1A4RA

G12v mutant of human placental cdc42 gtpase in the gdp form
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
190
structure length
190
Chain Sequence
b'MQTIKCVVVGDVAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G25K GTP-BINDING PROTEIN
publication title Nucleotide binding to the G12V-mutant of Cdc42 investigated by X-ray diffraction and fluorescence spectroscopy: two different nucleotide states in one crystal.
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 62
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1a4rA00
3B78A 5KDDA 4AWXA 3MWYW 1S3SA 1QHHA 3AB3A 3AVPA 4GP6A 4Q66C 1S9HA 4JYBA 1GM5A 1GL7A 2BMEA 2C95A 2VRWA 5FUWA 2Q0HA 1N6LA 3C4JA 2BM1A 2JA1A 1CJUC 3I73A 4HLUC 3E1SA 1SKYE 4HAXA 3WNBA 2OLKA 1XEFA 1WBBA 3VU9A 3B6EA 3GEIA 1DAEA 3ADKA 2GEVA 5FL3A 3CZQA 1P61B 1E0JA 3U4QA 2RGDA 1KI1A 3EASA 2REBA 2ZSBA 4LHVA 4P32A 4FCVA 1RKBA 4OI2A 4D4LA 621PA 4LUCA 1DARA 3LXRA 4AC9A 2WAYA 1Z5ZA 3LVQE 2IS1A 3LXXA 4Q01A 5TY0A 3NXSA 3TE6A 1Q44A 3G82C 3FMFA 2AD5A 4GNKA 5F9HA 2O8EA 2J7PD 1TF2A 3SBEA 3CLVA 5FPTA 4D6PA 3VQTA 1E1QD 3QBTA 3QY0A 1RIFA 1KZ7B 1P5ZB 2VYFA 5JS7A 2ZS9A 4HDQB 4A15A 3JVUA 1SVMA 1E99A 4YDSA 2QMHA 3KJEA 4QBGB 4UXJA 2WWWA 1XZQA 4MDEA 2QN6A 2GAAA 1UBCA 4E07A 3KUCA 1CKEA 2CMKA 4G5QA 3AF0A 4L5BA 2V3CC 3T1VA 4EFLA 5J4LA 3AEZA 2WICA 4B3GA 2QAGA 3CR8A 1ZP6A 3SQWA 1J70A 3HU3A 1XTJA 1Q22A 1CR1A 2IF0A 3GQBA 4LWZA 3RLFA 4RFSA 2V54A 3HU2A 1F5NA 4M1OA 1G5TA 3QXCA 4KBFA 3CM0A 2WOOA 2X2EA 1NN3A 1ZRHA 2KE5A 2GJ8A 2RMKA 2DY1A 1W1WA 1SQ5A 2JLRA 1AKYA 4NTZA 1XCPA 1VMAA 4LBYA 3R8CA 2WJIA 2J46A 3K9HA 4L9SA 4QHYA 3U61B 1NNEA 1P72A 2VSOA 2FWRA 2KB0A 3GMTA 2YKGA 2Z0MA 4RD1A 2QQ0A 1Z47A 3QSYA 4FINA 3S1AB 4NL4H 4J0QA 4A2QA 3X1WA 2OFXA 5L8VA 3QKRA 3I62A 4RD4A 3T5DA 1G8GA 3H1TA 4URWR 1Q21A 5DISB 2ZRBA 4V02A 2D2EA 1TUEA 2ZQ5A 8OHMA 5JJLA 2IEZA 4LYFA 3TKLA 2H92A 3Q9LA 4AK9A 3QEJA 4XOIA 5L3QA 5KDOA 1E79D 3MD0A 4O0MA 4JVLA 3QXXA 4KVAA 4Q7MB 4QRHA 2IUUA 2CXXA 2J1LA 5HCNA 1N0VC 4GOJA 2O8FB 3H0KA 1GDDA 3RC3A 4MUAA 4KFRA 4WOPA 4ON9A 4KO8A 3RYTC 3OEED 3FHCB 4PHHA 4HZIA 1KKLA 2ONKA 2JIZA 4H1UA 3D31A 4Z54A 1XNJA 2AK2A 2EYQA 4RKEA 5TVKA 1E2EA 1VKJA 1V43A 4Q4LA 4QKQA 4M21A 1E9BA 2NO7A 5B2ZA 3R9WA 5P21A 3WHKA 3W9YA 1P2UA 3X1ZA 3A4LA 1ZNWA 5F2EA 2IYSA 4NCNA 1AS3A 3SFVA 4HUQB 1DAIA 4LC1A 5JZVA 1U9IC 4V0MA 5HZKA 3P20A 2FDCA 1DBSA 4Q5IA 5FOTA 1ESNA 1QHSA 1DEKA 1E0KA 3SZRA 4XVUA 4W5HA 4CEJA 1ODFA 4Q1CA 2OT3B 2IUTA 4NPHA 4XWAA 4F93B 1W47A 1JJ7A 3BERA 3RS3A 4Q1AA 5FOUA 3BFVA 1YZNA 3KB2A 1Z0DA 1N6IA 1OFTA 4V0LA 4F4CA 4I1VA 4HYYA 2WPDD 4PTLA 1FTNA 4MRNA 1YRAA 4V0OA 4NCIA 3EZ7A 1TAGA 4PC7A 4JLPA 4Q7JB 1GWNA 2FH5B 4HEJA 2QI9C 1EESA 