4XCFL 5DZLA 2IAND 4HBCL 4G7YH 1OGTA 3O45B 1NIBA 1T03H 3T1FB 5JR1H 3WFHA 3QH3B 1ZHBA 3BT2H 2VLJA 5B1CA 1HWHB 3PHOB 1TETL 3KPLA 5MI0C 2I27N 3JUYA 1HEZA 3UO1H 2BCMA 3ZTNL 1KF9B 2R0KH 1IO4C 3DYPA 4KJPD 5JDSB 3QXAA 2DLGA 3F58L 5C9JA 5F7YC 5HHME 2JK5A 3S98A 2FJUB 3IJSA 5DJ2B 1LWHA 5JHDB 4W9JC 2OK0L 1QLEL 4JFZL 3HZ3A 4KO6A 5KOMC 4NWUL 1KY6A 1IFHH 1LO3H 4UT9A 5EZLB 1CFNB 3FQTB 5C97A 4X4XA 1Y0LA 3BRFA 3K1KC 4AWJC 4XWOC 4QTHA 2VXUL 2VC2H 1DE4A 1MFNA 5IMKB 5IOPB 3C5XA 1TZIB 2Y36H 3HVNA 4KTGA 3C08L 1PIFA 4PB9L 1DO5A 2CO7B 3P73A 4AIEA 1ICTA 2BVTA 2H32H 4X98B 1CFMA 1DCEA 3VFTA 2O5ZL 1BG9A 4BFNA 4ONGH 5KN5A 5FCUL 1KIPB 1E7UA 4XCCH 3MLZL 4TL5A 3VCLA 3NCYS 4K55A 2B9AA 4CUCA 4XVSL 3EFDL 2J4WL 1KG0A 3H3PH 1EFXD 2PPFA 2YMXL 5B1JA 2DQDH 5C0EA 2FDBP 3BDBA 3LZFL 5BUPA 3U2SB 2C1PA 3QUML 1FJ1B 1EVUA 3NCYP 5I74C 2BFVL 4WEMB 3SKMA 4BYHA 4BFIB 7PCYA 4OI7A 1HWGB 4FQPA 1QLRB 1F3RB 1NTDA 4HLJA 4K8RD 3V6FB 3VE0A 4BK4A 3LH9A 4GW5B 4AKOA 4ZG1A 4NNPL 4AI7A 3G6JE 3THMH 3WO4B 2NTSP 2L4OA 2GJ6A 1DQIA 1W80A 3I3DA 2JIXB 4X9FA 1M7IA 2CHZA 1SVZA 4QHNB 4LNVA 1PDKA 2C4XA 3O9WA 5K1JA 1A3LL 2JE8A 3C6LB 3Q2VA 4HIXH 5F97E 4KOBA 2B3RA 5LXGL 4JEGB 4OQTL 3EYUH 4IKKA 5HYFA 3I9PA 4JDVA 3WNPA 4C4UA 2A1WH 3CXHK 4K71C 3CU1A 5EWIL 5DYOB 1G7JB 2CKBA 3K91A 4PS4H 1KYUA 3LQZA 4FG6C 3MRQA 3SOTA 1X5IA 5DEGB 2ZCZA 3U48A 4MVBC 4KTEL 4F20A 2HT2C 1I8KA 3MRJB 4ZUTA 1YMHB 1HN1A 2FNBA 2ZSVB 4P2RB 1CLOH 3LAFA 2NX5A 3MBEB 3ML9A 4OIIL 3VFGH 2ZOTA 1JPGA 4IOFD 3ULVC 2FNWA 3D2UA 1M71B 1AKJD 1NIDA 2DQCH 1PY0A 4XP1H 2O4EA 2P80A 3VNZA 2X89A 4JJOA 4FFZH 4N0UB 4ZW7A 5GGQL 1NJ9A 3FN0L 4FNUA 2X2JA 1TYJA 3LNGA 5JHLL 5C09E 3WLBA 4HJIA 3UP6A 3SN6N 3PXJA 4Z7WB 3QO0A 2YUWA 1N5AB 3KYNA 4UTBL 4FQXC 4CSTA 3ILDA 2FBJL 1GGYA 1TTFA 3DX4A 1YZZA 1BSIA 3MI6A 3ALWA 4NPYB 3O2WH 