1A4AA

Azurin mutant with met 121 replaced by his, ph 6.5 crystal form, data collected at 16 degrees celsius
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
129
Chain Sequence
AQCEATIESNDAMQYDLKEMVVDKSCKQFTVHLKHVGKMAKSAMGHNWVLTKEADKEGVATDGMNAGLAQDYVKAGDTRVIAHTKVIGGGESDSVTFDVSKLTPGEAYAYFCSFPGHWAMHKGTLKLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Rack-induced metal binding vs. flexibility: Met121His azurin crystal structures at different pH.
pubmed doi rcsb
source organism Achromobacter denitrificans
molecule tags Electron transport
total genus 29
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1a4aA00
4X4KA 3NJJA 2AFNA 4DP1X 4YSCA 1IKOP 1KDJA 1TEFA 3T6WA 3JT2A 1NINA 3TBCA 2CAKA 4YSQA 2IH8A 2GC7C 2EIKB 4E9QA 1ET7A 1KCBA 4HCIA 1F56A 1L9PA 3WNIA 3KW7A 1JERA 3C75A 3TASA 3QJQB 2MRYA 1WAEA 3FSWA 5I5JA 3ABGA 4FA7B 1E65A 2FNWA 2PPCA 4DP8X 1AS6A 2TSAA 2BZ7A 1ET5A 1AZNA 1SFDA 4AX3A 2HLEB 2QPEB 3FSAA 2VW4A 4G72B 3JTBA 3ASOB 1V54B 3X1EA 4AKOA 1MG2C 3NSCA 4A68A 3WKQA 2A3TA 4AI7A 1MZYA 3CVDA 2UX7A 2NRDA 4N4YB 1N68A 2XXGA 1GS8A 3QJSB 2BP0A 1B3IA 1SFHA 4DPAX 1RCYA 4YSUA 5LDUA 3NJGA 1X9UA 3FPYA 3TBBA 1E5ZA 1J9QA 2B08A 3L45A 3FQ1A 3PXLA 2JFCA 2XUWA 1URIA 2FQFA 3UADA 2HX8A 1PY0A 1JVLA 4KOCA 1NPNA 2PP7A 3KW8A 5PAZA 2OJ1A 3FU8A 2YAHA 2YAFA 2ZWNA 2WO2B 4YSOA 3QJTB 1A65A 7PAZA 3OD3A 2Q5BA 2JKWA 3CZUB 2J5WA 3WIAA 1J9RA 4HZ1A 3V9CA 4F2EA 2Y69B 1E30A 3OMNB 7PCYA 2BP0B 3QJVB 4KOBA 4YL4A 6PCYA 3N2JA 4RH4A 2PPDA 1ZV2A 4F2FA 5I6LA 1JOIA 1KBVA 2LLNA 3AY2A 2BWIA 2VW7A 4E9XA 4QKTA 3QQXA 1SDDA 1ASPA 1HFUA 1PMYA 2CCWA 5B7MA 2XLLA 3TA4D 4NAJA 3CDZA 2UXTA 8PAZA 4M4RB 2GC4C 4E9YA 1KCWA 3FPXA 1WA2X 2IWKA 2YAOA 2P80A 2YAEA 4MFHA 4ZK8A 1E5YA 1IBYA 5D4IA 2EIMB 1V55B 4DPBX 3X2QB 1JVOA 4NB7A 2RACA 2EIJB 4Q89A 5B7FA 4GP5B 4HHWA 2HX7A 4WTQA 1ETJA 1HAUA 2HRGA 3EH5B 3H4HA 3PLYA 5I28A 1SDDB 1KV7A 1BQRA 3NYKA 1DYZA 1E67A 2CBPA 2X88A 2XXFA 3CDZB 4GY4A 1GS7A 4G7RB 1PAZA 5FC9A 2HXAA 1MDAA 2DV6A 4G70B 2IWFA 4E9VA 3MX0B 1L9OA 1GW0A 3AG3B 2FQDA 1MG3C 1WS8A 3D12B 3FU9A 9PCYA 1OF0A 2W88A 2XVBA 2AZAA 4UANA 2HX9A 5B1JC 1TEGA 2ZONA 3MBWB 4GXFA 1T5KA 1SF5A 4KO9A 1ZIBA 5PCYA 3NJKA 2MTAA 2XX1A 1AG0A 4YSAA 1M57B 4KO7A 3ZIYA 3T6XA 1BXVA 1GS6X 4A67A 2QDWA 4DP9X 3EF4A 4JHVA 1PNDA 1IBZA 4HALA 1JZJA 3SBQA 1PLCA 1J5CA 2BW4A 1W8EA 1X9RA 4UF7C 3UABA 2Y1AA 5A7EA 3SBPA 3EH3B 3GXUB 1JZGA 1DZ0A 1UATA 1ASQA 3AW5A 1AS8A 5TK4A 2IH9A 1AZBA 1NICA 3FSZA 2IDQA 3NJLA 4DP4X 1M56B 2PPEA 3ZDWA 1AANA 1L9TA 1AIZA 3OM3B 2WSDA 3AG4B 1PZBA 2IWEA 5D4HA 2P80D 2Q9OA 1W6WA 4BXSV 1OV8A 2EINB 1ZIAA 2H3XC 2YAQA 1MZZA 4N8UA 3DIVA 3NJFA 3IN0A 5E9NA 2HRHA 1KDIA 4AZUA 3T6VA 3AG1B 1NIDA 3NJNA 1XB6A 5B3SB 1VLXA 5AFAA 1NTDA 4F7KA 2XV3A 4E9TA 2AVFA 5I5MA 4KNTA 3H56A 1GR7A 1QHQA 3QJUB 3FT0A 3X1FA 1EHKB 1RZQA 2XU9A 2BP8A 2YQBA 3PAVA 4G7QB 2PCYA 3FYIB 2FJSA 1XMEB 1AS7A 1A4AA 3NSDA 1FA4A 1NWOA 1PCSA 3S8GB 1BEXA 1A8ZA 4HHGA 2ZOOA 4A2DA 1R1CA 2XWZA 3HEIB 1JZFA 4DP2X 4CSZA 4K9JA 4BK5C 1BXAA 1JZHA 1PLAA 3PCYA 4HAKA 4FAAB 1HAWA 2DYRB 4GYBA 2I7SA 4JHUA 2YAMA 2DWSA 1EZLA 2DY2A 3ASNB 2BP8B 3OQRA 1SHWA 1WA0X 2FT7A 1ADWA 3GYRA 3EH4B 2OV0A 3WG7B 1BYOA 2QDVA 4P5SA 3RYMA 4L0PB 2FT8A 1ZDQA 3PAZA 3ZX1A 2OCCB 1OE3A 1OCRB 4G71B 4TXVB 1JXDA 2PP8A 2N0MA 5I6MA 2FT6A 1J9SA 1SJMA 4G7SB 4BXVA 3ABKB 2FQEA 1W6LA 1OE2A 1PZAA 5B1BB 1KYAA 2BO0A 3BVDB 1BYPA 2R7EA 4AKQA 1OCZB 1V10A 1WS7A 2H47C 2PP9A 3FQYA 4YSTA 5AKRA 4A2HA 5B1KA 2I85A 1IUZA 3UGEA 4DPCX 1JXFA 3IE9A 3WKPA 2J57A 4YSDA 1A3ZA 3X1GA 3DKHA 3OMIB 2BWDA 2VMJA 4BWWA 3SQRA 2J56A 3CVBA 3UAEA 1XB8A 2ZXWB 4AKPA 3CG8A 1ILSA 1CC3A 1TU2A 2E86A 2R7EB 3CVCA 1L9RA 3H4FA 3IEAA 4A2FA 5I5IA 2IAAC 1SHXA 2AZUA 4A2GA 1ZDSA 2VSKB 3FSVA 3S3BB 1A4BA 4E9WA 5I6OA 5B1JA 1OCCB 1AZCA 4QLWA 1QLEB 4W1TA 3IN2A 5I6NA 3IBOA 2YXWA 1NIAA 2CUAA 5IY5B 4E9SA 3AG2B 4W9ZA 4YSRA 1WA1X 5I6KA 3UACA 1BXUA 3OMAB 3AZUA 2FWLB 1JXGA 5B1AB 2X87A 4M3HA 4GP8B 3PPSA 4KO6A 3ERXA 1AR1B 3FQ2A 2VSMB 1M9WA 2WO3B 2FQGA 2B3IA 3V9EA 1OOWA 3X1NA 2XX0A 4YVNA 6PAZA 4A66A 1JZIA 2UXVA 1ET8A 3ABMB 3QPKA 3TU6A 3NSFA 3UAAA 3NSYA 3EHBB 1KBWA 5TK2A 4BWTA 2QPDB 2YARA 1AQ8A 3FS9A 1NIBA 5D4JA 5F7AA 4DP5X 2GB2A 4YVUA 3T71A 4DP6X 5ANHA 1ID2A 1RKRA 1L9QA 5F7BA 3NP3A 2GBAA 2UXGA 1NDTA 2W8CA 4BDVA 2I7OA 1GYCA 5AZUA 3NJIA 1ZPUA 1A4CA 2XV2A 2DYSB 3HB3B 1AG6A 4P5RA 3NJHA 2GIMA 3S8FB 3N55A 5I6PA 1BQKA 1CYWA 1NZRA 1NIFA 2H5UA 2TSBA 2IDFA 2YAPA 3G5WA 3BQVA 1OCOB 2PPFA 4HCFA 3SBRA 3S3CB 4KO5A 2VN3A 3GDCA 1GY2A 2FTAA 2PCFA 2GSMB 3FYEB 4YSEA 4UAHA 4BDVB 3WNJA 1SF3A 1ASOA 1FWXA 2IDUA 4HIPA 4PAZA 3FU7A 4NERA 2EILB 4E9RA 2IDSA 1NIEA 3T9WA 1PNCA 1AZRA 1AOZA 4GP4B 1ILUA 1YLBB 1XB3A 2XYBA 4PCYA 1I53A 2CALA 2HZHA 2QT6A 1GSKA 3QJRB 5B7EA 1QNIA 1FFTB 5I26A 2CJ3A 3ZBMA 1AAJA 4Q8BA 1CUOA 3NP4A 3T6ZA 2IDTA 3ABLB 1JZEA 2J55A 4JKNA 1PF3A 2GI0A 4EF3A 3FU7B 1NWPA 4KNUA 2PLTA 2XV0A 1BAWA 4YSPA 1J5DA 1NPJA 1IC0A 1GY1A 2BW5A 2YXVA 1J9TA 4DP0X 1AZUA 2DWTA 1CURA 2BHFA 4CSPA 4YSSA 1RZPA 2GHZA 3PAUA 5EHFA 2VM3A 4ENZA 1PLBA 1PZCA 1BQ5A 3X1BA 4A2EA 1CYXA 3U25A 2JXMA 4BWUA 4WKXA 2UX6A 3WI9A 1TKWA 2PPAA 1L9SA 1KGYE 4KNSA 4HCGA 1OE1A 1SNRA 2VW6A 2AANA 3NJMA 2UXFA 3NT0A 2BZCA 1AACA 4DP7X 3S3DB 2VM4A 3DTUB 1N70A