4B2IA 4PANA 3CIOA 1K8RA 3K09C 3K9LA 1OXSC 5CIWA 4Q4JA 1D2NA 1XD2A 3VR6A 1VPLA 5AUQA 3QKTA 3AF3A 1CU1A 5KNDA 3NVAA 3WNCA 1UADA 3KQHA 2JGNA 2G88A 5G3YA 3WMGA 1YZGA 4Q4HA 5JWRA 1KNQA 1N3BA 1QHYA 3W6NA 2E1RA 1NVVR 3QXSA 3EPKA 4FMCB 3NHBA 1G9XA 5DI9A 5EQTA 2C9OA 2WAXA 4AY2A 2YWEA 2ZE8A 3VNVA 1Z0FA 4L16A 4TWZA 1SKQA 4LHWA 1G6HA 4BLQA 4BEBA 1U8ZA 1FW6A 4DXAA 3CRMA 3I61A 2PEZA 1KDTA 1P62B 2EWVA 3W8NA 5FL7A 4L8GA 2AFIE 3M1IA 1ZJ6A 2V1UA 4GT1A 2I1QA 4A0RA 3FMPB 3Q8XB 1H8HA 1NVXQ 1JPJA 4YMSA 2R65A 4FMBB 4HAZA 2ZS7A 4IDQA 1YR6A 3R7WB 2ZVPX 3QPWA 4US1R 5JECA 1F2TB 2R6DA 1TEXA 3CRQA 4DLYA 4E22A 3L43A 5L3SA 3IDQA 4Q4AB 4RKFA 4TLDA 4DSUA 3ICQB 3GPLA 2V7QD 5FBQB 4TYPA 1M7HA 2O8CB 1Z6XA 2PLRA 4WW0A 3PEYA 4A0GA 4BFXA 2QAJA 1YKSA 3PCRB 4DRZA 1JAIA 2ZRJA 3HPQA 1UDWA 2PT7A 4ZKDA 4RY2A 3EPHA 5EE0A 1RE0A 1LY1A 5KHOC 4M1WA 1VDZA 3H4MA 1XP8A 2CE2X 2BOVA 2ZE6A 4B3FX 2J59A 3A1WA 1XJCA 4JLMA 2BVNA 4LJAA 4BFVA 1N2CE 1YZLA 1ZIOA 2CL7X 3N2IA 2W2VA 4MA4A 4DB4A 5EP4A 2QPOA 5J4KA 1IJEA 3CRW1 1DAKA 1TU3A 2E87A 3AP2A 3OHMA 4B76A 4CZ2A 4FMDF 6Q21A 4MDFA 1YHNA 4DLSA 1EWRA 2G9NA 3ZD6A 1UBFA 1E1RA 2WBLC 1OKKA 2YOFA 3UG6A 2NPIA 1ZM3A 3WNDA 2JLYA 2RAPA 3BORA 2N1BA 3I3SR 3A8TA 5KDLA 1ZYUA 1E9DA 1NG1A 1FUKA 1RFLA 1ZU4A 4B35A 4KSBA 2EWWA 4LJYA 3GLFA 1VG9B 1EFUA 2P5TB 1JQJC 1VG0B 2RGNA 4Q03A 3UMSA 2KWIA 1Z2AA 4JMPA 5FR1A 4EQ6A 5GJVC 2DWOA 4MRPA 5FUVA 4C0BA 2DFTA 3ZQ6A 2V4ZA 3FYHA 2A2ZA 4A8JB 5DNYB 4FIDA 4A8JC 4Z1MA 4Q48A 4M22A 1A82A 2K5UA 1IY0A 1QHIA 2WWXA 1NKTA 2ZETA 2GCPA 2QTFA 1ZC4A 5IF9A 4LSGA 4XWOA 4IOKA 1SVOA 1YR8A 3CF2A 1SXJA 5EP2A 1G8PA 5KPDA 4XD7A 4EPVA 421PA 3GJ4A 1QG2A 4NYMR 4Q1BA 1RRPA 5AWFC 2XOKA 4C3ZA 2WKRA 1IN5A 2GJKA 2EW1A 3FMOB 1JALA 3FOZA 3UXMA 3O47A 1E0SA 2HXSA 4B3BA 2VHTA 2ZAMA 1ZU5A 2ZJYA 1Z0JA 3LQRA 1OYYA 3MWJA 3TUZC 5K8LA 3GLHE 5AJWA 1O3YA 5BYKA 1KY2A 2AHOA 4LBVA 1TF7A 3AUXA 1R6BX 3REFA 1SVWA 4IVQA 1R7RA 1ANKA 1BIFA 1XZPA 2F9MA 4DSTA 4TZ0A 4FD2A 3OE7D 2E9SA 3TNFA 1ZM2A 1DE0A 1OW3B 1OT3A 1H8EA 2VF7A 5IT5A 4XTCS 4YLGA 2FJUA 2AL7A 2YWFA 5C4MA 1XPUA 2QM7A 1E32A 2JLXA 1E9AA 4HATA 3U6KA 2B92A 1HYQA 4YDHB 4RD2A 3VHLB 3TRFA 4G01B 1XD9A 1ZVQA 3B1XA 4O2RA 4P33A 4DLVA 5EP1A 1P9NA 2AXPA 2ZRCA 3OIUA 2Q3FA 2JCSA 5DLQC 4IFBA 3TQFA 3W3ZB 1DPFA 2ZR7A 4GI7A 4C30A 4ESVA 1G64A 4QHSA 4HDCA 1OH8A 4GSYA 2OM2A 2XEXA 3B1WA 4PZYA 4BLRA 1KZGB 4F4JA 1KNXA 1OHHD 4IDOA 2PCJA 1RZ3A 3WY9A 1RJ9A 4XSGA 2XZOA 2QSZA 4JLOA 2NPFA 4KXFB 1TX4B 2I1VB 1LFDB 4IDPA 4POAA 4O25A 3LNCA 1YE8A 1KI8A 4NCJA 2LWIA 4R2HA 2PEYA 1G21E 2N42A 1L2TA 5EZ5A 3QF4A 5UKDA 5DYIA 3BH0A 2O52A 3RVBA 1DG3A 1W46A 3ZH9B 1MV5A 3RRZA 1OYWA 3UMFA 2UKDA 4IVPA 2Z4RA 3NDBB 2GBLC 4A9AA 2JJ2D 3IBYA 2VHUA 