1IQDB 5F7WC 1WUZA 1PY4A 5ICZA 1E3XA 4E9WA 3S3CB 3LJ3A 2LFGA 1YVLA 5D70L 2FHBA 1FI8C 1XGRA 4G9DB 1ZA3B 4DK6A 2H5UA 1FC1A 4X99A 4HWNA 4DGIL 3BEWB 2BVQA 1FL6A 2ZX6A 2G5BB 4RAHA 3EUDA 1J0ZA 3IMWA 3E80A 4UQDA 5CILH 3ZIYA 4NYLB 3LKRB 5TH2A 1A6AA 5FHBL 4D0BA 2IH8A 4YZFF 3L4TA 4UQ2B 3WUWA 5INDA 3ZYJA 3TFBA 2ENPA 3HHRB 2F68X 4N8VB 4F8NA 3AG3B 1FNEA 4ZQTA 2GJ6D 2D3LA 3JQOB 1YYLH 1U30A 2C3VA 2QR0A 3VTMA 3CFBB 3KGRA 5JA8B 3HBQA 2E9GA 4JRYD 2GIXA 2K7QA 3AWGA 2X4SA 2IG2L 3DJRA 3SBQA 3A4DA 1MH5A 3B7UX 4P9MH 2P24B 4KXCA 4XN4A 3WE1A 4LARL 4ZTPL 4NO2B 1J18A 5DVLA 2TSBA 2D2OA 1U8LB 1K72A 2VN7A 5DGQA 4U7MA 3D7PA 1KYOK 3BEVB 4CDHA 4K07A 4LSRH 1I8MA 2GFBB 4YX2L 2P5EE 4FFWC 5C0BB 1BEXA 3T0DA 1KLFA 2ODHA 4N25A 5H4ZA 5LN8A 1CS6A 3MBXH 1BZ9A 1XH2A 5IR1B 4FHKA 5CZKA 5KYNA 1PVHA 1ROWA 3L08A 2Q87A 3KPSA 5T1MB 2VE6B 1NFAA 2KLRA 3KYKH 3TA3B 4B6ZA 4RMBA 2BWDA 4AEIH 4JQIH 4IOIB 4ZPVA 3ARYA 3VD7A 1IZKA 2X1OA 4DFHA 4YAQB 3RHWK 3A3YB 4HJJH 4QJ3B 4QXUL 1IAOB 1ETZB 3X3GL 2PF6A 4M48L 4P4KA 3WKQA 4MYWB 3ML8A 1IEAA 1KGJA 4L4VD 2FSDA 4JM2A 2IPUK 1J8KA 1HINL 5G4MA 4XBPB 4Z3JA 2ZF8A 1JWSB 3FW6A 4UT9H 2OL3A 5KYXA 2DTSA 3SO3C 1L6XA 2Y5TA 4JPIB 1BXXA 2QBWA 4WGWB 1K6QH 2J7LA 3VTTA 3WFDH 5BO0D 1A1MA 2LU3A 4I3RH 3RE0A 4TTDD 4DWHA 1LO2L 5E9AA 3S34H 5HJ3B 5EOTA 2FECI 1UUNA 2EKSB 4JLRA 3SDCB 2WN2A 4AMWA 2BNRB 2HVBA 3WE6B 1OY3B 1HCVA 3DVFA 3QPQD 1HKLL 2BSDA 3MV9B 1CPUA 3DX8A 4KVCL 4KI1A 4ONHA 4DKDC 5JPMB 3MTXA 5I0WA 1OE3A 4Z7NE 1F97A 1IBFA 4HS8L 2V9UA 1EHXA 4F2FA 4UZUA 2QQNL 1J1PL 3WEMA 4P2CG 4XOCA 3U9PH 3O41B 3U0PA 2EH8H 4Z7UA 5CJXA 4Y5VB 1OP5K 3JV6B 3WIHA 1QYGL 3NJMA 1ANUA 1B0GA 4IKIA 2DDQH 3M17B 2VLRE 2FO8A 1YNTA 2QZ5A 4NO0D 4CKQA 3FU3A 2OMUA 2R2HA 4FI6A 3N42F 5E9DE 1N3NA 3DIVA 2CPCA 4ZUWB 5L8JB 3L1OH 4KJPC 1T2JA 1OZTG 4LKCB 1C16B 4WRLA 