1A4AA

Azurin mutant with met 121 replaced by his, ph 6.5 crystal form, data collected at 16 degrees celsius
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
129
Chain Sequence
AQCEATIESNDAMQYDLKEMVVDKSCKQFTVHLKHVGKMAKSAMGHNWVLTKEADKEGVATDGMNAGLAQDYVKAGDTRVIAHTKVIGGGESDSVTFDVSKLTPGEAYAYFCSFPGHWAMHKGTLKLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rack-induced metal binding vs. flexibility: Met121His azurin crystal structures at different pH.
pubmed doi rcsb
source organism Achromobacter denitrificans
molecule tags Electron transport
molecule keywords AZURIN
total genus 29
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1a4aA00
2DYRB 5F7AA 2HRHA 4DP4X 1V10A 1OCCB 1KCWA 3EHBB 2N0MA 3TBBA 3NJMA 4YSPA 1XB3A 4YVNA 3FU7A 2HX8A 3BQVA 2CBPA 2UXVA 1SDDA 3EH4B 5D4JA 1ET5A 5I6PA 1QLEB 3S8FB 3PPSA 4DP5X 4A2FA 1J5DA 4TXVB 4BWWA 1GYCA 1E5ZA 2YAEA 1TEGA 3FS9A 1FA4A 4BWTA 4QLWA 1IBYA 2LLNA 5I6KA 4NAJA 2XVBA 3PCYA 2DV6A 2XXFA 3BVDB 3NJIA 4BDVB 1JVLA 3H56A 2JFCA 4GYBA 1HAWA 4ZK8A 1JZIA 1GR7A 4AI7A 2AFNA 1OOWA 1SJMA 3NJFA 1I53A 2EIJB 4YSTA 2PCFA 1AZUA 2PP8A 1PNDA 3AG1B 2XV3A 2IDSA 2UX6A 4AKOA 4L0PB 2XXGA 3ABMB 1TU2A 3FSZA 3ASOB 4HALA 2PPFA 3NJKA 4HHWA 4G70B 2UXFA 1NIFA 1WAEA 2PPDA 4KO9A 5I6MA 1PAZA 3X1EA 1HFUA 1M56B 4Q89A 4KNTA 2VN3A 2TSBA 3CVDA 2IDQA 2H3XC 1NZRA 1ZDQA 1SF5A 4GY4A 2VW6A 5I5MA 1OE3A 1JXGA 1L9PA 2VM4A 2EIKB 1AZRA 4N4YB 4JHVA 4YSRA 3X1NA 1ASQA 1JXFA 4PAZA 5PCYA 2BWIA 3PLYA 1KGYE 1V54B 3X1FA 2HLEB 5B1KA 4FA7B 1J9RA 3TU6A 3S3CB 3T9WA 2HZHA 4HAKA 1W6WA 1SHXA 1SFDA 5IY5B 1ASPA 3S3BB 1X9RA 3U25A 2XYBA 4GP5B 3PAUA 2IH8A 1M57B 3SQRA 3ZDWA 2VSMB 4BXSV 2A3TA 2PP9A 2QDVA 2GBAA 3FU9A 2BP8A 1XMEB 3WKPA 1W6LA 1KBWA 1AR1B 2H5UA 5LDUA 2J55A 3NP4A 2HXAA 3T6ZA 1JOIA 2YAPA 3UACA 2ZWNA 1A8ZA 1NIEA 1AS8A 1PLBA 4M4RB 1NPNA 4Q8BA 1AZBA 4YSUA 3NSFA 2IDUA 1F56A 2IAAC 3WNJA 3SBQA 1NIBA 4NB7A 1KDIA 2AZUA 4E9QA 1AS7A 2EILB 2BW5A 2IWEA 2UX7A 1EHKB 2BHFA 4G72B 1AANA 2HX7A 2TSAA 1WA1X 5A7EA 3KW8A 2HRGA 3QJSB 2CUAA 2BW4A 2YAMA 1PNCA 3L45A 2BWDA 3PAZA 2AANA 2MRYA 1JZJA 2I7OA 3DTUB 2XV2A 1BXVA 5F7BA 5I26A 1R1CA 1JZHA 4DPCX 8PAZA 2IDFA 1DZ0A 1PY0A 4A66A 4E9TA 2FQFA 3ZBMA 1GY1A 5AKRA 2J56A 5TK4A 4YSEA 4N8UA 2XV0A 4BDVA 2UXGA 4G7QB 1SF3A 1AZCA 4YVUA 1L9RA 2GHZA 5B1JA 4DP1X 4GXFA 1IC0A 4DP6X 4G7SB 1NINA 1OCOB 3ERXA 1CUOA 2E86A 1AIZA 1NIAA 4DPAX 4E9XA 1MDAA 3WG7B 7PAZA 3AY2A 3MBWB 4KO5A 4BWUA 5TK2A 2IDTA 4GP8B 3EH5B 1CYXA 1KV7A 3GDCA 1HAUA 2RACA 4GP4B 4HHGA 3FQ1A 3V9CA 3OMNB 2JKWA 1KYAA 2FT7A 3NJGA 3NSYA 3UAEA 1IBZA 5I5IA 2XWZA 5ANHA 4YSCA 5D4HA 3TBCA 7PCYA 2CAKA 1NPJA 2WO2B 1GSKA 4F7KA 4UAHA 4E9RA 3SBPA 3NJHA 2R7EA 5B1AB 1AG6A 1QHQA 1WS8A 4A68A 1NICA 2QPEB 1A4CA 4YSDA 4AKPA 2CCWA 1A65A 2YARA 3FSVA 1BQKA 3NT0A 3CG8A 3X2QB 1PZBA 1RCYA 2GIMA 1ILSA 4F2FA 1PLCA 2EIMB 2NRDA 4HIPA 5EHFA 1CC3A 3FT0A 1PLAA 3WI9A 1BXUA 3FYEB 4E9WA 1RZPA 2YAFA 2ZONA 3ASNB 1BQ5A 1SDDB 1GW0A 4KNSA 1WA2X 3PAVA 2Y1AA 2WSDA 1KCBA 4UF7C 4UANA 2H47C 1TKWA 1T5KA 3CZUB 2VSKB 9PCYA 2YAQA 3NJNA 1JVOA 1AOZA 3X1GA 2FNWA 1BXAA 5E9NA 2AZAA 2VW4A 1BYPA 1V55B 3T6VA 1ZIAA 2HX9A 3DIVA 1W8EA 4PCYA 4A2DA 2YXVA 4BK5C 4NERA 2PPCA 3NSCA 5B7MA 2BZCA 1ZIBA 3CVCA 3NSDA 2IH9A 2VM3A 3N2JA 4KNUA 1JZEA 1L9OA 1A4AA 2GC4C 1ID2A 2UXTA 3OQRA 1ZV2A 5B1JC 4WTQA 1VLXA 2BP0B 2GC7C 3FQ2A 3KW7A 1E30A 4YSAA 2EINB 3OMAB 1IUZA 4HCFA 4YSSA 5AFAA 3S3DB 2OV0A 2DWTA 1L9SA 3HEIB 4HCIA 5D4IA 3IBOA 3CDZA 4CSPA 1ASOA 3HB3B 1URIA 3CDZB 2FT6A 4DPBX 4JHUA 1XB8A 2DWSA 1E65A 3UADA 1MZYA 1WA0X 2MTAA 3QJUB 1ILUA 1OE1A 1L9TA 2W88A 2B3IA 4W1TA 4YL4A 1B3IA 2IWFA 4EF3A 1NTDA 1GS7A 4P5RA 2P80D 3SBRA 1AAJA 1GS8A 2P80A 1GS6X 3H4FA 1N68A 2QDWA 4A67A 4G71B 4BXVA 1FFTB 3IEAA 1JZFA 2CJ3A 3NYKA 2XU9A 3QQXA 2FQGA 1OE2A 3QPKA 4E9SA 6PCYA 4KO7A 3NP3A 1BYOA 1NWPA 3FSWA 2B08A 3ZX1A 3RYMA 1YLBB 3D12B 3X1BA 3NJLA 2BP0A 3QJVB 1MG2C 3V9EA 2FQDA 2XX1A 4F2EA 1TEFA 3NJJA 1CYWA 2YAHA 3FPYA 5B7FA 1RZQA 2PP7A 4RH4A 4DP7X 1WS7A 4WKXA 1PZAA 3AW5A 4ENZA 1PZCA 2DY2A 3EH3B 1DYZA 3T6XA 3WKQA 6PAZA 3PXLA 3FPXA 1JZGA 3ABLB 1JXDA 1PMYA 2FTAA 4A2HA 3S8GB 2W8CA 2I85A 3OD3A 4JKNA 1SHWA 3WNIA 1NWOA 2WO3B 5I6OA 1ETJA 3JT2A 4MFHA 3C75A 1OCZB 4AX3A 2BO0A 2XUWA 2JXMA 5PAZA 4X4KA 4W9ZA 1QNIA 1AG0A 1UATA 4HCGA 2IWKA 2YXWA 3QJTB 3AG2B 1E5YA 1M9WA 2DYSB 3N55A 4QKTA 1AS6A 4P5SA 4HZ1A 4E9YA 1RKRA 3AG4B 3AZUA 1ADWA 5FC9A 3ABGA 3H4HA 2VMJA 3FSAA 4G7RB 3OM3B 4AKQA 1ZDSA 2YAOA 1PCSA 4A2GA 3EF4A 1NDTA 1OCRB 1ZPUA 2PLTA 3WIAA 2BP8B 1J5CA 2PCYA 1MZZA 4KO6A 1CURA 2X88A 1OF0A 5I28A 1PF3A 3TA4D 3FYIB 3QJRB 3UABA 1KBVA 2XX0A 2ZOOA 1X9UA 2X87A 4KOCA 1BEXA 3ABKB 1A4BA 4AZUA 1BQRA 4KOBA 1JERA 4DP0X 2YQBA 1IKOP 3QJQB 2FWLB 5B3SB 1BAWA 1N70A 2XLLA 2Y69B 3IN2A 2OJ1A 3ZIYA 2QPDB 2J5WA 2VW7A 4YSOA 5AZUA 2J57A 1L9QA 5I6NA 1XB6A 3T6WA 3G5WA 1J9TA 3DKHA 4A2EA 4DP8X 1E67A 4DP2X 3UAAA 4YSQA 1ET7A 4E9VA 2OCCB 5B7EA 3IN0A 1SFHA 4CSZA 2GSMB 1ET8A 2R7EB 3AG3B 2PPEA 3IE9A 4M3HA 3FU7B 2Q5BA 4DP9X 2FT8A 3TASA 2GI0A 1AZNA 2FQEA 2ZXWB 2QT6A 2PPAA 3T71A 1NIDA 2AVFA 2I7SA 4FAAB 3MX0B 3JTBA 3CVBA 3UGEA 1SNRA 1FWXA 1A3ZA 1J9SA 2FJSA 2GB2A 5I6LA 1EZLA 3FU8A 5B1BB 3FQYA 3GYRA 2BZ7A 1OV8A 1GY2A 3OMIB 1AACA 5I5JA 1KDJA 4K9JA 1MG3C 2CALA 1J9QA 2Q9OA 3GXUB 1AQ8A