3HP1A 1II0A 1AZTA 2JLWA 5HE8A 3NIBA 3OFND 1FX0B 1XFAA 3D8BA 1NN0A 2FZ4A 1NVVQ 1B0UA 1YVDA 2PCLA 1Z0KA 4IOMA 2O8BB 2XX3A 4F92B 5AJZA 1D5CA 2FEOA 2G1JA 1TQ4A 4U00A 3MG9A 2F3RA 3NKVA 4HB3A 4XVQA 4DHEA 3AVQA 3TK1A 1MABA 2H8KA 3LBHA 5K8UA 1MOZA 2BCGY 1X3SA 2NTYC 2AX4A 2RB4A 2OXCA 4BZXA 2H1LA 2Q9AA 2D74A 3HWSA 1JR3E 5LD2B 3WYAA 1UDXA 5LD2C 1CULC 2X77A 2AD1A 1EWQA 2J3EA 5FTJA 1NKSA 4JBXA 5EP3A 5KNCA 4GRAA 2IYQA 4DIEA 1PVOA 5KYKA 3U7HB 1ZC3A 1YZUA 1G3IA 2VQSA 3V4FA 2JJ8A 3L8ZA 4HAWA 3GJ0A 4KLZA 4PQYA 4B71A 2FPLA 1S1CA 1AM4D 3NBZC 1OXXK 1YJ5A 1E2DA 5HR5A 2VP5A 1COWD 3F8TA 3R8FA 2D7CA 3CF6R 1LW7A 1IY2A 5CJ2A 5FPYA 1G3UA 3CNLA 2GDJA 3QOFA 4KHZA 1Q1ZA 3AKEA 3U3MA 2J41A 2IA5A 3AKDA 4ZPXA 2ZSFA 1C1YA 1OKKD 2SHKA 2FEMA 2BHRA 3KFXA 3OEHD 1F60A 4QHTA 4HLDA 3KXKA 4NU0A 5FI1B 4G5GA 1W36D 4TN1A 1XMJA 1ZBDA 2FFQA 2ONJA 1KK2A 4RZXA 3NEJA 1KK0A 1KI6A 3O8DA 2ZIAA 1UKYA 3WRYC 2PZEA 1NVWQ 4OK5A 2VTKA 5CK5A 2BV3A 3W6OA 5EE9A 1OE0A 4ACAA 5C46F 2B8TA 1NMXA 1J7KA 1LS6A 4Z1MD 1N5JA 4C0AC 4UNNA 3C41J 1M7GA 2HLDA 4Z8XA 821PA 4TLCA 1KOFA 3GJ3A 2CBZA 3LW7A 1GRNA 2FN4A 3QPUA 4LBWA 1WE2A 3RSLA 1R0ZA 3U3OA 2ZSEA 4XD7D 1BO6A 1G3RA 2PX0A 4D2IA 5B58C 2XOKD 1YZKA 2PX3A 3CF0A 1KO1A 2NO6A 4M9XA 3F0TA 1XMSA 2Q21A 4TSFA 5DO9A 1XTKA 1ZNZA 5D3MB 3T15A 2IXEA 2XSZA 3MJHA 1JAHA 1JQLB 2GXUA 4W7SA 3TH5A 3THWB 1G291 1SZPA 3UG7A 4MYCA 1VG8A 3AKYA 1YZQA 4JZKA 3H84A 2QQEA 1CR0A 3QKSB 1F2UB 1S4QA 4YONB 1XTRA 2CL6X 4C4PA 4C0JA 2DR3A 5E95A 4B2LA 1KMHA 1VCMA 4B3XA 4LYJA 4D81A 1R4AA 4L4UA 3ZZ0A 2NZ8A 1H8ED 2CJWB 4PFSA 5BWMA 3GLGB 2ZI7A 3GJXC 1W4BA 1XDBA 3P1JA 2W2TA 2ZJBA 2Q9BA 2WMNB 1M1YE 5JEDA 4TMXA 3ND9A 2ZRAA 4M1YA 2J0UB 2AR7A 2O0JA 1AZSC 4K81B 1W0KA 2AN9A 1ZCBA 2PL3A 3ETLA 4HZUB 2QBYB 1C9KA 3EW9A 5EZ6B 5KU1A 4U02A 1S8FA 2ORWA 2F3TA 1TNDA 2C03A 3ZJYA 2QP3A 1R0XA 2ECKA 2YC2C 4G5SA 3AVVA 2WMOB 5FOVA 1CBUA 2RGAA 4WZ6A 2GEUA 3MGCA 2XXAA 4UQOA 4OHWA 3CPJB 3EAQA 4EPWA 4QNRA 5JSZA 2WKPA 3A1SA 3CH5A 3B2EA 3DVLA 5H1YA 1Q3TA 2BEKA 2ZI5A 5FBRB 4OQXA 1KDPA 1IY1A 2XTZA 4XVRA 5FBWB 2C78A 1E94E 4TZ6A 1IHUA 1OFUX 3VKWA 5JS8A 3DL0A 5JMTA 3RANA 5JRZA 1DO2A 3IO5A 5KOYA 4PHGA 1ZM7A 4IXMA 4M9ZA 4AYXA 2D2FA 1PLKA 1Z08A 2C98A 4WA7A 4TMZA 3C5CA 4MKIA 1Z22A 4KI0A 1UAAA 2CLDX 4DLUA 2QUZA 4IOLA 2GTPA 3U7EB 2RHDA 3AQ4A 1II8A 2IYVA 4CT5A 2FE4A 5G53C 3VR5A 2FZLA 2QTVB 2GA8A 4JL8A 2HYIC 3KXIA 4DDUA 1E2QA 4AG5A 2XNDA 3N2EA 3B1VA 4PSVA 1QZXA 4Q9JA 1Z6TA 4WIAA 3REGA 5JEEA 3ZS9A 3RC8A 3W90A 4MKHA 1TQ6A 1JJVA 3D7MA 4KODA 1W4AA 3L82B 2IXFA 3Q72A 5A4JA 3H86A 4BFTA 1GKUB 2DWPA 1OH6A 4DB2A 1CP2A 2KBFA 4RCZA 5JFGA 1N6OA 2XZPA 4ZIRB 3U7FB 1GRQA 4RFSB 2XAUA 4TYQA 1N6HA 2VO1A 1HH4A 2QROA 1N6KA 1U94A 3BH6A 