3IXAB 5ILTH 5A2BA 2W81C 5GRJL 2GT9A 1HL5A 1JHTA 2X41A 2I60L 3ELAT 4A7UA 4GO6B 1LP9A 1N2RA 3Q8FA 4R7DB 1HL9A 1XXFC 3O2VH 3QPKA 4XPTH 1NGYB 5IHZA 2HX7A 3UADA 2K9UA 2AK1L 1E5BA 3RTQB 4Q9QL 4NCC1 5BZDA 1BOYA 4KY1L 1W72A 1L7IL 2X6MA 3QZPA 4F7EB 4P2YA 2Q76A 5D7LE 2CKBH 4FZEL 5IQOA 4HC1A 4JANB 2NW2A 4YDLB 2X12A 3KZ8A 3V4VB 3BAEL 3LB6C 2ZOOA 2XXCB 4JKLA 1DBKH 5FM4A 2XTJE 4BKSC 4Z3IA 5KS9B 3KPOA 1UD8A 3VXUA 5DQJA 2HRPH 4HXAH 4DN4H 3LN4A 1G9NH 1P2CA 4K2UL 3IRZA 5TD4A 3US9A 3HE6D 4B5ZA 3N41F 5I6XB 2Q20A 1B2WL 1J1OH 2HTKD 4MLSA 5DQ9B 3FTSA 3RVUD 3VFMA 5JZ7D 1UWEH 4FQQB 5A40E 4GEJA 5TJWK 2GIMA 5F7UA 4ZMZA 3IJEB 4QHPA 4RGNB 4PVBA 1EEUA 1KOAA 1Z9NA 2H26B 1ZLVK 3LKPA 1TCRA 2Q2LA 2WBJD 4M7ZB 3H9ZA 3DUSA 5FUZL 6CGTA 2BZDA 1W0YT 2OYMA 3H2WA 4JFEA 5JOEA 1J1XH 4K8RC 1JV5A 4P46C 3W37A 2HWZL 1CFVH 4DGVH 3TF7C 3GSWB 4AW4A 3W39B 4IMKA 4AITA 1SZNA 1MEXL 4LF3B 4WJKB 3STBA 3SJVD 5I18L 2F58L 2W0PA 3D50A 3EGXA 1T0PB 4BFGA 4EN3A 3BZEB 4OLUH 3KLDA 5C08B 3IFOB 3W0WE 3QDJA 1ESOA 3S3PA 1UACL 1HHIA 4H0HB 4PJAB 1DBBL 1T89A 3QNXB 5FWRA 1LO5A 2XIIA 3V6OE 3QYMA 3JV4B 4OF0A 3RVTC 4IDJH 4L8CB 4HIJA 3PWPA 1OP5H 4EDXA 1IVTA 1ORQB 3VWKA 4I0PA 2VRQA 3WV0A 2XN9A 1TTUA 4FTVB 3I6LD 5BVJB 4E68A 2QSQA 3MRKA 3OC5A 3WFCL 1I8LC 1ONQA 4GLRH 1ULVA 4OZIB 5DJCA 3VFUB 3S36L 2VUOA 3FCUB 4JO1L 1EDQA 2OR7A 4B9ZA 1TDQA 5CLZA 5B3JF 3BQUB 4J3TA 3WL9B 3NFNA 2VLKA 1URIA 5C0IA 3FJTA 3ISWA 4L8DB 5AZEL 1I8IA 2FT6A 2UV3A 1VHPA 3QT2A 3HCVA 1TU2B 4TUOB 1P9MA 2VDPL 2WMPB 4FYRA 4LSVH 4WW2F 3AFLA 2XWEA 3O4OB 1AMXA 4WO4A 4GXFA 3HE7C 1DDHB 5EU4A 3T9WA 3UL4A 5CBAB 4R7NB 2AQQA 3WN5A 5IWLC 1ZTXH 5ITBH 2X70B 1TMQA 1JBJA 3H9SA 5CZXC 2ZUQB 2GYSA 4KI5D 1A3RH 1AXTL 5F3HA 3QEUB 1S8DB 2X0WA 4K9EC 5HPMA 2BCKB 4NZTL 4AUJA 2IFGA 3WYRA 1CXLA 3BDYL 4NNXB 3SQOL 3NG5A 1ED3A 