chains in the Genus database with same CATH superfamily
3KPNA 2NZ1A 2IH3B 4PRIA 5D93B 5JR1H 2HMIC 1JBJA 2HKFL 2DQEL 1IKOP 4QRTB 5DYFA 1R0AH 3MNZB 1VFAB 3HN5A 5E5RB 1NCOA 5F44A 1FDLL 1S9VB 4HS6A 2CAKA 5HJGA 3WFHA 4L8SA 4LFHG 3L5HA 5IHZB 4Z7NE 5J0BA 1NH6A 1JGUH 3WNIA 3D0AA 2DRUA 3MUZ1 1OXYA 4X7SL 5E2VH 4CMMB 4AMWA 5LBGA 3PABB 4LL1A 3EGSB 4WFED 1MW1A 3BUQA 4R4NC 2BY1A 4ZYKA 2V5YA 4JG5A 4ZO7A 1AZNA 3UPRB 1QNZH 3F6IA 1TIUA 2OXGA 5JYLA 1ZMYA 1PDKB 1MG2C 4GI6A 1EHXA 4A68A 3KGSA 3NCYS 3D85D 4LSDA 4KKBC 4LNRB 3HPLB 3FFCD 5FWRA 3BO8B 3GSVB 4YUEL 5EA0L 3VXRA 2XXGA 2VLJB 3KWXA 1A7NH 4MQ7A 4ODSH 4HPOL 2Y6TE 1NGPH 2EIZB 4K23L 2HWZL 3P1VA 5EEZA 2HJFB 2PABA 2G9HA 4R2GD 4JFED 3M07A 5DJ0A 3FQ1A 1HCZA 4Y2DB 3UTSA 3W2DL 2I07B 3V4PL 2H32H 3FO0L 1HSAB 4NC2B 2WLLB 1FCGA 4BSVB 3IDGA 4ABVA 4L2YA 2YN3A 1J0ZA 1I1RA 3ECUA 5DVOA 3IJEB 2YXFA 4L48A 2VL4A 3ML9A 1XZ0A 2C4FT 4G7YH 4RCAA 4BUGA 3QVAA 4WSJA 4ANKA 3TVMD 4FQLH 1E30A 1N0LB 2BP0B 4HJTA 4MS8C 4Z3TA 4DKAA 6PCYA 3IXTA 4KGJA 2ZXBA 4Y4HB 3KPSD 3Q7JA 4KFZC 4HFWA 4UNUA 2A1WL 2JJWA 1SHSA 3VXOA 1PG7H 1XCQB 1RQ5A 4WTXA 2NY2C 4ZSOA 2B20A 3H3PL 2W81C 2P5WE 4FXGA 4CU8A 5BVPH 4DH2A 1QWNA 5E00B 2E9BA 1QSVA 4PGCA 2FEDD 5TPWH 3U2JA 1M6OB 2BC4B 1ND0A 2IBGA 3L95A 1CDGA 1E5YA 1SHMA 4NB7A 2C9VA 1A3LH 5CAYB 4C83A 1ZKAA 4Z7IA 4BE5A 2X4SA 3HS9A 1IU1A 3HTLX 4HP5A 3NH7L 1FPTL 1NAML 3PWNB 5H37G 3SOTA 1HAUA 2H6PB 2WUBH 4LPVA 1S4IA 3X13B 2VMEA 4GW5A 4PWJA 4FZEH 5I28A 2WLKA 3FH5A 1QSEB 2OMUB 5DJYB 1DQLL 4UQ3B 4WK0B 4U1KB 4FQXC 5J6GB 2AAAA 5C6TL 1K4DB 1QR4A 2WHVA 5JDSB 4HEPG 1IE5A 4G70B 1UCBL 4Q2ZB 1JV2B 4JGNA 4H8UA 1A2YA 1TVDA 2MFNA 4GRWH 4JGUA 5TDPA 1Z0MA 3FO1B 1OF0A 2XVBA 1FNHA 2XNAB 1G1YA 1NMAH 2P5EA 1MN4A 3LSOB 1TEGA 1UM6H 4H0LC 1O6VA 5D5MF 2W5PA 3DX2A 4F8QA 4POYA 2CA4A 3T2OA 4CVXB 2K6ZA 4KX8A 2N56A 3ARBC 3KWWB 4JDZA 1IAKB 4F33A 3O3BA 3QIBC 12E8H 4DVRH 3NJKA 3OPUA 5KJ4A 2P1YA 1TJMA 1R24A 2UVEA 2VLRB 3EFDH 1U2YA 4JVUA 4PVLA 2BVQB 5EU5A 5FV1L 1MVYA 3LRSB 1IBZA 3IGAB 3C60B 3FBQA 1PLCA 3E8UH 5E6UB 1NCNA 4MNQD 3UYRH 3U2SB 3LEVL 1KWGA 3QZWB 3VFGL 5AW7B 1S7TA 4GG6E 1RLWA 5AOLA 5MERB 4B9FA 5C0AE 4XC1H 3FC8A 4PJBF 4JEGB 5DHVA 4MX7A 2WAHA 4TNVK 1MSPA 5EIIA 5CCKL 4KUCF 4JFDE 2AJUH 1REIA 4PW9A 2YA0A 1J5HA 1H0DB 4HH9A 3LS4L 3S2CA 2YD0A 1JZ5A 4N6QA 1KBGH 2IQ9H 2QELA 3CQFA 4PRHE 1FF5A 1MCRA 4KV5E 1J12A 5CN2A 1J5OH 5CZXC 4BINA 4N5EC 4M7ZC 4KQ3L 5EEXA 3NJNA 2P47B 2Q7YB 1WC7A 2DQ6A 2KI6A 1TQBB 1A7BA 2Z35B 3AU0A 3HLKA 3P2DA 4PRPB 3T5WA 3BP6B 3LMJH 4JRYE 1SJVA 5HHQA 1LMIA 3MBXH 2R2BA 4KNTA 3FHAA 5I8CB 2MCMA 5DRZA 5I1EH 3EO9L 3FQRB 5IW6B 2CUIA 4HGWA 3P54A 4AGMA 4IOFC 1JPST 5EU4A 2Q76A 4MCYB 1YNKL 3GIVA 3VVWA 1WZ1H 2AJVH 3CVHB 1UJ3A 2V17H 1BEXA 5TQ2H 4XBPA 3V8CA 3KLHD 2BY0A 3D06A 2OZNA 3EYFB 3WELA 1EH9A 1R1CA 4IU2B 4RGND 1CE1L 1XAUA 5CGYD 3W9EA 1MJ8L 1UT2A 1CGSH 1L0PA 3DMMC 1SXZA 4M5YH 1LO4H 4PB9H 1JZHA 1WHPA 5K59E 4UQEA 5J9PB 3WNMA 2E9GA 4FTVB 1XDTT 2LHAA 4LDOB 1OAKH 3AM8C 4ZMWA 3W0WA 2FL5B 1OGTA 3JWOL 2VISB 3ZN6A 4F7CB 5LKNA 3D5OF 1UXWB 2VDKB 4JO3H 3EOTH 4CADB 1G9ML 3Q06A 3FT4A 2AJ3A 1LO3H 1NCBH 1SUJA 3L1EA 5G2NA 1T3FB 1U3HA 4K5LA 4AH2A 2HPOA 2A99A 2E27H 5BQ7B 4N85A 2X2YA 2F8VA 1SBSH 2AK4A 3MUGA 4FFYA 1EFQA 1XGUA 2EDNA 4LP8A 2VAJA 2ZF9A 4RNRA 3ZHDA 1KCUL 4PWIA 3EZJB 3MXVL 4G71B 4TOYL 4X4ZA 1DUZA 2CHXA 1IILE 1SOSA 4KRPB 3P73B 1SOKA 2R2HB 3APFA 3HG3A 4G7SB 4LCWB 3L3GB 2WSPA 2JB5L 1Z2KA 3IJSB 4G6AD 5HDBE 5B1BB 4M48H 3CZGA 1YEDA 3BVDB 3L3HB 4LLQB 4M1GL 4HFUH 2Y5TA 2PP9A 4L2LA 1UADC 1S9KC 4IKKA 4IRJD 1AQDA 2F6AA 3IAQA 4WJKB 1RZKH 1XCXA 2IXQB 1CTNA 1IUZA 2NXZD 4GO6B 3DX9B 4GLRH 2I24N 5F7EH 3MRQA 2J6WA 1I8LC 4Q7DA 1PKQA 3EOBA 3UX9B 3WKNA 4JPWH 3JQOB 1P4BL 2D7MA 1LEGA 2AEPL 4ELMB 3BMWA 1NGYA 1VEMA 5B39G 1PGRB 4X6DA 5ID1B 4KH9A 3WTWA 3UTQB 1O6SA 2V3EA 3SPJA 4KZDH 3GB7A 5DK0B 5ECGA 5IHWA 1AGFA 1OB1B 3BT0A 2IAAC 1SHXA 1H8OA 2G3MA 4P07A 5KOMC 1ORSA 4OCWH 4TVPH 2KT6A 4EI5A 4QTHA 1AMXA 4WCYH 4XO3A 1N3NA 2EDTA 3FTYA 3I6KB 3NGBC 4U6HB 3UROR 1U21A 3OLEA 4Q9CA 2X3CA 4LMQI 3AGVA 1C16B 3KXFA 5AYQA 2AQNA 4BKLB 1M2OA 3MDJA 3U6RA 1Q8MA 4RAHA 5ISZE 1DUYB 4JFFE 4OZIE 4N1CA 1EUUA 5ANMA 1W91A 1U3HD 4P5TC 3PAYA 4YVNA 5BZDA 1U8PA 2X4QA 4FYTA 1NOFA 1WFJA 3TU6A 5FUCE 1JGLL 2EIBA 1CFTB 5KSAC 2L04A 2X6CA 1AO7D 4WNQB 4I89A 5IG7A 3O45A 4U3HA 3I75A 3S3SA 4ODXA 2BVPA 2FGZA 2VZ1A 2KDGA 3VRLE 1B6UA 1XZWA 5A2JH 2X2UA 3NFPB 7CGTA 4X42A 1RKRA 2DW5A 4QHLA 2BP5M 3HBZA 5ACZB 1UA6H 2W8CA 4W93A 2DKSA 3LQAC 4JZNB 4UAOC 4HDIB 4DZ8B 4U1JB 1OSPL 2O72A 1FFQA 4JFZL 2WXHA 1QMUA 4QXGL 3EDJA 3IAGC 1BX2B 2WWMC 2R1WB 2XVLA 3LV3B 3LIZH 4JFPA 2X4UB 5D1XB 5HJ3B 4R7NA 1GAFH 5DEZA 4HZLA 1E50A 1VPOL 4HLZG 5EC1B 3UCQA 4X7CC 3BZFB 4L4TE 3RWCB 1UZGA 5F7DB 3BZEB 2WAQA 4H13C 3L16A 3SE9L 2ZT9C 4D3CL 3BGAA 2PCFA 3CE1A 3FUDA 2MOVA 3QCUH 4G8IA 3ZL4H 4A55A 4JFQA 2JLLA 3FYEB 5JW4Q 2AAVA 2R9HC 4BDVB 1ZTXL 2WTPA 4XC3H 3VXUD 5L6YL 1I82A 1E3XA 5D7IF 2H2PC 1TG8A 4XTRC 3ZSTA 2PXYB 4F8OA 3MZGB 3CZKA 1LK3H 2A4ZA 2HVKB 3NRQA 3B5TA 2NY7L 