1A4AA

Azurin mutant with met 121 replaced by his, ph 6.5 crystal form, data collected at 16 degrees celsius
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
129
Chain Sequence
AQCEATIESNDAMQYDLKEMVVDKSCKQFTVHLKHVGKMAKSAMGHNWVLTKEADKEGVATDGMNAGLAQDYVKAGDTRVIAHTKVIGGGESDSVTFDVSKLTPGEAYAYFCSFPGHWAMHKGTLKLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rack-induced metal binding vs. flexibility: Met121His azurin crystal structures at different pH.
pubmed doi rcsb
source organism Achromobacter denitrificans
molecule tags Electron transport
molecule keywords AZURIN
total genus 29
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1a4aA00
9PCYA 1NIBA 1AAJA 2BW5A 4G7QB 1BYPA 3X1GA 5I6LA 3G5WA 2PPEA 3S8FB 2Y69B 3QJTB 2HXAA 4NERA 5PCYA 3U25A 3FU8A 3EHBB 2VMJA 1X9RA 4HIPA 2YAQA 2PCYA 2W88A 4KO6A 2LLNA 1PY0A 2WO2B 2J56A 1PNCA 2PPDA 4BXVA 4YSRA 4E9SA 1W6WA 4YVUA 2VSMB 1JVLA 2DYSB 3X1FA 4X4KA 3PXLA 4F2EA 2B3IA 1URIA 2H3XC 2YAMA 3WIAA 2AVFA 4Q8BA 1PAZA 1W8EA 5F7AA 4A2HA 3PPSA 4A68A 1WS7A 1AANA 3NT0A 4BXSV 2WO3B 4YSEA 1NPJA 3HEIB 1ILSA 1NIAA 2XWZA 4AKQA 5F7BA 1KBVA 3PCYA 4AKPA 2XX0A 1SNRA 2IDUA 3S3DB 2IDSA 3NSYA 3QJRB 2BO0A 2BWIA 4BWUA 4QLWA 2PPFA 2VM3A 1GSKA 3OMNB 5B7FA 1JZGA 2PP9A 5LDUA 4E9RA 1NIFA 1VLXA 4BK5C 1ASPA 2AZUA 2X87A 1FFTB 4CSPA 1KYAA 3FSVA 4DPBX 4YSUA 3GDCA 1W6LA 2VM4A 2XYBA 3ABLB 4F2FA 4HCFA 4YSAA 1I53A 3MX0B 1AACA 1OE3A 1XMEB 2Y1AA 2UX7A 1AS7A 3PAVA 1SHWA 2I85A 1RZQA 2IWEA 4KNUA 4A67A 1N70A 1PCSA 2QDVA 3ABKB 1CYWA 1ASOA 2VW7A 3JT2A 1CURA 6PAZA 3DIVA 4KO5A 2MTAA 1IC0A 1TU2A 1GS7A 1OCOB 1RCYA 1WAEA 5I26A 3QJUB 2B08A 4E9XA 1EZLA 2PCFA 1PF3A 1MZZA 1WS8A 2Q9OA 1ADWA 1RKRA 2HRHA 3FQ2A 2XXGA 4YSPA 1J9RA 4DP6X 2IDFA 3T9WA 1QNIA 1PNDA 2H5UA 3CVDA 1AZRA 1E65A 1AS6A 7PCYA 1AZUA 1PMYA 1ILUA 1UATA 1MDAA 3AG3B 3CDZB 2XV2A 2YAHA 3OM3B 1RZPA 2X88A 5B1KA 4ENZA 2QT6A 2OV0A 3CDZA 3AY2A 2GHZA 3IN0A 1XB8A 1JERA 2UXTA 2TSBA 2YAOA 3QJQB 1M57B 1J9SA 1A8ZA 1GYCA 1SFDA 1TEGA 1BXVA 4W1TA 5I6MA 2P80D 2IH9A 4JHUA 1J9TA 2VN3A 1M9WA 1AS8A 2VW4A 2FT6A 4DP4X 2YXWA 1NIDA 4UF7C 1JZHA 2AZAA 3ASNB 5B7EA 4EF3A 1E30A 1A4AA 1IKOP 1BXUA 1DZ0A 4KO7A 4ZK8A 1ETJA 3TBCA 2TSAA 2J57A 1NTDA 2XX1A 5I6KA 2BP0A 4WKXA 1GY2A 1AOZA 2GC4C 3IEAA 4AI7A 3QPKA 3N55A 1OCZB 1QHQA 1KDIA 5I6OA 4UANA 1AQ8A 2AANA 3V9EA 1ZDQA 1L9PA 1R1CA 5TK4A 5I28A 4E9VA 3SQRA 5D4IA 2XLLA 3ABMB 2VSKB 3OMAB 1E67A 3DKHA 1DYZA 4M4RB 3TBBA 3UACA 1E5YA 2PPCA 3FSAA 2XVBA 4GP8B 1TKWA 3KW8A 4N4YB 1IBZA 2N0MA 2FTAA 2YAFA 4F7KA 1PLBA 4G72B 2QPEB 3S8GB 4W9ZA 2E86A 3ZX1A 2FT7A 4HZ1A 1J9QA 4YVNA 1JVOA 5B1AB 3JTBA 3NP3A 1A3ZA 4YL4A 2HX8A 8PAZA 4KO9A 1BQRA 2BZ7A 1NWPA 2YXVA 1JXFA 3IBOA 2HZHA 4BWTA 2FT8A 4HAKA 1ET8A 4AZUA 3X2QB 2NRDA 1OF0A 3PAZA 1L9OA 1AZCA 1OCRB 4JHVA 2JKWA 2PP8A 4HHWA 3T6XA 1ET5A 1AZNA 2VW6A 1CUOA 3KW7A 2PPAA 4BWWA 2CAKA 3HB3B 3NJJA 4FA7B 2A3TA 2IWFA 3IN2A 1CC3A 2PP7A 5ANHA 3NP4A 1A4CA 2P80A 1NDTA 3C75A 4DP1X 5FC9A 2JXMA 1BQKA 1SHXA 1T5KA 1BYOA 1PZCA 2YAPA 3FQYA 4HHGA 2GI0A 1M56B 7PAZA 3X1NA 3NJFA 1OE2A 1GR7A 3BQVA 3NYKA 1A4BA 4A2FA 1KCWA 5AFAA 4BDVB 1ZIAA 1SDDA 1ID2A 5B1JA 3S3BB 1NWOA 3FSZA 3CZUB 1PLAA 4P5RA 3GYRA 3BVDB 3WKQA 4WTQA 4GY4A 1FWXA 4TXVB 3OMIB 4L0PB 2MRYA 2I7SA 3NSCA 2XXFA 1HFUA 1CYXA 3ZBMA 2XV3A 1XB3A 5AKRA 2R7EA 2XUWA 3CVCA 3NJGA 3PAUA 3ZIYA 1GS6X 4G70B 3WNJA 2CBPA 3QJSB 3UABA 1L9TA 3H4FA 3CG8A 4DP2X 1PZBA 3QQXA 2R7EB 5PAZA 2J5WA 5I6NA 2BP0B 2GC7C 3X1BA 1ZPUA 2FQGA 3AZUA 4A2DA 2ZXWB 2GIMA 3NJHA 5B1JC 1TEFA 1OCCB 4KNTA 2UXGA 5IY5B 2ZONA 2PLTA 5D4HA 4Q89A 2BZCA 1IBYA 3FPYA 3S3CB 3T71A 1JXGA 4YSSA 1FA4A 1J5DA 3ERXA 3ABGA 2RACA 3FQ1A 3AW5A 3FU7A 2I7OA 4FAAB 3IE9A 3GXUB 5E9NA 2ZWNA 4A66A 3UADA 1QLEB 3FU7B 1BQ5A 1EHKB 4E9YA 1ZIBA 1AZBA 2BWDA 1V55B 3TU6A 2FQFA 6PCYA 1BEXA 4E9TA 1JOIA 5B1BB 3FYEB 1NPNA 3RYMA 2BP8A 2FWLB 2XU9A 4G7SB 4NAJA 1AG6A 2YAEA 2DV6A 1AG0A 4NB7A 1IUZA 1OOWA 2HLEB 4YSDA 3WI9A 2CALA 4PCYA 4DP8X 5D4JA 2HX7A 1E5ZA 3SBQA 4DP9X 3H4HA 1B3IA 1JXDA 1KV7A 4HALA 4UAHA 3TASA 2EILB 3EF4A 3WNIA 4BDVA 1L9SA 2BW4A 3EH3B 3FT0A 4MFHA 2W8CA 2GSMB 3NSFA 4YSQA 1F56A 3D12B 3MBWB 1L9RA 5B3SB 2CJ3A 2Q5BA 1X9UA 4A2EA 2IWKA 3TA4D 4P5SA 4GYBA 1SF5A 1KDJA 1JZEA 2QPDB 2UXVA 1J5CA 1N68A 1AIZA 3FPXA 1WA2X 2BHFA 3AG2B 3FU9A 4AX3A 5TK2A 1JZJA 3PLYA 4CSZA 1MG3C 1WA0X 2WSDA 3H56A 3FS9A 2YARA 3UAEA 2IDTA 3L45A 2QDWA 1A65A 4KOBA 3CVBA 1KCBA 5B7MA 2HRGA 2UXFA 1JZFA 1KBWA 4KNSA 1KGYE 4YSTA 4DP5X 2FQDA 2H47C 4DPAX 2IH8A 1OE1A 5EHFA 3SBPA 1PLCA 5I6PA 1SFHA 1ZDSA 2FJSA 3ZDWA 4DP0X 4DP7X 1L9QA 1ZV2A 1PZAA 3NSDA 3ASOB 3AG1B 4G71B 3NJLA 2CCWA 4RH4A 1GS8A 1MG2C 4E9WA 1ET7A 5I5MA 1XB6A 1GY1A 2HX9A 4KOCA 1SF3A 4PAZA 5I5IA 1JZIA 4AKOA 2GB2A 5AZUA 2DY2A 3AG4B 3FYIB 3UGEA 2OJ1A 4HCIA 2EIMB 1NIEA 2JFCA 3FSWA 1AR1B 2OCCB 3NJNA 3EH4B 4JKNA 2FNWA 1GW0A 5A7EA 1WA1X 3SBRA 3WKPA 1SJMA 1NINA 2AFNA 4A2GA 4N8UA 1BAWA 3NJMA 4GXFA 2ZOOA 3T6VA 3WG7B 1V10A 4DPCX 2EINB 2BP8B 3T6ZA 1BXAA 1HAWA 2J55A 4HCGA 1HAUA 3OQRA 4GP4B 1YLBB 2DYRB 4GP5B 3V9CA 3T6WA 4G7RB 2IAAC 2YQBA 4E9QA 2DWTA 2CUAA 2GBAA 3N2JA 3QJVB 2XV0A 2EIKB 4YSOA 4YSCA 3NJKA 4K9JA 3OD3A 4M3HA 5I5JA 1V54B 3EH5B 2EIJB 3NJIA 2DWSA 2IDQA 2UX6A 1NICA 1OV8A 3UAAA 1SDDB 4QKTA 1NZRA 3X1EA 2FQEA 1ASQA 3DTUB 1MZYA