5CEYA 2ADGB 4JFDB 1VFOA 2OL3H 4IYKA 3AMKA 2JQZA 3PFUA 1M42A 4OZ4A 2B8OT 5IW3A 1XDTT 3BKML 2C7UA 1OTSD 2WUBL 2RAMA 1AFVH 3OJMB 5E6ID 1U8PB 5E1QA 1KWKA 5EF2A 1GL4B 5HGAB 1LMKA 2ERJB 4TVPH 3NAAL 1RJZB 3L5XL 3SKUD 2NSQA 5MEQB 5ICXB 4N2BA 2OTWA 4NS0A 4H8QA 1HL8A 4APQC 3QA3B 2ZWLT 2YD3A 3QFDA 3L1EA 1M1SA 4EI5A 4DUWA 3OM3B 4MCMA 2ICWI 1JZGA 3ES6A 1Z7JA 2XQYA 4K7PY 2XI9A 2WWMD 1PQZA 4QRPE 4DZ8B 3BMVA 2B4CH 4P59H 4BBWA 1LE9A 5CCGE 3T77B 2ODIA 5ETUB 5E08H 3WIHH 3H53A 4B0MM 3F8UB 5C7XH 3PL6B 3IF1B 3FB5A 4P5TC 1M9SA 2RB8A 4UIMB 4HHAA 1TVBB 2DOCA 3NZ8B 4B3VA 4LCUA 5MEOB 4DUVA 2F53E 1JGLL 2R69A 1M6OB 4YXHH 5E8PA 3ASWA 2EDKA 4F3FA 4FAAB 3DPBB 5DEFB 5TQ0L 2VR8A 4ZSOB 4PAZA 3GSNL 3Q2NA 5EZIH 4WWKC 3PWNB 3TXAA 5B7FA 3W56A 1E2WA 1IGTB 4Y5YB 1B9KA 1D5XB 1I9RL 2BVPB 1XF1A 1LEIB 3HR5B 5D1XC 4GRLD 4QRRB 2N1KA 3KXFA 2F0CA 1HEHC 3VWJB 5L6YH 1F1AA 1W72H 3SDXE 3A4EA 3VFVB 1HAUA 2PYEB 3HN8A 3RRQA 1QA9B 4NN5C 4BGDA 3V2AR 4DPBX 1XCQB 4RMWA 4BGLA 4GG6B 5EUOE 4I48B 1OT2A 2PP7A 3POCA 4AT6B 3G5XA 3QPQC 1N4XH 4OQ1A 5FUOH 4X6CE 3QORA 3H3KA 3VYOA 3WHE1 1YHPA 1HZHH 1DSWA 3X3FH 3D18A 3MLRH 3NJFA 4KXZI 2NY5H 5DMIL 1MLBB 4BD4A 2ADFL 2EDFA 4X5PA 2YMOA 4GMTL 3QQ3B 3EXLA 2I26N 2NXYD 3NQIA 1RIVH 3WJJA 4MMXA 2UXVA 4QXVA 4MMZB 5T1LD 4RAUB 3B9EA 2L7UA 2ALAA 1JV2B 1NUNB 5CBEB 1OD9A 4MZ2A 5IVXB 2WP3T 1UKSA 1ZT1B 1U58B 5LGHL 3DO7A 1KV7A 3F62A 1RP9A 1V7MH 4O9HL 4RAVA 5BV7B 3QJHA 5FO2A 3C5ZD 3P77A 4XVJH 4YPGA 4GSDL 5D2LE 4G9FA 4V1DB 1QSZA 3R1GL 1QOKA 2AQ3A 4P05A 5J11B 3EOYG 3K72B 4X7TB 1UWXK 2J5LC 4KC3B 1NSNL 3MRDA 3U30C 4F5CE 3IRPX 5EHFA 4G2AA 4YMPA 5TE7H 3X1GA 3NZHH 4ZRGA 1MREL 3WJLC 3KJ6H 1A7OL 1E4JA 2XA8H 3QCTH 2O61B 1PLGL 3NCJL 1IC5H 1J8SA 5L4JA 2X4NA 1BZ7B 2NT1A 4N0CD 5SWZA 2FH8A 3T2PA 1G5AA 2NNAA 4FG4A 3T0EB 3QUZA 3ZL1A 4DHLA 