1DDHA 5I26A 2CJ3A 1A7QH 4KY1L 2VLLB 4X6CF 4E0RA 4V1DE 4NJAL 3S37H 2H1PL 1SN5A 2QSTA 4MJ4A 3I3EA 1T5WB 2FRGP 3PNWB 4BELD 3IKKA 1CGVA 2JLPA 1R6VA 5I8KH 2PLTA 5E6IA 1ZAGA 2FJHA 4J8QA 1HHJB 4M7LT 4JB9H 4HBQA 4K71C 3CDFA 5D7LB 4G8EA 1GY1A 3FQNA 4QD2E 3CHSA 1XIWD 2DWTA 3E6HB 5BRZA 5B38B 3ASWA 3IFNL 4ISVA 4HAFA 1EJOH 4CSPA 3FB8B 2WYIA 2XXMB 4O2FB 4S1RL 3ULVH 2GJZB 1P9MC 4XHJC 3UMTA 5IMKB 1LGVA 1CBJA 3N0AA 5LWYH 3BKJL 1YYML 2LE9A 4HIXL 3WI9A 5A2FA 2NY0C 3TFKD 3FW6A 3QNXA 4EBQL 1YG9A 3O2DL 2BRRL 3RFZB 4IHOA 1M4KA 1G1KA 4PM1A 1T66D 1ROCA 4ZG1A 4Z8FL 2EYTA 5DUML 2ICCA 2Y4SA 3NJJA 2L7JA 4WW2F 1QTSA 1UM4L 3FU3A 2J44A 1XH3A 2Y22A 3V10A 5GGSY 3D1MC 1CU4L 3UZEA 1TEFA 3WEBA 4C58B 2OJZH 2CCLA 1I1FB 2J1YA 4P2QE 3SO3B 3LXBA 2AJZB 3VGAC 1FE8H 2V5MA 2CBMA 1PZUB 1LP9E 5D1XC 4FLHA 1OP5K 5DJXB 3T8XA 1KLGA 3HFML 4H5SB 3ABGA 1B0IA 4FA7B 3GS0A 4WHCA 3BMVA 5HDOA 3KBFA 2WYTA 3KJ4B 5FB8B 3IF1A 3QEHA 1G9HA 4DN3H 1NGZA 4N86A 3MOAH 1LE5B 3DARA 2IOMA 3ZE0E 3GMMB 4WTZA 1M2VB 1VFUA 5AVXB 4HJ0C 1KCRL 4PVBA 1IVLA 2R1XB 3DV4B 3VDCA 1T20A 5D1QB 3SQBB 1DQJB 1MZYA 4ZODA 1M7XA 2BIOA 3BAEH 3OKYA 4DEUA 3VAEA 1RSFA 1IC7H 1DVFA 4CMHB 4CN6A 5C0GB 4MQXC 3MLWL 5BRZD 1SYSA 3TBBA 2YGPA 4PLNC 4O2EB 4JE0A 2XUWA 4XMWA 1EANA 1RFDH 1TZHA 3CAFA 3KL0A 4X4MA 2H6OA 5CHNB 3BLBA 1Y7VA 3KH4A 5JUEL 2ITFA 1C12B 2X3AA 3APCA 4FQIH 3DUSA 4YSOA 4OM0H 5EZJB 3WFEH 5GS1A 2N1TE 4F58L 3G5VA 1X5HA 4E42B 3M17B 2K9UA 4TQ8A 3REWA 4N9GB 2Y36L 4GSDH 4NC1E 4OZGA 2YPKA 3L08A 4WV1B 1SXNA 5J89A 3QJVB 1ADQL 1KB9J 1GKOA 1FG2B 2C3WA 4UIMB 2OFQA 5A6LA 2E6QA 3QI9C 4GAGL 4KDWA 4MCNA 4YIQA 1KBVA 2LLNA 3MLZH 3TCLA 1HL9A 4S10A 2DYPD 4JN2A 2ZUYA 5INDB 5I1IL 3DC0A 4PTUB 4XOBA 2A6IB 2ZX5A 4PJIB 4OFYA 4ECNA 3QHZL 1ZS8A 2ADGB 4F7TA 3T2NH 5C0ND 1X6LA 1ZSHA 2IWKA 1KN4L 5EEVA 1H9DA 3FF8A 3V4UH 5IQNA 3MV9D 4ZK8A 4DGWC 3B9KA 3ZDYB 5IJKC 3FO2B 1WTGT 1EFXB 1U8IA 4Q89A 2DLIA 5T5FL 4GW4B 4BFRA 1IEBB 2HX7A 2F1AA 5GZNC 1N64H 2MPAH 5F0JB 4AV4A 3BPOB 3K6FA 4NRZA 1KBKA 3RWIB 4YZFF 4BH7A 4RSVA 5I76B 1JHKL 2X4NB 1FO0B 1P69B 3KVPA 4MWFA 1BQRA 1DYZA 1E67A 1TITA 4ZT1A 5I74C 2VMCA 4HX1B 2OK0L 4WVRA 2CKBA 1V8HA 2DV6A 4PRIE 5FUOH 1XSOA 4ZMNA 3PJSA 1HILB 2VWEC 3C6LA 4PV8B 1BD2B 4QXVA 1INEH 3BFOA 4W9HC 4PTTB 5FKAB 2D3VA 3RIFK 1EBPA 5I75C 1DVFD 3LNDA 4KUZH 3T4YB 5IQ9A 3FZUC 3PWPD 3U46A 3ULUE 2XG5A 1KPRB 2FBRA 3HG0A 3T4AB 1RHHB 3GI8L 1JZ4A 1BMGA 4BYHA 5I2IA 4YOKA 1MLCB 3Q6FB 3NESA 4HIIB 1J8HA 1D6EB 5MENA 1NSNL 3NIGE 5C0BD 3VSQA 3HBPA 4DO5A 5KSUB 3EDDA 3A6CH 4YFLI 1GHFH 1JHTA 1BXVA 1H9VA 4MXWH 4ONFL 4B97A 4NJ9H 3EF4A 1AIFA 3MRGB 4XVUC 4B9CA 4QJ3B 3IFPA 3CDGB 1AHWA 2WVSA 3ZDXE 3HB3C 2J71A 3GRWA 1VGKB 1XGYH 3Q2CA 4PJ7E 4PLJD 3IM1A 4ACPA 1P84K 3V0JA 1KELL 4KXCA 3VXRE 4OI7A 3RWEB 3UYPB 4LU5H 4N3UA 4IBYA 1EDHA 3AW5A 4GQ9L 4JM2F 2D8KA 3QAZC 4Z76B 4TLKA 2AXGA 3IT8D 4OCRL 2V9UA 3NJLA 4OGXH 1KTLB 4PGDB 1ESOA 2NX5B 4DOHE 4M8UA 5CCGE 2R0LH 3ZKMD 2WZ5A 1L9TA 1Z3RA 1IZJA 3UTSE 1NC4A 1MOEA 1IJNA 4XP6L 3VI4B 1IVTA 2VN6A 3P3TA 2B15A 4UINH 2HA1A 5IVNA 3P0GB 4B60A 3WCYA 4F7EA 3DGGB 1K85A 4X0NA 3M8OL 3T6VA 1G7LA 1WEJH 5CLTA 4CSSA 3ULAB 1XB6A 2QVMA 3H6AA 5ICZB 1I7ZB 1JHLH 3LZFL 4JDTH 4U1MB 1HXMB 4G6KL 2ZOUA 1RJLB 3KDMB 5IB1B 5F97E 5AEAA 1DZBA 2APBA 2VLME 5I1KL 3H56A 4NQEB 4F57L 4NXSA 4IEFA 3PWJB 4ZSOE 2WQXA 3GXFA 5JOPD 6CGTA 5TF1H 5T33L 2XTJE 3QQNA 4R83A 3VXTA 1S5IH 3Q44A 3NQKA 4YC2B 4CUCA 2XFXB 1OWWA 5BJTA 5JW5A 3ZZLA 3LKNB 3JBG7 4X7TA 4B50A 5FWQA 2CLVB 3IJ8A 3Q2VA 3D3VB 5DVNA 4UT9A 1JGVL 1MQKH 1E5BA 1R3KA 1UXSB 3RZWA 1Q9WB 4MKMA 3P3YA 3P3UA 1F1GA 3CH8A 2HT2C 1Q0YL 2SODB 4GYBA 2YAMA 1J8SA 2YXMA 3NCYP 4WY7H 1WUNT 5F96H 5EO9A 1IC5H 3EJPA 2D03L 4YO0B 3MCG1 5D2NA 1RURL 5LUMA 1IBGL 3CN4A 1MUJB 1IFHH 1ONQB 4JL1A 3RYMA 4P2AA 1QEXA 4R0LA 4ZPVB 3PAZA 4M93B 4FQJL 1A9BA 4J6IA 5DUBB 2JSFA 4PSPA 1GJWA 1NLBL 1SRDA 2P5EE 4PREA 3STLB 4P4KA 3JUYA 4HU2A 4U6VL 3SYOA 3DVNB 5FK9A 4ES9A 5DTFB 4EDWL 3SDDA 4ELKA 4R90H 4W4OC 1FFPB 2RAMA 4KKLD 1R5WB 1PZDA 4WFFD 3UTZB 2YOCA 1QI3A 5T3ZE 5TGBA 2CO7A 1MCNA 2C7UA 1TXKA 3C6SA 4YHKH 5AW4B 5T1LA 3V52H 3FQYA 4HJGB 3TS8A 2OA9A 2XVGA 3IRCA 1Q0XL 3LH2H 2LQRA 4I9XA 3SSGA 4BH8B 2F7IA 4WUKL 1J8RA 1QPXA 1DBJL 2VJ0A 3IE9A 2DJSA 3EDEA 2IWGA 3K74B 2CDEA 4OSUL 3GUTA 3VE0A 3FRUB 2V2XB 2P52A 2BVTA 2XBDA 3T1WA 1CD1A 3DO3A 2Y7SA 2ZXWB 4X6EA 2HG5B 1JMXA 1HE8A 3LVTA 4HJ1A 1EDYA 1SGKA 1SOQA 4FYSA 3MRPB 1IGTA 5SWZE 1NMBL 2UY6A 2ENSA 3FB7B 2KPNA 2CJSA 5DURB 4N22A 2EDQA 1ZGLM 5I0VA 2ZKWA 1U8JA 1AHKA 2W9DL 4LVOB 1A22B 2DIEA 4W1TA 2FNBA 3CVHL 2HCZX 2WW8A 2X9ZA 4A7GA 1C8PA 2D2OA 5E2UH 5IY5B 1CE6A 2D3LA 2ZWLT 4YX2H 3OSKA 2FB4H 3V4VB 3GTTA 4RMSA 2ESVD 3RVUD 3PQYD 1QUNA 3V0DA 3MODL 3V0HA 4LEXH 1B3JA 2PW2B 4YC2C 5DLLA 1QASA 2NUPB 3FQ2A 2WVTA 2FQGA 1CGYA 3AUVA 3AXLB 2NY3C 3NCXA 3QH3B 1KPUB 2VDKL 2EH8L 5HI3C 1J1XL 4PJCF 1KBWA 3ILPA 3KYKL 4D9LL 2P8LB 3W39A 2DTSA 4MD4B 2PTTB 3KLSA 5D4JA 4B3VA 5FA4B 2C1PA 5FO8B 4NGHL 5ANHA 4XPGH 1U8NA 5JO5B 3OC5A 3HHSB 1QRND 1I3UA 1E43A 3FUIA 4JY6A 3J7HA 4J3UA 3WLBB 3AREA 3LZPA 5C9KA 4XNQB 4HZAA 4Q52A 5CEZL 4RRPM 3MA7A 4JRWA 4FXKB 3U1SL 1LE9A 3GLEA 3X12A 4KJWD 4ZXBD 