2ODWA 4JLNA 2EVWX 4DUGD 2QTHA 4JKYA 4OL0A 3J81k 1X86B 1WP9A 1R8QA 3NH9A 2ZUCA 3CNOA 1E3MA 5JRJA 4PO9A 2IHYA 5DN6A 3WHLA 1T3LA 2VP6A 4YXWA 3SJAA 4ABYA 2R62A 4D4MA 1L8QA 3FFBA 2F6RA 5GVRA 5TMPA 1AS2A 2JATA 3TBKA 2ZXUA 1FMJA 1KK1A 5DSZA 3VR1A 3PVSA 4HLQB 2QNRA 1NP6A 2GNOA 1BOFA 4JVNA 3EXAA 2JLSA 5FOSA 3P32A 1NLZA 3IBGA 2QT0A 2RGCA 4LRWA 2C2HA 3I92A 4I81A 1F6BA 1TADA 1HQYE 4TTQA 1WBDA 2GXSA 3CB4A 1WB9A 2HV8A 4D4JA 1VTKA 5DHAA 1E96A 4TTPA 2FSIA 221PA 1XD8A 3E2IA 4URUR 4BZPA 2ZRIA 1G6OA 3DZDA 5EJEA 1LF5A 1US8A 4C7OA 4LOAA 1FTSA 2QE7A 1S9DA 2V6JA 2W6JA 4M4SA 2VP2A 3IGFA 2RKOA 4FN5A 4RJLA 3CO5A 3PUVA 1KO4A 2VPPA 4LCBA 2GILA 4TSFD 2OBMA 1DTSA 3C14C 2I4IA 5BXQC 3AVXA 3NDPA 4W9MC 2H5EA 1ELOA 1GUAA 1KMQA 3T34A 721PA 2G83A 4Q1DA 2BDTA 4P4SA 2ZI9A 4C0LA 3MCAA 2QGZA 3T61A 4URXR 5BN3A 3NBXX 2QPAA 4TYNA 5JWHA 4CEJB 3PEVA 1HE1C 4DLWA 3IPYA 3L2OB 1I4TD 1HT1E 1IM2A 4LJ5A 4F91B 5HZHA 3GLIE 3VR3A 1K5DA 2ZYWX 3BH7A 1ZUIA 4JBWA 4NH0A 1AJEA 3THYA 2OXRA 3PITA 2NMVA 1T8TA 3X1YA 1E9CA 1Q0UA 3JZMA 2CLCX 2ZR9A 2ZITA 1NSTA 1JEDA 4ZDWA 3FGNA 3EIEA 3WXMA 2ORIA 3NC1C 3KDSE 3ADDA 1T6NA 1SVKA 5TB5A 3MLEA 3ZVMA 3BFXA 4Q1EA 4PO8A 3VKHA 1W0KD 1KI7A 3OAAA 1FFHA 2QA5A 1DVRA 2PJRA 1ZNYA 2B7BA 2FSGA 1CRQA 3BB3A 4Q4HB 2C04A 1KSJA 4LJ9A 4QC2A 3KB1A 1YR7A 3LDAA 4PSAA 2ZI4A 4DZZA 2ZRNA 1NIJA 2YHSA 2O8DB 1I2MA 2WJVA 2YC4C 3I8SA 2YNMA 3VMFA 2WSSD 5CB6A 5DYGA 1Q1EA 3WRXC 4TT3D 2RH5A 2IX3A 2H7VA 3ZZTA 3UIEA 4WZAE 2CHGA 2DHRA 5KPJA 1CTQA 4NBSA 3QXJA 5GJWC 1KTVA 4P0TA 4RCYA 1NLFA 4TL8A 3OIWA 3GLGE 4QGHA 3N5CA 4R9UC 1IXSB 1XF9A 1XXHE 3AM1A 4M1TA 2XTMA 2R6GA 4H9GA 4AIIA 3ASYA 1RC8A 1M8PA 4GBMA 2GVZC 1NLYA 2J0VA 5L3SB 2PMDA 4TL7A 2F43A 3GFOA 5EXPA 1J8YF 3L0IB 5EXTA 2WJJA 3U3RA 1WMSA 1NBMD 1KHTA 2WJYA 2GJ9A 2BMFA 1AGRA 2IHBA 2Z43A 4YMTA 4B74A 3WMFA 2WOJA 4O3MA 4HB4A 3HR7A 4EKDA 4PQRA 1VIYA 3ASZA 521PA 5JLJA 2NZJA 4WVFA 1GILA 3GLHA 4IXNA 5DI3A 2XNDD 2XJ9A 4MITA 2WM9B 1TU4A 2P65A 4LHYA 4LV6A 2DFKB 2DB3A 1EFRD 1R8SA 2HT1A 1EFTA 3SYNA 2C77A 2QPTA 4JBYA 3MWKA 3JZAA 3BBPA 2QG6A 1R5BA 3SNHA 1CLUA 2IYRA 2A5GA 1CXZA 3FVQA 4LGMA 2Z5FA 3IQWA 1D9XA 5E7JA 2V9PA 2D62A 1W36B 1BYUA 4KLNA 4URZR 1L4YA 4P4UA 1W7AA 3S1AA 1XMIA 4B3CA 3GLFB 3DM9B 2OILA 4OQMA 4M1SA 1TL7C 4MRVA 3KXLA 2IYTA 3PFIA 2QT1A 4LPSA 4YC7A 1HURA 4MGYR 4Q9HA 3RDPA 4DDVA 1YR9A 5J4HA 3ND8A 1K5GA 4OQFA 1YRBA 4QG7A 4JLBA 4ZDJA 4JVMA 5EE5B 5LB4A 3CBQA 2AKYA 2HYDA 3B60A 2O8FA 1SXJB 4FCWA 4AYTA 3ONWA 1G20E 4C9BA 5C18A 1OJLA 2W00A 3K0SA 1GNQA 3EG5A 3CX7A 4JSYA 2JEOA 2GXAA 4EIWA 2H16A 1E2LA 2P6NA 4B3DA 2MSDB 2JDIA 4FWTA 1MO4A 4W5JA 5CYOA 1DO0A 2ZUDA 3LW8A 2X19A 4HUQA 1U9IA 2FA9A 3AVTA 2A5YB 2JJ1A 3A1TA 3VX4A 1DAGA 2CNWA 