chains in the Genus database with same CATH superfamily
4JQVA 2KT6A 3VQLA 2A74A 2OR8A 2NW2B 4KXDA 2EVIA 4G82A 2BNRD 4TUOB 2GCYB 3I50L 3ZE2F 5T3XD 4AGPA 3JWNH 1ZVSA 2J6EL 4G6KL 5ICZA 3UTQB 4C57C 1MIEH 2YA2A 2Q7NA 2VLRB 2WOBA 2ZOWA 3HMXA 4HV8B 2LLNA 2NPLX 4GI9A 3KCPB 1HWHB 2F54B 2AJUL 5D9SA 2Z7YA 4GMSL 4YSRA 3BKMH 4O02L 2YD7A 5GPRA 5T3XH 4BXVA 5E9DD 3VSQA 4YHKH 3PXLA 3L4CA 4XPHL 1QA9A 1MVUA 3JXAA 4XMLL 3WIAA 2GK0A 2IAMB 2V5RA 5L6YL 3EW3B 5CD3B 2K3HA 5HHOE 1CO1A 1H0DA 1H8NA 4OZHB 5IW6B 3IAGC 3CMGA 4JPSA 3VB8A 4FF9A 5E9AA 2GK0B 2IAMA 1NFDA 2Q8BL 5CINL 5JORA 1XF2B 4NJ9L 1M6OB 1NPJA 3BFWA 2CJTA 1AY1H 4KAQH 1UUSA 4ZS6C 2WZAA 5DD0L 4QJ3B 3KXFB 4LKXA 4LEBA 5JDSB 3U4BH 1RLWA 1KGUA 2OTWB 5CEYB 4AW4A 4K5LA 4PJ8B 3L7FB 5I8KL 4GXUM 1HINL 1KXTA 4V1DE 3RA7H 4JM0A 1NKGA 3A67L 3FOMA 4V1DA 4S2SB 1OAKH 4QRRD 3QG6B 1KLGB 1YEFL 2FCBA 2OYMA 5JOFB 1A02N 4PVBA 4BK5C 5E99L 4LARH 5LBSA 2FJHB 4N1EA 5CLXA 3HKZA 5F8RC 3FB7B 2P8PA 1SUJA 1KYAA 3L9BA 4QHUA 5DHVH 2VR7A 3FUDA 3ABLB 4F2FA 1VGKA 1FL6B 5I8KH 4A38A 4PVLA 5IEHA 4Y19D 3EOBA 3ZKND 4RFOL 2G2RB 2VZTA 4W68A 3QFJB 2KERA 4XN2A 4G3YH 3ES6A 3SY0B 2O1AA 1OZUA 3MCLH 1JSYA 2HTLC 4KX8A 5F2FA 3RWJB 1B0IA 3D4CA 4EDWH 4AEHL 3D9AL 4ZX4A 3UC0L 3K80A 4AXWA 1A7OH 3M6DA 4UTBH 1RY7B 5J3HC 3REWA 4CJ1A 3ZR6A 3RWEA 3KH3A 4ZNEE 5I26A 4E9XA 3IJ9A 2I32A 2CLVA 3UAJA 4Q56A 5F6IB 3H0TB 3FQNB 3ZZSA 1FSKB 1Z0NA 2X9ZA 1JN6A 2YRPA 5DHYB 5C6WH 1NFKA 1PDKB 4RMSA 1FNSL 1PNDA 4YGAB 4E41E 5AOLA 2NY2D 5FKAA 4Y2NA 4XX1G 3ROOA 5GGQH 4JQIA 1IKNA 5HGGS 3ARDB 1EO5A 3QUXA 5FUZH 3UG4A 3MR9A 5JUEL 3P02A 4POYA 4XNXL 3N44F 5LCVA 3WFZA 1Z0MA 1RHFA 3I85A 2F8OA 4HFUL 2VMCA 3ETBF 3KAAA 3L2LA 1CLOH 1Q9LB 5L0QC 1J0ZA 1J8RA 1NGXB 5LGJA 3C2AL 1NFIB 1ZT7B 3TT3L 4Y5XB 1YECL 3ARQA 5AVTB 3S8WA 3IN0A 3LV3B 4HHAA 4LGRB 2ZX5A 4Y4KA 2Z4QB 3WSQH 2XSKA 1MVYA 4OV5A 4PWIA 4TLSA 3G6JF 1L0QA 2ADJB 1Z7JA 3T3PE 1U3HA 2PO6A 1HILB 4K23L 4N85A 4KITB 5MEPB 4FQXB 4OLUL 2H0PA 2IH9A 5H94B 1CI5A 3QWOA 1M9WA 4S1QH 3NAAL 3SDXA 1U3HB 1BQSA 2ITDA 1TMQA 3P40A 5FYLE 3AS3A 3QC5X 4M1GH 2ZOKA 2QHRH 2Y5QA 3TPUA 3VDCA 2CU9A 3TA3A 4AM0B 1YY9D 2BS71 3L5IA 4KRPD 4PVNA 2V2WB 2B20A 3MTXA 2YD5A 2P8MA 4I77L 4IRJB 4WTZA 3ZDZF 4XI5D 2XY2A 1MRFL 1CD9B 3QFDA 4AYMC 2XX1A 3ATEA 5DJ2A 3RGHA 2NY5L 5D6DA 4N2LA 2KQMA 3ULUF 2TRHA 1OB0A 1ICTA 4IBQA 4TVPE 1K72A 5AOKA 1A2YA 1CGSL 3P2BA 1BF5A 2QKIC 2ZG3A 5HGAA 3KWWB 3TCLA 4QRSB 1K2DA 2VITA 2IC2A 2HT3C 4G6AC 1IBHA 1DYZA 3RVXD 5DTFB 1DJSA 4G7YL 5AYUL 4E41D 2OP4L 5EO1B 4NGHH 4KMLB 3LMJH 1A4KA 5CBAA 5EEZA 1G0YR 3ARTA 5K9QI 4XXCC 3WKML 1MFDL 3KHOA 1SHSA 4U1GC 3JZYA 2HG5B 3C6LB 4MKTA 2K45A 1TYRA 2CRMA 5EC2A 3A67H 4GW1A 1QSED 4IRZH 4F91B 3QO1B 2CLVB 4GEIA 3RX8A 2YZ8A 3QXUA 4L4TB 4NQVB 3TM6A 4EUPB 3D2UA 5IVZA 2DW5A 1XGZA 3B5HA 3LS5H 2E74C 2KLRA 4Y5VA 4LBEA 3AROA 4I89A 4E0RB 5I1HL 5ANHA 4WRLA 3SE9H 3PF2A 1J8KA 1A4CA 1QR1A 1YDPA 5GRUH 1JF6A 4Q6IC 3OX8A 4JFFD 1HL9A 3PABA 3WD5L 5KVGE 3IPBA 4LLAA 1FGVL 5CIPA 1PZCA 1CFVH 4UQ9A 3UBHA 1NMBH 4AJWA 3I6LE 3GNMH 2R23B 3BQVA 2DQUL 1INDH 1UYWL 3D1MC 3MV7E 4M7LL 5D6CA 4R7LA 4I0PD 5AVVB 1HEZA 1KGIA 2WZ5A 5B8CA 2AJ3A 1VKXA 4WKZA 3AM8C 5K9JL 1LGVA 1ID2A 4Y5XC 1H5BA 5AWNH 2X9XA 2GTZA 1MDTA 5DQJB 5CJXA 4IBZA 1YNKL 3CDYA 1EVUA 4YHPB 1JGVH 2DKUA 3TH3T 1S8DA 4KUCF 2F8VA 1A47A 3HI6L 5FA3A 2BK8A 4I48B 3ZYJA 5EUOF 4CBPA 5E6IC 3HCVB 2A6JA 1CG9A 4X6FB 3ZBMA 3ZOAA 4JVWA 1ZOXA 4I48A 4XI5C 1HDMA 1PZDA 2ZTBA 4CVXA 3IF1B 3V6ZA 1BGXL 2ED8A 4HU2A 1I9RL 3ARGB 4PBDA 4XPGL 2DJMA 5PAZA 4WW2C 2J8HA 4G6ML 4TKWA 3QQDB 3KNBB 3F8UB 5F3HA 5CSZB 2QPSA 5DD1H 2WUCL 5EZPA 5JPNB 3FDWA 1TEFA 3BD5A 5AW5B 1HS6A 3IDNA 3ATAA 3ARFC 5DJXA 4O02B 1UWEH 1WAPA 2V6HA 1G9NC 4YUEH 3S3CB 2PCFB 3TIEB 3DV6A 2B5IC 1LD9A 1LEGB 2WQ8A 3Q48A 4HJJL 3X3GH 3R4RA 4I18A 2NTFA 5FYLL 3GZOA 3UDWA 3SKNB 1Z9MA 5AAPA 1CXHA 4ISVA 4EI0A 5IMKA 4NO3B 3GRWH 3CZLA 3UADA 1T2QL 2CDFA 4UT9A 3B7RL 1A8JH 4UT9H 3T0ED 5ESQB 4EI6B 2CIIA 4FNRA 5BMFH 2P49B 2RQEA 2W92A 1BEXA 1E4JA 3BUYB 1ETZB 1FE8L 1FORL 1PFOA 2V33A 3TURA 1K4DB 5EIIB 4KJQD 4HULB 2VDQH 1LWJA 4WJKB 4G9FE 2DEYX 5IROA 5SWZA 3RTQD 2LU5A 1OAZH 1R24A 4UTBL 3QI9D 3QNZB 5FF6B 3NSJA 4RSVA 3MLWH 1SJEB 5E00B 1MJ8L 5AW3B 3WO4B 4BQBA 1E5ZA 1U3JA 5AL0A 3RVWD 2EYRB 1U92A 4MXQD 2AW2A 2Z91B 1JXDA 3MN8A 5DLMH 2JKLA 1OGPA 3KWVA 4FI8A 1LEIA 4UWQB 1ZLWH 3ZDZB 2WKLA 2CE6A 3PWNB 4XXWA 1DSYA 1UASA 4DT2A 4EAEA 5INDB 3BSGA 1D5XB 4HKXA 5FYJE 2WV3A 4X4YB 3NIFE 3LXCA 2OZ4H 4Z7VE 4A63A 3CUPB 5KOVC 3V5KA 3OC8A 4AMXA 3EO9L 1CL7H 4HXAL 4WW2B 3ARXA 1Z2KA 4N8CL 4R96A 2F54A 4ZTOH 2IWKA 3TA4D 3WTXA 5E99H 2IJ0C 3N04A 3ZU8A 4Z5RA 1NC2A 5B39G 4X5RA 3V5KB 3IXTB 4N5EC 1JPTH 1Y18A 2DQFB 1HOEA 4NX0A 4OLEA 1TNMA 4MDIB 3IF1A 3V6ZB 2CLRB 2MOVA 2FX9L 4G1EB 4JW3A 1OK8A 3P0VL 4WEBL 12E8L 1KEML 3NZUA 5E08H 4UILL 4G9DA 2MCPL 3VM5A 3KGUA 5CJOH 4OZIE 1NQBA 2DH3A 1QSEA 1G1OA 4M7KH 1JVKA 1HOCB 1XR9B 4S11A 5A6IA 1J1XL 2FQDA 1NM4A 2IQAA 1WCBB 1PX4A 4GG8B 1M1XB 1QOKA 4LEOB 5D93B 1L9QA 4H1LH 4K8RH 3S6CA 