3JWNG 2DQUH 1C5DA 4WSGA 3TCXA 2AK4E 3GLZA 2FECI 1TF4A 4KI1A 4HUXA 5CJOL 3X11B 3GMLB 1MCKA 3KPRB 4PUBL 5DD5L 4NO0A 4UUJA 5C0CA 3KJ6L 1Q9OA 3TO2B 4Z0XA 1FWXA 4DFHA 1N2RB 4JHZA 4OLZH 5E1IA 4NERA 4XVJH 3SE6A 3Q9QA 3WN5A 3FT2B 1DN2A 3ALXA 4YAQA 3TEXA 3FDWA 3L13A 4E68A 3SEPA 4ILDA 4I48B 4LF3B 1HQ4A 1LO2H 1GC1C 2XV6B 1K8DA 4WO4C 3CFEB 3K6OA 4NUQA 4PJAB 1HIML 5LCVL 1QNIA 2XZQL 3EJTA 2C7FA 1DLFH 3LNFA 4JGJA 3K2IA 1PKQE 3MLUH 3NFNA 2VDRB 1I1YB 3CSTA 5EPMA 3HE7B 3SGEI 3MYJA 4UB0L 4BRVA 2QQLL 3I9GH 4K7PL 2FLMA 4TSCL 5IMOB 3D7PA 2VZUA 2IPKA 3MTRA 1YJDC 1YYLH 3NACH 4LHUA 1PF3A 4X6DE 4JY4A 3TBSB 3BE1L 3UAJA 3MOBH 5K5YA 4KNUA 5KS9B 4Q6IC 4G1EA 3QISA 1YMMA 1P1ZA 2NQ3A 2RFXB 3P30H 3IMBA 1R46A 2R4SH 3SKOA 1UT1A 1G87A 4DP0X 5IT2H 4Z3IA 2DIBA 4IMLB 4M02A 3QE5A 2V9TA 3HLAA 2OZ4A 3FJTA 4PCKA 1GYUA 1WGVA 2XWJA 1F3JA 3GUFA 3OXSB 4KPHL 1OT1A 5DFTA 2MHAB 1A7RL 3KXFE 3WS3B 4BZYA 5TDOA 1L9SA 1T1WA 1NL0H 4B95C 3P3RA 1BFOA 4GBXC 4GPVA 1LL1A 5LBSA 3H6JA 4WWPA 2Z65C 2QGCA 1U33A 1KYUA 4L1LA 2VCOA 3HG1B 4HSCX 2WNKA 3GBMH 4FCHA 5FX3A 4PD4J 3DTUB 2OQJB 1AQMA 3EH2A 4G1MB 4K5PA 3O6FD 1KXQA 5DJ6B 4R7VA 4H1LG 4NO5A 2JJSA 1TTGA 2ZOKB 4X7FC 1XR8B 2IH8A 4PY8I 1FL3A 3WENA 1CD8A 5T1MB 3QA3B 3HN3A 4MMXA 4YBLC 5GGTL 2HH0H 1C9SA 3H53A 3UBFA 2R23A 1VIWA 1QZ1A 3U30B 3ELAT 4P4RB 4WU5B 4Y19A 3O8XC 3F7PC 5I5JA 4ALAC 3HAEB 4LLWA 3QG7L 3VFTB 4G6MH 3MRKB 3LEXB 2BNRB 1HHKB 4BQ9A 3OKDB 4OCXL 5DA0B 4AX3A 1LO5A 4URTB 2A7BA 1AP2B 1P4IH 1LD9A 4JZOB 4OLYL 2YQ3A 4C4BA 3IMTA 4K8RC 4MHHI 3SOBH 4XI5C 5DVPA 1JVKA 4R5VA 3DX6B 4MA3B 1E7UA 3WY3A 1SN2A 1I9RH 2JB6A 3QDJD 4U6TA 2AKRA 1I31A 3Q43A 2G5UA 1YMMD 3QQ4A 4YGAB 2J6EA 5BO0D 1X9UA 5FV2A 4FFTA 3FPYA 3HMXL 2B08A 3ESMA 2AQRA 4QXWA 3MNWA 2H4EA 2D7TL 3VJ6B 5EOCH 4JJHA 1X5JA 4Y2OA 4TF4A 2FWSA 5C6WH 2Q5BA 4QRQB 1DSYA 2WCGA 4G8GA 1OIOA 2V7HA 2FLBT 2MOGA 2XWTA 3TN0D 3N2JA 3DIFB 4KUCD 2YC1B 3VH8G 4APQA 4J28A 4Y5XA 1A6UL 3DHMA 3VXSA 4P2OB 2MQCA 3NCBB 4RESB 1AKJA 3JWOC 1K72A 5L8JB 2FZ3A 4X80H 1XGRB 3INUH 4MRBA 1U8MA 5DD6A 3BWUC 1MW2A 2GC4C 5K9KA 2F9BT 3WIHL 4ES8A 2E46A 1A7OH 4KRMB 4WI5A 1BWMA 5I66A 2HJLB 2WP3T 5MHSD 1KWKA 3X2QB 1MFNA 2GTZA 1BOYA 2UYLA 2AGJL 2CRYA 2EKSA 1SLVA 2BMKB 3ZDYF 4Z77B 1P5VB 1OEZW 1TT6A 3NCCB 4JPIB 4FKHA 3TPUB 1UYWL 1YPZB 4L1TA 2DQDH 2VRAA 5CJXC 5DJ8A 2X88A 4KRNA 2VDNL 2XQYA 1UXLA 4HV8B 5F9OH 5TH2B 1OY3B 2VZTA 2X4TA 3AG3B 3FN0L 3G5YB 3M46A 1YEKH 1GZPA 2UWEA 4MYWB 5AALA 3SBWC 5KSBB 1HQRB 1QSFB 4OJCA 2W88A 1UWYA 2CPUA 4MCZA 3D39D 3T77B 1D5BA 4Q6KA 2AZAA 3QB7C 2ZYIA 4OU3A 5CCJA 1CF8H 2LU3A 4N2GA 1A1NA 1D5XA 4JX0A 3HE6A 3SDYH 3T2PA 2Y1ZA 2G75A 2ZUXA 3GJEB 1AG0A 1MH5B 1XT5A 4JO2H 3W82A 4J2XA 3BP4B 2GY7B 3IMRA 1DDTA 5FYLE 3FQ4A 2XZCH 3SGEH 3MLRH 3NZHL 4WEBL 2V7NB 5LQBH 2DJUA 2DLGA 4G8GD 4LARL 4P3WA 4W9DC 3ARZA 3GZOA 3ZT6A 2P24A 5IK3A 5J57B 1WWCA 5CSBA 3KWTA 3DRTB 1AKJD 5CINH 3FH7A 4JREC 1MIML 1WWBX 2DWXA 4NPYA 5K9QI 2EZ0C 3SDAD 1PG7W 2CD0A 4M6OL 1BECA 3OF6D 2BS9A 2XKNA 5BV7C 1RD6A 2HVBA 5D4HA 3F5WA 1A14H 3DBXB 1Y6KR 1CG9B 5KYWA 1U42A 2QLYA 2UVFA 1CTOA 2ZSWB 3A67L 4FCAA 2H3XC 1MZZA 3BWAA 4MAUL 1PJ9A 2WBJB 2ZX7A 4W9IC 3L7EB 3BKYL 1VFOA 5AZEL 3BWSA 4H8WC 4TNWK 3QQDB 4N90D 1K2DB 1AGBA 2BM3A 4L3CB 1G7HB 5LNEA 3TT3H 3D25A 4F2ME 2A6JA 2AQ1A 5HDQL 3C6EA 1VB9A 2AVFA 2PWEA 5I5MA 2VUYA 3X14A 4F3FA 3K81A 4KXZI 3HZYB 2JIXA 3CLFL 4UIKL 2XWXA 3GKWH 5FF6A 4OGZA 3EGDA 2C26A 3A3YB 1FO0L 3FYIB 3QIWC 4LHJB 1CGWA 3I6GA 3WHE1 3O4LB 3BEVA 4FJ6A 3WD5H 4MKTA 4OY9A 4B53A 4OFPA 3MN8A 5IBTH 3FQTB 5E0FA 2X4RB 3DUHA 1IARB 3TH3T 2G0LA 4X5WB 4A2DA 3NPSB 1HXKA 4RFNC 2FSEB 2EICA 1RZ8B 1IGMH 1IM9B 2C9UA 3BH4A 1JV5A 1MCPH 5G5DA 3BAKA 2ZIDA 4FL4B 2YMXH 3T2LA 4GRMA 5KSVB 1HAWA 1LHZA 2VDLB 3EUDA 2H3NA 1A21A 2ZSVB 1M1XB 1AGEA 4N0YL 1MAKA 1EEUA 1BFVL 1CPUA 2WXGA 1PX8A 5HGAB 3EDFA 2R8SL 4AUJA 2P8MB 4KI5D 1CZ8H 5CCHE 1IQWH 2FYVA 3Q6GH 1PY9A 1IZKA 2QDVA 4FJYA 2VR7A 3GSOB 3TCTA 2GIXA 1VACB 2R2EA 3QUMH 4OQTA 1A6VL 4K9EH 4WJG3 4EDXB 4HJUA 3CFUA 3IDUA 5IW1B 1T21A 4OIIL 2X0UA 1OE3A 2Z8SA 4AEEA 2HMID 3AMKA 4GJTB 1HI6A 2XKUA 3GMOB 2FT6A 3FTUA 4XP1H 2J88L 3BW9A 3KPQA 1SJMA 3GHBL 2Z64C 1O6TA 1UGNA 1W6LA 3ZYJA 4F15B 1RZIA 5GSVA 1J8HE 5HGGS 3KLLA 1OAZL 5MENE 1I85C 4N2CA 3TBWB 5DJAB 2VR5A 4AL8H 4ZMLA 1YEHL 4H7VA 2GW5A 1OW0C 3GJFH 4J6RH 5IOKA 2H8PA 4RAUB 3PGFH 1ZANH 4JM4H 4TQEL 3PXHA 2UUDH 4P9MH 4KROC 5E8NA 1HNFA 1H3WM 1WAAA 4G5ZL 4P9HH 1CB4A 3PDOB 4MBOA 3BVXA 2NY5C 4WDIA 2MCAA 2G3ZA 1G6RL 4N3TA 5HPMB 3N40P 35C8H 3U0TA 4QRTA 5F88A 4OLXL 1P2CA 2Z0UA 5KVEH 4PH8A 5DO8A 1N5YL 1OAXH 4FQXA 1TZAA 3AY4C 4WGWB 2WBJC 3MRMB 3S96A 4M6MH 4A2FA 4ZBJA 3D50A 1A0QH 3TZVC 3PABA 1J5IA 3MV7E 5GHWH 2BCMA 1OCCB 2YBGA 4J3OC 4DVBB 2XRAL 4OCYH 1QFOA 2AABL 3RBGA 5FFLA 3MRIA 1BVLB 3LB6C 1L9MA 3ARBA 3DA0A 5CD5D 4KZ0A 3H9HB 2BX5A 3B43A 2QL1A 3QIBA 1GGUA 4W9ZA 5GRVK 5EULV 5CIPH 3UACA 2EDMA 3BLKA 1G9NC 3QXAA 3DXAB 1F6LL 3D09A 2HKFH 3NZ8A 3QYMA 2DQEH 2GK0B 4ZFZA 5D72L 3OR6B 3PPSA 4Y16B 1TU2B 2Y7OA 1FDLH 1KG0A 3NCMA 5JYMA 5FUZH 5J7CC 2WO3B 2F2HA 2ADFH 1N12A 4AGOA 1F5WA 1IGJB 3TLRA 5C2BL 4JN1H 4X7SH 4NYLA 3QIUC 1CDCA 5JHBA 4FL4C 2NY2D 1F00I 