chains in the Genus database with same CATH superfamily
2ZOKA 1A1OA 5AVTB 1EJFA 1P2CB 3Q1EA 4BUHA 3FONA 1KCWA 4HUVA 2MCG1 3MU3A 4M03A 2AJUH 1WZKA 4E42A 2CBPA 2VISB 3KJ4B 3EH2A 5EUKB 5EUOE 2F74A 4NX0A 2XWBA 3JBG7 1VADA 1G9MH 1ET5A 5F1NB 1KC5L 2CRIA 4PCTA 3V4VL 4HF5H 2X9ZA 5BZWA 3P3RA 3C60B 5EF1A 1WGVA 1NLBL 2WVVB 3N85H 4NNXA 3WFDH 4TNWK 3G6JE 4ICXA 3GRGA 4HFWA 4UOW1 4NI3A 2NUPB 1DJXA 1IBYA 2VMFA 1SHSA 3DTXA 5LXVA 4JQVC 1SJHB 2BY2A 2EYTB 3C60D 3LS5L 4CU7A 3NJIA 1P6WA 5I1KL 3H56A 25C8H 4HJGB 2WLIB 3ZYOA 4FL4B 1T89C 4WFFE 3VXSB 3D3VB 3BKMH 2O61A 4ONOA 3HNTH 4YSTA 4L3AA 1PNDA 3AG1B 4I1PA 5T1KA 4PJ7B 3HNSL 5INDB 4YXKH 1BZOA 2AJSH 5EEVA 4TVPL 1NBYB 3R18A 1HXYA 5I6MA 4GB9A 4UQDA 2O5XL 5DO2C 1BZDA 5AUMB 1HFUA 3UBGA 3X1EA 1QBAA 4KNTA 4DAGH 4K71C 5IMMB 2R2EB 1CGXA 1INQB 1U8JB 2IIJA 1DFBL 1ORQA 1M05A 2K4WA 2VW6A 2IQAB 2BNRA 1UWFA 4I87A 4M7JL 2F8IA 4XO5A 4O00A 2FEDD 3A6CL 1WAAF 4RRPG 1KFAL 3AM8A 4FG4A 2CBQA 1T6WA 2HLEB 1IC4L 2E7CA 1QVOA 2VDKH 4OV6F 5DLLA 5L2JB 1J7VR 4WI5A 1L3WA 3EJRA 1TJMA 3SBWA 5L4MA 5FA3B 4RMUA 1F45A 4R26L 1PZ5B 3AXHA 4MQ7B 3BAEH 3S3BB 2BY3A 3U4KA 3PAYA 2W9LA 3DX0A 3FT2A 4KZEH 1RIUL 3P3SA 4JY4A 2QR0B 1MVFA 3TBYB 2BWQA 4UOZA 4DO6A 2JB5L 4ZI8A 3MNVA 4M8QB 3S36L 3FU9A 5KVEE 3US0A 4C56E 3LNIA 1V05A 4JFTA 3IWVA 1AJ7H 4BCXA 1JWUB 1Z32X 2OMUA 2XIDA 1CDJA 1DFXA 3WXWL 4O2FA 4F8PA 3O6FD 1NPNA 1YUKB 3QSKB 2GK2A 3CFCL 5C0FB 1EZSA 1DVFC 4JE0A 5I19L 3VG0H 5KW9H 4OY9A 5D6CA 4AUJA 1RH8A 4GUCA 1LD9A 1OSZA 4NO0D 1PZUB 1BVOA 5E6IA 4NP4L 4B96A 3SDXE 2R1XB 3ULUC 2XZAL 4OCYH 4NZDA 2BHFA 4LT7A 3EOAB 1DHKA 4R97B 4Y8AA 2AEQL 3UBXB 2N4IA 3PYCA 1I1YB 3Q5OA 3RQ3A 3TFKD 3SBWC 4KFMA 5JXAL 6CGTA 5GPRA 5C08B 4I0KA 1K8IB 3Q7JA 4U4IA 4K9EH 1NCDH 1H6EA 3LX9A 2WTRB 4FXTA 1CVRA 1GOHA 1SY6L 5EZPA 1KJ2B 5F7BA 2KQNA 3WY2A 2FH6A 2X4PA 2A6IA 4L1BA 4ZUTB 3FC8A 3MLSH 5SX5K 2OP4L 4E9TA 1I8MA 1CDCA 1IE4A 5ITFB 2VAJA 4Z7WF 1G7PB 3L5JA 3N06B 4U6TA 3Q3GA 5HDRA 3N6YA 1VHPA 2FO4A 1MFCH 3KYOB 5DQJB 1F4XH 3D3VA 1CDYA 1AGDA 3AU0A 4LMQI 3TBTB 4E9XA 3MKGA 4LF3B 2X0VA 1ZWIA 3GC3A 5ERWB 1MDAA 4JDZB 3AY2A 4BQBA 4WWPA 1FGNL 4BKSC 1GC1C 1P2CA 2H41A 1FNFA 5TK2A 4X4YA 4XMKH 4JHWL 3QDJA 5JZ7C 5JHLA 2H26A 1KJMA 5I1GH 4RAUA 3GM0A 5T3XL 2DQIL 5T3ZE 2QPFA 5HHNA 1F0LA 1Z2KA 3HC2A 3RUGA 5IROD 2E9BA 3B4NA 4KMQA 2CIKA 4PCSA 2A6KA 1INEH 3NSYA 3MLUL 3QO0A 5I5IA 5TDNB 2M1KA 3I3DA 4UZGA 3TXAA 1FC1A 5JHDD 1JSYA 3HUJA 3N91A 4QHMB 3L3OA 4YSCA 3MTXA 2WV3A 1DVUA 1NPJA 3PP4H 2PW2A 1FZMB 2WCGA 2ENYA 4X6CB 4ZTPH 2GJZB 5GGTH 5FUCE 2YFOA 2WLIA 1FFOB 2FCBA 4UINH 5JXED 4WUUD 3K74B 1G5GA 5EOTB 2VLJB 4WO4A 4RZCA 5EO0B 3C9NA 5E7FA 1F41A 1U8IA 4BFNA 1UM5H 2MTPA 5I2IB 3QJOA 4FD0A 1NFDB 1KIQA 3GINA 1ES0B 1NBYA 1ZVNA 3DJRA 1IAOA 1ORSA 4JUSA 3FYEB 1UB5B 1N67A 2DM3A 2YAFA 1HHGA 2VQ1A 4YDMA 4PS3A 3QQDA 1FYTD 3ZT5A 4YHZL 1GMIA 1WA2X 4Z1PA 3OBAA 1ICTA 3CDFA 4P4KD 5EUOB 1ZRUA 3TWYA 4OCNC 1R3IH 5D1ZC 2HPTA 4Z7UF 2X0WA 1X6LA 4NT6A 2YPKB 4O02L 2VSKB 2X3CA 4PHZA 4EXKA 4AL8H 1L5GA 3NQIA 2XBTA 3QPQC 5C0BE 4Q9BA 5C0ND 1NCOA 1P5VB 1JGIA 3M1BA 4F5CE 4S1DC 1QSFD 1QAWA 3LH8A 1P6FA 5HVHC 2HJLB 3OJVC 3WYRA 3LQAL 4OLZL 4YK4B 3Q05A 2ZSWA 4LCWE 1YAZA 1MCPH 3OJMB 4J4PD 4U6YA 3T08A 5B7MA 1IAIM 4JQXA 5CEXA 3RWCA 4D3CL 2SODB 1KXTB 2IH9A 4KNUA 1W0VB 2AHIA 1PKQA 2HSIA 5TH2B 2GC4C 3F7KA 4PJAB 3K8LA 3TBWA 2CM6A 4N0UA 2EIZB 4GAJL 1CBVL 5D4QA 4PH8A 4WTQA 2DI8A 2HVJB 4JR9L 5I1LB 4M62L 3U6RB 1R33A 3GMRA 1A2YB 2EINB 3HAEA 4JQIL 4L05A 3C5ZD 2I60H 5I1KH 4X2UA 5KYWB 1ETZA 2VZOA 2X53A 1XF3B 1CD1B 3VTTA 1QLEL 4U1GB 3IB4A 4GUPA 1GA2A 5JQHC 3I74A 1AO7B 2P8PB 1HHKA 3BVNA 4PS4L 1G6RB 4NZUL 3V6OE 3KYOA 3MMEA 5ITBL 2Z1KA 4ZUWA 2I5YL 4B41A 3D4GA 4KBPA 4XPFH 5J4MA 3D0LA 2WXGA 3SE8H 2F08A 4LESA 4A67A 1E9PB 4KPHH 3MRKB 1QW8A 3IEAA 4IBWA 1CTMA 2CJ3A 2Y7SA 4C4KO 1HQ4B 1B4JH 2V3DA 1U8IB 4XP6L 4YHPB 3ZKXC 4HKJB 4LCWB 2GBUA 5EWIL 4K3EH 2OYLA 1PX4A 3ZO9A 1WFMA 3VD7A 4B50A 3AMKA 1EFXA 4YC2C 5DCCA 3P11L 2ESVD 2XFXB 2A1WH 1MG2C 4XNYL 3ARQA 3GMLB 3G5VB 3HBQA 2GSGA 1A7BA 1HHGB 2VQ1B 1J8HB 4NUJB 3QRGH 5HGBB 2IPTL 1EEZA 4KTDL 3G9AB 4H40A 4ISVB 4QTFA 4M1DH 1RUPL 3T3MF 4J3SA 3KPRB 3CUPA 2V3FA 2QQLL 3FT3B 4JRFA 4NT6B 4ETQA 3RVTD 1M71A 3SKJH 1XXFC 1U8NB 4Y1AB 3WKMH 3MA7B 1BV8A 1OTSC 1RMFL 4KJYB 2EXTA 2W8CA 3OD3A 4PGCA 2FK9A 1KIQB 3K0WA 5I1IL 4RRPA 2ZCKH 5DFWH 2YGOA 4ZT1A 1LO4L 2ICCA 2QSCH 4UILL 5C70A 2H9GB 3VXME 1HHIA 4BIKA 4ZMXA 3DIFA 4TSBL 4CADA 3VD9A 4XN9A 1TQUA 3IDXH 3QXDA 1EMTH 1Q9WA 3EHBD 3HC3H 4N2LA 2IWKA 3DX6A 1CJYA 1TQTA 1JF5A 1SLVA 2KQMA 1A14H 3DMMB 3AG2B 3K0YA 4K3GA 4QKTA 4Z7WA 4W9HC 1ZLSL 3PGFL 1JWMA 4HS8H 4MXVF 1I85A 4Y4HA 1J18A 2NCEA 3I6KB 2ENQA 3WFCH 1LWJA 4H0LC 3CFEA 3FN0H 1PEZA 4PS7A 4HEME 4EIBA 2LU4A 2LFGA 3FRPG 4PMEA 1JUFA 1QRKA 1F4YH 1QLRA 4H88H 1KB5L 3ZTJH 3JV4A 4DIXA 5MEQA 1CBVH 2IFFL 5BRZD 5KSUB 4Q2ZB 2VAAB 2VH5L 3TA4D 4PJFF 2LLGA 3BGMB 3H9SA 1CF8L 3FHEA 3H9HB 1MPAH 5IW1A 3IFPB 3JVFC 2GABA 3AQXA 3V7MA 4P5MB 1BLNA 1QUPA 4YXLH 1H6FA 3H9SE 5L0QC 3WD5H 