4PUBH 1J86A 3V7AG 3ZO9A 3T1WA 4AIEA 2ZJSL 4MD0A 1MG2C 1LP9A 5FW7A 2EP6A 3TOPA 4XPTH 3LEXB 5D7JA 1WUZA 4CC0A 4ELDA 4NQCB 4G9FD 1SLUA 2GUOB 3QEHB 1MRDL 4DH2A 3MV8B 2W07A 5J6HA 2JFCA 1RFDH 1UB5A 3ULUD 5DC4B 1D5MB 2ROXA 3EG9B 2IOMA 1MW3A 3FT4B 3VXSE 3HI5H 2ORBH 2CBQA 3JWOH 5I71B 2YN5A 4NC0B 5AVSB 2XZAL 1HH9B 4KMQA 3T0EC 4B53A 5M94B 3O9WA 4MXVE 3HVNA 1YEEH 2EDYA 3BWAA 2GY5A 1FIEA 6TAAA 3CXDL 3T0AA 3POHA 1E2WA 3Q43A 3JTTA 4P2RB 4Y8AA 5DMIH 4N25A 4GH7B 3SYCA 2X0WA 2K3TA 1IFHH 4OVVA 4E5XA 1IC7H 2XV0A 5BO1L 4LLWA 1IZJA 4YSOA 3FN3A 5H37H 3REWB 4PG2A 5E0FA 3CSTA 5BW7A 25C8H 2CLZB 5TTRA 3NJIA 4F8TA 4Z7IA 4R6UA 4R83A 3ARSA 5J8OA 3RFRA 5IHHA 1OKEA 2NQ3A 1RPKA 1NDMA 5DHYA 5IVNA 1T1ZB 2ZNWA 3DVNB 2BIQA 4R4BB 5CR1A 1QRNA 4HIXL 3DDFA 1KTDA 3KLKA 4FJYA 2X6BA 1PD0A 3GBLA 4UINL 4EXKA 1H6UA 4LASL 3SO3C 1O7VA 3S8FB 2IEPA 4X99B 3QUXB 1OSPL 1JL8A 4X4YA 1BF2A 4GUOA 1NL0L 2DIAA 3MRNA 4Z7WE 4HKZA 3A6OA 3QO0A 5IEKA 3SDDD 3KLHD 1OGAE 3MRHA 1W6WA 1XXDC 3BFQG 1JGDA 5DJAA 2YPLE 3R8BB 1JXJA 2AV1A 5C2UB 1TVHA 1FZKA 3WAKA 1I1CA 3LVTA 4PY8I 4MMXB 2CR3A 3VCLB 3VXSD 1A6PA 1E3FA 3GLEA 4NKDA 3W56A 4A2HA 3PPSA 5BRZD 1GYUA 1AANA 3LPGA 5D70H 3MJ9A 2ZX6A 2XZCH 3SDXB 2BOCB 3MBEB 4BH8B 1ILSA 4QNPE 1ZTXL 2A1WH 2WQAA 3KDPB 2MSPA 4GUPA 2A83B 3QEHA 2VL4A 3CZJA 3C9NA 1WZMA 2VN7A 3TA3B 1NANI 2HSIA 4OZFH 4ZMXA 5IB3A 2AJXH 3S34H 4RFOH 2BWIA 1Q1JL 4N9OB 4YBLC 5LN4A 2XQYG 1ZEAL 1MJUH 4OQTH 4DERA 3MI6A 2F58L 2PP9A 4G6MH 1UD2A 1UB5B 5C7ZA 4FDWA 3M1OA 4B9GA 2J8UB 2VDPH 4QPEA 3ZRCC 3MLVH 4P2RE 4AH2A 3GKZA 1T4KB 4L8SC 3HJ0A 3RA7L 1GVIA 5L0QB 4YSUA 3P9MA 2XYBA 2V9TA 4XPFH 3HHMA 4TPRH 3MRMA 2DS4A 5FHAH 1HN1A 3S4SG 1XMEB 4N87A 1RUKL 3Q13A 1QSFB 1DUYB 4WENB 4MASA 3EJRA 1VF5C 5L6YH 2A0LD 3KPSE 1QATA 1H19A 3APDA 5AW4B 3RVUC 5K5YA 1S7RB 1JMZA 2O26U 1CJYA 3OAYH 4OGXH 5EU3A 4HFWA 3C5XA 4Q6YA 3LTVA 3WMQA 3DIVA 1N8ZB 4MNHB 1XAKA 5K9OA 1JV2A 3QS2A 1JHKH 3ILDA 1T0NA 3H2PA 1UJ3A 1B0WA 1TF4A 2XG5A 5C9JB 1ULVA 2XBTA 5D2NE 1FFOA 3PWJB 4QJ5B 1ZTXE 4YFLF 3FQ2A 1URZA 2XXGA 3CN1A 3VI3E 2R2CA 2IDFA 1F8TL 2FJFB 3UTSE 3K1DA 5IBLC 3QNYB 4F93B 3FF8A 1D2PA 3IRCA 3UPRB 1NAMB 2E8YA 4PB9L 5GS0L 1ZXQA 2K8MA 3CFDB 3LDBB 4JRYE 1N0XH 5FIEA 4JHWL 1EVTC 3W9EB 3O4LE 1TITA 4FLRA 4MQTB 5JPMA 4AEFA 1H3UA 4N8VG 5D7IA 3BIBX 5KUKA 4Y2OA 2AGJL 4OV6F 5C6TL 3HRZB 5EU6D 4PY7B 1L7IH 3E38A 4AK1A 5DJAB 1RZGA 3VXRA 1AI1L 2WXPA 1RURL 3TT1L 5D7IB 4IHBA 1QR1B 2YEVB 1KB5H 1A8ZA 2BMKA 2P43B 2UZIL 5DHVA 5D6DC 1IVLA 1G4MA 2OXHB 4NNYB 2QFRA 4PSRA 1HNGA 2O93L 1I3UA 1Z9SA 4UYPA 1E4WL 2DIEA 2ZSWA 3WS3A 3QUXD 4ZX5A 5L2KB 2JNZA 2ZXBA 4PV8A 1AQDA 3MNZB 3S7GA 3ULAB 3BKJL 4NWUH 4ZMZA 1A7NL 3UTTA 1Q0XH 3UTOA 5HHOB 4KI5C 2WN3A 4H40A 4P3DA 1ZA3A 3P54A 3QUMA 4CBZA 4G7YH 1NC2B 2EDFA 5BZZA 4N2OA 2C9XA 4N2FA 4D9QD 2JJTC 3V5HB 4KPHH 3ZO0A 4K8RL 3EYQC 4ZSOE 1DJHA 1LDPH 1PY9A 4U1IA 3L6FB 2QVMA 3F2LA 4FMVA 5TQ2H 2DAVA 2LAAA 1IV8A 1NCDL 1H15A 4Z7OB 3CU1A 1R5WB 1S46A 1A6UL 2VDOB 4ZI8A 5JXED 1KULA 1S9VB 2R1YB 1JPST 3MNVA 4EN3A 1S7QA 5F1OB 3ZQWA 2HLFD 3GSNA 3MJ9L 5I8EA 3ATDA 4GSRA 1ZAGA 2DH2A 4P05A 3EZJB 4HK0A 4XWGH 2VLKE 4WGVB 4YHYC 3HN8A 4ZX6A 3HG5A 3LPFA 3OWRA 4XX5A 4PJIA 4DKFH 5HDRA 1BJ1H 3BJLA 5H2BA 4JHAH 1IJNA 4PJIE 5IMMB 4DN4H 4V1DD 3NP3A 1A3ZA 3EYQD 2RGSA 2Y7NA 4KO9A 1ND0B 1NWPA 1SM3H 3HAEH 3N85L 4FQ2H 43CAB 1ET8A 1DZBA 3Q8EA 1OB1B 1KB9J 3C8KB 4XOBA 3U82B 4IOIA 4EIBA 3SDDA 2H8PB 4Z7NE 1F58H 4BGLA 2C1PB 4X9BA 3LN5A 4ELME 4IKJA 4FMFA 4OFIA 3HFFA 3HE6D 2PPAA 2FJFA 3HRZA 4ELMA 2L7EA 3B2UC 2OW7A 3MLYL 3K72A 4U49A 2PUQT 4RMTA 1FNGB 5BRZA 5C8JB 4PBXA 4QLRA 2XICA 3LIZH 5EUKB 2PKDA 5GXBB 2XQBH 3U79A 4P59H 2J1YA 1T03H 3SCMD 5D7IF 1TZ8A 4F92B 3I9GH 5EFIA 1QI4A 3SE4C 2ICEC 2YC1A 3NCXA 5SX4I 4F7CB 4HG4K 4WW2A 5GRJH 3DURB 5AFAA 1TJHL 4FXKC 1MFNA 1G9NL 3KBHE 4R0LB 1E8XA 2HB0A 3CNKA 4PJEF 3DWTA 4OF6A 3VQ1C 3FSZA 3BKCL 3DYOA 1INDL 1UYWH 1JFHA 2AAVA 2AK4B 2MPAL 2WXHA 3MUGB 3DX2A 4H0HB 4KROD 5B3JE 5HI3D 1AC0A 4LCCB 4GY4A 1JWSB 1U33A 2B3RA 2I25N 2X09A 5FGCE 3VD9A 1BFOB 1TTCA 1VA9A 5EF2A 3ZTEA 1P84J 1UCBL 3DC0A 1DQDH 4AGLA 1N7MH 5AKRA 4RIRA 2M1KA 3HZ3A 4K73A 4I18C 2ARJQ 4LPXA 2YA0A 2N01B 2Q8AL 1WFMA 4BA8A 2GJ6D 3OQ3B 3QUMB 5BOJA 4KX7A 1G1KA 2W0FA 4OU3A 3V4UH 2VOTA 3MRKA 2HJKA 1D7CA 2VLKA 3CSGA 3OV6A 4K3DH 4K4KA 2I9TB 1CGVA 2J8OA 2DJUA 1GOGA 2WNGA 3GSWA 4L8BB 1MIMH 3B2MA 4KNTA 4YK4C 5EO0B 1ID5I 1MWAL 1UH4A 5DUMH 3OZLA 3VRLF 1OF2A 3BW9A 4GPVA 4Q89A 2O5ZH 4P9ML 3GXMA 3B6SB 4WO4A 4YSSA 2F5AH 1RL1A 1E0OB 2B8OT 3UAJD 1QHOA 4UV4L 3MODL 4XCCL 1XCTB 2VLME 3BT2H 5DS2A 2DQEL 5E8DL 1IGML 3VFUB 4JY4B 4K7PH 1MY5A 2L3BA 5E8EA 3OZKA 1WIUA 2FR4A 4M02A 3M7FB 4NQDE 2B2XL 1MRDH 3VFTB 5KYXA 2BIPA 1HSBA 1EHAA 1WAAF 4XX1E 4Q0XL 5EOQH 4RETB 5E4IA 2YMTA 2IGFL 3TESA 5DMKB 2XPGB 1J0HA 4U2ZA 5M7QA 4LHUB 1DBKH 3BAKA 3IFLL 3Q7JA 5ITBH 4JG0H 5C09A 5KWYC 2WMPA 4GIOA 1QEXA 3TASA 3WNIA 1FAIL 4NUGH 3SD2A 1AGBB 1IQWL 4R0LA 2NX5A 3GXPA 4DN3L 3APNA 1FVDA 3D33A 3QPXL 2E27H 1J8SA 4Z7QB 4LIQE 4JLRA 4BQ6A 1JZ6A 1FF5A 4TVPL 4E2OA 3TO4A 5ID0B 4QRUB 1JDCA 4L5FH 1E9OB 4GKNA 5IQ9A 3G04A 1TJXA 1E7VA 4BSWA 2QBWA 4DN3H 3MLZH 4B0MB 2BHFA 2AK1H 2X4UA 