1DQQB 3B7RL 2XIIA 4DP5X 3FKUS 5F7AA 3V0FA 1JXKA 4DPRA 4GKNB 4H8HA 3I02A 4Y5VB 5I0DA 1U4EA 3P11L 3G9AB 4YHYB 3LPWA 3OAZK 3CLEL 4FKEA 3VFNA 3I6SA 1LWJA 1N0LA 2XWBB 3AQDA 2ADIB 2ATPB 3CFNA 5GPRA 5CLZA 5KYNA 3V9FA 5D2NE 2WOYA 3L4ZA 3MRHA 4PJXB 2YRZA 4HPOH 4HKBA 4K23H 2HWZH 3WHE0 2PPFA 4I4WB 4Y5YB 3WHXB 4LGRB 5IROC 3SBRA 5EN3A 4HK0A 4FQXD 4KO5A 5AAMC 4Z7NB 3W2DH 4N9OB 3V4PH 1II4E 1KTBA 3PWUB 5CNHA 1RV6X 1GZQA 4YSEA 5J3HC 4EEEA 4RDQG 3AS3A 4MAYC 1U8CB 5I30H 5B3JF 3U6XS 1DHKA 4HWZB 5D7JB 3A22A 2X5PA 1OF2B 5GS0C 1GTFA 2ID5A 1N67A 3SPIA 2CK0L 4AGQA 1RPKA 1WUZA 3RL1B 3BWZA 1H6FA 1GGIL 4PRAA 5BOJA 3ARDC 4KXZH 1CLYL 1T04A 2A1WH 3DMMA 3QJRB 1BMZA 2O5YL 4XVSL 1I7RB 4GRWE 4JY5L 4MNGE 2XA3A 3M1BB 4UQ2B 3D0LA 5EN2A 3TM6A 1I8KA 1T7VA 5K1VA 3T6ZA 3H3PH 2Y5QA 2W95A 4UM9B 5GQBA 2ZJSL 3IXAB 3V4VL 2HRLA 4P06A 1UURA 2XNAA 2L0DA 2YD3A 1MFVA 4DAGL 4TNGA 5E6ZA 3F00A 4Y2DD 2DH2A 1HCVA 3IJHA 4QHNA 2NDFA 3P77B 1MI5E 4P5KB 5C8JB 4LHUG 5ESVA 5KS9F 4PJFA 5CLXA 3CXHK 2Q86A 3NH7H 1FPTH 1NAMH 4MJ5B 4LAQL 1KXVC 5CBAB 2W0FA 4J27A 4XNZB 3BAYA 2BHFA 2OL3B 5ESAB 3WLWD 2UZXA 5EHFA 4JBSA 3ES6A 1UB6A 1XEDA 4TNEA 3T0DA 1DQLH 2FIRT 2ICEB 5J12B 1VZGA 4ODUA 1NCJA 4GKSB 4NFCA 2PR4L 5C6TH 5AZ2L 1GKEA 4Y4HD 3DGCR 5IUCA 3MCKB 4D9QD 1UCBH 4D8PB 4MJ6B 3W9DB 1NGXA 3G08B 1BZQK 1LQBC 1ZS2A 4CKVX 3AJ7A 2VQTA 4I9WD 3RWJB 1SMDA 2CGYA 3DIDA 3S3DB 4Y1AB 4LGPB 5I16B 3WY1A 4HJEA 1IBFA 4Q9BA 1I8LA 1VESA 3EJSA 3STBA 1QA9B 4ABUA 1T5XA 2J73A 4LASL 4G3YH 3MFFB 4GG8B 1P6AB 3H42L 2IGFL 4UTBA 2BIMA 1FZMB 2AITA 2BDNH 1QBML 2JK5A 2BSED 4Z7WE 2IAMB 3NPZB 4WSKA 2C9RA 2XC8A 3FSWA 3LEYL 3RKPA 1F97A 1ZE3C 3D4GA 1I8AA 5JMRA 2WK2A 3LEVH 5A6MA 4MBRA 1RY7B 2Z35A 1QSED 4PRPA 3OKMB 3R7QA 3VFGH 4QY8A 5IFAL 2HLEB 1NFIB 3VGEA 2HLFD 3AT0A 5DEJA 4ZUTB 2XTSA 3FQRA 1FHNA 4JANB 4MMZC 1CWVA 4XCEB 4QTIL 1FNEA 1YMHB 2A4CA 5TE7L 5CCKH 4F7PB 4Z5RB 1JIBA 4ZW3A 5EU7E 4L3FA 5FECA 4DKDC 2IG2H 3FU6A 4EUPH 4P5TA 2BHUA 5C0CE 4H25A 4ZUSA 4BCZA 1G7IA 2X53A 3HS0B 3IAPA 5A2KH 2Y07L 2X38A 3OL2A 4P23B 5JNYB 4EPSA 3VFOB 5D2LA 5KSAA 1W72A 2VLRD 4LQFH 4KQ3H 5CSZB 1T2JA 5JW4N 2HX8A 3BC9A 1NPNA 4FTVA 4YHOL 3WBDA 3PU7A 3HNTH 1T7WA 2N7SA 2YAHA 3IDNB 3C60D 1RJYA 3NIDE 3L5JA 4DZBA 4ZFFA 1QLFA 4F7CA 2AJSL 1UXWA 1FYHB 2PTVA 4FI8A 4GG6B 4J39A 4HZ1A 3EYOB 2NSQA 2NW3A 3L2LA 4UOZA 5C0AB 5FGBC 5JW4M 2ZKYA 4IW4C 1A5FL 3DX7A 5E23A 2JNZA 4EXPX 4JFDB 4XNZC 2A83A 1N6QL 1MIEH 5IM7B 3CFDA 3LZQA 4OUUA 5DT1L 5B7MA 3K5SA 5KJRL 3KL5A 4I18B 4AQZA 1MJ8H 2HFFB 3QDME 2ICEC 3L3GA 1WA2X 1TFHA 1W0YT 4PRHB 2R0KL 5FFGA 1HDMB 1XGQA 3LN4B 3OX8A 4FERA 4YJZL 1WF5A 3RWHA 2WJ7A 2WN2A 4F9PC 4GKZA 3ZHKA 3DETC 4JRYB 4PRPD 1G9MH 1T22B 1ACXA 5IB2A 3MBWA 5DFAA 2HFEB 1YC7A 2HN7B 3UTTA 2O6DA 3NOIA 3H0TB 5LAPA 2BHZA 4DTGL 2P49B 4MZ3A 4ELMA 1SYVB 1XSJA 3CDZB 4GY4A 4OLUL 5EUOE 3MRFA 5H35B 5A2IH 2EDBA 1KCUH 1PX3A 2Y06L 4P57B 4TOYH 3BSZA 1YPZF 3BKCL 1W0WB 3PV6B 4Z23A 4ZFOL 5DK0A 4U31A 5ICXB 1DLHA 3QUXC 3PIQA 3FU9A 4JFXA 1QR1A 2OMBA 2GAZB 1B4JH 2JB5H 3BYYA 1FHGA 4EI6A 4EZKA 4M1GH 4X9IA 3OZLA 5AVRB 3H2WA 5KSAD 2Z8RA 3NFSL 5KSBF 2J5LB 1O7DE 4U6HA 4Y19E 5I17B 5JOFB 4P3CL 4FTVD 2AW2A 2H41A 3TNMB 1W8NA 5PCYA 2DMKA 4KKRA 4MDIB 5KYYB 4I0PC 5JOEA 3MTXA 5E5MB 5MI0C 4XPTL 1P4LB 3RPIA 3VX1A 1ODAA 1P4BH 3LIUA 1P9MA 4AIZB 2JXMB 1HNGA 1X9RA 1LWHA 5F3FA 1CGUA 3MSPA 1C5BL 3QJFA 2E0PA 1F1AA 2WWMD 2IH1A 2V9RA 3TH2T 4R3SA 3EYVB 3ULSB 3GEWB 4P23C 1ZHLA 4LKXB 1CFTA 4LSRL 1ZHNB 4PWEA 1DEEB 3AVEA 2F1BA 2QGEA 2IH9A 3MRLB 4KRPD 5LAXB 4LCWD 2O93L 4YL9A 3ZDWA 1AI1L 4JGMA 1GCYA 1V27A 4IS6A 1C08B 1W6WA 3WTYA 1TTUA 2R59A 1O5PA 3BLPX 1XBRA 3WTXA 4FQCL 4E41A 1ZLUK 2H2PD 3QQ3B 1L3WA 4XTRD 5D1XA 2R1YA 4G7VL 4PSRA 4N8VA 4JPVL 4DFIA 1GJIA 1IM3B 2BOCB 3U0PB 3C5JA 5BQDA 2P9RA 3R4RA 5B3SB 1EBAA 2P48B 4N2LA 4J8RB 4P05A 1F4XL 5AVSB 2V6HA 4KKNA 4WRLA 2LW3A 5IOPA 1JGLH 4OCNC 3BPCA 3VXSE 4F7KA 3K72A 3LS5L 3VRIB 3LRMA 3SDXE 3O3DA 2P5PA 4KXAA 1UH2A 4IKJA 1J9CT 2XN9A 4BFIA 3G6DL 1XF2A 4HOZA 4E2OA 5L88L 4U33A 2F54E 3ZGIA 5D55A 4OIBA 3DX4A 4XBGB 5I0ZA 2R83A 2W0KA 4JFZH 3MGTB 2VXQL 3LVEA 1Z9SA 4BK5C 4YFDB 2YEQA 2MCPL 1B9KA 5ISZB 2NQDA 4OZIB 1VPOH 4CVUA 2X6BA 4PJEA 3QS2A 3LD8B 1TNNA 4RRPG 2OTWA 5TQ0L 3HIZA 5ABAA 3PNWA 2J43A 3BGFC 4ETQA 2Q3ZA 2RALA 2NY0D 4D3CH 1GGYA 5KW9L 3RWGB 4GO8A 1AQHA 3C5ZB 1M05A 1JPGA 1FNGB 1HCFX 3SYAA 3V0AC 4K15A 4FFWC 3QZPA 4BFOA 5C0EA 2J5LC 5ETUB 1L6PA 2UWEE 1JF1A 3C2AL 3QI9A 3L9BA 3VMNA 4UT7L 2WD0A 3V79C 4MJIE 3ARXA 3WUWB 4KTEL 4P5MB 4XPAL 1DN0A 3WFCL 2DQFA 1R4XA 1SLXA 3S34L 5IMKA 3RZCC 1EGJL 2PO6C 2NY7H 4KY1H 5CR1A 2I9TB 1BYPA 4NJAH 5D1XD 2H1PH 3OZ9L 3ARRA 5IJKA 1A9VA 3V6FB 2ORBL 4YSTA 4NQCA 1MJJA 1L0YA 5K9OB 4L4TB 3Q1SH 4PI0A 5F0LB 2BSDA 3K6NA 1IGCL 2WXQA 5GZNA 1MFAL 3TIEA 1E9PB 1I9JL 3X1GA 1TYEB 1E6OL 4Z7QF 2G2RA 4KJYB 3E1F1 4FHKA 4HOXA 2E9JA 3F85A 4RMBA 2VLKE 3IFNH 4AKPA 4NNYA 1JWMB 2XN9D 1FP5A 2OMYB 3UDWC 4S1RH 4ADJA 1S3RA 1EIBA 3JTSB 1WRFA 1EJ8A 5E5UB 2PXYD 5DJXA 3G6AA 3RJDA 5DMJB 2OMVB 2Z9TA 4A2GA 3BKJH 1YYMH 4HIXH 1ZLSL 5EBWB 3RA7L 1K3ZA 2VN7A 3TBYB 2XIBA 1S9YA 4XOEA 2CA3A 3O2DH 2BRRH 5F1IB 3DDGA 4V1DB 1IT9L 3NG5A 2YXWA 