4TPRH 3BW9A 4Z7NE 1NOAA 4M1GH 5HHME 2Z34A 3IDIB 5E94B 2XLLA 2C5DC 4FQQA 3WEBA 4WCYL 3P4MB 1DJIA 4M7KH 2O93L 4Q14A 2A83A 1QR4A 3GHBH 4UUJA 3VXMB 5HYJB 1ET7A 2WBKA 4XPTH 2JB6A 3H0TA 3FF8A 4NZRL 2OTWB 1QI4A 5DDHB 5D7KE 3MUHL 1F3DH 2NLJB 2HG5B 2VKXA 3FU7B 1TLMA 3K7UA 2APBA 3MNWA 4OTXH 3GTNA 2BRRH 5HDQL 3RX5A 3LKSB 3GS7A 4NQSB 4X99A 2VDQL 2XKNA 3D30A 1KIUA 3AAZB 3CVBA 2EO1A 3UGXA 5FB8A 2BFVL 2AITA 4FX5A 3V4VA 4D0BB 1YJDH 1F90H 4Z7UB 4G3YH 2WVTA 3MBXL 5F7FA 3AUVA 3P3YA 4K3HA 3O41A 1QR1B 4R3SA 2ICWB 2R2HA 2HKFL 3B2MA 5TPWL 3BEVB 4OAWA 4O02B 3H55A 4EI5B 1QNZL 2Z4QA 2CALA 3EGDB 1U2YA 1TTCA 5CINH 2FEEI 5GRWA 4DP4X 3RNQA 3TF7C 4AZ8A 4LOVA 2WXJA 4PJXE 3S35X 2DICA 2RAMA 2DLGA 3HAEH 5IG7A 5J5EA 5JR1L 3ULUL 3LNGA 2XIIA 3OPZL 3QNXB 4GAGH 3VAEA 2LVCA 4DP5X 4WO0A 4Q9CA 1BCIA 3ZQ9A 3ZE1E 2F7OA 3BAYA 4P0DA 4BWTA 2DWDB 4ZFQA 3QWRA 4R7DA 2LLNA 4LMQE 3B3IB 1YEFL 4E41A 3GMNA 4NAJA 3SO3B 1JGEA 1T22B 3TH3T 5KN5B 1CS6A 5CWSA 1HE8A 4ORZC 1I3UA 4HT1H 1JYVA 2QQLH 1X5XA 3GSRA 3D2UD 4Q6IB 5BXFA 4B6ZA 3KXFA 3TTSA 2AQSA 4KKPA 4MWFB 4GS7C 1CQKA 5CO1A 2BLFA 5FA4A 3FSZA 4A7GA 5TQ2H 4LLWB 1J5HA 4QD2E 4HHWA 2UXFA 1RUKL 5AYTA 1TJXA 2CLZA 2XWJA 4NAMA 1N6UA 2JKXA 5E2VH 1XH2A 3RWFB 5AOJA 3QUGA 3S2AA 4HBQA 2VR6A 1OE3A 5DVPA 2WD0A 3RGHA 4XMZA 2YJLA 4ONFL 3ZMRA 5JOPE 5PCYA 3U4BL 3DGGA 1DVQA 2AGJL 3PLYA 4XMKL 4AENB 5BRPA 2AAVA 3U0PA 5HJ3B 3VO0A 4G6AD 4OD1L 4X8GA 4ZX5A 1QFWH 2NY7H 1JHLL 1TLKA 3TU6A 2J72A 1JWMB 1W6WA 2YN5A 4I0PD 1TG8A 2FVNA 4EOWL 4BFKA 1FO0H 2BIPA 3U25A 2FLRT 3SGEH 5IVXA 1RK1B 3VCLA 1C5BH 2ZYRA 1QQDB 3IRCA 3PAUA 4Y88A 4FABH 2EDWA 4D7PA 3VGDA 4XGZA 2VSMB 1VEMA 3E38A 2A3TA 5DWUL 4L18A 2AEPH 2Q0ZX 5HHOE 4V1DE 4IKIA 4RESB 3LRGA 3E6HB 5AZ2H 3A6OA 2CHWA 3P2BA 2MQ3A 1LEKA 5C7XL 4JREC 1OOAA 3EZJB 4LNRA 1U8MB 3BZEB 1VA9A 5SWZB 1CPUA 4R3SB 1A3RH 3UBXG 1Y6KR 5FDWA 2RA1A 2WXOA 3ARGD 3KYMB 2HKHH 1HL8A 4PRHD 2KLSA 3SO5A 3BDYH 3T04D 4K7PH 5T3ZD 1F56A 2JB5H 4XNZC 3DSFL 2B16A 2XRAH 3Q2NA 5AOLA 3E8UL 4KUCF 1FN4B 1F1AA 1D6EA 3PV6A 1E90A 4G72B 2BSSB 4TSAL 3RA7H 3QA3A 3NABL 5AQ0A 4LQFL 4XCNB 2XCMC 3QJSB 4OCWL 3TVMB 5LNGA 3CFCH 2Z7ZA 3MBEC 4BEIA 1HNGA 2DIBA 5DT1H 1OZUA 1DVFA 1R1CA 5HPMB 1ZY9A 3FB7B 4MAUL 1B88A 1MXGA 3CLEL 4NIYE 3M6DA 4I85A 4PEEA 3VYOA 2FYYA 3PUCA 3PDOB 4AEHH 4XN1A 4B7LA 1T22A 1HE7A 1Q0XL 1NFIB 3V0IA 4W9CC 1L7IH 1UB6B 4UDTB 4GXFA 3DMMD 2AV1B 2F19L 4OZ4A 3I50H 1G7MB 2E86A 2R0WH 2FJFA 3EOTH 1TDQA 3Q2WA 3R06A 4UT6A 5DMGD 1NIAA 3DOSB 2HLFC 2X1XR 2WQSA 4F7PB 3MBWB 4HG4J 3QCUL 4CVZB 2HVKB 2Z0BA 1M7UA 1P4BH 2QVKA 3AU1A 1FYTE 3EDKA 5DSCA 5E7BA 1U93A 2LTQC 1K9TA 2R9HC 4OJFH 3R8QA 5DC9B 4GP4B 3F01A 4H2AA 4XXDB 1UXMA 3US1A 5IROC 3FFCB 2WYHA 1IAIL 1TR7A 4PTUA 5EB9A 4X6DE 5EG6C 4CDHA 2WUBL 5DF0A 4MX7A 5B3NA 2ERJC 1UCTA 1IBZA 4N8VG 4B53A 5IEKB 5DYOA 1NANH 2CR0A 1OXYA 4GBXD 4X6EB 5D7HA 3L5HA 2OMYB 3O4OC 3P9LA 4L3CA 4O02H 3UBFA 4Z8FL 1Z3GH 4DKFH 3WKML 1BVNT 3IF1A 3QEHA 5HI3D 1PL3A 1QHQA 4S1SL 4X4XA 5CWSB 4MA7L 5C8JA 1CDGA 4Y7MA 4CN1A 4JGUA 1QSFB 1P6AB 1A9BB 5DS8B 1TTUA 4FMFA 3BUYA 5D7IB 1MJ8H 4AW4A 4C4BA 3K72A 1NLBH 3IETB 3N85L 3A67H 3RVXC 3BT2H 3IMVA 3D34A 5CBEA 4FNSA 3SDDB 2XPGA 1Q9OA 3HB3C 3O2DA 5J7CC 4H25B 4H8HA 4JJ5B 4MZRA 1T0MB 2WN3A 3F05A 3FT9A 4U6HA 3L3JA 2VUKA 2GHWB 3L4YA 4MKTA 3T4AB 4MKMA 3PAVA 4NO5B 5C71A 4OF0A 4HGWA 4QO1B 1U95B 2WSDA 4PJEA 1P4LA 3LQZB 4HXAL 3HZMB 1RJYA 3G5YB 4LVHC 4M5TA 4OIBA 4P9HH 4NRZA 1UGNA 5CR8A 3JWOL 1NC2D 4MYPA 5DRXA 3WHE0 3QPQD 4BFGA 3VMOA 2BINA 1OB0A 4NC2B 5IIEA 3G6JB 1RUPH 4HBCH 2R83A 4CMMA 2ATPB 4JY6A 4GI6A 1IGCL 3BFOA 1M2OA 1KBGL 1XGUB 1ZS8B 3VGAC 4W70A 4EJ1C 5CLWA 2ZF8A 1GSMA 3VX0A 2PPCA 2PTTB 2MCPL 4PGJA 5I16B 2H1PL 4BZ1A 4NQCD 2XWTA 1AQKH 4F9PC 1ZIBA 4OFYA 1DQMH 2E7DA 2GT9B 2D0GA 1LDSA 3TA3B 5T3ZL 4MD0A 5MEOB 1QBLH 4NWUH 4ECNA 2N7SA 4QKXB 4L3FA 4BK5A 2UXTA 4BCYA 2BCMA 2GQHA 1ZV2A 3TF4A 5D96C 2F5AL 2A74B 3GKZA 1ZLEA 3O8XB 1E30A 1Q90A 2CSPA 5HHQB 3P9MB 3EADA 3HIZA 3L48A 3JWNH 5HPMA 4DF9A 1YEWA 4MDRA 3DRTB 1LVEA 1YG9A 4TF4A 5JDSB 1FG9C 1KLGA 3T2PA 1SDYA 5HVFB 4Y5YA 2VDKB 2WTPA 5A16B 3A24A 5FIEA 3TP4A 4YGVA 3ARBD 5IOKA 1R0AL 4HSQA 1FP5A 1MZYA 3D39D 2MTAA 3IJHA 2BOCA 4HDIA 4HUKB 4UM9A 3QFJA 3S5LB 4OCSH 5DRZA 1EJ8A 2KZBA 2NW2A 2ICES 4HAFA 3ESMA 2IPUK 4OLVL 1J05A 2BVPB 1H9DA 5EU5B 3FUEA 3C5JB 4LOFA 1TSHA 3FQNB 4FG6C 5B21A 2CDGA 3KH4A 5BO1L 2L7UA 3MBEB 3TJEL 4XMPH 4KMTH 4B27A 2A9BA 1GGTA 3ZZQA 3D48R 3WJLA 4A04A 4Y4FB 4BFRA 2A4ZA 3BUYB 3G08A 1MWOA 4Q6KA 4X7TA 3Q8AA 1F00I 1NWPA 4WHYH 4AJVA 1KT2A 4WUUB 2VLJA 4ZNEA 4IBVA 1YLBB 5BUAA 2E8ZA 3BZ4B 3APCA 3NJJA 5EO9A 2FB4H 4HHAA 1FBIH 2NZ1A 3QI9C 5FO8B 2V17H 4FQXB 2JLPA 1ZSDA 1MJUL 4QOKD 4PJEB 3ABLB 4NO0B 1OTTC 2NY5C 4FQ1L 4MJ6B 4X9FA 4FG2A 2F7PA 5C1MB 4N2KA 3OSVA 2YXMA 4U1IB 1OAYH 3GWJA 5EO1B 4Y19E 5C3TA 2YSTA 2WLNA 2IAND 5FYKU 2YD2A 1SHWA 1CL7H 4Y4HC 1T4KB 1QSVA 2E4TA 3OHXB 4ZSOB 5A6IA 1ETJA 1LYQA 4QHNA 5C0IA 4JJ5A 3A23A 4WFGD 1QSFA 4HIQA 4NQDD 4TPRL 4X4KA 5CSBA 4J27A 1BMZA 1BLIA 3MR9B 4GQZA 2C1PA 1ZEAH 2ZX5A 5J11B 1VACA 2EE3A 2VZTA 4RBPH 1HT6A 4N0FA 2R0ZH 2PXYD 4GKZB 3FZUC 4H25A 4YDZA 2R1YA 3SCMA 1JZDC 4I89A 3RIFK 1MRDH 