4YR6B 5K1VA 5L4MA 1N64H 5D7JC 4AYFA 4L8CA 2A73B 5GGUB 3AMLA 4MDRA 1R3JA 3ARUA 4TVPH 3MV7B 1OGTA 1LO2H 3V4VA 1TIUA 2ZOLB 2D9CA 3DX0A 4K71B 1FZMA 1RZKC 1IC1A 3GMMB 5J9PB 1KB5B 4XNZC 3S48A 1FVCB 2MJWA 1FZKB 1KGYE 1N5AB 3B3IA 2RAMA 1I8MA 3K6IA 3UTZA 3O3EB 2AITA 2G0LA 3NN8A 2OL3H 4MJJA 3C6EA 5ILTH 3MRKB 2OMTA 4HWEL 2JJVA 1CFNB 1GZQB 4A7TA 1TETL 4X9GA 2R0ZH 1MRFH 5K59F 4JDEA 1JZIA 3V52H 3GSWB 2DY2A 3MA9L 3C8DA 3X3FH 5SV3A 3KYMA 4QHLA 2L0DA 4P06A 3BUQA 5JW4M 1T1YB 1AR1B 4RAUA 4M61A 3AUWB 3OLDA 5AAWA 4MYPA 2Q7YB 3VWKA 1DVXA 1NLBL 1BIIB 4JO8A 3VFWA 2WANA 4M1DL 2QQNH 1I3RB 4N2IA 5TFSL 5L2JA 1CTNA 3B8SA 3WG7B 1R3HA 1NKRA 3T6ZA 5LGHL 2ZQKA 4Z3GA 3QH3B 3VFRA 3FB6A 3OAZK 1B0GA 3ULUH 1I1FA 3NRPA 1EERB 2OMWB 4AV5A 1BJMA 4N20A 4QRRB 1MN4A 3A0OA 2Y72A 2EQDA 1MLBB 4PJ7F 4PD4K 4P2OC 5I82A 4CC4C 4D0CB 2J7LA 3KBEA 1CGTA 4OQTL 4K9JA 4L1HA 2CDGB 2EEBA 2EIJB 4CVZB 1JZ2A 4Y4HA 2IDQA 4YDIH 3I6KB 5C86A 1TT6A 4L05A 4FXGB 3HUJE 3UAFA 4D0DB 2Q3ZA 1ASQA 2A6KA 2IBGA 1A1NA 4FTDA 5C6PB 4JFYB 1V7ML 4P5KB 4FFYA 3G5YB 4XBEH 4LLDB 2XYCA 4U7MA 5GRYA 5A2IH 2AEQH 5DK2B 4ZXBA 5B4MD 2EEDA 2LU3A 3QJTB 4XO8A 4AYBA 1X5HA 3FU8A 3N43B 4ONHB 1X9RA 5IK3B 2X70B 1MCDA 4NN5B 2DWXA 5CEZE 2NY4D 3EO0B 4LF3A 5IROD 3T3ME 5JXEA 4M8QA 1U30A 4P4KC 4L0ZA 2NYYD 1SQMA 4XNUL 5J9PA 5IOKA 4QJ4B 1SEBA 1XL4A 2P8LB 4QOKB 4UYQA 1T1WB 2X3CA 1KIRB 4O51B 2VLKD 4HCRH 3IFOB 1KTRL 4X0KA 4ZMWA 4MJHA 1JPSL 3D39B 3L3OC 2WVVA 4PJFA 3BO8A 1LK3L 3PWVA 4JB9L 1BQHA 2X4QB 1YCSA 1R5VA 1OP3H 4WWKA 1JAEA 3D39A 1CU4H 1KENL 5F7BA 1XF4A 3OKOA 2XACC 4MHHI 2OMYB 5IOPA 3PWUA 2AQ3A 5AB2A 3PCYA 1EZUA 2X4TA 3ET9F 2F18A 2QLVB 1WD9A 3S5LB 3RTLA 5MEQB 1WITA 3C5SA 4XO5A 3LNFA 2DM4A 2VIRA 2PPFA 4JKKA 2PR9A 3E6HB 5KJ7E 2A9ML 3CLFL 5E6IA 1GSKA 3HG1D 1E2VA 5B7FA 1LM8V 4PRIE 2HUHA 2ZCZA 3KHQA 5LDUA 2MQCA 4M5YH 2L04A 3MRJA 3OL2A 1MI5B 2WUBH 4M61B 3RNQB 4Z23A 1UA3A 5HYFA 5EF3A 1G7HB 2YD2A 1JNLH 1MJUL 1Q94B 3GBML 1IKFL 2ITEA 1EZSA 1YN6A 5D2NB 1RULL 2NY6C 2DM3A 1XAUA 2FYYA 2XTSA 1FNFA 4OB5L 5D7LB 5K1NA 3QH3A 3VFRB 4GW5B 3IKKA 2XWXA 1AS7A 4TNEA 2CDGA 5F0PB 1KCUH 4CVZA 1ACYH 4PWGA 1IAOB 3I2CL 3MRGB 4YXKL 1MWAB 3HC3H 3LRMA 3WN5B 1IT9H 4K7PY 1TJHH 1KCRH 3ABKB 1QPXA 4UQIM 1FVEB 3EGDB 4NKOA 5H4YA 1HESA 4IKIA 5D7HA 3L5XH 4MXVF 4NRXB 4QOKD 1YMMB 4KDTC 1RCYA 1SOSA 2VH5H 3ULVD 2NUTA 5DUPL 1FL5B 1WS8A 1LE5A 3X12A 5DMJB 3WU1A 5D7IE 3CC5B 1BFTA 2DL2A 3LN5B 3B2UD 4DP6X 4CNIB 4ZFZB 1EEYB 4LSUL 1XBDA 2LABA 4FHKA 4P5TB 2X42A 5J4MA 2UZIH 5KW9H 3VGHA 1AZRA 1D2OA 2WWKO 1K3ZA 4OCYH 4MNGB 4LARL 2BY3A 5AENA 3BYYA 1KLFB 4OF0A 4ZUTB 1TYJA 4G8EA 5AG9A 1P2CA 2C1PA 5C0ND 2EH8L 1OAUL 2FLBT 3D39E 1NBQA 2CCLA 1WE5A 4ZMTA 3G5VB 2B14A 2NY1D 4X9YA 3OKOB 5T1MB 5CD3A 1F3RB 3MROB 5A16A 5DEZA 4L3EA 3IDMA 4HOWA 2ENJA 4FKHA 4TUUA 3O6KH 4PJ8A 3M46A 3MROA 5A16B 2OULB 4UQ2B 3VSUA 3QDGD 4M43H 5D7LD 2XA3A 1V7NH 1DVQA 4OTXL 4P2CG 3IB4A 2HKFH 4LVNC 5KS9F 3QCTL 1E30A 1TFPA 2LGNA 3L95B 3VXUD 1MAML 3CXDH 2WLYA 3ZE1E 5CCJA 4XXCA 4BFIB 3Q2VA 4JX0A 1JYNA 3GJFK 3I9GL 1YY8A 2Q2LA 4JBSA 4CU7A 2ZJSH 3SKMB 2BIMA 3MRLB 1F6AB 4Q9RH 1YAIA 3QCVL 4I2XE 2CNYA 5I18L 3D34A 4Y4KC 5LGKA 3CSFA 2KHAA 4U6XB 2OMZA 3Q3GB 3UBGA 2WAQA 3U7YH 2C34A 3P3TA 4DKTA 1MCWW 2ADIA 5CUSH 3NH7H 1KXVC 4NI6A 4TQEL 2A77L 3PIQA 4LHQB 5AKTA 3GSRB 3VD4A 1S9WA 1TKWA 1TLKA 5CGMA 1M6UA 2Y6TE 4IU2B 1CVSC 3E1F1 1E6JH 4GAFB 4K23H 1E3XA 3L3HA 3SE9L 2FX7H 2GG1A 2PO6D 1SDYA 2YRBA 3WN5A 4IU3B 2N4IA 2WLZA 1TO4A 4JDEB 5HJBA 4ZFZA 5EUOA 4WUUE 5IESL 1WC7A 5EPMB 2O6FA 4BH7A 2ARWA 4KJWC 2FT8A 3OXSB 4BWTA 1EBAA 2H26B 2VC2H 1KB9K 4K3DL 2CRZA 2X28A 1OP4A 2VJ0A 4NQDD 4R84A 4O00A 1EGJH 2ICCA 2B39A 4XHQA 2ADFH 4JFSA 3DARA 1VGEH 4R4FL 5EULV 5TQ0L 4HLZG 3KW7A 4I5BA 1DBMH 1B9ZA 4U1KB 1UB6A 4BCZA 3GJFH 3OGCB 4FA7B 4P2QA 4C56B 4TTDC 5FM4A 2BY2A 2BNUA 1W72A 4PLJC 5KYYB 5JHLH 2UYLB 3RURA 4OZIF 4BV1A 5BS0E 3QR0A 1DANU 1OAYL 4PG2C 4DP1X 4EIUA 1BBDH 4TF4A 1MLBA 1JE6A 1M6OA 2YAPA 5EOCL 3F7YB 4NQQA 1KTKE 2WHVA 3F84A 2R0ZL 1CYGA 3NEEA 5ACMA 3MO1B 1A4BA 1BW8A 4X6EB 1OTSC 2IFFH 2FWSA 2YPLA 3BH4A 2Y7MA 1QUPA 3HS0C 4R2GD 3WLBB 1AKPA 3NJXA 1LQSR 1NC4D 1L7TH 2KL6A 2QGDA 4J3VA 1ZGLP 1NCHA 1JD7A 4OAWA 4RDQG 5F1SA 3ZTJH 1RZJC 1OANA 3HI1A 4CL7A 3FCUB 3RU8H 5D7JD 5BVJA 3OG4B 1MCSA 4LB8A 3PY9A 4NQXB 1AXSB 1YSOA 5MENA 1YUHA 5DJ6B 1FWXA 4DOHB 3DX6B 2DQMA 3FB7A 5K1JA 3U1PA 3UJIL 3CQFA 4QGTA 5FECA 1DHKA 4ONGL 1X7SA 5JYMA 3DX7B 4YUEL 4IEFB 3FU6A 4G8FB 5IQ7H 1F4WL 3BRFA 1S9XB 2NSXA 4LF3B 5JW3H 4ZQKB 3LS5L 2VITB 2P5PA 2XN9A 2DIBA 5I6NA 2ZOLA 3QWQB 1A6VH 2WIIB 1OAXL 4NT6B 3AZUA 4JFDD 4EKXA 2XN9B 1E5UI 4R7XA 2NY5C 4OKDA 4F37K 3UYRH 3RUGE 2HTLD 3MLZL 3FMGL 4AUYA 3G6JE 3L3HB 2BXZA 2C4FT 3WIHA 4M1CD 5AW8B 1O9VA 1PU0A 1AFVL 3KJ6L 1BEYL 1KSRA 1YC7A 1CDGA 3BUPA 4JO3L 1TYEB 3PIQB 2LV4A 4LCYB 3U4AA 1AQMA 1V05A 3BP6A 3JTSA 4L8DA 3DIDA 4HUMB 3C5JB 3GXUB 4XPTL 3S36H 4TNVK 1FNLA 3P11H 3FRPG 4OUOA 1HHIB 5DURB 2H6PA 3MFGB 4JG0L 5F7WC 4Y1AB 3U0WH 3CN3A 2FZ3B 3K4ZA 4JFZL 4XTRC 2FQFA 2MCG1 1AYOA 4OF7A 1A1OA 2FVNA 4X5XA 4AT6A 4PJDA 3IU4L 2R9HD 5DSCA 3RI5F 3FYEB 3K4AA 4X6DE 4BRVA 4HEMA 3MUHL 4G7SB 4DGIH 1KELL 3V6BR 