4JFYB 5IWLC 2O6EA 4PMFA 4M9OA 3EYUL 3SGKC 4YSRA 1I3GL 2PF6A 2CDGB 1EEQA 4Z8FH 4H2AA 1Z5YD 5DUMH 4KX9A 3VWKB 1BAFL 4KMTL 1CDIA 1DQJA 1UM4H 1EO8L 2ICWA 5DS8A 5AW8B 1FYTA 4PRNA 5EUKA 4M3HA 4PV9A 3S48A 1CU4H 3KCPB 3KYMB 2KL6A 1AR1B 4PY7A 5D7LD 2OMXA 3LJ3A 4NSKB 4B5ZA 2R69L 1A6ZB 3IMSA 4GINA 5EO1B 1JGEB 1DJHA 2KLTA 2G5BB 1J1PH 1E27B 5CP7B 5DR5L 5C0RL 3HFMH 3U6XA 1COBA 1AQ8A 2VRKA 3Q01A 4Q74A 1BLIA 3LD8C 4NOBA 4TUJA 1E4KC 5HDRA 1UH4A 2XOTA 4OJYA 1OM3H 1WPCA 1YNTA 1Z66A 4YBQD 5DRNA 2C9XA 5FUCC 3IDYB 5DJDB 4QWWD 2AXFA 3DPDA 1FG2A 2Q3AA 4EOWL 2XV2A 3FTXA 2EE6A 4LSVL 5HJBA 2OX5B 5GZND 5L2KB 3JVFC 1AG6A 4AT6A 3LHPL 5IEKB 1ETZA 3PP3H 1YUKB 4PJ8B 3QO1B 2N7AA 5D1ZC 2EYRB 3QFDB 4O4YL 1W0VA 4GEIA 4FI6A 4PJXF 4AITA 3MLWH 4BV1A 1GYAA 2ERJC 4PJIA 2GJ6E 2CLZB 5JXAL 4BZ2L 5LO7A 4P2QB 2Y2TA 1VA9A 4L0ZA 1BZ9B 1LP9B 5A2BA 1DCEA 4C56A 3RY5A 4FQ1L 4UAHA 2W91A 1BPVA 4NO2B 4Z3GA 4Z7NF 2D4FA 3N3EA 1HC1A 1MJUL 4F58H 3FZUD 3RGVC 4J1UB 2DZEA 3W11D 2IDSA 1U8QA 4RISL 2F8OA 4NUPA 3Q0HA 1B4RA 4ZD3L 2VITA 5MEOA 1ADQH 1P7QA 2QADB 3OKLB 3ZE0B 5I76A 1C7SA 1LYQA 4FA8A 1Z3GL 2C5DC 5HGDB 4OFIA 5C7XL 5AB1A 2CALA 2CU9A 4KVCL 3RU8L 5D1QD 1I7TB 3L7FB 4OF5A 3H2PA 1S46A 2KMWA 1MF2L 1MFBH 1V7NL 2A9AA 4XVUD 3R1GH 4U7KA 1U3ZA 7FABL 3DV6B 5HVHC 3N43B 4LVNB 4EN3B 1WWAX 1JWSA 4ZAKB 1KN4H 4OZ4B 5JDJA 3L3OB 5CKGA 4HKJB 4IBUA 5HHVL 4LLMB 1UOKA 3N0PB 5ENWA 2QVTA 3STZB 5EF2A 1IIKA 1JFQL 4LLVB 1QRKA 3HR6A 4HIIA 4QPEA 1WVZA 1WD8A 2VR6A 1WZLA 1K8IB 4C47A 1RP8A 3S88L 3CDCA 2W9EL 5J6HB 4W4OA 3PHAA 5CBEA 4JG1L 1PIGA 3GSUB 2OK0H 5LGHL 1T7YA 2OMZB 4LRIC 4QHKJ 2NLJA 3PGCA 5FA3A 2VAAA 5T3XD 1U8LB 2DQGH 1XSIA 2DQTL 3CPUA 3C8DA 1D2OA 1NBYB 2KLRA 4LPWA 4XCNA 5JR1L 2BZCA 2HFTA 4ENEC 4JCWA 4DN4L 1R0AL 2K6WA 4TPRH 2ATKA 1NJ9B 3VD3A 2Z31C 2ITEA 1CD9B 5J13B 3GI8H 2Z93B 4C56D 3QUKB 5F9DC 1ZA3B 4U1SB 3FUNA 2Y7QB 3CUPB 3PWLA 4E9QA 1NSNH 2AV7B 3WEXA 1L9PA 1TKWB 1X9QA 1ZXQA 1N8ZB 3DGGA 4UQ9A 3UERA 4APXA 4LPUA 2VYRE 2CR6A 3BVNB 4ONFH 3QJQB 1CL7I 3DUUA 4R4FH 2RCSL 5FHAL 3VD9A 2AV1A 3QUYB 3VXNA 4B9IA 2BNUA 3FQUB 3CZFB 3EG9B 3EDKA 4Z3EA 2ZOTA 3KPNB 4GKLA 4PRIB 4Y4KC 2HT2D 5BZZA 4G72B 4OZHE 4NDMA 3PL6C 1V54B 4GQ9H 3ZQXA 1BD2D 5EDSA 1JWUA 4AKOA 5TD4A 3RVTC 3Q8BA 4HS6B 4OCRH 2VDQB 3WFHB 4L8SB 2A3TA 4OF0A 2YSTA 4XP6H 2WZPD 1Y6NR 2RMNA 2WCSA 1VJSA 3W56A 3D3VA 3DX3A 2B1HL 1UXSA 1F3DJ 1M1SA 4ZYKB 2ZWSA 3M8OH 4HBCL 3Q1EA 3PFUA 3WIFB 2R51A 2ZX9A 2XJKA 5ALBL 2OSXA 2OXGB 5F89A 2WO2B 4FQLL 2X12A 5FOJA 3OD3A 1YY8A 3ZDXB 4EN3C 4LVNC 2JKWA 3ARGC 5I1KH 2OL3L 3FCTB 3L3OC 4F57H 5DD0H 3VXRB 1MUJA 4LOVA 3EOAA 3WTTA 4MQ7B 2HYMA 3O2WH 5D96B 3FRPA 3KBHE 5T33H 5E2TL 3TYGL 4GG6F 4IK6A 1JOIA 2G9HB 4WHYG 5TE4L 2NYZA 2VXUL 5AW2B 4DOHB 4IM8A 5DUBA 3T3PF 4MXQC 2NX5D 3A4EA 3UTSB 4KKZA 3KLKA 4Q9RL 4X4YB 4HEME 1PQZA 2CCWA 2G4EA 3DVNA 1JGVH 4N68A 1ZHKA 3IDGB 3L81A 8PAZA 2YPVL 1CIUA 4K5OA 4PJFE 4NN5B 2E47A 4ZUUA 4CVWA 3S7GA 1ODUA 3KM2A 1Q0YH 3DOHA 1XZ0B 2YAEA 4LLAA 3V6ZA 5AB0A 1ZVHA 1IBYA 4PWFA 5DVLA 1V55B 3MUUA 2E75C 3IXTB 4KV5F 2D03H 1RURH 3CSBA 1IBGH 4HFWB 5KYUA 2VQ4A 1KT2A 1JUFA 2B4CL 4AZ8B 4UV4L 3BN9C 3VXOB 1UOWA 3PLYA 4RMQA 2YFNA 4HLEA 1KV7A 3BP5A 3QPQD 4ZDHA 4NQED 4OLVH 4ZSOB 3HC2A 2G2NA 4JR9L 4FQJH 4WO4A 1GS7A 4G7RB 4FXGB 1NLBH 3LPFA 4MJJA 2HG5A 4U6VH 4PGCB 4PW4A 2PN5A 3HPJA 2WLIA 3A24A 4XRCA 1NMAL 4EDWH 3EJCA 4KVPA 5CD3B 1PD1A 1LXMA 1RZ7L 1UM6L 2GSIA 3MRPA 4XMVA 5FM8A 3HJEA 2BJML 3D3VD 4C83B 1RZJC 2NY3D 2LU5A 2OJEB 3QUYC 4OFVA 1WG3A 5F6IB 4JG0L 3TO4A 4H26A 5HI3D 2BPBA 4TV3A 1AGDA 3ZQWA 4DVRL 4I0KA 4Q6IA 2NXYB 4GXFA 1EAOA 5JHDA 1BWWA 3ET9F 4GW5B 3EFDL 1Q0XH 3K4DA 4OFQA 3WXVL 4J4PA 4JZJC 4WUKH 4QHMA 1DBJH 3IDMA 3VNYA 4XNXH 4OSUH 1M57B 3E8UL 3UYRL 3CFKA 3GNML 2L7QA 2QQNL 3L3JA 4YLQT 5KG9A 4JHVA 1YAZA 4ZMXA 1XF3A 1IJ9A 2NZ9C 5EBMB 5DCCA 1JPSL 3BUIA 4M8VA 4PP2A 3SBQA 1A2YB 1JF5A 1N6UA 5C09A 2P5EB 3S35L 4GBXA 1ED3A 2F18A 4M43L 2NY4B 2FIKA 1HH6A 5TK4A 4RGNB 4JDZB 2QHLA 1KJ2A 4LSTH 5FYJE 3O3BB 3RWDA 3DPBA 4J12A 1JPFA 2PPEA 5FO8A 1R24B 3CVHH 5D2LE 3ETTA 2CXKA 4WIQA 2FWUA 2Z3FA 5EU5B 5JMOC 3NN8A 3C12A 3T2QA 2RA1A 1KZQA 5DU7A 1JI1A 3FTWA 5D96C 4AC2A 3MODH 5HP5A 1TUPA 4XNQA 3EGXA 1HJCA 3X3FH 4P3DA 4JPQA 2V37A 1S7TB 1OPGL 2IIJA 3O8XA 4B3EA 5ID0A 2AVGA 2EVGA 4DKFL 1QFHA 5DHVB 4N2FA 2VDKH 4MX7B 3R0NA 1G7PA 1J1XH 1H6UA 4XCYA 5CGBA 4UTAL 3VDBA 5EIIB 4TNFA 1F90L 3KYKH 2PYEE 2MWCA 4XN5A 1WZ1L 2K1MA 2V17L 1XL4A 1SXAA 3PAVA 3ZTNL 3G9VA 3VGHA 2VDOB 1WISA 3OKEA 4HH9B 5DURD 1CL7H 4NGHH 3V5DA 1PCSA 5DA4A 2KS0A 3GSNB 3MCLL 4WW1A 1JZ6A 3I50L 4M5YL 1B0GA 5JHDD 4PB9L 4DWHA 2BSSA 5F1KC 5LBVA 1RJZA 4O02B 2C9PA 3IGLA 1WC7B 4PRBA 4LF3A 2NXZB 5C9JA 5I19H 3R4DA 1BEYL 2XTJC 5I15L 3U1SH 4LOFA 5HHQB 3UTTE 2BCKA 5AUMB 1KCVH 2R2BB 1TVBB 5DRZB 5TJWK 1LO3L 4TL4A 3F6LA 4HGWB 5IF0A 5LJYH 4K3DH 2WN3A 1SHWA 1WA0X 3VD1A 4OZIF 2DJMA 4LCCC 5EU4B 2Q76B 3GIVB 2DIAA 5CJQL 4PUBH 4I7ZC 5F6IC 1SBSL 4ONHA 1UJ3B 2OV0A 3QZNA 3BQUC 4JRFA 4XBPB 3LY6A 1GCFA 3BISA 5F9AC 4QTFA 3KHOA 4A63A 3W9EB 3LZLA 4QGYA 3OKNA 4LCUA 5GGQL 2OKMA 5HYQA 3VRLF 3PUUA 1WQVT 5ACLA 1N59A 3W0WB 4TSAL 1OGTB 4XNUL 3ZL2A 4HJJH 4Y7MA 