4NAQA 1YDPA 1K2DA 3MLRL 4PJAA 3TBWB 2CGRH 3VXNB 1EZVX 4H4NA 3CTTA 2Y6SD 2BP8B 5GS2D 2OSLB 4OGZA 1J5CA 3VSQA 5IJVB 2WXKA 3HS0C 4KO6A 4LOEA 1HEHC 3LVTA 3RPKA 2ATKA 1PEWA 4JM4H 3GXIA 2X87A 4EN3D 1NC4A 3LNEA 1QSZA 1KMGA 4APXB 5SWQB 4NS0A 4JN2B 1BQRA 4WW2B 2GTQA 3UTTE 3UAFA 2YQBA 2DQUH 4F7MB 1D5IL 1CXEA 2CJTA 5KZCB 3LRHA 5J9PB 4I18B 1UD2A 2UZXA 3K71A 3VSVA 4GRWE 3NAAL 2IPUG 2B15A 2Y25A 2ZOLB 4XE0A 4IMKC 1XCTA 2D7MA 4HOWA 1Z9LA 1J9TA 3UAAA 1MH5A 1A6TB 25C8L 1EZVY 4OQTL 5B7EA 3IVKA 1BBDH 5AUMA 3QAZB 1VKXB 1MRFL 4M43H 2Q5BA 3L7EB 3LHPH 3ML9A 1DANU 1M05B 2VR8A 4G1MB 2IMMA 4MCZB 1BM7A 4KQ4L 3KPNB 1FVCA 1NIDA 5EOCL 4NWTH 4HHAB 4PQXA 2F61A 4B9ZA 3MOAH 4FAAB 2WIIB 2GFBB 4P99A 2E27L 2VDRB 1F4AA 1A3ZA 3RVWC 2VC2H 1G1CA 2FJSA 1UEMA 1ZSHA 1QSED 1TFHA 1QLFA 3D0VA 5EZLB 5C86A 1U8JA 3I85A 4F3FA 3L4UA 4Z0BL 1EXGA 2IQ9H 2WXFA 2Q86B 4KDVA 3MC0A 2E9JA 1J9QA 3OZLA 2QZ5A 1KCKA 4HPOH 3D69A 2G2RB 3RFZC 2IGLA 1OCCB 1PLGL 1RUQH 3FQNA 4JCMA 5MI0B 3SOTA 3VX1A 2YPVH 3FT3A 4RSYA 4YVNA 3IMUA 4A63A 1RUML 2QSVA 4KHXL 3RFRA 4YS4A 3CPUA 4FXKC 1HDMA 1BFSA 1R3HB 2O5ZH 3KWVA 1JZ4A 3MYZA 1IVLA 1M7DA 5ICUA 4GKLA 4AYID 5JW4Q 2FIRT 3EYQC 4FFZA 4Q9QL 3UJTH 3V6ZB 2PETA 3PPSA 3W9DB 3S8FB 1HZLA 3IXAB 3UC0L 5J56B 1QHPA 3ETBF 1EBAA 3QCVL 1KJ2H 1UD3A 4ZFZA 2ODHA 3AUWB 4NQXA 1F4HA 4L8DA 3GO1L 5ALBL 4DTGL 4OCWH 2BNRB 4OB5L 1JPST 4FQ2H 3AXLA 2JIXA 2C3WA 2NY2B 4XHJD 3UTTD 3QVAA 1ITBB 1IGIL 4HH9A 5F9OH 1XH0A 1JPEA 3IDIA 5J13B 1J8HE 4U1GC 3B9KB 5BW7A 4MJID 1KJ2A 1KJVA 3BGAA 5F7MC 1FI8C 1YECL 3LKQB 1P7KA 1P7QB 2NQCA 3PFQA 5I30H 5IMOB 2XXGA 3SPGA 2JI1A 5A2BA 4CILA 4M5ZL 3RI5F 4Z78B 1M56B 1OO2A 2JJSA 1HH6A 2Y3NA 3CH1A 5IOPA 2ZUWA 4WFEE 1A3QA 2IDQA 5IFJB 2RCSH 1E8WA 2FO4B 2YPVA 1S7WA 4DO4A 5IMKA 1PIGA 1GZPB 4GLRH 1W8OA 3THML 3VRLE 4G9FB 2H8PA 2N1KA 3FO9B 1R0AH 3KCPB 3ZDXB 3G5XB 4DAGL 1A02N 3LN5A 4KDTA 2HZHA 5HYSG 1I1CA 1BJ1J 2EYSA 5DHVA 4XC1L 2QHRH 3MNMA 3O4OB 3O9WD 1X7QA 1MIMH 3CLFL 4GG8A 2K4AA 4MAYB 1T1YA 4F7CA 4GO8A 3UBXA 4NENA 4P2QA 4IBZA 3HKZA 5C2BL 1J86A 2EIDA 4WW2A 2BP8A 2CIKB 3NZHL 1C7SA 4XNUL 3HFMH 4IRSA 2H6OA 1KZYA 2IG2H 2NY5H 2PTVA 1IT9H 4OGXL 2X7LB 3T6ZA 3DPDA 4DGUA 5ESAB 1XAUA 3R0NA 5IG7B 3WTTA 3V5KB 3RX9A 4ZFOA 2XA3A 3PHQB 1ZHNA 3U82B 2XQYA 1HOEA 4GW5A 1MJ8L 4D0BA 5FO9B 5D1ZA 5KS9E 4PBVC 5CKGA 5GRYA 1TYJA 5DJ8B 2F5BH 3O3AA 5F7EL 3O41B 3S8WA 2WB7A 4E9QA 2JV6A 4CGUB 4I0PC 1ZVHA 4CAGA 1LO5B 5SWSA 3O9WB 2BNQD 2X70A 3BAIA 4ZXBA 4XBPB 1QUNA 4NCDA 4XAWL 2HRGA 4FYSA 5EFIA 5F1KC 2BMKA 4JMXA 3KNBB 2BHUA 3AT8A 1UB5A 3DTUB 5I26A 4OIAA 3H85A 1U8OB 3BRFA 3EYUH 1A5FH 2WUBH 1G43A 3EUUA 3LB6D 5KBMA 3ZBMA 3FUIA 4XCEB 4YSEA 1SHMA 1IBHA 1KBPA 4LLUB 4KI5C 1B0GA 1BREA 5JHAA 1G1YA 5DFVC 2UXGA 4F20A 1DUZA 4PJ9C 3F5WA 2PO6D 4G8FB 4LEBA 1E6JL 4WWID 2MEJB 3PPEA 4I2XB 4U6XA 1NINA 5F8QC 1P7QD 4IYKA 4L4VE 4YPGB 1GMEA 1AVAA 3ZJAA 1ZHKB 4U1HA 4OFYD 1CDBA 2Z92A 4JL1A 1ONQA 5IMOA 3L3DB 1UH4A 4LSTH 1CLOL 5EOCJ 3D69B 1ND0B 3NJXA 4MB1A 5ANMA 2NY2D 1WD9A 1UZ8A 3NH7L 3JWNG 3AQDA 1BD2E 4EIZC 1CE1L 1IBFA 5IW6A 4GSDH 5BZZA 5KJ7E 4LHUD 1CWVA 5IHBA 1A21A 3AXLB 1KOAA 2FGWL 3RE0A 3ZDXF 3UO8B 5JIIA 4AMXA 3M1BB 2V4LA 1H15B 2WBJC 2KS0A 3QUHA 3L6FB 4QF1A 3BP6B 4UIKH 1TNNA 1NOFA 1NGYA 2HVJA 3V4PL 1ZGLM 5CM1A 5DVMA 5AVRB 4PJAE 3ZSSA 1DQQB 2P5WE 3WL9A 5IJKC 3CSGA 5DHVB 5HJGA 3TBCA 5IHZA 4PRIB 1NL0H 3GRBA 1PSKL 4I48B 4HIJB 4HXBH 5D93B 4OLWL 3C6LC 4HQQL 5CJOL 3C5SB 5ICYB 3CZJA 2ZUUA 3KL5A 2V37A 4UQCA 2HUEA 4YX2H 3PWPA 4YSDA 4J3UA 2DQCH 2JKJA 3NJVA 2YPLE 3NT0A 3UTTA 5E6RB 3VG0L 3MROB 5FEBA 1PVHA 2NRDA 4YHML 1XGPB 1VSCA 4F2MA 4I2XE 1JTOA 3MGOA 1KPUA 5C2BH 1JPSH 4K94C 1KSRA 1A0QH 2YXFA 4O5LL 3J7HA 3SDAA 5CD5C 4FG6D 1UZ6F 4RA0C 5GS0C 3C6LA 4RGNE 3U0TA 2CGYA 2WNGA 1TMCB 2VDPH 3QFJD 4O2CB 4B0MB 1N59A 1T5WA 1G7IB 1I7ZA 2X70B 2WNXA 2JKLA 5J6SA 4QGTA 2ZOKB 2BRQA 4D9RD 3FQ4A 2GCYA 3IJYB 1JVOA 3HI1B 3OWRA 4QRQA 1BXAA 1JS4A 3S37X 4P4KA 3BN9C 4TTGA 4XH2B 3QORB 4PRDB 1Z9MA 4XB3A 3NCYS 2GJ6D 5I9QB 1A6UL 3DIVA 5HY9B 5KG9A 1D9KC 1MFAL 2HRLA 4H1LG 4AYGA 4PV9A 4Z6AT 4GMTH 3CUPB 4J12A 3LPOA 3L5IA 3FOMB 2QSCL 4FKHA 4ZXBD 5HI4C 4JQIH 5IR1A 1K85A 1BZEA 4C47A 4G8EB 5LBGA 3LKRA 2ITEA 2VM3A 2O6DA 1LE9A 1Z9OA 4FNLH 4FTVA 2Z92B 1KWKA 1M3JA 4HCRL 3OLGA 4OB5H 1UQSB 4PR5A 3AM8C 4YSSA 2IWGA 1TZ8A 2A6DA 4W9KC 3EFOA 3BOVA 2DMKA 4HKXA 4PSRA 3ZTNH 4GG6B 1U8NA 1MRCL 3KPTA 2K45A 4YNYB 4L8CB 3KEDA 2WLLA 5HGHA 1RZKH 1ZA3B 1B0GB 1URIA 2PXYB 3C8KB 3CZGA 3QEHB 2FT6A 4JFHD 1Z1WA 3V6OC 3UTPE 4EIUA 1A9BA 3MOBL 3ZDXE 4BQ6A 1NGWB 1T3FB 2ADFL 5ELIA 5B22A 1UFUA 2WLJA 3ZKSD 3BUBA 4EN3A 1MJJB 3IJSA 3JWDC 2KC0A 4EQ2A 1GS8A 3JV4B 3ISRA 5J57B 2Y6SC 4LU5H 1XFPA 4MZIA 5D7JB 5DS2A 3U4EB 2C1OB 1QVOB 3W1ZA 2DQUL 4AQAA 1TQWA 3NYKA 4A38A 1U8PB 3SYPA 2BS9A 1XIWC 3WCYA 4L2YA 3ARFD 1LQSR 2BIQA 2V7HA 3N0PB 4LQ1A 3CFJB 1NKRA 1LTXA 1JBJA 1IRAY 3MRQA 4Y19D 3MCLL 4ZX6A 5AAMA 4HLJA 3V9EA 4N2HA 4X6DA 5H94B 3MLZL 1TZIB 4B3EA 1OB1B 4UV7L 3K81A 2J8UB 3ELQA 3U0TB 5B7FA 2DQFA 1FSKC 3SPIA 5HHMB 1NC4D 1NCUA 3QCTH 3VD3A 5I15H 2NY5L 3AJ7A 1TT6A 3WKQA 3O3EA 2OZNA 3PXLA 3N41F 1MNUH 2OTWA 4KROD 2DKUA 4AOFA 3UYRL 5DDHA 3U4AA 