4PSKA 1BMFA 1RRCA 1JBKA 5KSYA 1RW4A 1BKDR 1VHLA 3BD9A 4ILEA 5TDHA 3EC2A 3KKOA 5TARA 2ZAOA 3AF4A 4Q47A 3UANA 4HSEA 4GFDA 2FFHA 1LTQA 5LBIA 1E9SA 1E69A 2YOGA 5SZIA 2QU8A 4BQSA 3LO5A 3BB4A 3K09A 4DT1B 3IHWA 4PQFA 2CHVA 2ZSDA 4XTRA 2OO7A 2O0KA 1GAJA 1IONA 1VYTA 3AV0B 1VYVA 1JR3A 1G41A 3KKQA 4CEIA 2ODEA 1MO3A 2ZR0A 3DDCA 5AJXA 4RFVA 5L3RA 1VCIA 1T8UA 5FOXA 2DCUA 3K0AA 1UFQA 4MUBA 4Y0VA 4Q18A 2WTUA 1R10A 1E2IA 1RJ9B 4HB2A 2J87A 2V1XA 1FOEB 1IBRA 2KBEA 4TQUS 4V0KA 1IXRC 1M2OB 1GIAA 2OCAA 5HCIA 3KFVA 5DH9A 1PV4A 2VHCA 2V6IA 3KQKA 5K8TA 2P6RA 1GNPA 4X8OA 3ZGXA 4IEIA 5B57C 1EFCA 4X8HA 1Q20A 2PZGA 3R7WA 2OSBA 4KITB 1OIVA 2JIZD 4KYIB 2BCJQ 3CZPA 5FTLA 1TEVA 3Q5DA 2R9VA 2ZRGA 1GZSA 4MKFA 3QPVA 2QSYA 2ZJOA 1P4SA 2BKEA 2MSCB 1UF9A 5H8WA 2GVDC 5FTMA 4A0HA 3IEVA 1B23P 1G8HA 4EFMA 4WZBE 2X8AA 1X8LA 1KDOA 4RD0A 1GL6A 2RGXA 3IIMA 1AK2A 4H1VA 4PPQA 5FR2A 2A30A 4FMDB 5BN5A 1HTWA 2FMXA 1G7RA 2PH1A 4XWKA 4LYHA 3QXHA 2DWQA 4MYHA 2QMUA 5J4VA 3TAHA 5IK2A 2ZI3A 3TGPA 2CCKA 1Z0IA 4PAQA 3AF1A 2VEDA 3K1JA 4EFNA 1OH7A 2RCNA 3U6BA 4ZV4A 1KI2A 3RWMB 3PV0A 4C2UA 2HUPA 1QHNA 1ZD9A 1YZTA 1ZM9A 2Q9CA 3K0CC 4MH0R 3HDTA 3UKDA 4D82A 4D0LB 4CEHA 2X1VA 4WXPA 1FMLA 3P4XA 5EE1A 3LX5A 4DCNA 3UPUA 1EK0A 1U0LA 1WA5A 5FUXA 3SHWA 2FPKA 3PXGA 4ZDKA 1UBGA 2FU5C 4JS0A 5J40A 4A8JA 2ZU6A 4EPRA 3LQQA 3SFZA 3KQLA 3O8CA 1N0UA 4I1UA 4UNPA 1KI6B 3NWJA 4TTRA 1G7TA 3A4MA 3CX8A 5FPHA 2KI5A 3GJ5A 5CLQA 5AUNB 3SE0A 2VHQA 4Y0AA 2GF0A 3GP8A 5FL7D 2WHXA 2GK7A 1M34E 4CT4B 1H8HD 4LV8B 4UNRA 2F1IA 4LX0A 4BLTA 3AF2A 4PXAA 3FE2A 4DKXA 1ZAKA 3LLMA 4BZQA 4LHXA 1GTVA 1W44A 4YQFA 1Z6GA 1SKYB 4C0KA 3B1ZA 4Z51A 1GKYA 4I99A 5HTKA 2GXQA 2CEAA 3U44A 2EFCB 3KKNA 4JSTA 4C0QC 4KYUA 3ZVLA 1HV8A 4MYTA 1U81A 2IYXA 3NHAA 1YQTA 3K0FA 4DWJA 3LRPA 4GOXA 1KO8A 4I1SA 3LLUA 2WJHA 2HCBA 2I3BA 1W0JA 1U90A 4DCTA 1W2HA 2F1HA 4OI4A 5J47A 1BMFD 4RD6A 1AKEA 4IJMA 1NMYA 1CF4A 1BYIA 4IRUB 2BBOA 3ZDQA 1OPXA 4IEEA 1U0HC 4BLSA 1W4CA 1FP6A 2A5FA 2OZEA 1KAOA 4YMVA 1N6PA 5B64A 3VKGA 3THXB 4JVSB 1Q1BA 4B43A 5JCZA 4AG6A 3AP3A 1E1RD 2LCFA 3ZIAA 4D0GA 1T0JB 1KI9A 1HE8B 1CR4A 1D9ZA 1QVRA 1PJRA 1LNZA 3LBIA 3SHFA 5FOWA 4EJSB 4B6FA 4EJSC 3QVVA 3GJ7A 3VFDA 5A0FA 3RHFA 1RRFA 1ZMXA 1FNMA 3BS4A 4S35A 2ZRDA 1JR3D 1J2JA 4JLKA 1XEWY 4A6XA 2G3YA 1FNNA 1XEXB 5C2JB 3B13B 1HUQA 4ZDIA 3Q3JB 2W0MA 5BYJA 1SXJD 3CRRA 4EUNA 2ANBA 1P2TA 3RNLA 1G7CA 2CL0X 2RGBA 4BECA 3KQUA 3TAUA 1EFHA 5G3ZA 1JB1A 2GBLA 5CDFE 1F48A 3LFUA 4A92A 5E7IA 5KSZA 2WWFA 2ZANA 2ZRKA 1AGPA 2QENA 4A1FA 3LD9A 3RS4A 3C8UA 1ZD8A 4ASUA 2J7PA 2GK6A 2QRZA 4Q7LA 1E1QA 3WBJA 1SHKA 1SVIA 1OF1A 5H68A 2DPXA 1UPTA 2EFHB 2BBTA 3SR0A 2BBWA 4DLRA 3LV8A 2XNSA 1DAMA 4NYMQ 1QHXA 1E2FA 2FG5A 