1HIMH 3TJHC 1OE2A 4MXVE 5LCVH 3THML 3UCRA 1KY6A 2XZQH 3U83A 1RZKL 3VNZA 2VB5A 5SWQA 3FT4B 2AJ3B 2FJGA 3GGWB 1WYJA 1OHZA 1U3HB 4K7PH 4AH2B 1TZOA 4JPWL 3CJJA 3UG4A 2NY4C 3HG1A 2AK4B 3MUGB 3BE1H 4C8XA 1XGUB 2VGLM 4K94C 3EJYC 3OMIB 2ZUUA 3D08A 1NEZG 1HHGA 3QBTB 1DUZB 2ZOLA 4BWWA 4GQQA 5CJXA 3SQRA 3OWRA 5F7MC 3MGOA 2ZOKA 2J12B 3PHQB 5T1MA 1QYGH 4HXBL 1YEDB 4XMXA 4MLSA 1CC3A 3INOA 5DMKA 4TVPL 2Y5TB 4JO8A 4KPHH 3IE4A 2EACA 4AE0A 3SBWA 3BP7A 2XZAL 1A7RH 3L2NA 3CPLA 1AQDB 1QOKA 3ZJAA 2NYKA 4E41E 3MRKA 2Y3AA 4JHBA 1HTYA 3MRQB 1BBJA 2YZ1A 2ZICA 3H55A 1PKQB 1AP2A 3EOBB 1NBZA 3HNVL 3MPCA 3RVVC 2EUZA 1LEGB 1A3RH 2X89A 1MJ7L 1E8YA 2JQZA 3BX7C 4ODWA 1NGYB 5IIEA 2B59A 1WH0A 2EDWA 4X6DB 2VDPB 4MA3A 4BGDA 2F68X 1BXUA 1O6SB 3C5XA 2X87A 3GB7B 3ERXA 3U4BH 1AGFB 4QHPA 1ULVA 1OOWA 2GHWB 3GFUA 6PAZA 4A66A 1W8OA 2DTML 2LAAA 2DKMA 5HYSA 4KK5C 4EI5B 1RH8A 4WKZA 5GGRA 5GJTH 3JWDL 4QTHB 3WKML 1N3NB 3JV0A 2YARA 3QG7H 4LCVA 2UZPA 5ILTL 4JFTA 2ZZUT 3D52A 2CGZA 3KXFB 3P4OA 4PLKC 5C07E 4OCXH 1C5CL 4UTCA 5C08E 4OLYH 1D6VL 5ANMB 1UJ3C 1GAFL 1C1EL 1EUTA 2G0KA 1T80A 3V6BR 4MZRA 5BZDB 4OB5L 3HG1D 1U8PB 2X4QB 3SZ6A 3SJVA 1ML0A 1DEDA 5IHBA 4M7LL 4A2LA 1QVOA 2H5UA 5IG7B 3O45B 3I75B 2BHYA 3CGTA 4M8QA 2W59A 2YEZA 4HCFA 2BVPB 3HMXH 4ODXB 4HG4J 1KSRA 4I1RA 2VN3A 2VJ8A 2YD8A 1S7VB 5J1TC 4QHLB 1U95A 2WVUA 5IVXF 2D7TH 1PZ2A 1F6AA 2O5ZL 1FVDA 2J7LA 3QIWA 2XICA 2BY3A 1LK3L 2OMTA 5KAQG 1LP9F 1H3PH 2EO1A 2GT9A 4OGYH 1WBZA 2BNRD 4JFPB 4R7NB 4IMKC 4G6JH 4UZUA 4HZLB 4D0BA 4A7TA 2EH7L 4MHHG 4KJPC 4OFDA 4NQCE 1Z5LA 5HVFB 5AG8A 1P7KA 5SWSA 3Q8FA 4WUUA 3SPVA 3OXRA 1S9WA 2PCFB 3HC4H 4G8IB 5DYOA 3GZQA 4WWNA 2F74A 3RX9A 2OI9B 3QJXA 1SDYA 4JB9L 3VSTA 1HQRA 1QSFA 1THCA 2FJFA 4UM8B 4UQCA 1IAOB 4EF3A 2ZD0A 1EK3A 4JDEA 3T77A 5E9DA 4B9JA 2GVYA 3K8LA 4HMEA 1EJOL 3N43F 3BIKA 3T65A 1MCWW 1SOXA 2AGJH 4LQ1A 3Q2WA 3LDBB 2WXRA 3QQ9C 2O5XH 4N0FB 5LWYL 3O0LA 1DDHB 2GHZA 4E0RB 2YUWA 1UYWH 3RHWK 5L0QC 2C3HA 2NUTA 2C3VA 3K46A 4KH2A 5I5RA 1I85A 4NI6A 1F4AA 1RIVL 2OM5A 3BCDA 4HCGA 4P2OD 1FYTE 3MLSL 1OE1A 4WJ5A 5E6IB 2Q2EB 2X40A 3QC6X 1OW0A 2R56L 2YKLL 2XHNA 4G8EB 2IDCA 2HFGL 5I24A 1TQVA 3FQNB 1ZLDA 4AENA 5DI8A 4YHZL 2GFBA 4ISVB 4KZEL 1B4TA 3DBSA 4FNLL 2JQAA 4WU7A 4BCXA 5E08L 1J48A 3DJRA 4L4VA 3FTVA 1RUKL 1D9KC 2ZSWA 1FGVH 3AY4A 1KCBA 4H0IA 1H6EA 1J10A 2WBJA 1U41A 3QNXB 2QKIC 4X4XB 5F9JA 4DN3L 4ANVA 3ARPA 4YHML 3MUY1 4D94A 3MOAL 1RULL 2KHAA 3TZVA 4IHOB 4L3CA 1UD2A 5DEFA 3S5ZA 5DMYA 3O3AA 1AS6A 3VYOA 1LMKA 3AITA 3LX9A 2VH5L 2EYTB 5AL0A 3S6CA 5IGXL 1MIMH 2VW4A 4FNPA 1KYOK 1XH3B 3BAEL 2Z1PA 3X1EA 3MV8A 3OZKA 4GKOA 4M6OH 4HF5L 1QSFD 3ROOA 4KJQD 1YC8A 3JWNC 1GXEA 4KBPA 2YPLA 5HHOA 2K7PA 1VEPA 3T8XB 5JA8B 2WWKT 1KLGB 4KQ4L 3ULUF 4J23A 3KEHA 4MD0A 4Z7OB 4MAUH 1KBPA 2FSEA 1MFMA 1E5ZA 2CLRA 3S4SA 3D4CA 3IF1B 4GUPB 3QEHB 4QT5A 5AZEH 2Y7MA 3JTTA 1NGZB 3QIUA 1A8JH 1PY0A 1FH5L 5KSVA 9CGTA 3OPZH 5HDQH 1W2KT 4XO4A 3QJTB 1KLFA 2ZSVA 4OQ1A 4WENB 4OAWA 4YEFA 2F5AL 4HPYH 1T20B 4TN9A 3TA3B 3WIAA 3MUJA 4ZS6C 5LXGH 4X9FA 4UIKH 4X8XA 4PI2A 3BAWA 1FO0H 3SO5A 3ZDXF 4YL4A 5K9QG 3GM8A 1DVFB 2HG0A 1VACA 2OSLA 3U2IA 2ZWKA 5I6LA 3LDBC 2MJWA 2CGRH 1SYSB 1Q9KA 4MVBC 4KKQA 1TZHB 1HFUA 3FRPG 1R34A 3V4UL 3RX7A 1D5RA 1NKGA 1JZ7A 2OR7A 1R3JA 5IROA 3VH8B 3DUSB 1OLLA 5E4OA 5AAMA 3ZDZE 2Q2LA 5GS1B 2WBJD 4I5BA 3REWB 1XMWA 4IIQC 2BZDA 1BJ1J 2YPKB 4MAYA 2V8LA 4F2MB 1G9EA 4N0YH 3DO7A 4RAUA 1BFVH 2G2PA 2R8SH 2B77A 4YIQB 1IFGA 1RK0A 3TCLB 2W07A 2HRGA 3S3JA 4JN2B 5KVEE 5FUOL 4MMYA 4AYSA 1A6VH 3EBHA 2Z1KA 5BXFA 3MV8D 3OSVA 3ARDA 3FN9A 3P0YL 5H94A 3TV8A 4OIIH 4F7TB 1ZS8B 3KBPA 5DJ2A 1IX2A 3S36L 4HKXA 4ZX4A 2N3JA 2YK1L 2GI7A 3MUHL 3O4LD 5T5FA 4XR8C 2J88H 5KJ7E 3B9KB 3IDIA 3TBVA 4HUCA 1U8IB 1H8LA 3O6ML 3FULA 4RGOL 2VDQL 3QJHA 3CC1A 4GT0A 5B21A 1IM9D 3J07A 1YEHH 4PJ9B 3LXCA 4YE4H 3MLVL 4NRZB 4TQEH 1MHEA 4MXWL 4NJ9L 1QO3A 5M94B 4MWFB 1YECL 1WSST 2J8OA 1KXVA 5E7FA 5DD1L 2EE2A 3ZE2F 5A7BA 2OSYA 2CKBB 5DZJA 3B9DA 2NY1B 4CSTA 3PJSB 4FFVC 3GMNA 2IANA 4EIGB 3C6LB 2JJUA 4OLXH 4L9LA 3DOIA 3IU3A 1N5YH 1J0YA 4LU5L 4YPJA 4RLDA 3U46B 5IQ9B 1X4YA 2XG5B 1HZLA 4OGXL 2J1KA 3QWNA 1E6JL 2R0LL 3F7QA 4NCDA 1J87A 3CU1A 3LNGA 4JPKL 5I2IB 3VM7A 1NICA 3K8KA 1G4MA 3D33A 3LKRA 5EU6A 1J8HB 1EAQA 2XRAH 4UINL 3WSQH 5MENB 2AABH 1AANA 3GPSA 5FO2A 1A9EA 3TA3C 4L0YA 1JHTB 2FLRT 3FB5A 5J3HD 1UVQA 1AIFB 3LPPA 4LB8A 1WEJL 4NKOA 4X5XA 3IFPB 3FAXA 1DBMH 3M6DA 1ZVSA 2GITA 1WT5C 3UGUA 1AHWB 3N85L 4WWOA 3VWJC 2VMDA 5SX4I 1KB5A 1JHLL 3I9PA 5D72H 2YWZA 3QORC 3NSJA 4IGBB 1QFPA 1XGPA 4ORGA 3V4LA 1ANUA 2E9IA 4XH2B 5I1JL 1ERNA 1KTKE 2ICWJ 2AXGB 1CFMA 5C2BH 1QI4A 4BFGA 5KWYC 2ZNXA 2ZP9A 4NFDA 1FV1A 1NC4B 4XZ4A 4HIHA 4OI8A 3NIFE 2W60A 4MMZA 4KKPA 1WFTA 5IQLA 4N0CD 2N4IA 4QRRA 3QXUA 4F7EB 1P6FA 43CAA 5EC2B 4UU9A 2WLHA 1SEBA 3CLEH 4FEMA 4AG4L 1G7LB 1JGDA 1KXTA 3FCSA 1S7QA 1T6WA 3S9DB 1JZFA 1QRNE 4CSZA 3KWUA 1K9TA 4R26H 2IPTL 5F96L 3BIAX 3BKML 1DVUA 3O3EA 1NPUA 2A9MH 3DXAD 3N42F 5GGUA 3K71A 2I7SA 3MA9L 3QNZB 3M1BA 2BLFA 4IEFB 4ZMOA 3ASNB 2EEBA 3FCGA 2UZIH 1IFHL 5IMMB 1NCAH 2FT7A 3P0VL 4D7PA 3VXTB 2M1KA 4X5LA 1KEGH 5CZKA 5A2AA 