2FTAA 5E0FA 5F6IC 2KHAA 3RILA 4YHIA 4E5XB 3K4DA 1ZXQA 3GXTA 5LHDA 1FPTH 3P4MA 1OP3H 5F2FA 4HXBL 1JFHA 1W72L 4P2YA 4K15A 2Z31A 3SE8L 5C0DA 3VMNA 1BMWA 4BH7B 1XGQA 2VQ4A 4XP9L 3RVVC 5MEND 2WO3B 1TZOA 4N5EC 4G8GA 4WNQA 2OK0L 4YFLI 5KEZA 1JGVL 4MFHA 1HI6B 4ZFOL 2Z1PA 1ZT4A 2D8KA 4F1SA 1FVDB 4D9LH 3GSQB 5IR1B 5FGSA 4CU6A 4YDNA 5JDSA 2YXWA 1VF5C 2WLZA 5E5MA 4QRTB 2DYSB 3N55A 1KYOJ 4JZJA 3FCSA 3KG5A 1UM6H 4PYGA 1NSNH 5EU3A 4AZ8B 4W68A 3KPMB 1ORQB 1QFWM 4F5CA 4PU2A 1ZHBA 4FQQB 2DQJL 1NCNA 4G6KL 2W95A 5CEZH 5J1TC 4OJEH 4YMPA 3K8KA 1UENA 4B9KC 1W9XA 3NIFF 3TZVA 4QTIL 5IESL 4XPAH 1LDPL 2G9HB 2CDGB 1V3MA 1K4DB 3MJ7B 5SV3A 4B5ZA 3G5ZB 2A7BA 3VGGA 5IQ9A 2NY3D 3QDMD 3X17A 2AQ1A 4D0CA 1KJMB 3ILEA 5FGCE 2X3BA 2FZ3B 1SZNA 1TVHA 2H0FA 5FYKH 2ISDA 3MO1B 3VXUA 2D3JA 4FQJH 1KT2B 4WUUA 4AQ1C 2YD7A 2ZXCA 2WBJD 4LPVA 1OW0C 1R17A 1BAWA 5EBGA 2X4TA 1HCZA 4GSDL 4PJDF 3RY6C 2Y69B 3VVVA 2J5WA 3K5SA 2VW7A 2A6DB 3GZPA 2H0PA 1L9QA 1XB6A 3QUYA 4XAWH 4OUUA 1VGEL 4V1DA 4FXKB 3F04A 1CK0L 5EULV 3FO1B 2Q7YB 1J0JA 2FEEL 2QVIA 3R1GH 3SJVD 3HE7D 5DU7A 5F3HB 4X7DC 4G3YL 5E2TH 2PWDA 4NJAL 4JY5L 1ZAGA 3OKMA 3FN0L 1R24B 3KXFB 3QDAA 3CXDL 4H2CA 3ZHKA 2WUCH 2FQEA 4C56D 2DTMH 2XACC 3KEHA 3BDBA 2H2PD 4NM4L 3JTBA 5E6ZA 4YBHA 3WENA 4HK0B 1RUAL 1UJ3B 1J9SA 5EIVA 3VACA 3V95A 1MVUA 4WLCA 5E5UB 5GRZA 2BHYA 5L9DL 2LHAA 5CD5D 3ULUE 3ILPA 1GC1H 2B9BA 2CRMA 4IKLA 2BZ7A 4ZAKC 9CGTA 3B3IA 4XN2A 3LHPL 2VXSH 1MG3C 1X9LA 4FLSA 5D72H 2P52A 5JA9A 1RJZB 1HN1A 1HZHL 1U8QB 1S4IA 4FMKA 5F88A 1PS3A 3QNZB 1K5NA 4I8DA 4OD2B 5E8DH 3QYMA 4TVSa 4QLRA 1XB3A 2DIJA 4HWBL 2V9UA 5D55A 1EAQA 4HV8A 5JHBA 1TZIA 5KVDL 4XODA 3K2KA 3PRZA 3RDTC 4RAHA 1WBXA 4JPVH 3T2LA 1UVQA 3UDWA 2R69A 2UZIH 3GSQA 1ED3A 3U4BH 2XNAA 3REVB 5EZIH 2X28A 4YHKH 1O7VA 1EJ6A 4QHNB 2V5YA 4JRYE 2ZUQB 5I8KL 3FFCD 4ZTOH 1UA6H 3ZSTA 3VH8B 1JGUH 3ARSA 1ZGLA 3DURA 3DYPA 3FTXA 2QVTA 3GSOA 3IMWA 4JRYA 1DDHA 2A9MH 4POZC 1WFNA 4W9EC 1CGTA 1HAWA 5DUPH 4N0UB 3TLRA 1I53A 4GKOA 4JFEE 4U3CA 2PCFA 3IJEB 4RIRB 4U1LA 4TNVF 4LPCA 5AWNH 3REWB 3WLWC 3GSNH 1AKPA 3PV6B 2ZT9C 1HVXA 3ZYIA 3EJJX 4D94A 1FLRL 2FZ3A 2VSDA 4KV5E 1OSPH 4XCNA 2HH0H 3ALWA 4ZMTA 4GLRI 3L4ZA 1CD1A 4KUCD 1YJDC 3LEVL 3T0EC 2OTUB 1VRSA 4TRPH 4OLZH 3H9YA 4F33B 2CG9X 1B0RA 1DQLL 4JKLA 1U8MA 4N9GB 2MQCA 4RWYL 3H2QA 5IWLC 5AW8B 1JXFA 5AW1B 3B9AA 3OF6D 3V4UH 5GZOA 1KELL 1XGTB 2WZPD 5I1EH 3ZL4L 5IBLD 1NCIA 3QEQE 4TVPE 2L7JA 3MBWA 3BCDA 4CUCA 2D9CA 4HAKA 4GXUN 3TNMA 1BGXL 1QO3B 2ITDA 2VIRA 2YJQA 2ZX7A 4HWUA 4GBXB 3IMRA 4D0CB 3CZEA 4RFNB 5JIHA 1QPKA 2C7FA 2F9BT 3B5TA 3FTGA 2PYFA 3HNVH 4PJXB 5DJ6A 2IBBA 2X6UA 4UAOC 1IEHA 2G9HA 2W0LA 1FFNB 1L3NA 4IGBD 4J1UB 4G83A 4CDGC 2X4TB 4KJPC 2CQVA 4N2EA 5E4EC 4JPWL 2O5XH 1UA3A 3HG0A 5I2IA 1N2RA 4M4RB 3I6LE 3BT0A 4XX1G 4W9DC 1GIGL 5FYLH 5F9JB 2OCJA 3P2DA 1CF1A 1PPIA 3NSFA 1HXMA 2EH8L 2KZKA 4HIEA 1R3JB 3CMGA 3MGTA 4IGBB 3EJPA 2IAMD 2Q6WA 3VFMA 3NFPA 2AV1A 3QNFA 1IC4H 3TOPA 5LBSL 5JIDA 5JIMA 4JJOA 1W0VA 5KVEH 5E56A 2NXYB 1E6OL 12E8H 3IU4H 4W9LC 3I2CL 1QWNA 4HWBA 3X3GH 2LAAA 4QXTB 1IAIH 5KVGE 3IFLH 3MRPB 3P02A 1MCPL 2MRYA 5C0BD 3U2SB 4DPCX 5DZNA 1S7TB 4Y5VA 4NUMA 3T1WA 1NLDH 1T5XB 4PGDB 5E1IA 5D7LD 5FYLE 3RJDA 1IARB 1GY1A 1P5VA 1XWVA 4NQEB 3FJTA 1CE6A 1MI5B 1HCVA 3BN9D 2Q87A 2E7LA 3IETA 3AS0A 5ECJE 3B7RL 6FABH 1Q9WB 3EOYG 1JXKA 3P30H 2CM5A 2YPKA 4YPJA 2DQIH 4BHUI 5EORL 2K9UA 5AW0B 4H8WL 5C6TL 1IC0A 4S1QL 4EI0A 1AIFB 3OX8B 4G6FB 3QR1A 4IJ3B 4WFFD 3VXUD 2CXKA 3ZKQD 4DW2L 4F92B 4JANB 5ISZA 4PRPA 1QRNA 5AEAA 3QIWB 5TE6L 1AQKL 2XNAB 1SLUA 1PFOA 1LP9F 3IYLW 1XGZA 4JPKL 2WNWA 3S48A 1GXEA 1KV7A 1UWEH 3GZKA 3PP4L 3NCMA 4QIRA 4JRWA 1HX0A 1T6BX 4LIQL 3QIBC 1X44A 4YLCA 1F58H 2CLVB 2NX5A 3KPOA 4IOFD 2PWEA 4TM9A 3LB6C 1F3RB 1GGYA 1MFDL 1HH6B 2H7WA 1MLCA 3NJGA 2HLAB 1MHPH 4G5AA 2Q76B 2OI9C 3MLSL 3GMRB 2O1AA 4OZHE 4X5XB 4XN4A 4F37K 3VGAB 4JFVA 3S4SG 3LEXB 3QBTB 4MJ2A 4EDWH 4TS6A 5D71H 1J8HA 4NUJA 3D51A 3H8NA 4L1DA 3RDTB 4U1KA 3DLQR 3GMOB 4E9RA 1I1AD 1MFUA 1EZUA 1ROWA 4PWKA 4QCIB 4MRCA 4CMHC 4MQXC 5IQOA 3BVNB 1OGSA 3MOBH 4IRSD 1XR9B 4A37A 3IE4A 3O3AB 4WI4A 2EYRA 5E8EA 1E9PA 4ZO6A 3F84A 3HHSA 1I8IB 2NLJA 3LS4H 4FXGA 5CLYA 4HZAA 3L16A 1OF2A 5CZXC 5IJCC 5I76B 2OXHA 1WUZA 2OMZB 2YD6A 2ZPKL 4G59C 4KTGA 4J8RA 4YDJA 2ZUVA 4J23A 2DTML 3HZKB 2NXZC 4XXCA 4ZYKB 3ASNB 3ZKNC 4DUVA 2EVHA 4XNMA 5H4ZA 1B2WH 4EUPG 5BZDB 1KCUL 1U3HC 3CXFA 1KCBA 2ZCLL 1YN7A 4NM8L 2CDEB 4E2OA 4ERSH 3TYFB 2PABA 1D3CA 1YYLH 4AMWA 2OTPA 3IS1X 3TJEH 1WITA 1AOZA 3UPRA 5GRJH 1K6QH 2FNWA 1IEBA 2EO7A 4WENB 2YA2A 3CIAA 5IROA 5EC1A 1MCRA 4HJ0C 7FABH 2MKWA 3TV3L 3O2DL 3DGCR 3CD4A 3MV9B 1MLBB 3V0AC 2ERJB 5GRUL 4QWWC 5FYKL 1P0SE 3TEXA 3SPCA 1FGNH 3BGFC 2JJUA 1A7QH 1MN4A 3EO1A 3VFRA 3QUMB 1HNFA 2UUDH 1JZEA 4KAQL 2FIKB 5L4IA 5ESVA 3KPLB 5JOEA 1Z9NA 1D9KA 3KYKL 5CU9A 3RDJA 5JPNA 1MI5D 3CC5A 3MJ8A 3S3DB 3G04A 5F9OL 1WP6A 3IXTA 2IEPA 2DWTA 4GMTL 2G3NA 3TO2B 2JI2A 4HGKC 1QLRB 1E3FA 1NSNL 4FFWC 1FBIL 2ENJA 4LSVL 4Q9RL 1I7UA 2JWYA 3HB3B 5HGAB 1RK0A 5T5FH 3WEXB 1YEKL 4U31A 3KLDA 4JG1L 4JPIB 4DQOL 4XCCH 3TCTA 3EH1A 1G84A 1YC8A 1A25A 3RKPA 4DKFL 2MQ0A 4NPKA 