3GEHA 2IWRA 1X6VA 3TIFA 4NYJR 2FFBA 1IN7A 1W49A 5EXXA 3HJNA 4A82A 1P60A 5M04A 2QL6A 1SULA 4D80A 4KV9A 4G5OA 1S96A 3MUFA 2JAQA 5CK4A 5CITA 2CLSA 1X1RA 1ZIPA 3TSOA 4BFYA 1T3SA 1GITA 2QRNA 3WBKA 3GCGA 4HAYA 5LDDC 3PENA 2OFWA 1U8YA 3ZVNA 3QENA 3L0OA 1KSGA 3UMRA 3W6PA 2P67A 3QIAA 3EC1A 3OESA 2QGNA 2XB4A 3L0PA 2QMOA 2IYUA 3CWZA 1OV4A 2ANCA 2OLJA 5KUTA 2XGJA 3EIQA 2YZ2A 2RHMA 2ERYA 3B82A 3BJIC 1NN1A 3IPXA 4PHTA 5FBLB 3KJHA 4RD3A 5AR1A 5IK2D 5K8IA 3TSWA 4IKEA 4A6PA 2LKCA 1X1SA 2CE7A 4M53A 2YV5A 2IEYA 4JIMA 1ZW6A 5CJPA 1NIPA 1OLOA 2OG2A 4LK2A 4TL9A 2KJQA 1QHHB 4QJ3A 4D26A 3RRYA 3FTQA 4KSCA 1RPZA 1P7CA 2GJSA 2WWYA 1Z6AA 3DMNA 3G0HA 5CB8A 1GP2A 2OUKA 2ODNA 2R6CA 4NONA 1A2KC 4ACBA 3VU9B 3V9PA 2OBNA 1XB2A 3GLIA 4HB0A 4QBIA 1AA9A 5DE3A 1Q12A 4B48A 4EPXA 1P73A 1G7SA 1SVSA 1JPNA 2BKUA 3IUYA 5JWOA 4P4TA 3U4QB 2OCYC 2C99A 1E79A 1UM8A 3IKJA 4URVR 1PLJA 4KAXA 4LY6A 4MGZR 5FI0B 1RYFA 3IO3A 2XJ4A 5F3WB 3SJZA 1Q3HA 3MSXA 3OEEA 1RRGA 1Z0AA 3BXZA 4MRSA 2A78A 3C5HA 2AWOA 2CDNA 3KTAA 1IN6A 1OSNA 2VSFA 2ZU0C 5JJKA 4IDNA 3MWLA 1GNRA 4LZZA 4TLAA 3AVYA 4PC3A 1E2HA 3TR5A 2O8EB 2UZ3A 4AI6A 1XBTA 5D3MA 1U8AA 1ZNXA 3FPAA 3K70D 3I4LA 3A37A 1XTSA 3THWA 3VR4A 2FNAA 4Q9LA 4TLEA 1KI3A 5FFMA 1MO5A 3PEWA 2IS2A 3DPUA 3AP1A 1F2UA 2GZDA 4X8MA 2D3WA 3RAPR 4KU4A 4AURA 1NY5A 3WMEA 1U2RA 3BRWD 1AS0A 2VP4A 1P75A 2HF8A 1R0WA 4CIDA 1XPRA 3PUYA 2FOLA 2QAGB 4OHXA 2QAGC 1LS1A 2A9KA 3CPEA 3FWYA 3K0EA 2CJWA 3JVVA 4LHZA 4HUTA 2WPDA 4ZI2A 4JLJA 2C9CA 3KZ1E 3GLGA 5GJBA 4KJZA 4TMKA 1XXHA 1G4UR 3KKPA 5EUMA 3OZXA 4BLOA 2EFEB 2ZE5A 2GZAA 3LA6A 5HPYB 4M9QA 2J0UA 2UVQA 2W2XA 1Z29A 3SBDA 4MQBA 1GKIA 1MRNA 3R20A 4UNSA 1UKEA 3TVTA 3GEEA 4PAMA 3PQCA 4ERNA 1BS1A 5L3VA 4YMUA 1E9EA 4EDHA 3HYTA 2FF7A 3GJ6A 4FW9A 3TJZA 3CH4B 2AK3A 3GD7A 4F38A 1PUJA 2D7DA 2AWNA 3QKRB 5SZJA 1J8MF 1M7BA 3TMKA 1AN0A 1UBEA 4OQNA 4L15A 3T35A 2OHFA 2GEDA 3ZYCA 3QI2A 4ITRC 1G18A 3LWNA 4QGFA 1ZD1A 2WWIA 1P9RA 4XSHA 3TW4A 3K9GA 4Q00A 4R7ZA 3VNUA 2P3SA 5L3QB 1W2GA 3M4YA 3KJGA 2ZJZA 3IILA 4A4DA 1EX7A 3CR7A 1T4GA 4FI3C 2IF2A 2HLDD 2TMKA 3H2YA 2ZJ2A 5TV2A 3P26A 1R2QA 2PMKA 1VCNA 1MH1A 4MGKR 3WP1B 2ZSAA 4A0FA 2WZQA 4G5RA 1I2DA 1Y63A 3M6AA 3B85A 2V7QA 3QVUA 1FQJA 3VTKA 1Y3AA 1Z06A 5FUYA 2FSFA 2MSEB 3SS8A 5G40A 4LV5B 2XSZD 2BIFA 2P6UA 4ASUD 3RRNA 4GDFA 1QG4A 2ZVQX 4DLXA 2IYLD 2YINC 3ZVRA 3ZQJA 2RGGA 2ORVA 1MT0A 4P3YA 3ZZUA 1SHZA 2F43B 1CJVC 4LI0A 5AJVB 4E5UA 1IQPA 1NF3A 1GRRA 5EUQB 4PHFA 4JKIA 4OK3A 3FKSA 3P4YA 2FPMA 3U60B 1NRJB 1NVUQ 4MGIR 2R6FA 2IYWA 4DSOA 1X8KA 4TYWA 1WRBA 2J5XA 1E2GA 1CRPA 2LKDA 1CS4C 2GCOA 2NGRA 1W4RA 1WXQA 1T5LA 3G5UA 4D0NA 4ZCMA 1PUIA 3BK7A 3GLHB 3MMPA 4QFMA 5DI3B 3BFKA 4Q02A 4S2EA 4ARZB 