2QMKA 5DT1H 5KAQF 3H54A 2F74A 3PXLA 4LSDA 5HGHB 4HJ1A 3RHWF 3MLTB 2G0LA 3QUYD 4NM4L 3UC2A 5AW7B 3CC5A 3QIWB 4U1IB 2Z4QB 3L9RB 3A67H 1FH2A 3VSUA 2WN3A 1F13A 4YFDB 5IBTH 1FIGL 1H0DA 4QHUB 1RD6A 3HE6C 1JNNH 1N26A 3D2TA 2HTKC 3KXFD 4P2QE 2EDDA 3RVUC 3UBFA 3P69A 4RMVA 4IW4C 1U8NA 1ZKAA 2FT8A 4GKZA 3HPLB 1MNNA 1PCXA 1RIHL 5AW1B 1BZQK 3RA7L 3FCSB 2WBJC 3OXRB 4ZW6A 4DOHE 1RPUA 4XBEH 3SE4C 4XNAA 1JPFA 3EZ8A 3QFJA 3DRTB 2PWGA 4YQXL 4WJG3 1KULA 1CDIA 4PGDA 2Z8SA 1ZDSA 4PG9B 4LLWB 3AS3A 4JZOB 3ARUA 3H8NA 1AR1D 2HSIA 4K3GA 4PJ9B 3L3DA 3AZUA 3CVCA 1F00I 1E6OH 2H6PB 4AYDC 1SUJA 4U1KB 5EF3A 3RL1B 2WAQA 1SN0A 5F89B 5HI3D 1TXKA 3OKLB 5HHQA 5LWYH 5CSGA 1BQUA 3VG0H 3OX8A 4AL8L 1FA4A 4YK4C 5FECA 5L9DL 3KWUA 1QVOB 3ATFA 3MJWA 1OAJA 1I8UA 1ZGLP 3OXSA 3LV3B 2JI3A 1ZLDA 1W9XA 1A7PH 5FV1L 2WXMA 3M88A 1V3KA 1G7IB 5DD5L 2ZXEB 5GGTA 3HNVL 5BJTA 1UYWL 3ULVE 1NM9A 2DQJL 1QO3A 2FWOB 4HISA 2F5BH 1RVFL 1DUZA 2AAAA 3BVXA 5ACMA 1J5OL 3EZJB 5K9KA 4Z7VB 5DK2B 5CKAA 4AMKL 4MSWB 4QO1B 3WS6A 2XU9A 4YNYB 1M7UA 2XXFA 2FR4A 1S7XA 2FWSA 3DMMB 3DA0A 1C5DB 2MQCA 3QJQB 1KJMA 3PWUA 4UAOB 2ZYRA 2LFEA 3NK4A 4LLYB 3H0TA 2MRYA 1IAII 2E4FA 4IBWA 4RZCA 3RX9A 5I73B 2OKMA 3F84A 2DYPD 2A6IA 4CDGC 3OGCA 4PCYA 5CD3A 4KROD 4OZFG 1KGWA 1F90H 2NZ9D 1ZE3C 2PR4L 1AO7B 3QSKB 1NFIA 4MNQD 3VXOB 1AZBA 2NY0C 1Z3GL 1VF5C 1DVXA 1FH5H 3JWDH 1X5KA 3BGFC 3OPZH 4CMMA 3RGBA 3QZWG 4JM2F 1MFDH 5DHEA 1E4WL 5A43C 2EDMA 3HS9A 4OF8A 2R69H 1F1DA 4Y4FD 2LU5A 1MXGA 4KI5C 1A47A 4XHJD 1DBAH 2WXNA 4ZBJA 5C1MB 4JRXB 2I9TA 1JIBA 3BRDA 4ZFOL 1QSED 1OZUA 4M1GL 5K69A 5JW3L 2EO7A 3S37L 4OLWL 3C2AL 1H3VA 3DXAD 2J8UB 3QFJD 4X5WB 5DD6A 4BHUA 1T4KB 5EEUA 4KTDL 4ELKB 1NAKH 4RSVA 1CE6B 2E9IA 5TQ2H 3GJEA 4PJEE 5D7KD 1ROCA 3G7TA 5GPRA 4DN3H 1OTSC 2FQDA 3I9AA 2GTZB 5E6IC 3EO1A 4OV5A 