1HINH 1W72B 1JZ6A 2ZCHL 5AAPA 2BXYA 2HJKA 4PRPB 1EHAA 4F2MB 1BEYL 2ZAHA 4LFHD 5JIKA 2X4OB 5IHLB 5KSUA 3TGXA 2P80D 4NLHA 3ULVE 2WCPA 43CAB 3UO1L 2XI9A 3WIHH 3TH2T 4DW2H 2V5SA 5EF2A 4O9HH 2JNZA 3BWAA 4M3KB 1OTUC 5AYQA 3ZL4H 1IIIA 3QPKA 4YE0A 4FXGB 4E9SA 1LE5A 4OFKA 2P5WB 3KPRD 1CMOA 2E75C 2VTFA 5J3HD 3MLYL 4GFTB 2YBGA 4RNRB 5IF0A 5MEPB 3OKKA 5GGQH 5J9PA 3CHPA 4KKNA 3PWNA 1J8HD 4K3JL 3CVIL 3QEQA 1Z7JA 3ULVH 3U7AA 4XXCC 2AKRA 4CNIB 3VXQB 4NQQA 4G6KH 4GI8A 5CEZL 3F58L 5J6GB 3CX5J 1JXDA 5GS3A 1R3LA 4AUYA 1XD0A 3IVKB 1R3KB 2V5TA 3NCCB 5EEXA 1URLA 2R23A 4Y19B 1CG9B 3IT8D 2YRPA 3JTSA 1AGDB 1T2XA 2FAUA 4YDLB 3QJHA 3MV9E 1IV8A 4IRJD 1A14L 4CN4A 1XIWB 3FB8A 2XXMB 4XAKE 3LSOB 2ZKHL 4H0GA 1RQ5A 4LF3A 3MFGB 5F89B 2OXHB 1IZJA 2EIEA 5L2KB 5I15L 1T0OA 1TQBB 5EBMA 1MI5E 1N0LA 4F2ME 3VWKA 3VXTA 2VXSL 1A8JH 1WFIA 4MWFA 1EANA 1TQVA 3HHSB 2ZWSA 3KPSE 1KCRH 2ARJA 2GSIB 2HFFA 4OM1L 5GRVL 4KKRA 4KHTH 4JPQA 4KJWD 3WAKA 1AG0A 3EYFA 4XNMB 4JZOB 4JFXB 2WLLB 5HGHB 1TENA 5HYQA 3CZNA 1OF2B 1AS6A 2ZPKH 1FE8H 4JFFB 2CDFA 3ARGC 1DQDH 3K5RA 4J8RB 2Z0UA 1WT5C 1NCBH 4FYQA 1OL0A 5FHAH 2YAOA 2NQDA 3COOA 3EF4A 1BAFL 4K7FA 3EOBB 5IV2A 3RGVD 1IEBB 1T2JA 3VFRB 4JO1H 4LB8A 4LCIL 1KFGA 4PJ6A 3O2WL 3QUML 5HBBA 1TMQA 1XZ0A 1RSFA 1UA6L 1SDAB 1U8LB 1MZZA 2EE2A 1J87A 4IK7A 1A7NL 1WF5A 3FYIB 5D1XA 4B3VA 3OJDB 2IG2L 4LASH 1W80A 4WUUE 5I75B 1JPSL 2KZWA 4MS6A 1FFQA 3L2NA 4NZTL 4UILH 3WLWD 3ZL1A 4ELDA 4UIMA 5HHOD 35C8H 2LTQB 1JIBA 1G7HA 3D4ZA 4GG6E 3N1GC 5HYEA 4Q6IA 1UOWA 2VL5B 1PD0A 4APQB 3MRRA 2K7PA 3HPJA 2NY1B 5JHDE 4H26B 2QPDB 2OX5A 3W0WB 4ZMQA 4LDCA 4GH7B 3DKHA 4NN7B 2WYIA 1H5BC 3JT0A 1E9OB 3BI9X 4RAVA 5LBSH 2FUTA 1OPGL 1UEYA 2BDNH 1G4MA 1YEGL 3GSWA 3S6CA 3S96A 1R34A 4K23H 2QMKA 1PYWB 4BRJA 3O6LH 3IFNH 3DUHA 2NW3B 2ZXWB 2NY3C 5KSAA 3VFPA 3K8MA 2AVFA 1NEPA 3MX0B 3UGEA 1IAKB 1HC1A 4YO0B 1SN5A 1OP4A 1REIA 1HQRA 3E0GA 3KYAA 4H5SB 1VIWA 5EIQA 1HI6A 2K7QA 1DVFB 1YMME 4NBYB 3R1GL 3LRKA 1FC2D 5SWZA 2A5UA 5J6HA 2I9LB 4JFPB 3BWAB 1AR2A 4KAQH 2NTSP 2WLMA 4MA3A 4IM8A 3T3PE 4F8NA 1S9VA 1BVLB 3UJJH 1IB5A 3ARBA 3C2AL 2D0FA 3CSTA 1YEJH 2F53D 3J2PA 4KKBD 3UTQA 3U46B 5E00A 3BQUC 3NVQA 3U9UB 2NUTA 3GHBL 4IRZA 1PIFA 4GQQA 3L1FA 5HI3C 3SKMB 2OSWA 1XGRA 4PG2A 4Z5RA 3DWTA 4IU2A 1E4XI 2QFRA 2VISA 2YQ3A 3DX4A 5C0GB 2D3NA 4OSUL 3HC3L 5JHDB 4PN6A 3CVHL 3FRUB 2FX7H 4YAQA 3QZMA 4HFUH 2R56H 3OB0H 2VNCA 3LKNB 1E5ZA 2YAEA 1TEGA 5I0WA 2FX9H 1G9MC 1GZPA 1GKEA 2WSKA 3TZVD 3O6KL 5IWLA 2XXFA 2QQKL 3KPRE 4NHUA 4XC3L 4BDVB 2HKFH 4OLWH 4UT7H 3GSXB 4TLSA 1DQJB 1OOWA 2FX8H 4PM1A 2OZ4A 1R3KA 5F7EH 1ZLVK 2OSYA 3INUH 1U3YA 3UMNA 4PP1C 3HHMA 5GGRY 3LNDA 4HJSA 2R39A 1A4KB 1TFPA 1FYTA 3T0XA 2RTTA 1NFAA 3VXRB 1A6ZA 2VUOA 1JGUL 1WAEA 3CPLB 1J12A 1INDH 2BSRA 2CO6A 3IJ7A 5AL8A 1USZA 1X5JA 2VN3A 3RFZA 3TIDA 4G43B 3WLBA 3ZMEA 5T8IA 1NMBH 4DVRH 3KNBA 2TRYA 4X6DF 2C26A 4OM1H 5K9QG 1CT8A 3EYOB 5IBTL 2VM4A 4H8WC 1FV1A 4N4YB 3MNZB 4L8BB 5BRQA 1U41A 4PAZA 1WJ3A 1D7FA 3O11B 5IKCA 2Y7QB 3L9RB 4X4ME 4CVZA 2P9RA 2KMWA 1KEGH 3LZNA 4KX9A 2CDFB 5CAYB 4UNUA 1ASPA 1M7IA 3GSWB 1BAFH 3S96B 2FSDA 1MFDH 1ZTXH 3WKYA 2VR5A 1OP5K 5C92A 4MQ7A 2NW3A 4L8SB 1E28B 4XBPA 5KANG 3NACL 1N7MH 4UDUB 3UTSE 4Z77A 1KXVC 3TBYA 1E4WH 4LBEB 3WKPA 3BE1L 5F3HA 1CDUA 3AB0C 1C7TA 1SYSB 4UCFA 4U1SA 3VXUE 5DHMC 1CU4H 1YNTF 1ZV5A 4HV8B 4P07A 1KGWA 1ZD6A 2NY0D 2XVGA 1SPDA 5E2VL 4IMKA 3BPNB 4U3HA 4Z3HA 5J6HB 2ICWJ 3LAFA 5D2NC 1UKSA 1UXSA 3AQZA 4LSSH 4X8JB 2K70A 4PJFE 3B6SA 1MVUB 3EAKA 5EIIA 4WFHD 5I8CA 1ZVSA 2EDLA 4ZW5A 1DUYA 2IAAC 3BW9B 2IAMC 2XZCH 2A0LD 2J7LA 3H9ZA 3VXRE 3KDPB 1DJWA 2V5MA 4IBLT 3RAJH 2XN9A 5EU6B 1LNUA 3MJGX 4EUPH 5F1IB 3GJEA 4AM0A 2CCLA 4CKQA 1P5UB 4IW4C 4ZUVA 4OT1L 4DJMA 5C0RL 4QWWD 2CUAA 2GEQA 1SN0A 2CA3A 4RAVB 4Q2ZA 1GL4B 3Q5TA 2B4CH 3FU0A 1U91A 3EW3B 1F3JB 1PQZA 5DD5H 1A3LL 4A66A 3ZN6A 3M86A 4TLUA 2I69A 1UOLA 1A7RH 2FJGB 3POCA 3QUYC 4XHJC 1EA9C 4AIZB 5C9KA 2XV0A 1QEWA 1XT5A 2OXGA 4ZPTA 1C08A 4BDVA 1W16A 1OW0A 1UASA 3D2UA 4NRZB 2WQAA 1IM9B 1EO8H 1ZA6B 3T4YB 4MXQC 5I30L 1UWGH 3WHXB 4GG6F 3QCUH 2Y5TA 2Y5QA 1XGRB 1I7TA 2LE9A 1NGQH 4GKSA 4XC3H 1AC6A 1LGVA 1QNZH 5DEZA 4BZ2L 3HHRB 5HJDA 1NCWL 3IPEA 4HVBA 5ICZB 3L81A 2DWYA 4AMKL 2PCXA 3WKNA 2HG5A 5CFAA 2NX5E 5LGHL 4FZEL 1LLAA 4Y4FA 2YRLA 3FQ1A 4MA8L 1N3NB 4JO2H 3V0FA 3JWDL 3V9CA 4OSUH 3FTWA 3T8XA 1NM4A 4JX0A 3L5WB 4NHUB 3GPSA 5JW4R 4FGMA 3WNLA 3PU7A 5LGJA 3MA9L 4AYDC 4Y2NA 5L8KB 4PV9B 2F1EA 4XBGB 3HZ3A 4CU8A 4YHNB 2UY6A 1GSKA 5GIRA 4F7KA 3B8SA 4UAHA 3A6CH 3LKRB 4KK8C 3SBPA 4Y5YB 2BVYA 3GJFH 4AC4A 4XWGL 1V7ML 2WQVA 1ZTMA 4AT6A 1WZMA 5C0BA 5IP4A 2OBGA 2VIRB 4A68A 2VXVH 1HXKA 1RY7B 3E3QC 4PJGE 3O4LB 4NBXB 2KI6A 3NCWA 4K7PL 5TDOA 4WO4B 2MPVA 3WLBB 5HD8D 2ZSVA 2EP6A 4LKCA 1MCLA 2H32A 3DETC 4LCYA 4WI0B 5L88L 5E1QA 4ZAKB 4QXTA 1FVCB 4F7TB 3S36H 3GB7B 3B7TA 3EO0B 1BXUA 2GUOA 1F02I 1SOKA 4YX2L 2CO7A 5J1SC 5CJ8A 2HRPH 1SJEA 3DUUB 1LO2H 1RU9L 4DNLA 3RLSA 5DK2A 1OAXL 1CLZH 3T1FB 3O9WC 5T1KD 5G2NA 5JQ6L 4LSRH 3VYPA 2W5PA 4OQTH 3LXBA 4QRUB 1WZAA 2VLLB 3FBKA 2WXPA 4LHUB 3GSRB 5D5ME 5BXFB 4QRSA 4XX1E 2J6WA 5CGBA 3K6FA 4PJ8C 5D2LB 5HP5A 4X6DB 