3PDOA 2NXYC 2DEWX 4Z3IA 3EYVB 3O2VL 3ZL4H 3ZR5A 2EYSA 3U30C 4QHKJ 2VDPB 4U1JB 4GKZA 5LXVA 1GIGH 1YEKL 4HUWB 4ODWB 1MKFA 3EFOA 1EQWA 2QJDA 2DWEB 1D5IH 1KIUA 3TEXA 1AGFB 5F93C 3OR7A 2WWNA 3P3UA 12E8H 1KEMH 2FLRT 4LE8A 2DLTA 1ZK9A 1T4WA 4F8PA 5SWSE 1T83A 3D12B 4YZFE 1DE4B 3F7PC 4J6RH 2Z6FA 5D6CB 4YBQD 1N0LA 5D1XD 5BO1H 1HWGB 1I8UA 1NAKH 4ZFFA 1PGRB 4HMDA 3AXHA 1AI1H 1D5IL 2I60L 1U93B 4C4UA 1PZUB 3FQTA 1E28B 4XP5H 6FABL 3O3UN 3HMWH 4KHXH 3SYAA 1PSKL 2WSDA 3E7JA 5IJVA 1UJTA 1XGRB 3GSOA 2QDWA 2C9SA 3PWVB 4FJZA 4IGBC 2FBJH 1AOHA 2EACA 5I75B 1T0MB 5TE4H 4AYEC 1MPAH 3BN9D 4FQCL 4ERSL 1OE1A 5CP3A 3EYFB 5EIIG 5JIDA 3NCJH 2NZ1A 3UGXA 4Y1AD 4IKLA 1RZ8B 5DD3L 5I73B 4F9PA 3KNBA 4M1DH 4XB3A 4X98B 4XB8A 5GHWH 3EAKA 1ET7A 4MLIA 2O6DA 3QWRD 5IFJB 3HMXH 3MACH 5JPNA 2OL3L 4WAFA 1ADQA 2CPCA 1QG3A 4FP8L 5ILTL 2C3VA 1NIEA 4XOCA 3TJEH 4MXWL 2HJLA 4LLQA 1FLRL 3EH4B 4KKNA 1G7IA 1N67A 4LPUA 5DUBA 5BV7H 3WKPA 4UDTA 1ACZA 3E6HA 3IGFA 4N8UA 1UURA 2VABB 4HIQA 9CGTA 3N41B 3DUSB 5C71A 3OQRA 2XTJC 4Q4EA 5D2LB 1ACXA 1PPIA 3SKMA 5GS2H 3RILA 4GBXC 4BK4A 3B9KA 3T6WA 1E5CA 1WISA 4FFTA 2DWTA 4XCEA 1WO2A 2GAZA 4I3RL 3WXWL 5IGXL 5CFHA 5IHUL 1PFCA 2XT1B 1FL6A 2XG4B 4WI0A 1UD8A 2E56A 2EIKB 1OAXH 1PBYA 1RIUL 4KK6D 4NO2A 3UMTA 2YJQA 1WFTA 2APBA 1TZIA 2AV7B 2FIRT 4KKLC 4MAYB 4P3WA 4YLCA 4NN6B 1OPGL 4JJ5B 5D71H 3LKOB 5A40E 4E68A 1O7SA 3EH5B 3IFNH 3QIBA 3H3PH 2ISDA 3WSQL 1HQ4B 5FFOA 2IF7A 4G1MA 1XGYL 4JO2L 1N0LB 4LPYA 4MQSB 2G2NA 3X1EA 3RFZA 1MOEA 4IU2A 4N0YL 1EEYA 1FVEA 1NGWA 3ZDXF 2WIMA 2AC0A 5EB9A 5ALBL 3U2IA 2BOLA 1WPCA 3WO4C 5EBWA 4HPHA 1E28A 1RSFA 2Y0SA 2Y69B 3F62A 2HXAA 1YPZB 3FFCD 3QIUB 2VO5A 3A22A 5CN2A 1LK2B 1MSPA 1UZ6F 1FNSH 3E1ZA 4E41B 3GZQA 1X5MA 3ARGA 4MVBC 5IUCA 4B27A 3HFMH 3LH2H 4YAQA 1U93A 5FKAB 3GMRA 3ZDXB 4W9LC 1MHEA 4JQIL 1DQKA 2ZE0A 1S5HB 2AVFA 4PGZA 1JK9B 3FQXA 1K5NB 1NH6A 5LJYH 1MCIA 3WFCL 5L8KB 4JPWL 1KY7A 1DEEA 2ALWA 2XNAA 5EZIH 3LN9A 1CFSB 3QG7H 1WS7A 4DK3A 2EE9A 4GW4B 2A74C 1XF5B 3MRIA 4FQHB 3AGWA 1QSEB 2R4SL 5T33H 5HYQB 4JG1H 5DD6B 4YZWA 3RTQA 5D5MF 3S37H 1LD9B 1LEGA 3V4PL 2FIKB 2C3VB 2H4EA 2RBLA 2HWZL 1JWUA 3WNOA 5F7UA 4XC1H 4LOUD 2JQMA 5FCUH 3MNMA 3NSYA 1LWHA 3S5ZA 4GFXA 1OAUH 4QLWA 3KLDA 3THMH 3QQ3A 2V3EA 3LZNA 4G6FD 4KBPA 4QHMA 1QEWA 4Y2DC 3WJMA 4BZ1L 1VGKB 4PG9B 4XZUA 2VL5A 4QY8A 1AKJA 1DQJA 2HWZH 5CGBA 1UA6H 2G2RA 4JPIA 2MMXA 5DDHB 2ZXAA 1KBGL 4XNBA 3ULVL 2DJ4A 5D7EA 5FO7A 5EEUA 4FOMA 2EUZA 2EVHA 2P9RA 2XN1A 4HUXA 4YWGH 2AQ2A 5DUPH 1AGEB 3ARVA 2Z0BA 3L2MA 2G0KA 3NOIA 3UMNA 1PYWB 5HHPB 3QHZL 2R2BA 4HUXB 3DOIA 3GSVA 2V9UA 4J3OF 1QACA 4IK7A 4Z76B 3UROR 2ZD0A 2CPUA 2H2PC 2QV4A 1OIOA 4W4OC 3UTPD 5EV7A 5BUGA 1SXBA 2R2BB 3ML8A 6PAZA 1PG7H 2ZT9C 2JB5L 4I85A 3SYPA 3VTTA 3F05A 4N28A 1PZ5B 3U4EB 3TEYA 3B5TA 3ARGD 5GGSA 1FYTD 1UXWB 3RRQA 1HU8A 2OSLB 1NEZA 3VYOA 1N4XH 5C0RL 4JO4L 5DHXB 2E59A 2F5BH 4M9PA 2R29A 3MRHB 1XX9C 4Z18A 4ADJA 3O0RH 3IDJA 3SKJL 5KYUA 2NY3D 1F0LA 3GRBA 3MOQA 4PGDA 1ZHLA 3SDCB 3CFJA 5KSBB 1RZJL 3CU7A 2O6PA 5IVZB 2DBLH 3LYRA 4HWBA 4HP5A 1UB6B 4NWTH 3N85H 4FLOA 4J3XA 5EF0A 2BXYA 2GHZA 2M2DA 2ZWZA 4X2UA 3ZYIA 2BFVL 3DGGA 1KJMB 1SUHA 2YRZA 1QSEE 2WSKA 4R0LC 3UAJC 4UQ3B 1S5HA 3LZFL 3IGKA 2HKHH 5I2IB 2GSGB 4R4ND 1W16A 2UY6A 4HKBA 2OSWA 3QWRA 1ROWA 2E9JA 4HUWA 5HYJB 1J8HD 2DBLL 4W1TA 2DI7A 4OZ4A 2GSGA 3MRCB 5LBGA 3UZQA 2FT6A 2YXWA 5GRVK 1JZHA 1KCSL 1YG9A 3ARFA 4QXTB 1VADB 4PGBB 3U1QA 4EF3A 3T4YB 1G9HA 1FP5A 2C5DC 4Q14A 1DZ0A 1XEDA 1CGSH 2X4RB 1RUAH 2VDMH 4L48A 1NOLA 4Z7WF 1VPOL 3OSVA 4AJ0A 3H9SE 2IH1B 3SEPA 5EIQA 2LAGB 3EOBB 1GY2A 3APCA 3OF6D 3FW6A 2JKXA 2AMUA 4I1NB 4PJFE 1O6TA 2ESVE 3G6AB 4PVMA 1ZV5A 1P4BL 1G6RB 5IVXB 1CD0A 1S9XA 3PHOB 3T8MA 4WW2F 4ZODA 1AQ8A 5E8PA 5J6GA 1WV7T 3MACL 1MFAL 5ANMA 3U6RA 2BS9A 2X89A 3ARED 2UZPA 3MXWH 1R3KB 5LN8A 3PGCB 2JH2A 5D1XA 3TBBA 3JV6B 3ZLQC 3AT0A 5IFAH 1AGEA 4MNHA 4JRXD 3ZKXB 5EU6B 1KTCA 1IM3D 2N0MA 2ZKMX 2OM5A 2CKBB 3M1BB 2P7TB 3OBAA 3ARYA 4OFQA 3ULSB 1UWEL 4HJGA 3CZNA 3PWJA 4P23C 4PGJA 1J5OL 5B1AB 3FFOA 3U30B 4C55A 2NY0C 5CBAB 1A9BB 4J3BA 1I7TA 3W0WB 4M03A 3FTGB 5ERWA 1N8ZA 3VQ2C 3GB7A 3WIHL 5I30H 2FX7L 4HFUH 1SBSH 1XIWD 1OF0A 6FABH 1T0NB 3A4EA 1FDLL 2DZEA 2E7DA 3H2QA 4WV1A 2J88L 2X4PA 3J2PA 4HHWA 3NIDB 4IOSA 1PL3A 1N6VA 2A3TA 3WEBA 4Z3HA 2VDKH 1PZ2A 2D4FA 3LNDA 1LO5B 3IN2A 4Z7QF 3ROOB 2XVKA 2ADGA 3ESOA 4DKEH 1BD2A 2CRYA 5FC9A 3SJVE 4UB0L 2FO1A 2IPKB 5TDNB 2H32B 1UWFA 3B43A 1MRCL 4I3SH 3UERA 5IBTL 2RHEA 5HYJE 2Z8RA 3QAQA 4KQ3L 4XMLH 5A3ID 1TQTA 1P7QD 3LKSB 3IDIB 3PQYE 3MJ7B 1RP9A 4DFHA 1F42A 3GO1H 3VFGH 4DKEL 1SXCA 2ENYA 5HYEA 3N1FC 2IBBA 3I74A 1PAMA 3BKYH 1W9XA 3IDIA 2VQTA 1FI8C 5H94A 3BDXA 3QJHB 4PLNC 5GGTH 3N43F 3TNNA 4KZ0A 2R1WA 4WTQA 4E5XG 1N9PA 3QXWA 2Z92A 2WBJD 5E03A 4M6OH 5IJVB 1PEWA 1WRFA 2VDMB 1HHGA 4ODUA 2VDNH 5AW1B 4FZEL 1T2JA 3MOBH 3PG2A 2NT1A 4AMKH 3GBNH 4G7VL 3GMOA 5F1NB 1LK2A 4J3UA 1QFWM 1I7UA 1ZLVK 3WXWH 4OLVL 5IJBC 1Z9LA 1BVLA 5C0CE 2R7EB 1J48A 3OWEA 1QI5A 4L5FL 1C8PA 4ETQA 4MNQA 3W0WD 5AOJA 2YUVA 3DJTA 3QFGA 4WWPA 3UC2A 5EO1A 3ZTJG 3U6XA 4A2DA 2AXHA 2CIKA 4PJ5E 2WINA 1G94A 1PLGH 1SDAB 1B2WL 4FYRA 