4NYJQ 4ZIRA 3FFAA 2QY9A 4Q4JB 2KSQA 1XD2B 2ZS8A 1U99A 4CRWB 4JT4A 2HEIA 1W5TA 5KSPA 3DKVA 1MRSA 2ZYUX 5CM9C 2VF8A 4BRUA 1EG7A 4HLUA 4IHQA 3QNUA 3SI7A 2REXB 4IOJA 5FPSA 2C5LA 5GADl 3Q5EA 3I8XA 2QM8A 4N1AA 4NCKA 1Q57A 2NG1A 5JCPA 2GJAA 2AXNA 2D4HA 3DEFA 1IN8A 3BIFA 1T5IA 3EX7C 1O87A 3GFTA 4TMWA 4PZLA 2CCGA 1IXZA 3B7GA 1LB1B 1NBME 2MMCA 5SZKB 1DAHA 1TUIA 3KX2A 4FMCF 2GETA 2GZHA 3EA5A 3EZ2A 4JJKA 1UEIA 1E6CA 1BH2A 1Q1QA 3X1DA 2MMGA 1G19A 3SN6A 3IEUA 3U2QA 3BB1A 3F3YA 4CVNA 4PZZA 3BC1A 1KSFX 2DFLA 2HJVA 2XZLA 1CJKC 4BUJA 1DS6A 1NN5A 5HE9A 2VL7A 2OAP1 2WWGA 2NOAA 2ZJAA 1S2MA 3DMDA 2ZRHA 4JL5A 4Q9KA 1E4YA 3TW8B 2EQBA 3OE7A 4BE7B 5FPKA 4B47A 3A58B 5LPNA 4PX9A 1WQ1R 1IJFA 4XIGS 1LVGA 1WDTA 1ONBA 2ZROA 1RYHA 1XEWX 2V8OA 5FTKA 3I32A 1IAQA 2CVFA 1E2NA 1EX6A 2VH5R 3SEAA 1G16A 2PLFA 4LJ7A 2J45A 1M6NA 4L9WA 4N0DA 4OHVA 4A36A 4DLZA 4LYAA 3SJBA 3FDIA 2YWGA 2P0EA 4PC6A 1NJFA 2VIIA 3NH6A 4RZUA 1T9HA 2BC9A 2BMDA 1KDRA 4V0NA 4Q9IA 4FXPA 1FQKA 2ZRMA 1N5LA 1Z63A 5AUOB 4BLPA 2ZM5A 5G41A 2QP9X 2VP0A 4XH9B 1CJMA 1L7VC 5IHPA 2PBRA 3PR1A 4B75A 4HDOB 4M0LA 1W36C 1G4AE 3VAAA 1P2VA 4OQLA 1DELA 4ZO4A 2P5SA 3I1FA 2F1JA 1OHHA 4ZCIA 2RGNC 4EQ6B 3OIVA 3C15C 2GESA 3EWAA 3MAAC 3KKMA 3KJIA 3CKLA 2IT1A 5SZHB 3TQCA 5DN6D 4LJ8A 5H70A 3CWQA 4YXWD 3BAFA 2ZE7A 2ZJ5A 3C16C 4MYUA 5C4GB 2PZFA 4CEIB 4G3XA 4LPKA 5AJYA 1XX6A 2N46A 3QKUA 3RWOA 4LJ4A 4NMMA 1D2EA 2P2LA 3X2SA 1NG9A 2H18A 4BWYA 3IIJA 1P3JA 3AVUA 1UJ2A 2HXYA 3K0AB 3T06B 3U7GA 2O8DA 1SXJC 3QJYA 3T1TA 1TTTA 3QE0A 2FSHA 1OXUA 5HKKA 3DOEA 3F5FA 3PUXA 4NP6A 2JJ2A 3FB4A 3T1OA 1ZM4A 3NBFA 3TVDA 3CNNA 3V00A 4DC9A 1I4LD 3OFNA 1QDEA 1NL3A 3AVOA 3QG5A 3HR8A 3TUIC 1KY3A 4QNMA 1KJWA 4PPGA 4CDGA 2F55A 2R8RA 2IC5A 3TR0A 5E7MA 4DLTA 4A2WA 2XB2A 2QE7D 4K46A 2W6JD 1T91A 2HDNB 3A1UA 1HT2E 4Q1FA 4UNQA 2Q3HA 4RVCA 4URYR 4ZI3A 3LX8A 3FHOA 1CJTC 1DOAA 3PUWA 4PAOA 1M74A 2IYYA 4X8LA 3EZFA 3SJCA 3SYLA 2GHIA 2JLVA 2JASA 2FGKA 3AH8A 1W5SA 4DSNA 5C1BA 3NC0C 4W5WA 1S3GA 3LBNA 1E2KA 2GWHA 3NG1A 3KQNA 5E3HA 3FKSD 1FL9A 1VHTA 3NTUA 1XCMA 4TQAA 2NIPA 1PZNA 1QF9A 2FX3A 4FWIB 4NE2A 2OCBA 5CLLA 1COWA 3SOPA 4ZCLA 3PJRA 1OXTA 1GG2A 4HAUA 3I5XA 1GOTA 5A5GA 3I72A 4DCSA 2IL1A 3OEHA 2B6HA 5GVSA 1PLLA 1XMVA 3SU8A 3HYRA 4G1UC 4IVRA 4LJ6A 2WVJA 2QP4A 2YOHA 4N0EA 4CEHB 1L4UA 1XU4A 1E2MA 3MRSA 1E9FA 4CYMA 2A7QA 4II7A 2WIBA 3OAAD 2VBCA 1CEEA 3IQXA 1FP7A 1OFHA 2HF9A 4M2LA 4BFWA 1A1VA 1KJYA 3R9IA 4GOKA 4RZ2A 1NMZA 1A2BA 3ZD7A 3PUZA 5ANRB 2R2AA 4V0ME 3QF4B 2BWJA 2BMJA 3LY5A 2PT5A 1VYUA 1D2MA 4BRWA 4DEYA 4YMWA 4GMDA 1HEIA 3BWDD 3CW2A 1F2TA 2CK3A 4KCGA 2XTNA 3BGWA 3DKPA 2ATXA 1QBKC 2ZEJA 2W58A 3TSZA 1TQDA 4Q4AA 4IFEA 3DZ8A 2H17A 4KFTA 3UK6A 5KTYA 