5H94A 5KS9A 2A73A 3W5NA 2VW4A 3MZTA 2PW1A 1BYPA 2EADA 5AVSB 3HN3A 2OSLA 4DZBB 1DEEA 3CFJA 2ZF9A 1JVKA 2D4FA 4Q6IC 4F15B 1W8EA 2XV6B 2OMWB 4BSVA 3IAGC 1MW3A 2OQJB 4MNQE 4BK5C 2NX5D 5CGTA 4U1SB 4OLXH 2FDBP 1HOCA 2E76C 3ALXA 3CFDB 3HKFA 4AQ1B 4DVBB 4DUWA 4P23A 1MF2L 1D5BA 1X7SA 3G9VA 1KGCD 3VFWA 2WN2A 3CVCA 1WBZA 2FSEB 5I18H 1MAMH 4JN2A 4LHQB 5CEXB 3KS0J 1MCWW 2PNDA 4NNYA 1NCHA 1MJJA 3TNNB 5JLZB 2X6VA 4G82A 1FAIH 4ACTA 4BH7A 1M6OA 4YSAA 2W0FA 2B2XH 1IUZA 3VMPA 4FNPA 4R6UA 2IGFL 1B6DA 1EFQA 3JUZA 4KKLC 2AVGA 1NCBL 1O6VA 1DQTA 1BG9A 1WO2A 3CDZA 3Q43A 4CVXA 2F54E 1WT5A 3W37A 4FZ8H 2VXUL 3FTUA 4ZPTB 1QX1A 4PI2A 1GOGA 1GVIA 2NY0C 4HUNB 5GS1A 2H26B 4GPVA 5CLTA 3QRFM 1E65A 3VQMA 4M7ZC 1KGXA 3TO4D 3CH1B 5HHOA 2EEDA 3BIAX 2OL3B 4J3OD 2W88A 5CILL 1SY6A 3GGWB 2X2UA 3FT4A 2IDCA 3QHZH 4NKIL 3QPXH 2HLAA 4AIZA 4EXPX 2IWFA 4LRIA 2FWOA 4OD3L 4M29A 5T5NG 4BFIA 4ODTL 4OBRA 4PB9L 3VFTB 4HIIA 4ZNCD 1DP0A 4H0HB 4OCYL 3NA4A 1Y18B 5C0EB 1YEJL 2DDQL 1GRWA 1MCKA 1MW1A 3ZE1F 2RQ8A 2V17L 3FQXB 3ZE2E 2DIEA 1CFNB 4P4KC 3RGVA 5JQIB 3NP3A 1DLHB 1NC2A 1E8XA 2MCAA 5B39B 3VFNB 4NENB 4P2QB 5EOTA 5JMRA 2PCPA 5HYJE 1EPFA 1JI2A 1VFBB 3NJLA 2WAHA 4L8SC 2ZE0A 2NR6A 2OP4H 3MLTB 4BQ8A 1BOGB 4PBDA 2ED8A 4DP7X 3W9DA 3ULVF 1CGWA 3F65A 5L8JB 5D5MB 1MFEL 3NA9H 4OI8A 5D70H 2ZWZA 5L7XL 3GHEL 2ZKWA 2Y7OA 3IDGB 4YBQD 5AALA 4LHUA 3HC0A 1KNOA 2A0LC 2FUQA 2DEXX 3AACA 3AY4A 4WWKA 3ZQXA 5JW5B 4ETQB 5J0BA 3IFOB 4TQEH 3SQOL 1OALA 2J1XA 4NN6C 5BO1H 1T2QH 1ES0A 1SM3H 4PP2A 1FZJB 2MFNA 5I73B 3WNIA 4XP1L 1OANA 2F7QA 3OWEA 4ZOAA 1T20B 4N8CH 3UERA 4Y0GA 2RIKA 3JT2A 2HT4C 4ENEC 2ADYA 4FXLA 1JI1A 3IFLL 5TTRA 1RZFH 2HYMA 3OKMB 4P3DB 1TO4A 1B0WA 4FLHA 2QZQA 3S3SA 1TVHB 5IJKA 2H32B 2ZYSA 1X5YA 5IESH 2IADA 2HJLA 3IS0X 1T4WA 4UYPA 3FKUS 2DQTL 3KBFA 2OZ4H 5E99L 3RB7A 3KGUA 1DJSA 2WBJA 5CXPA 5D1QE 4OCLC 4KKBC 1WLHA 4FQ1H 1MJUH 2IGTA 4MNGE 3M8OL 3WNPA 1S9XA 3FF7A 3QCTL 4ICWA 4JQVA 1CVSC 4DSYA 5DRWA 3BFQG 3FUFA 3SGKC 2K8QA 3GMQB 4AG4L 3WIIH 2Y36H 1CURA 4JBSA 3RTQA 4P46C 3IWUA 3S88H 4L8DB 4N28A 1T7ZA 1IGYA 4P4RB 1PFCA 3FFDB 5HHOB 4LCCA 2VDQB 2XOTA 3V0GA 2XBZA 4UQ2A 1MAKA 1NAMA 4GRWB 4FZ8L 4W9JC 3GK8H 4YHKL 3VE0B 5CJ5A 2AJSL 2AXJA 4PWEA 3VRLF 2HTKC 5JYMA 1SJVA 1HILB 4G5ZH 1FNLA 1H15A 4HWZB 2P45B 3BP6A 4MRBA 4Z7OF 3FUMA 4ZUUA 3FO2B 4XXWC 2J57A 3EG9A 4IRZL 4NKIH 3FQTB 2BP5M 4YSQA 4H8UA 3MXVH 1U4EA 1FAIL 2HA1A 1MCDA 3SGJC 3X3FH 1O7DE 1F8TL 1JK8B 4WI2A 2YGPA 4RVBA 3LDBB 1LILA 5A7BA 1ET8A 1WRFA 5CN1A 1Z5YD 3Q0HA 1YEEH 3MLRH 4QRBA 4E42B 3L3IB 5KBKA 2OW6A 1N18A 5EBWB 2PCFB 3I9IA 1IM3A 1BFOB 1X9QA 1L0QA 5DHYA 3BH9B 3VGFA 1MHCB 3R19A 4JHBA 5FHBH 4K71B 3TH4T 1KLGB 3TONA 1B4TA 3C09C 5FFGA 3BZFB 5DMKA 2V33A 4OJYA 2AEOA 2WC7A 3ARRA 1E43A 3C6EA 5AW9B 3ZHFA 3GEWB 3CXDH 3NN8B 5C0EA 3NCBB 4YHPA 3SDCB 4EUPB 1M53A 3FQXA 3W0WD 2Q9OA 1XIWD 1NKOA 1AQ8A 1CXHA 2BSTB 4AITA 1JF1B 1NCAH 3F7QA 5J89A 5D1ZD 1J5IA 3H42L 4ODUB 4N24A 5F72S 4YDKH 3TBBA 4EPSA 2HX8A 3RL2A 1SVZA 2YQ2A 3SKJL 4OZHB 1TJGH 4GBXA 3QUZC 1NAML 3CH8A 4NUQA 5I6PA 3VWKD 4FFVC 2XHNA 3VNYA 2Q2EB 5LCVL 4ODWB 4QXVA 5I8EA 4NZFA 4XPGH 3Q2CA 3VXSA 3ECQA 4M8UA 3K46A 1HQ4A 1NQBA 4JPWH 2BHZA 2EXWC 4E41B 1O0VA 4N87A 4UBDD 4POZD 3TFBA 3KPQA 4KZ0A 4L4VD 5C0AA 2AFNA 4AI7A 5EF3A 5AOZA 4FN0A 4X5LA 3P30L 4UTCA 1T6VN 1YC7A 4NI6A 2L7QA 4MXQD 5C0JB 4RMQA 1DBBL 3T4AC 2XV3A 3HG3A 2UX6A 3FFDA 2AJZA 4PV1C 4UV4L 3FH7A 4OLYL 4C8XA 5CN3A 4XTRD 4O2EB 2JE8A 3GMPA 4PTTA 3RIFF 4DN3L 5LO7A 3TEZA 2QHLA 1CL7L 2DMHA 3VRIB 2AQTA 1S9KC 3VWJD 1JXGA 2Q8AH 1Z0MA 1N9PA 1KGIA 1BBJB 5KVEL 4LEEA 1TTAA 5MENA 1ZSDB 3APMA 4H20H 3MRIA 3RTQD 1EUTA 3H3BC 1T0NA 5F6HJ 2MH4A 3QEUB 1SHXA 4JZNB 4QY8A 4JFZL 3H9HA 4G7VL 2LU7A 1OWRM 4TUUA 5IW1B 3W57A 3WS3B 4C54A 1IGYB 4P4RA 4I3GA 1UWXK 1M57B 2DD8H 2HFGL 3ISWA 5DHYB 4MNHB 2NYKA 2F1AA 1S7SB 3GMQA 6FABL 2D7TL 2VDLB 5JO5B 2B1AH 3FQRA 3M45A 2X1PA 4Z7AA 3U1SH 3ZKXB 2YAPA 3TV8A 1SLWA 4LOUC 4OTXL 4B9YA 4S2SA 1TJIL 3PG2A 3A4DA 2BSDA 5JHDA 3DVIA 3VXPB 5MEQB 1JFQH 4IOIA 5DC2A 5SWZD 5I24A 3VJ6B 1EXHA 4H5SA 3I2CH 5BUPA 4Z7UA 5C08A 3PWLA 5FYJL 3ETBJ 3UJTL 4EZLA 2CH8A 1IQDA 3LZFH 4N90E 4TN9A 3ROOA 3CQQA 3W5MA 1AIFA 2EILB 4WQOA 4GKNB 5I1AA 3K6DA 2LFEA 4LEXL 4P5MA 1BFOA 2R4SH 1KELH 4MAYC 3MXVL 1OCWL 2MIZA 3GHEH 3KWWB 4JFEB 3S9DB 2IAMA 3NCEB 4P46D 1L7TH 2X1OA 4R90H 1F6AB 4MCYB 2V7NA 4JQIA 4LE8A 3UCRA 2ENPA 2IF7A 5EN3A 1SVCP 1J8SA 2BH0A 4PJBE 3L1GA 1ZK9A 3VXOB 1G6RL 5D6DC 5TD4A 1BZ9B 2DPKA 2ZXEB 3H3PH 1EEYB 1N64H 1PY4A 4PW4A 1QFOA 1WSST 1FQ9C 2V8LA 1GTNA 5AKSA 3TYFA 1JHTA 3FTSA 4LVEA 4R7DB 5D9SB 3A47A 3L3OB 2VERN 1GGBL 4G8IB 2UZYA 5KN5A 5F70A 1KYDA 2XKUA 4GRWF 2OYMA 3P3UA 3QDHA 3TIEB 1JF1A 1JPGB 2CKBB 3FQUA 2FR4A 4ZMAT 2ADFH 4KX8A 4O02A 3RL2B 1VCAA 3ARFC 1MCOL 2XVLA 4HHGA 4LP8A 5HHPB 2J88H 1FGVH 3S3JA 5BQ7A 4YGAB 2D2OA 3GLAA 1J1XH 4I3SH 4KXZH 4PUBL 4X6FB 5DMJB 1XL6A 4JFOB 3OL2A 1HNYA 1QMUA 3NK3A 5K69A 1O6TA 5KUMA 4M1DL 4QTHA 1SOSA 2PXYA 5DJYA 1DQVA 3STLB 1LDPH 1ZVSB 2G3MA 3E80A 4FTVD 2WQXA 4JE4B 3M7OA 1N4XH 1NGZB 5GSVB 1D5RA 1WYJA 1ZVYA 2JXMB 1KJ3H 4R4NC 1H6TA 4H8PA 4KY1H 2V7HB 1CICB 3X11A 1R19A 1QBBA 2G4GA 2J6EL 