4PJ5A 1X5YA 3RWCA 3GJFA 3RVXC 4B7IA 1CE1L 4OI7A 1RPQA 3ZT5A 3JYCA 2OYLA 4ISVB 2B1AH 3MC0A 3R06A 5EA0H 3D2TA 2NXZB 5F0MB 2ZKYA 1WJ3A 2H0JA 5BXFB 3N40P 1A3LL 5FO9A 4D9LL 2VABA 1A4KB 4HPYL 4XRCA 5F9OL 4MB4A 1CXFA 1YNTA 3CHRA 3L4UA 4L4TA 4OJDH 3QQ3B 4HWEH 1BD2D 3SGEI 1OCWL 3M1CA 1T5WB 4GSXA 3VE0B 4S0SD 4D9QE 2XA8L 4QT5B 5EBGA 3LH2L 5BUPA 3SJVA 2AJUH 3V79C 4HT1L 4JZJC 4MRCA 2WZPA 1NPNA 3DRTA 1WK0A 4K3EL 4M4PA 5EF1A 4NUQA 3WFCH 3MJ8B 3L5XL 4NAJA 3VJ6A 4CSTA 3SQOH 4JRYA 3SGJA 1HCVA 2JKJA 1TQBB 1IUZA 1I8KA 1OOWA 1USQA 3GK8L 3P0YL 4C59B 5HPMA 4PIBA 4ELKA 3W11C 5DHVB 4XAKE 3SBQA 4M8VA 2MQGA 3MKGA 3UDWC 5IBUG 3VGGA 5EZOH 1N64L 2NNCA 4WVRA 4PJEA 4U6YB 4GQ9L 3IMSA 1MIML 2J5LB 2W8CA 4MMYA 3I02B 3BVVA 2WD0A 5DVLA 5I23A 5LNGA 2DB8A 1JYWA 4GLRH 1QZNA 3NEXA 1UM4H 4HIEB 5DS1A 5DJ0B 3QUYA 4KTEL 2F08A 1ES0A 3VI4F 1HEZB 1G7PA 1H8OA 2CXGA 3BIKA 4EN3D 5GSVA 2UXVA 1NBYB 1U8QA 3TWCH 2E0PA 2Q87A 4OJYA 3HC4L 4AX3A 3O3AA 2EH7H 1NLDL 3WTYA 4Z7UA 2OAAA 1ED3B 1R4XA 4KUZH 1PY4A 3CHPA 3IDXL 3B8YA 4GAAA 3GUFA 3TLRA 5DJYB 2Y06L 5I1AA 5E8NA 3CTTA 3ZE1F 1R5WA 3SO5A 5A2CA 1GKOA 2FATL 1OALA 4JRWA 4N5UA 1UOLA 4N0UE 4XPHH 3I84A 3QIBD 3PGDB 2O6CA 3BDBA 4XCNA 1R46A 3ZE0F 4GOSA 1PZAA 2Q6WA 3V0AC 3ATFA 4DETA 1CFSA 3GLDA 2WLLB 3SDXE 2FHCA 2OTPA 3HI5L 4KOCA 1LO0L 3BP4B 2AS5M 1K8DB 3I6GA 5GS3A 3HAEG 3UTSA 2IANB 1WGOA 5F3BA 1KOAA 3GF8A 4LSPH 1NAML 2CDEA 5KAQF 2OCCB 1YEGL 2DJSA 2FNBA 2JV6A 1LO4H 2W5PA 3GSXB 1ZANL 3WEXB 3MV8A 5EORL 4AQEB 2VDLH 3U7WL 1XGTA 4UU9A 1WICA 2VO8A 3BLKA 4Z7NB 1DVUA 3CVIH 1E9PB 2VDQB 2VKWA 1UD5A 3DIFB 3DTDA 3EYUL 4YHNA 5DMKA 1YLBB 3GMNA 2EICA 3KPNA 2VLJD 5C1MB 1HNYA 3V9CA 1TVBB 3PYCA 4L5FE 1N5YH 2NR6D 1AXTL 5DQ9B 2AJZA 1YECH 4UIMB 2VSCA 2QR0A 2AXGB 4LIQH 4OCLC 4UI2A 4N6RB 1QSZA 3GD1C 3OJMB 2XETA 2NXZD 5GJTL 2GPZA 2XCMC 3OKEA 1R3KA 3QZNA 5CFAA 4KHTH 3IU3A 5DTFA 3LNHA 4NPYA 4QTHA 3O9WC 4ZFQA 2EE3A 4PI0A 3VGEA 2J1ZA 4DO6A 2P5EB 1E9OA 3L1EA 4NOBA 1EXUA 2CZNA 2OSYA 4NUMA 1JGEB 3MLXL 4YHKL 4JEGB 4JS7A 4XVSL 3NRFA 4Z7UE 1TU2B 3QDGE 1OLLA 2VQUA 5DEFB 1X5GA 2PPEA 3ZQXA 3J27A 4B9JA 5IT2L 5I1EH 1DSFH 1BF8A 4HEME 4NERA 1YY9C 4KRPC 5E1IA 2WSPA 4YN3A 3TWYA 4H0LC 3GB7B 2PTTA 3PFUA 5ETUA 1MAJA 1ZHKB 1CI3M 1JVLA 1FC1A 2OK0L 2JTDA 2H3XC 4LCWB 3MLSL 5CBEA 1QFWL 4KJYB 2YOCA 2FB4H 3SIKA 2E4TA 3FQWA 4JRFA 5BVPH 5BRPA 3F6JA 2V5MA 3W57A 2WYTA 4KJYA 4ILDA 2WP3T 3NT0A 5I1AB 2W65A 3DRQA 2EVFA 4J3OH 3DGGB 3LAFA 3BESR 4J3SA 3QDMB 1UENA 3S2CA 4Z0BL 1J1OL 2FECI 3VFMA 3S36L 2F7QA 4WJ5B 5FM8A 2IANE 3R1GH 2VERN 3DSNA 5I19L 5F7MC 4JUSA 2ZXEB 5DD1L 3SGDH 5I74C 5IKCB 3RE0A 1S9KC 4IM8A 4OI9A 3Q1SH 1WBYB 1ZTMA 3DK0A 2GHWB 5IB3B 1YO4A 5J5EA 4QHUB 1JZ5A 3OKDB 3OXRA 1NIFA 3TV3L 1QLEL 2WBKA 4H8PA 1D5MA 3DETC 3EG9A 3MDJA 4H5SB 4NQSA 1DQLL 1TVBA 4FKKA 1KIQB 1AD9A 3M17A 2V17H 5FV2A 5BRZE 3JV4A 1SOQA 2CGRL 5DWUL 4UU9B 4LP8A 4Z77A 1CTMA 3B2XA 3QS3A 1FBIL 5I76B 2X9WA 2ATPA 2BM3A 2R0KH 1P7HL 3QQDA 3BXNA 1T20B 1UXLA 1OVZA 1DVFC 2HPTA 3W3BA 5CZRA 1ZXKA 2A6KB 4Y9CA 1CPUA 1LDPL 4ZMOA 3II3A 2X9YA 1PEZA 1DBBL 1NL0H 1IC0A 3K6FA 1PKQE 4HQQH 3OGOE 4KK5D 4J39A 2WNXA 1EZLA 3KG5A 5LLIC 1RUQL 4XMWA 1CLZL 4PIRF 4XR8C 2HRHA 3MLTB 1DUZB 5C0CD 4D0DA 3HMWL 3AXLB 1R33A 4XCFH 5KSAA 5HHVH 3T9WA 1AD0B 1BV8A 3DVGA 5K39B 1FFOB 5HJ3A 2J20A 1BOGA 1BHGA 3E9TA 3HC0A 5AW6B 5C0JB 2AJSL 3QDMD 4WHYG 3DUUB 4OQ1A 5DFAA 3LN4B 2VR5A 4KRMB 3CDZB 3TT1H 3D0VB 3EFFB 1K6QL 2YAHA 4Q74A 1D3CA 5EZJB 3ULVH 1QNZH 5IHBA 5FOBA 4S1RL 5SX5K 3JSSA 1I8KB 2XN9D 1INQB 2AJSH 5EU4A 1GYCA 2PYEA 4MZ2A 4XXDA 5KBNC 3PWUB 3GRWA 1RJZB 4ECNA 4FRWA 4N2BA 5CILH 5JMOC 2UY7B 2OXGA 1CD8A 3D69A 4JHUA 4PJFB 5T5FL 1BZQK 3FU5A 4MJID 3TNNB 4PS4H 5GJSL 3G9VA 3HPLB 4OD2B 2IMMA 4J27A 5F9WB 5E2WH 2V2WA 2JB6A 1BWWA 1WUNT 1JK8B 4L4JA 4TN9A 5JPMC 1PKOA 5ADOL 4N3UA 5T5NF 3CBRA 4KGJA 1ES0B 4XCYA 4KQ0A 2XQ0A 2GJPA 4W9HC 2Q8BH 3RBGA 3T4AA 2GEEA 5DU7A 1JK8A 4IBLT 3KLAB 4YHZL 3CHSA 1Q94A 3QUKA 1ZT4B 3WNLA 2M8XA 1LXMA 2CKNA 1QWNA 3BKCH 1NANH 2V2XB 2VDQL 4JDVB 1YQVL 4M6MH 3D4YA 3GO1L 3VFGL 4F15C 5GS1B 2CJUH 3K4DA 5LO7A 4H5SA 5DMGC 1GC1H 3QRGH 4NC1C 3X14B 1WCQA 4DK5A 1QO3A 3T77A 4E9VA 3RVUD 4N68A 4A39A 5C7XL 4BQCA 1Z3RA 4AENB 1NCWH 2VE6A 3K71B 2VT0A 2F58H 3CHXA 3QK0A 2CO4A 3HUJB 4G5ZL 4B6ZA 3IJ8A 1MREH 2YUXA 4EN3B 3IDNB 1BZEA 4OCMC 4L8SB 2NY1B 1LP9B 3MLVL 2C4XA 5T1KA 5I19H 1K9TA 3S9DB 2DI9A 3NK3A 4GW1B 4UQDA 5IB1B 5L7XH 4YL9A 1VJSA 4GRMB 4RBPH 3IBOA 2HRLA 1CICA 3WEMA 3VXPA 1BD2E 4P4KD 4G5ZH 4R3SA 2ICWI 3QDJE 3VWJD 1AZCA 2AK1L 3N6YA 4FGMA 1HYRC 2JKWA 4AL8H 1X5LA 4GBXA 2VXQH 1AZNA 3C8KA 1KXVA 1EEQA 1MY7A 2C4FU 2VMDA 3NJJA 1E5AA 4RA0C 2IWFA 5HPOA 2Z91A 4PI2A 4Q7DA 4OCSL 4OLXL 4U7KA 5F7KC 3H85A 1NCDH 3HTLX 4MLSA 4L4VE 3TX4A 4PJEB 2NTSP 2R23A 3GXTA 5T1MA 3S5LG 2IOIA 1UZ6E 1NCJA 2X4QA 1R24B 1RJZA 4H2AA 3QIBC 5IMOB 5GRXG 4D2NA 2W60B 5K9KB 1I1AB 1ADQL 1SJEA 5E00A 4K3EH 1VKXB 1WBXA 5EOQL 4CVWA 2EDWA 3VXRB 5HI5D 4OZFG 3R4DA 2WTRA 1IO4C 1K4CA 3D0LB 3ZVVA 1MW2A 4BDVB 3ULVE 1T7XA 1CFQA 5C0CB 4WSGA 3S2AA 4LMQE 3WE6A 3QQ9C 3ZTCC 1N26A 4PR5B 4BZ2L 2P24B 2BP3A 3CZUB 3NIFB 4X50A 4Z7VB 2OXGB 1FHGA 2EZ0D 4ZOCA 3TIDB 3IYLW 