2E7MA 5BJTB 5JW5B 4PJ9C 4X7TB 4Q56A 1GC1H 3QRLA 5DHEA 2GEEA 5FGBA 2WC7A 4M03A 1R3KB 3MLXH 4R90L 5CBAA 3FTZA 2W38A 5M95B 2FGWL 2BRQA 2WXFA 4A6YA 3NJXA 3VXPA 4ODTL 2DEXX 4LZKA 1GGIH 3POCA 2ICEA 5EO9B 2O5YH 4FULA 1KJ3L 1CDBA 2K8QA 3D4YA 5D2NB 3FUKA 3APMA 4XZUA 1AE6L 3DI3B 2H3KA 4GRLA 4OM1L 1X5MA 4PBVC 3W9DA 2ZJSH 1JCKA 3V4VH 4F9PA 4RMVA 5CP3A 1BZ8A 2FCBA 2CBQA 5GZOC 5E8OA 3WKPA 2P5WA 3Q8CA 5I16A 1A9BB 4DAGH 1A3ZA 5CN3A 5C09E 1D3CA 1WAPA 1ZK9A 2EDJA 4PREB 3ZXAC 4P4KB 1RIUL 1ZEAH 1OGPA 3QUGA 5FK9B 3MI6A 1ETA1 3SDDB 4ELKB 4YFEA 3UAEA 3AU1A 1RZGA 3CVIH 4LAQH 1KLUA 3ELQA 2F58H 5DWPA 1AHWC 1ZK5A 2FX8L 1ILSA 2EEFA 1AVAA 4N28A 5D7JD 5T1LB 3C6SB 2MKLC 5TGBB 1JP5A 1BDYA 3IEAA 4JRLA 3QUXA 1KULA 4DK6A 4IGBC 2IMMA 1GL4B 4IRZA 2FUTA 2PR4H 1A4BA 1FBIL 3E2HC 5AVVB 1EAJA 5BZWA 1P5UC 4N24A 3GF8A 3OKMA 1XGZA 2CDEB 3GUTB 3VXQA 3VE0B 4MNGB 2X4PA 4Q97A 5GRXG 1RUAL 5CZVL 1IB5A 2Z7YA 4M7KH 1CXLA 1N18A 4I0PA 4PJ5E 4XNMA 1X4ZA 1ZJBA 2YQ2A 4X6EB 3OMAB 1T4KA 3QXVA 1LM8V 1CCZA 2YOAA 2AHIA 1IGTB 4X6DF 4S11A 2UY6B 1M9WA 2APFA 3H42H 3L5XL 2GSGA 5ADPH 5E8PA 2OYLA 2BVOA 2B5IB 1U8JB 4RAVA 1QPKA 2BOLA 3NSFA 4ODVL 1QBMH 3NSYA 3MO1B 3VFSA 3B2UD 3CZLA 2YGVA 1YEFL 1V3KA 2GIYA 3GQFA 4BZ1H 3LEYH 2CNYA 5E4EC 5L7XL 3MFGB 4ZMYA 4FLOA 2NY6C 1CE6B 2Q8BL 3GBNL 4JNXA 1YRKA 4LIQH 1BLNB 1EERB 4AJVA 5HYSG 3BDXA 1QUNB 5IFAH 2RJMA 1CFVL 2GBAA 1NFDA 3GTVA 2WXKA 4KK8C 4QRSA 3RB7A 3RFRA 3L4UA 3BSGA 3DO4A 3D07A 3HKZA 3E7JA 3F8UB 1I8MA 4QTIH 4U6YA 3MACH 5TE7H 1UXMA 3DETD 3M7FB 2DYSB 4WLCA 5AAWC 4Y1AD 2P5WD 3ESVF 3FT3A 3D05A 3S8FB 4PS4H 2VDRH 3ILPB 1CYWA 1HNYA 1EZVY 4LPTA 3W39B 2DH3A 2Y07H 2E59A 4LT7A 2P3YA 3S3CB 2HFFA 3CC5A 1W15A 4U1HA 2C1PB 3KGTA 4FFYL 2HUEA 4PRHA 2Y0SA 2GSMB 2CH8A 1U8NB 3II1A 3QEUA 4HUNB 4NCC1 4UT6A 3UFIA 4YHOH 5IHHA 4PRDA 3FK3A 2IAMD 3ARWA 2XG4A 1U8HB 3KS0H 4JY6B 4JQVC 5SX4H 3VUAA 3AREB 3T3MF 4EQ2A 4LFHD 4DUWA 4F1ZA 3AFLA 3G7TA 3T9WA 1UD8A 4ZW6A 1LE9B 3SPHA 3GSRA 2JKLA 1F11A 1DLFL 3X12B 3BPNB 1ILUA 5F7NC 2F0CA 3QUZC 3KNBA 4L1DA 1C5DB 2WXMA 4PJBE 3DHPA 3SDDC 2QT6A 4I0PD 1GSKA 3X3GL 3WIIL 3NDZE 3JXAA 1A5FH 3HI1A 5B7EA 4BK5A 5KANI 3ZBMA 1KGCE 4F37K 4HUXB 1N6QH 4EI0A 5DT1H 2H0PA 3MOBL 1CUOA 4P04A 2P42B 5KJRH 4NO0B 4UUJB 4XPFL 2YQGA 4TYUA 5ICXA 3NSXA 5C0CB 1Q9OB 3UJJL 3P30L 1YUHA 1RUQL 3OMZA 4JO1L 4RFEA 2CRZA 4H40A 1SY6A 2VDPL 2AERT 4P23D 3WN5B 1YN7A 1Q72L 2Q6WA 4R6UA 4YAQB 5FW7A 4RWYL 1IL1A 3TNMA 3MNDA 2JKIS 1HQ4B 3NIDB 1AGCA 1K8DB 1GPOL 1H15A 2FEEL 1JZ3A 1G84A 3AQZA 4KWUA 3NFNB 4DTGH 2CG9X 1AC0A 2AK1H 3ALWA 3RPBA 5DQ9B 3HAEH 3V7MA 2PO6A 3RZCA 2JXMA 4L1BA 5AKSA 2IPKB 4LHUB 5C0AD 4JY4B 1EVUA 2Y06H 3BKCH 1Q94A 3ROLA 1TCRA 4EMZA 2VW6A 4G1EB 2WOBA 4JFDD 3IETA 1YMMB 1P1ZB 3L1OH 3DX8A 1N10A 1DP0A 4Q4EA 3SKOB 5LAXA 4HSQA 3NABH 4D0CA 3QJZA 5C0JA 3NFSH 4M1CC 1EWHA 2IOOA 3RY6C 4PRHD 1EJ6A 2HH0L 3HLAB 4P3CH 1C08A 4R5TA 3T6WA 1J0IA 2XWJB 1F3JB 2PCPA 2DQIL 4GXVL 4XPTH 3UDWA 1XEUA 5TDOB 3GLDA 3HMWL 4G6ML 3KW7A 1TJIL 2CBTA 4JRYD 1T1WB 2WQAA 4XWOD 1IQDB 1BFOB 1CLVA 2ZWYA 4LNVA 4D0DA 1SPDA 1WWWX 3MGAA 4WFHE 4M5ZL 1C5BH 3IB4A 3KPLA 4JAMA 1WFNA 3Q8AA 4TSBL 3SJVE 4LSRH 4AGLA 5IWLA 3JTBA 5GGTA 4NO5B 2DLEA 2V8MA 2JTDA 2J4WH 3WKYA 3AS2A 3SGKA 4LEOA 1FL3B 4NWTH 2HT4C 4MMXB 4ZTPH 3AREC 1AI1H 1GTNA 2NRDA 3QFGA 2WBWB 4FLSA 3EJZD 2R23B 4NKMA 1YY9C 3LQZA 4FFWD 1KBBA 4LDLB 4HIJA 4Y19B 5CLYA 2EUVA 4XBGA 1HS6A 4FQCH 4LLWB 3S98A 3PDGA 1BM7A 5EOCL 2BSBA 3F7YA 4G7VH 4EZLA 4FKKA 4JPVH 3RAJL 1LO5B 2FQFA 4M62L 4JFFA 2YD7A 5EU7C 1LD9B 4Z7OF 4W6XB 3ILQC 1DJIA 3LKQB 1F4XH 1E4KA 3SD5A 7PAZA 4ZW8A 1BV8A 2PO6D 1CTMA 4EKXA 2J8HA 3MREA 3Q5TA 5EIQA 5SWSE 2O61B 1ZTXE 4LSUH 4WUUE 3RRQA 2EDOA 4F2EA 5AD0B 3LS5H 4KMQA 2AKRB 1CN4A 3QQ4B 4QXTA 3AQYA 4UNIA 4L5FE 2BNQA 3G6DH 3U82B 3Q8EA 4XB3A 1TJXA 5E9DE 1WIUA 5L9DL 1JK8A 5L88H 2X9WA 1NOAA 5D1ZA 3MNWB 4LK4A 4ZTEA 2WGXA 4JDVA 3QRGH 1VERA 2UY7A 2VXQH 2K3HA 3FSOA 4Y2OB 2APVA 2Z34A 2WKLA 4HJSA 4QMEA 4G8GB 1IM3D 4ZUVA 5B22A 4EQ3A 5TQ0H 2V7HB 1PW3A 2XWTB 1T0MA 4APQB 3EJRA 3RGVA 5K9OA 4Y5XB 3PYCA 2BFVH 3L8QA 2CO4A 4OZGF 4RFOL 3VXSB 3BH8A 1CICC 1CGXA 1HHHA 5L8KB 4GQPH 3WIHA 4AYMC 2APSA 3L9RA 3ILDA 3VXME 1B0RA 1RZKC 2FZ3B 1U8MB 4N2KA 5DD6B 3CX5K 4UT7H 4UZGA 3V95A 5K9KB 5I8EA 1CYGA 1OTUC 4IQHA 4KTEH 4XT1C 4XPAH 4HWEL 5I66B 5EBLA 2F54B 4FFZA 3OAYH 2PWGA 4N8CL 3S34H 1EGJH 4JUSA 4L4VE 2GTZB 4U05A 3H9SA 1SEQL 1CLOH 2NY5H 5EBWA 5B39A 2EKSB 4IRSC 4AQAA 4JO2L 2L4OA 3FQWA 5ISZD 4NNXA 4ZO8A 1B9ZA 4JFFD 1GOFA 2X41A 2YD4A 3MLRL 1ITBB 2R4RL 4WWKC 5LQBL 4HK3J 1IGCH 1XXDC 5BS0E 2E6JA 1I9JH 1N7ML 4I1NB 2ZKHL 5DO2D 1E6OH 4QUOA 3VG9B 1IC1A 4AEHL 1GS6X 2QDWA 3C5ZD 1P84J 2X4TB 4POZC 5CINL 1A64A 1GZPB 2UWEB 2CO6A 3BGMA 4LRIA 5A6IA 4MCZB 4I77L 1D5BB 2ROXA 1Z9NA 1JGEA 2CDFA 2YPLE 1HYSD 3IDJA 5HHOE 4NN7C 3OB8A 5KZCD 1A1NB 1D5XB 3F12A 1RK1A 1EJFA 1KC5L 3RA7H 3HE6B 3FSZA 1VDGA 1G9NH 2Z31A 2G75B 3JYBA 3UTPD 2CIIA 3KH3A 4X6CE 3RDJA 4W9CC 1BREA 4U3SA 4BXSV 2VDMB 3EYUH 3HZKA 1I3GH 5BRPA 1I9EA 2GY5A 2XDHA 3QFJA 1BAFH 1FG9C 3QHFL 4KMTH 4L4TD 5DZVA 3IN0A 3RGVD 3CBJB 2HRHA 3RKDD 3ZZQA 2P24B 5IK3B 1GVIA 2FSDA 2OTUA 5IEKA 2VDLH 3QO1A