1ILSA 3CSFA 4HFUL 1GYAA 1R4XA 1H9VA 5INCB 4Z76A 4ZUVB 3A6BH 4EI5D 1ZV9A 2I25N 3EFDH 3P1VA 3VDCA 2Q2LA 4G80B 4J3BA 3QWOA 4X4MA 4M7LL 2F0CA 3F12A 2BPBA 4WK2B 1Z5LA 3UCQA 2CKBL 4ZRGA 1GW0A 4NXSA 1EGJH 3VRJA 1UUNA 5GRVK 2ZD0A 5FAAA 4CW1B 4QJ4B 4HYTB 4RQQA 5HYSB 5KAQF 2HT4D 1A1NB 1QA9A 1U8QA 1NBCA 4JFZH 2O6FA 4PWIA 1BJ1H 4X9GA 2R69L 2MOVA 3ARXA 3TEYA 2XXCB 2R0KL 5KYWA 4J8QA 2IOIA 4LLMA 4M61B 4YR6B 5TH2A 1MCWM 5D7EA 4DN3H 4JREB 4OFPA 2YBRA 4I9WD 1BM3H 4ANVA 4ABUA 35C8L 5B4MD 4A39A 4LVNB 4PCYA 2R1WA 2OA9A 1G7JB 5ECGA 3V8CA 5I1LA 4NERA 4MXWH 5MEPA 2AP2A 4MDIB 3ATBA 1LO4H 4Z7VB 2A4EA 3UTSB 3FQWA 4UU9A 2BIHA 2VR3A 4M1CC 5DLMH 3VXUB 3QZWG 3CLWA 4AUUA 4LARL 4QHPA 4TULL 3STBA 1B9KA 1TVBB 3OQRA 4TOYL 5J12C 4C59B 5LXGL 2P8PA 1F3DJ 2WNKA 5D7JC 5A2AA 3PWLB 1ZT4B 5AFAA 5CCKL 3PGFH 4PJFB 1YMMD 3S36X 5FDWB 4QRTA 1YMMB 5DMYA 3LS5H 2AK4B 4LDEB 1B6UA 2VZSA 4KJQD 4DOHE 3AU1B 4JHUA 1AGEA 1SJXA 3O6FC 1TKWB 5I8KH 2IXQB 3ARVA 3CLEH 3D0AA 2QGEA 2GSGB 3UJIH 3H9SD 4F1ZA 1KLUB 1MCSA 5TE7L 2G75A 5CP3A 1B90A 1DFBH 1FUNA 3MRFB 3TVMA 5KSVB 1EEZB 2PMZA 3DK0A 1HU8A 5TJWK 4OZIB 4PRHB 3ROLA 3CVHB 3U36B 3WD5L 4Y2DC 2XU9A 2EDDA 1E6JH 5E4EB 2FYYB 3CFEB 3DX8B 5FF6B 4KQ0A 3SO3C 4HCRH 3VU1A 2RBLA 3X13B 1MY5A 3P77B 4WWOA 5F7DB 5A2LH 3PGDA 4JL2A 1W8NA 2J8UE 2OS7A 3ZX1A 1UWXH 1WV7T 3JV0A 4CC4A 3D12B 3VUAA 2BP0A 2VDNB 3L4CA 1XTLA 4RWHA 1YAIA 5T5NF 1E4WL 1MCBA 1ECYA 1KJ3L 4LP4A 3H9SB 3FTYA 3APFA 3RU8H 4LLVB 1CYWA 4L3CB 3CHRA 2X10A 4RH4A 3PJNA 4PJCF 2F7IA 2J1WA 3HUJE 4JVUA 1XGYH 4N2OA 4XP9H 1SQ2N 2NZIA 1OPOA 3UG3A 4CW1A 5JPMA 5KSBE 2JJTA 5FECB 4KITB 1DUZB 5CSGA 1DO6A 2A6JA 3IU3A 2DQDH 3L6FA 2ESVB 4G7YL 4PREB 2XTJB 3MRLB 2FL5A 2Q1EA 3S8GB 1C8QA 1LO3H 2OX5B 3QIBB 3WNOA 3CDGA 4RCAA 1RULL 2G2PA 3WJJA 2I85A 2IPKA 5E95B 3P4OB 2XPGB 5IZ7A 3F58H 3STZA 1B4LA 3ZO0A 3GKWH 3S37L 5ITBH 4LBAA 2YSSA 2XQYK 3KR3H 5FKAB 4HS3A 1OCZB 4EN3C 1I3GL 2N56A 3IKCB 4U1LB 1DVZA 2JXMA 1OGAB 1ETA1 1OGTB 1YO4A 4GAYA 4KZDL 2ZKHH 3CHQA 4HCGA 1P4LB 3NQKA 1BQLL 4UMSA 2QSQA 4HKZB 1C8PA 5D1QA 3MR9A 4GO9A 4K2UH 4NLAA 3ELAT 3V0VA 2R27A 3P40A 3WN5A 4E9YA 2WOYA 4KVCH 4AW7A 5LAXA 3U46A 4Y16D 1TNMA 4U2ZA 2HT2D 1ZDSA 4XO3A 5AZEL 4D8PA 2C3GA 4YBQC 4J6IA 4L29A 2XTJC 4FNUA 4OAWB 3HR6A 1V3KA 3P0YH 4PRAB 4OUOA 1YEFH 1UZ6E 2LR4A 4BFIB 1U36A 5HYSA 1WGOA 1PF3A 2UVFA 1KN2H 4ZX4A 4JGJA 1IBGH 3QIWC 1MWAB 2YMTA 2P24A 3IJYA 4LCCC 5FCSH 3O2VL 2ZOOA 4WI9A 4C83B 5FFLA 2IXQA 1E8YA 2XWEA 3U9PH 1DDHB 1BPVA 4NCC2 4YGVB 4TKWA 4JN1L 3D52A 1EXUB 5TQ2L 4YUEH 1URZA 4KRPB 1YEGH 1N70A 5DD3L 3LH9A 4BQCA 5E08L 2Z7WA 5TFSH 3NFNA 3A22A 2AXFA 1QPPA 4Y4KD 1ZS2A 3VG9C 1MCHA 1CXFA 4DCQA 4OLVH 4V11A 2JQMA 4A2EA 4DP2X 1G7IA 2WWOA 2DM4A 3DX8A 5FF6A 4XZUB 2ADGA 2BVQA 2GAZA 2J1YA 3BKCL 1TVBA 4QTIH 5IT2L 5IUSA 4B9CA 3CVIH 3I3EA 3K80A 3NCFB 4KRMB 3ME0A 2LLLA 4LRIC 1F4WH 3D33A 1RIVH 5L2KE 3LKPB 2YPLD 3ILQC 4FADA 1BYNA 2BX5A 3MRFA 3EGDA 1XH1A 2Q7NA 3BWZA 3VXRA 1ZA3A 1FYHB 3H2PA 5KG9B 1I7RA 2ZCZA 3HBZA 5H37H 3RY4A 3SJVB 5GS1C 3E9UA 1BVZA 3FQYA 2DJMA 3UTZB 1IAOB 1ORSB 3GYRA 5ICXA 3IFNL 4GAJH 4PRHE 1PY9A 3MRLA 1UKQA 4KHXH 4FFYL 4YBLC 3G08B 1S9WA 3O81A 4X7SH 1Q0EA 4FEMA 4P2RD 4BELD 4C55A 4M7ZB 4J3XA 4OJAA 1WBYB 4PRHA 2WBJB 4OKDA 1YN7B 2N0MA 1NGXB 1AGCB 1I82A 1NBQA 4L1TA 3BQVA 2OMBA 4HIHA 4XPHL 2UXVA 1RZ8A 3AWFA 1T03H 5DHXB 3AGVA 4GSXA 2WZ0A 3E8UH 7TAAA 4I88A 4GAYB 1U3NA 1K4CA 4P23C 1FFPB 3QDMB 5DWPA 5E6YA 3U7YH 1BD2B 3JWOH 1PW3A 3MGTB 2ZP8A 3O3DA 5IB4A 5JIQA 1ROCA 3QE5A 4R90L 1YQVL 3GS0A 4QNPE 1GYUA 1L7TL 3MLZH 4JDTH 1XX9C 4FXGC 5EEZA 1G0YR 3ARFB 3GMMB 1OTSD 1XCWA 5HJ3A 4YXHH 1K8IA 4WI7A 4PVNA 3PXJA 4YHOL 5E8PA 2JJTC 2QMJA 2ZICA 4UOQA 4Y5XC 1NFDE 4XP6H 5D7JD 3V8OA 4ZUTA 5AW2B 5FUZH 1I8MB 3DO7B 2VLME 1E7UA 4ODHH 2Y23A 5ETUA 5FM5M 2X38A 3KGTA 4NRXA 4HG4K 2PPFA 1KYUA 3NJKA 4AXWA 1TCMA 1PAZA 1MHEB 3F85A 3D2TA 4NDMA 1WK0A 4JPVL 5CLZA 1IFHL 3BP4B 1QTSA 2R1XA 3VW3H 2B7DT 1ZT1B 3FL7A 4OI9A 1ZDQA 3FFOA 3GRWH 3QIUA 1DQIA 3VXNA 1JMXA 3HCVB 4NZUH 5I76A 1KTDA 5E51A 1KGYE 2BC4B 2WINA 3BIKA 4JVPA 2HWZH 3O3EB 4RDBA 1INDL 5B1KA 3T5WA 3ULAB 1TJHH 1UA7A 4YEFA 2IANA 4KROB 5TF1H 5CZRA 3KPPB 5IY5B 43CAA 3TVMC 5DRNB 1TUPA 3BEWB 4C57C 1NUNB 4JG0L 2XICA 3BH8B 2IH8A 3SD2A 4WEBL 3ZDWA 4QI3A 4W4OC 3RPIA 2GBAA 3Q3GB 4LCWA 4KU1A 1KBWA 2GKIA 2FHFA 3K71B 3UACA 5DLML 3WGUB 2W65B 4K55A 5K9QI 4DTGH 1OARL 4GFXA 2VXVL 5KBDA 1KB9K 5FOBA 4DK5A 4JM2D 4X0KB 1E4JA 1SUJA 4POUB 4QOKE 2HFEA 3PHQA 8FABA 4H7VA 3BZFA 4FMVA 1CXLA 4HC1A 1Q9LA 3QG6B 1SXZA 2NT1A 5B8CB 5D71L 2DBJA 4LRNL 1PAMA 3GI8H 3C5XA 1QTPA 3KPNA 1EK3A 2OMYA 1UYWH 2B20A 2BNQA 1BGXH 3II1A 5SWQA 4LSPH 1GPOH 3Q2LA 2HX7A 3DOSA 5AVWB 3RNKA 2EICA 1AO7D 2OMZA 3KW8A 4URKA 2E8YA 1NLDL 1F1GA 4D9QE 4KTDH 5C0AB 2BW4A 2GAZB 3L45A 4MMZC 5F89A 1II4E 1ZT7A 2I7OA 1UB6A 2XV2A 3DO3A 2J43A 1JZHA 1SOQA 3VG9B 4Z7IA 3CZFA 2MNWA 4N8UA 2F53A 1IAII 1W0WA 4FCAA 2FBRA 4BZ2H 3WFHB 5BV7C 2ZP0T 1NMCB 2W07B 1AZCA 3NEEA 4JFFA 4JLRA 1N6VA 2ZIDA 4IKJA 3PFUA 3RBSA 1XDTT 2LGNA 2LQRA 5E1AA 2DYPA 1NMAH 4WUKL 2QBWA 3NSXA 4L2LA 4AGOA 3AS1A 2ZJSL 4NRXB 3MREA 4GRWH 2APTA 1BBDL 4KK5D 3WG7B 4PTUB 3HE6B 2BNRE