4P5RA 1ZT4A 1T7YA 3VU2A 1KN4H 1AGDA 3OMIB 2ICES 4TUKH 4X83A 3SYQA 4PW4A 1SYVA 2N1KA 3JZ7A 3WTSA 2CO1A 4Y4FA 2G3NA 1KCUL 3KYNB 5D1QC 3V0IA 4X9IA 2ICEA 3O3DA 3RJQB 1F4HA 2A9MH 3CLFH 1ITCA 4MCZB 3KDMB 4DQAA 1IAOA 3HS0A 2HFEB 2FQGA 3L1FA 2OYPA 1KG0B 2N59A 2EDXA 4KQ4L 4MA1C 2HFGH 1HZHH 1OCCB 4PJHB 4R7DA 3RB7A 5IY5B 4I18B 3UXFA 3MRBB 3EDKA 4M7JL 2OMTB 1WIPA 3G08B 1XSKA 2EEAA 1FA4A 3FAWA 1OLZA 2WXIA 3PWPA 3ERXA 3SQBA 3HW7A 3MA9H 3BUDA 3LEXA 4G8GE 1DJYA 2BRRL 5AZ2L 4P3CL 1XGUB 4P5TA 5HVGB 1H3TA 2YEQA 4YLQT 1BAFL 4UV7L 4C58B 1YYCA 4RAUB 3ZDZE 1AQKL 5KOMC 3QAZB 4NQEB 2NY2C 4FQIL 2AJZB 4ZUSA 1H3WM 4DAGH 3RYMA 3EHBD 1CDUA 1E9PA 3OJDA 3RDJA 2VDLB 4WO4C 4DP8X 3F65A 1R3IL 2B16A 5F21B 3S35L 4F57H 4UQBA 4MQXC 1DLFL 3NABH 1Q9WA 2RMNA 3ROLB 4QRBA 3EF4A 1LO3L 5JQ6H 1UEMA 3SE8L 4PJBF 4YHYB 1MCOL 3ILQC 4LP5A 4OQTA 3CHOA 5A6MA 3VNZA 5D5ME 2GSMB 3OB8A 3L3OA 5BJTA 4G83A 5E2VL 4X9HA 3LNGA 4BZ1A 3WS6C 4JO3H 1L9RA 1S7XA 2B9BA 2VR9A 4F9PC 4O5LL 3ZGIA 1NBZA 5ES4B 3VXQB 3QO0B 1TMCB 1ZHKA 3RIFF 2K70A 4FNPA 4Y19E 3WHXB 5HI4D 1F00I 1S7XB 3UO8B 5JPNC 4ZXBB 3H3PL 2J2ZA 5KSAB 1EEZA 4LOFA 2L7JA 3F7QA 1QI3A 1BLIA 4APQB 1JZJA 3QCUL 5E6YA 1Q72L 2E75C 4Z7WB 5ISZE 3V0GA 3ZJAA 5CSGA 1BFOA 3KDMA 2VXVL 2Y07L 2RH0A 2ED7A 4OLZL 4EKJA 5DC0A 3L48A 5J7CC 3LRKA 5T3ZL 3T2PA 3CVBA 5D96B 3WDJA 3V0JA 5DLML 4UBDD 4NHUA 4DP5X 4YSTA 4DPAX 3EFDL 3ZPDA 4HUUA 2OK0H 2AXWA 2R51A 3GBDA 1AHKA 1TLMA 2JCCE 5E6ZA 3ZKSD 3MLPA 4MQXD 1U0QA 3WUZA 5FDYA 3B6SA 4NP4L 3KLQA 4LSVL 4WO4B 5GZOD 5IUSA 4P2QD 2PYEB 3D06A 2DQEH 3LQAH 4FX5A 4JFOB 1UH2A 3JTSB 4L8DB 2E6JA 4IRSB 3PP4L 3SE3A 4ZX3A 5I5IA 1IAII 3AG4B 2YD9A 5I1CH 5LCVH 1PG7W 2WCGA 4U3SB 1IMHC 5C07B 1P1ZB 4CU6A 3DX8B 3S98A 3DSNB 5IFHL 4PJDF 3S4SB 1EH9A 1MFEL 1DR9A 2WQWA 3TPUB 3U48A 1P1ZA 4GXFA 1OWWA 5E9DA 1ONQB 2IPTL 3HAEA 4KHTL 3OKDA 1HAUA 1LTXA 2FBOJ 1VB9A 1X4ZA 2OJEA 3KYKL 5JO5A 1AVAA 4DO5A 2F9BT 1ZLWK 3EYVA 5IP4A 2PXYA 4BFKA 2SEBB 4XWOC 5T3XE 3E6FA 5IESH 4MMZC 2AKRB 4YBQC 4PJ5D 1JDDA 5D1XC 3ZE0B 1ML0A 1BZDA 1CF1A 2QELA 4FL4C 1F11A 3O41B 2QL1A 3OJDB 4H8WH 2EE0A 3T0WA 4B5ZA 2VUKA 3N9GH 5E2UH 5J1AB 1IE5A 1JV2B 1U8KB 1A6AA 1WH0A 5AAWC 2CHNA 3DJRA 3K0YA 4PJAB 2NXZC 1UWGH 3QULB 1EHXA 2BVTA 4QYAA 4Y4HB 3JYBA 2G3MA 4KMTH 1BYPA 1NJ9A 1KXQE 4ZW3A 4B9YA 5K9OB 1EO7A 1WLHA 4QRQA 3RX5A 2HKAA 4EZLA 1A3QA 3MRQA 3OSKA 3D0VA 1ZE3C 2CRIA 3C6LA 4N0CC 3EHBB 4GG6B 2FWOB 3TONA 5CSBA 3VGBA 3RWGB 2YEZB 4FEMA 3CPLB 4HK3N 3ESUF 1FYTB 2V7NB 1C12B 3KR3H 4H8QA 5FR3A 3X1FA 1JJUA 43C9B 5HXMA 3K8LA 4HH9B 5LBSH 2RD0A 3S3JA 2YAMA 3MNWA 4MA8L 4IOFC 4Q8BA 3FTZA 1GKEA 1W8EA 1MUJB 3ENEA 3VFVB 2XN9E 1LVEA 1FNGA 2YGPA 1Z9SB 3LKPB 1UZGA 4OD2A 3HKFA 3GMMA 2XWZA 1OD9A 4Y16A 2VYRE 4YHOH 5IB5A 5JIPA 3VGAC 3D51A 4U6TA 4NNYA 4XCYB 4BUGA 3M8OH 4NO5B 3WY2A 5E08L 4N90D 5FWRA 1NC4A 4GBXD 1RUPH 2AJ3B 4L23A 2PWHA 4C56D 1D6EA 3IJSB 2NNFA 5KSAD 1DVFA 2KBGA 4LPTA 3HPLA 2OZNA 3FRUA 4F1ZA 3MRJB 3L7EB 5DUML 3BAYA 1Z5LB 3K8MA 3FSOA 2A9DA 2ZXQA 2ZWKA 1VLXA 2WLIA 5D2LA 4WSKA 3TYGL 1N8OE 3MJGX 1Y07A 2IH3A 3MV9D 1WTLA 2KS0A 4X6CA 2DLGA 3OLIA 4U1NB 4TV3A 1W6LA 4HBCH 2F7PA 3NCYS 2DTMH 4R2GB 3W37A 4LDLB 4GIAA 4Y4HD 1S9VA 2R1YA 2OTUA 3NRQA 3BSHA 3MCYA 3V52L 4MD4A 4IOSD 1OE3A 2Y1AA 5TE6L 3FB6B 5ENWA 2H2PD 3VI3B 3US1A 3DX1A 3FL7A 4OM1L 5EU3B 3VXSB 1GGBH 2FB4L 1Z32X 3FUEA 4MD4B 4U6VH 4JR9H 4ZDHB 5KVEL 1U3NA 1GC1L 4HJUA 3CX5J 2R2HA 2NCMA 3CWGA 3KPQB 3KD4A 4NZ8A 1QTSA 1KELH 1ZD6A 2WTOA 3LB6C 3SBWC 1E9QB 4EE2A 2R39A 3BVWA 3LXAA 3LKNB 3GMLB 3P0GB 3Q1EA 2DF3A 4FL4B 4Y4FD 4LFHD 5JR1H 2GI7A 2Q9OA 4PJ9B 1EFXA 3BX7C 4GT0A 4IU3A 3KBPA 4HIIA 4HJJH 3X3GL 4JR9L 1FH2A 3P4NB 4QMEA 4X8JA 5IM7B 2D7PA 3C60D 3DX3A 1ND0A 2WGXA 5JPMB 3F85A 2VWEC 1FV1B 2GFBA 1JBJA 1E7UA 1KXHA 1XGRA 4XPAH 1YEFH 1S3KL 2ADFL 2HP4A 5DJ8A 1NGPH 2WBWB 4ZUSB 2W60A 1QAWA 4JREC 4W4OA 3KEDA 4C56E 4HWZB 5EN2B 4BSVA 5I9QC 4URTB 4XNQA 1Q9KB 1N2RA 4WI4A 4WWKB 4Y2LA 2VXQL 3VFPB 1EFXD 1QVOB 1NCBH 3CFEB 4G8GD 4HXBH 1A5FH 5C8JA 4A1RA 2ZUQB 2WNKA 3HG1A 3WV0A 1T89C 1X5KA 2VLRE 3GXDA 3BEWA 4PWKA 1MAKA 2DIJA 3BPLB 1G9EA 1N10A 4MS8C 1R6VA 2K6YA 5CP3H 3ARDC 2F1BA 3QE5A 1F1GA 3O8XA 4RBPK 3WFEL 3V6OE 4A7QA 3VFSA 2VDLL 5BS0D 2P28B 3RHWK 5EOTB 1ZA3B 1SLWA 5KVEE 5B7EA 3VWJA 1AE6H 3KCWA 4HK3J 5LAXB 3M86A 5C0RH 1G7HA 2DKMA 3ISWA 3BH9B 3TJHC 4N2NA 3SQOL 1TTGA 1U8CA 4LCCA 5GGTL 2DQUH 4CADA 3BEVA 3QHTC 1MNNA 3QPKA 2VSDA 1H3PL 2GJ6E 2WBJC 4RIRB 2EJ1A 4Y4FB 2O61A 1PCXA 4ZYKB 4ZMPA 5FM5M 2AANA 1DJZA 2DWYA 4ZDHA 1UACH 3FXIC 3R8QA 4YEEA 5FW8A 3QJOA 3A5VA 1OP9A 4XMPL 3UTZB 2ARJA 2V8LA 2Y6SD 1MJ7H 4PRPB 3RDTA 4A6YL 4IIQB 3BHBA 2R2EB 2V0AA 2E86A 1AFVH 2FT7A 3BJ91 3L4VA 1JVOA 4H0IA 4OTXH 4UOW0 4HETA 1HZHL 2D8KA 3I6LD 1BQRA 5LXGH 5GJSH 1JXFA 3RWIB 4DK6A 2HZHA 4HAKA 5EOCJ 3UFIA 1JRHH 4P4RB 1EX0A 1BIIA 1XT5A 3D25B 4KI5D 1HH9A 5DWPA 3X13A 5KJRH 2BCMA 2ZX8A 4CC1A 1NBVH 2JK5A 2PTVA 5F7LB 3T09A 5HDQL 2DMGA 2BS8A 3CXFA 2ZUVA 4F27A 5A2AA 4BD4A 2PR4H 2AK4E 2CO3A 2NY0D 2RTTA 1SOXA 4U1LA 3IMBA 1F13A 4Z3TA 2Y3AA 1NEPA 1OPOA 1PVHA 2AQRA 2HT4D 4P23A 2VAAB 7PAZA 4WK4B 4FLHA 4OZIA 4D0CA 2X1PA 4G6JH 4JK0D 3CSYA 3F83A 3SDAD 1U8OB 1DBBH 