1BAFL 1KB3A 3L7EB 3SE9H 3FFDB 5I15H 3GMNA 3MGOA 3KCWA 4YXKL 3MJ9A 1RMFH 5I1JL 4Z23A 3M07A 5IESL 4HUXB 4Z7UF 3BIAX 1A1NB 2IBZY 3HKFA 4QRTA 1NFKA 4K9JA 3N04A 4N85A 4O2FB 3L1FA 2QELA 1KZYA 3H7LA 5KVGL 4F33A 2AVGA 5T1KA 4MHHG 1UCTA 4U6VL 5F7EH 2VT0A 2ZUUA 4YSOA 2CHXA 1MJUH 2WWKO 2WWMC 1XR9A 3DO3A 3GMLA 1YNTF 5TPWL 4C8XA 1FNLA 4QLWA 1NCDH 4XO8A 3LZLA 2IXQA 3GEFA 4UNIA 1HXYB 1QLFA 4MLIA 1BVNT 4UBDD 3NFSH 3BSZA 4QY8B 3T8XA 4EEEA 1UASA 2VDOL 5JO5B 1ZLWH 4WTZA 4G59C 3LKSB 1BQSA 5E6UB 2Y7MA 1NEPA 1LP9F 2VN3A 3PHAA 3DIDA 2R2EA 1FG9C 3BUBA 3L3KA 4MKMA 3ILQD 4Z5RA 4GBXD 2CLVB 1DZ0A 2ITDA 3PJLA 1B4TA 3C9NA 3UYPA 5JR1L 3WFBH 1ZHLA 2HJFB 2H3NA 5DS2A 3FO0H 1QZNA 2WZ5A 4FCAA 2CBMA 1GGIL 3MJ8A 3O0RH 3HC4H 2AKRA 2R0KL 3RU8H 2AXGA 4JFPA 1XWVA 2K78A 2BOBB 5LGJB 4ZFFB 1ZPUA 2DRUA 5IMMB 1BMWA 1CTNA 3FQ1A 3GC3A 1YJDH 4GO8A 4PTUB 3VGHA 1YMMA 1Q1PA 1UJ3C 2IH1A 4BK5A 4E36A 2M8XA 4U1NA 5T5FA 1UM4L 2F1EA 3ZDYB 4J3SA 1PIGA 1JJUA 4DZBA 2H3KA 3HNSL 4QMEA 1INDL 5B39A 2PYFB 2A9AA 3SDYL 4FADA 3CN3A 1GAFH 4P57B 2IANE 1BX2A 2WD0A 4WSKA 5EU3B 5BVPH 1NC2A 3IJYA 4QUOA 1TSRA 2NXYC 1U8MA 4WFGD 4ONGL 3WEXB 1L0QA 2Y69B 4FABH 2FRGP 4GINA 2KS0A 4Z76B 1TQWA 3C60C 3H7BB 3WDHA 3RPIB 3UIZA 4LMQE 4CADA 3TV3L 1PKQE 3FCBA 4HGMA 2AGJH 3W9EB 2BDNH 3C5ZC 3GIZL 3V0VB 4L3EB 4NFDA 1JI1A 2E7DA 3EYQD 1BJ8A 5EBWA 3S97C 4AZ8A 5GZOD 3TURA 5D8JH 2XG4B 1FO0B 2WLZA 1WZKA 2HPOA 2DQTH 1FFTB 4LIQL 1U9KA 2P8PB 3WXWL 3ARDA 1I1FA 1EJOL 2ESVB 3DI3B 2MCMA 3KLSA 2V7HB 4PJ5A 3QEHB 3N55A 3REVA 4UV4L 1H5BB 5I1KL 4WNQA 5CN2A 2YEVB 4N0CC 2KL6A 1AY1L 1EXHA 4ZOEA 1GOHA 1JUFB 2YXFA 3HBGA 3BCDA 2FX7H 3RGHA 3HHSB 2GUYA 1EAOA 5TTRA 3MO1A 1AQDA 5AL8A 3QUYC 4EI0A 1RZ7L 4OD1L 2XWBA 5MERA 3QIUA 4KVNL 5B8CA 5IJVB 4JVPA 5A7BA 1K4CA 1JFQH 2AEQH 2G75B 3B9KB 1TTCA 5D1ZB 4QRUA 1L4IA 