2A99A 4OAWB 2UWEA 3A24A 4KK9C 3BPCB 4WHCA 4X8GA 1UHVA 1A9VA 4EJ1C 3HR5A 2VXSL 3KPRA 2Z8WC 4YFDB 2APTA 5E5MA 4Z9KB 4JHBA 5KVFE 5L88L 3GK8H 3AREC 4ATWA 3WO3B 2D9QB 5FGSA 3QT2A 4JRXB 4LLMA 4PJHF 3JWNC 3NIGF 4TVSa 4OGQC 5E5MB 5J6SA 3ZZ1A 3BVDB 2YHGA 4RMBA 2EDOA 3I50H 1F58L 4LLYA 4O9HL 1R17A 4X5LA 2E8ZA 1VACA 3IAPA 2Y22A 3WHXA 5ECGA 1I3GL 4GKSA 5CZKA 2UUDK 5C92A 3QIWD 1IL1B 5LAXA 1QKZH 4HKZB 1GS6X 1P4IL 1XEUA 4UT6H 1JFQL 1L9TA 5ANMB 1AR2A 3U6RB 1EHNA 3LB6D 3O6KL 2QTEA 1J7VR 4F7TB 5T1LA 4O5LH 3RIAK 4AJVA 4MA7H 2O5YH 1T3FB 3SPIA 1YPZF 5DO2D 4BBWA 2BHZA 2VXQA 3RJOA 3FB8B 2CKBA 3WCYA 5CF3A 1F86A 1IBGL 3B9KC 3WEOA 4I9WD 4F7MA 1P4IH 5IHZA 1J5OH 1ETB1 4HF5L 4Z8FL 4U33A 2AEPL 3T2LA 3JWDC 3FPYA 3VI4A 3LQMA 3S4SA 5CZVL 4MRBA 2LOEA 2RACA 3FQ1A 2DQCH 4K9EL 1LILA 3ULUE 4TQIA 5AW7B 5F89B 1T22B 5TD4A 4EZKA 3O81A 1P7QB 3BVUA 5GHWL 4I87A 3IDJB 1CE6B 3X13B 2MIZA 1FLRH 1A7QH 4ADIA 1QRNE 2DDQH 1DBKL 3QEGH 3LRSB 5D5MB 4IS6B 4J8RA 2ZUWA 4ZZFA 3C5ZA 4IIQC 4P4RA 2H32A 2R29H 3MLUH 4AWJC 4H88H 2ZF9A 1P69B 1QUNB 1RZFH 4HIHA 3CFCH 4RAVA 3VNYA 4P46D 4KU1A 1E4KC 3SGKA 5IVOA 4S1SH 3V0DA 4ZOBA 4AMWA 1D5RA 2DQHL 4ETYA 4HALA 3ZY7A 3ILQD 3R7QA 3HB3C 3HR5B 3KPRB 2BW4A 4Y0GA 1OSZA 1MFMA 3EH3B 3FT0A 2TAAA 3L4WA 3QDJB 5E2WL 5IB4B 3TO4B 2QQKH 5F1IA 3QDHA 3BGFB 2D2CC 2CM6A 2KDYA 5IMLB 4GI8A 2Z93A 5JIMA 4H8WL 1CT8B 1MH5B 5E24E 4PJAA 1KJVB 2PYFB 3U36A 3VH8G 1M05B 4JZJA 5C0FA 1FJ1A 2IPUK 4BINA 4ALAL 4S1RH 3EGXA 1AIZA 5F9DC 4OIIL 3EJYC 3FU9A 1U58A 2O72A 2VR6A 1H8LA 25C8L 4Z7NF 1WQVT 3GSOB 1T66C 5L8JB 4HH8A 1KLUA 1NBCA 2KLTA 4MNQB 1CTOA 4NN7C 1KLFA 1K2DB 4PWEA 4UAOC 4Y2DD 1BQHB 4PJGF 2HYMA 3GZPA 4QOKE 1YEGH 3SCMA 3ULVF 2OW6A 1LO4L 2P8LA 4LQFL 4QOKA 1EDQA 4JANB 1M7IA 4GMTL 1U3HC 1P6FA 1EHLH 1E8WA 4O2CA 2ZP0T 3MLWL 3KPPB 4M8RA 1WHPA 4G80B 3LQZB 1M7IB 3TO2A 1GS8A 3LKPA 1ZLEA 4WW1B 3CMOH 1LMIA 1A9EA 4PAZA 1S7SA 2GB2A 3B34A 3FB8A 3U7YL 4LBAA 5DEGB 1OWRM 3CZKA 5AKVA 3TA3C 1BZ8A 1XSJA 2PF6A 1QBLL 4M5SA 1B6DA 5GRZA 2XA8H 1M7UA 2WP3O 4U4BA 3ETBJ 3BQUB 5FOJA 1KT2B 1S78D 1BAWA 2ZOOA 2VGLM 2BVOA 5F6HI 1NFAA 2J55A 4WNJA 3VX0A 1U8CB 5DJZA 2CO6B 4X5WA 3CXHJ 5FKPA 3GGWB 1SY6L 4QRPE 1U4EA 1OARL 1UZ8A 3MRRB 5L7XL 5DSCB 5GGRY 3K0WA 2PWFA 3L6FA 4RISL 5D7LE 5AVRB 4J4PA 2GBUA 5D7LA 1OSZB 1OGAD 4LCUA 4I0PC 5HHXH 5GS0C 1UM4L 3QNZA 2C3WA 2CKBL 5FF6A 4NYLB 1K5WA 5B8CB 2OBGA 2WXMA 3LZFH 1OV8A 1MFUA 2ZOUA 4IQHA 2XZQH 3VRLE 2ZSVB 3MREB 3I9AA 5DXWA 5LNDA 2BNQE 5K9JH 4GUQA 1AAJA 1CICC 1OOAA 1HE7A 1CN4A 2AQTA 3L3DB 4IGBB 1PZ5A 1UQSB 1QFHA 3ARRA 4NRZB 3I6SA 5TFSH 3GT6A 3TC9A 4X6BA 3U7AA 1S7VA 2OX5A 1THCA 3RWIA 1I82A 4WIQA 1HC1A 1HDMB 2IAND 1H8SA 5FYKU 5B39A 4PMFA 3VM7A 1T1WA 2J21A 3G6DL 3UTQA 3NCJL 1II4E 3WTWA 2DD8L 3BO8B 5I1HH 3ZHLA 3LJ3A 2OS7A 1WDAA 2Y2YA 3DTXA 1KJ2L 3ETSA 4M56A 3INUH 4QRAA 4NRYA 5HGHA 4WK0B 4U3HA 3D3VA 5FUOL 1RAMA 2VLJB 4LEXH 1UM5L 2NZ9C 1MI5E 4LEEA 4PJXF 4TUJA 3RVWC 3G5XA 1KEGH 4F8NA 3N40F 3TYGH 4MDJA 5DRWA 3PDGA 4Y19A 5CJXC 1IQDB 4MCYB 1U8LA 1KYFA 3D08A 4F80A 3HNSL 2Y3NA 3GSXA 1YNTB 2BO0A 3J7HA 2HLAA 2Z64C 4D3CH 5GSRA 5DRXA 1JRHL 3VE0A 4H2CA 2WYHA 1JZ7A 4DESA 3UEZA 1MHHA 3DPDA 5D72L 2WC7A 4DJMA 1WFJA 3D85D 1ZGLB 3STBA 3VWJB 4I3RH 2H1PH 5F3BB 5LVEA 1JNNL 1WIOA 4W9FC 4U6XA 4JFPA 1N5YL 4AG4L 5I0WA 3HBZA 3SDAA 5C2BH 3NA9H 4ZTEA 3PWPE 1U2CA 4WFHD 4ZOEA 3OMZA 2HTKC 3DXAE 4OLWL 4HCFA 2YGVA 2B1HH 4JAMB 2CUIA 3ES6B 4WDIB 4NKMA 5D7SH 1RZKL 3K2UH 4FCAA 4OJFL 3SDAB 1SMOA 3UEQA 5KEZA 4Q9RL 4FFVD 4AEIH 2NCEA 4BQ8A 2GJJA 4JFEA 4NYLA 3PHOA 2R8SH 3I9IA 2BINA 4OY9A 1WFIA 2QV2A 3WJLC 1HWWA 5JZ7C 1N70A 4PTTB 3H9HA 1CYWA 1G9NH 1RHHA 4Y2DA 4AQ1C 4AZ8B 5K59E 4UIMA 1A7QL 5FA4B 3OG6B 2AV7A 4KQ3H 3MRPB 4XAKD 1BZ9B 1JZ8A 3U6XS 2MPAH 4KZDH 4AQ8C 2F53E 5I1EL 2IBZY 5T1DH 5G2NA 2K1MA 3V95A 5IW1A 1BVOA 4L29B 3RNKA 3BZFB 1CFBA 1JS4A 1PG7X 1OW0A 4PJBE 2F7IA 1D5ZA 1JHLH 1N6QH 1TCRA 2BSTA 3W0WE 2ROYA 5F88B 3U9PH 1GHFH 3RL1A 4HUVA 1GGTA 4ANWA 1E65A 4K7FA 4MB3A 4Z0XA 1NUDA 1S7VB 4HX1B 2C1OB 2AP2A 2ITCB 2MWCA 3FOLB 4LMQI 3T1FB 5B3JF 3L81A 3WIHH 5I30L 1QPPA 1SBSL 4XBEL 2YWYA 2GBTA 5LBVA 4RISH 4KI5F 4RGOH 1XB8A 2XPGA 1FFPA 2RIKA 4TNFA 1G0XA 3QJQB 1M57B 5CMAB 3MZTA 2R1XB 5TDNA 1DVYA 2EYSB 1NFIA 3THML 4FS0A 5D96C 1Q1PA 5SX4H 4KRNA 3V0EA 1FIGL 4HUNB 1F3DH 4WEMB 4NQCE 4FHBD 4X6EA 1FCGA 4ZW6A 4MA3B 2Y36L 3VO0A 4UF7C 2AZAA 4BFIA 1ZK5A 1A6ZB 1OQXA 5HYSG 3QJFB 3FBQA 3EUDA 4HJTA 5JA8B 3QEGL 4N86A 1G7LB 4ZK8A 1P4BH 4DKDC 4RWHA 2AHIA 4P5TD 3ZRFC 2TSAA 4CA4A 1NGQL 3HG3A 1GOHA 5DYOA 4IRJA 1Z9PA 1RZIB 2ENPA 2VQ1A 4J1UA 5EBLA 5I6OA 5GZNA 4Z3FA 1C5BH 1HH6A 2PWEA 3OLEA 3RVTC 3T2QA 2XI9A 1G6RA 2K9UA 1E67A 4K8RC 4UIKH 5F96H 5IVXA 2B4CL 3QEUA 1N5AA 4QRSA 2W95A 3ULSA 4AL8L 2XVBA 1N19A 1PLGL 1BZ9A 4GP8B 4QHKI 1MW1A 5E6SB 3UCQA 3C09C 3S8GB 3HPJA 1U8MB 2NNAB 2J4WL 4KK8D 2GEQA 3GBMH 2B0SH 4QRTA 3BZFA 3ZX1A 2B1AL 2EO7A 3T4AC 1KBGH 2UV3A 3WTUA 1DBML 4EO5A 8PAZA 3QDGB 5KAQG 3L1OL 3V4PB 3JWOC 3U9UA 3MRPA 3PL6D 3EOAB 2EUVA 2O5YL 4MJIB 3TCTA 3FH7A 3LN4A 4HISA 5FW6A 3VXME 1U4FA 2O5XH 1LE9A 5T3ZE 5JA9A 5EC2B 1FFNA 4TYUA 2COQA 4XVJH 5EO9A 3IJEA 1NCCH 1VAHA 3FCSA 2WO4A 2R0LL