1EBAA 2Y2YA 3MRCA 3EDDA 4ZAKA 4GIAA 4IIQC 4WHTA 2ZUXA 4ZYKB 4LU5H 4S2SB 1YMMD 3QULB 1QHOA 4NO3B 1RAMA 5FO7A 2WCPA 5DJZB 1KXVC 4Z7IA 4XO4A 3L3OA 4RRPM 1MZYA 4FZ8L 4FEIA 3BUIA 3JYCA 1CICD 2DQCL 4MD4B 4PGCB 1PZAA 4WW1B 3CCHA 3BUDA 3F64A 5SWQA 1AR1C 5DRXA 4Y5XC 1KIRB 1J0KA 4NWTH 5CNHA 1EO8H 1T7XA 2A74C 3W11C 1A4KA 4OB5H 3LRKA 2AQTA 3TEUA 4U6TA 3CXHJ 4IOSA 4WFHD 3RI5K 3U4BH 1FG2B 4HWBA 3GUTA 1XGYH 2E9WA 2F7OA 1VFMA 3ZHFA 4KHTL 3ULUF 3ZDZB 4AGQA 3FF7A 5TFSH 1CJYA 1UWGL 1JPTH 2OJ1A 4G6KL 4F58H 5D1QA 5LGYA 1DQQB 1M05B 1YA5A 5KBPA 1AZNA 1SF5A 5ITFA 4Y16D 4TUJA 3P0VL 2DEXX 4K3JH 3TT1L 1URZA 2P46B 3O45A 3KLKA 5T3ZL 3T1FA 1W0VB 2YN3A 3QH3A 5CP7B 3ZKXC 3K6NA 3QNFA 3LPOA 2VDLB 3PHOA 1CXHA 4PVLA 1YYML 3K6DA 3HRZB 5JDSA 4UNVA 3RQ3A 3NN8B 1NOLA 1KBVA 2AABH 4FL4C 4XMLL 1RZFH 5EDSA 2J88L 5EH1A 5SWSB 4NSKB 5C0CB 1CO1A 5DJ2A 2EVGA 5AVWB 5JHDA 3FOLB 4AVJA 3BVVA 3VD5A 5I17B 5KSVB 4OGQC 2CA4A 2YWYA 4YHLL 1A6UH 4JM4H 4FXKB 1CFNA 4YSDA 5EZLA 3FQTA 3E1ZA 1DJGA 4MDJB 4G6ML 4HXBH 4KROC 5AB1A 2NZ9C 1SOKA 4LCWD 1MFCL 4NN6C 5AOJA 5IMKA 1KIUB 5IOPA 2FEDC 1Q0XL 3NCWA 1TZIA 2F5AH 2H8PB 3B5HA 2DJMA 3V79C 1NBCA 1R3KB 2CO7A 4WGVB 4I3SH 3VO0A 1WT5A 2VERA 5AVQB 5BZWB 4AG4L 3ARFB 5DD3L 1M4KA 1P4LB 5EIIG 4X98A 1I53A 2APFA 5JQ6H 2C9VA 3HNTH 2YKLH 2BWIA 4PSPA 1T6VN 2DQFB 4Y4FC 5HYQB 2YAEA 4TM9A 1KXTB 5F6IC 4O5LH 5EO9B 1KB9K 1KIPA 5KJ4A 2GQHA 4JVUA 4KNSA 3PE9A 3EYVB 3QQNA 2JKSA 4BE5A 4JRYE 4OLVH 3KPPB 4FEMA 3RX8A 4PJ8D 2BRRL 4DP4X 7TAAA 3I6SA 2WWNA 4XZUB 2DQ6A 4E41B 1IFRA 3SCMC 5H4YA 1A6VH 3S2AA 4QYOB 2F54D 4KHXH 2VJ0A 2VUKA 4NJ9H 2VMCA 4PLKD 3U2SA 2A9NL 3AG4B 4XX1G 1B3JA 4PHXA 1FJ1A 4CVUA 4KFMA 5F6HJ 1J5HA 5AYTA 4BFIA 1JTPA 1QLRA 5F9AC 3V6FA 1HIMH 4GW5A 1U8KB 5T5FH 2NLJB 3HG1B 4LSTH 3UYRH 3WFDL 3ZDXE 2UVFA 1SJHB 1K6QL 4X4ME