2O8CA 3GJ8A 1LF0A 1UEJA 2XITA 3LVRE 4QJ4A 5JI3E 2DFNA 3K70B 3K70C 1HA3A 4PPFA 1OXVA 2C9YA 1AQUA 1MABB 3A4NA 4QBHA 1KO7A 4NDZA 1OB2A 3OF5A 1UKZA 1EXMA 2DYKA 3DO6A 3QF7A 4I1OA 2QZ4A 4QJ5A 4E03A 2OEPA 1KJZA 4NKRA 3QQ5A 1HQCA 1V5WA 1OIXA 2R6AA 2AFHE 2O0HA 2C96A 5CIQA 3W5JA 1T0HB 4DCVA 3W8RA 1XCGB 3IHLA 1JEEA 4UJ3A 3U44B 1A4RA 1Z2CA 1KIMA 4QM7A 3BOSA 5CDFA 4PPNA 1CIPA 1VECA 3RRMA 3RS2A 1DAFA 2IBMA 3RABA 1HY3A 1XTQA 3K0FB 4DVGA 4OKSA 1S0UA 1JXMA 1E98A 4BFSA 2J9RA 4JJZA 1ZUNB 4CW7A 4RZ3A 2G6BA 2WV9A 3FHTA 2OBLA 2QEQA 3KUDA 1N5IA 1GSIA 2J0SA 2Z6VA 3E5HA 3LAWA 1G5RA 1NJGA 2G1KA 4P31A 4WXRA 2VA8A 1XWIA 1Z8FA 4DT1A 3AUYA 2Q3MA 4JLDA 2ZYVX 1P2SA 3KL4A 3QUSA 2ZTSA 4AKIA 1S1MA 4KFSA 4EPYA 2G0TA 5F98A 3ZS8A 4NYIR 4ESHA 2Z83A 4GPTA 3SQXA 1GVNB 1E0AA 2YVUA 2GKSA 2BJVA 4D25A 2D06A 3AGQA 2VLIA 4LDJA 2EYUA 2W0SA 3W34A 2JLQA 1D6JA 1D8TA 1JNYA 1KAGA 4US2R 2X2FA 1ZUHA 2NO1A 4UKDA 2Y8EA 3BE4A 4DDTA 4BGDA 5LB2A 4AKEA 3K9NA 3QEOA 2IW3A 3QG1A 1MKYA 1VG1A 2FFAA 1G3QA 3VR2A 1MR3F 4AKGA 3ECCA 2J7KA 2REOA 4NZYA 2G77B 2JLUA 2W83A 3EIHA 3T5GA 2ZI6A 5KSOA 1KK3A 1Z28A 3PG5A 4QXAA 4B2PA 2GAOA 1OH5A 2W6IA 1U0JA 5HKKD 3R9XA 1FZQA 1W48A 3B9QA 1ZINA 4JYCA 3AKCA 4OHYA 1U98A 4GL2A 1A7JA 4OI0A 2IUSA 4JT2A 2B21A 1N6RA 3EA0A 1QRAA 1T3HA 2JDID 4M1MA 1SVLA 4C0HA 4CGZA 1TF5A 3SYKA 1N5KA 3UATA 4LBZA 2R44A 5IDVA 1Z07A 3CPHA 4U5XA 1WF3A 4B73A 4U7DA 2JJ1D 5CM8B 4KFUA 4DDWA 2BJWA 3GLFE 3T12A 4B33A 3NBYC 2CNWD 2Z4SA 1KMHB 1YU9A 5FTNA 3B8HA 4IDHA 2F7SA 2WSMA 3C7KA 1N0WA 1J90A 4C2TA 2YYZA 4DEXA 1MO6A 1X8JA 5BQ5A 3ICEA 2EFGA 4R98A 1FUUA 2ZUBA 4HLCA 3K8YA 4BFUA 4R71A 3EZ9A 5TXGA 3PIRA 1EGAA 3FKQA 3OIYA 1SXJE 4GZMA 1QHGA 2WJGA 3ZLJA 2L0XA 4MKGA 4ZKEA 4AKHA 4LC0A 4EAQA 4DUGA 3K0CA 5FH9A 4Q7KA 4TQ9A 1G17A 4PC2A 4M8NE 2CCJA 1P6XA 4K8OA 1C4OA 3ADBA 1G8FA 2QORA 2AKAB 3L0SA 1JR6A 2XXAB 1JECA 1P9WA 4JLAA 2CHQA 4I4LA 4QOSA 1OIWA 4OI1A 5JSZB 2GRJA 3RS5A 3IIKA 4N3NA 5JHHB 3CONA 5ELXA 2OESA 4RSGA 3O8RA 3HPRA 1N25A 5DIFA 2IWHA 1GL9B 2NO9A 1G1MA 1II9A 4Q21A 4UJ5A 4KBGA 1R0YA 4CF7A 4TYYA 4JLVA 4TL6A 3GLIB 5BN4A 1KKMA 4BEJA 1IN4A 4GMXA 1CR2A 3M0EA 4D4KA 3U3JA 3B9PA 4QGGA 4DIDA 1FX0A 2RGEA 2ZRPA 1TMKA 5IRCD 2O8BA 2J0QA 2IXGA 4HI0E 1E4VA 2PJZA 4B32A 5JHGB 5GJCA 3P27A 1N6NA 4PR0A 1R5OA 2CK3D 5KO2A 2B8WA 3Q7QA 3KTAB 1XJ0A 2G0NA 3A36A 4WAUA 3K53A 3I5YA 1II8B 3QBVA 1LV7A 4V03A 3THOA 2O5VA 4PC1A 1Z3IX 4OBEA 1G5PA 2ZYTX 4AD8A 3LH5A 1J99A 2OV2A 4PO1A 5JI2E 2ATVA 3CRVA 1DADA 2ERXA 2GF9A 3EZ6A 4B44A 3WYGA 2IYZA 4DJTA 1KGDA 4E09A 4NCHA 1AQYA 4Q19A 5DGXA 5JJIA 5J5CA 2VP9A 4F7WA 4QGAA 2Q6TA 5B30A 1OB5A 3Q85A 3NEYA 4JL6A 3GFPA 1ZCAA 2ZRLA 3X1XA 3W5IA 4F4IA 5J4YA 2A5JA 3WP0A 3A1VA 2YJTD 4O2LA 1KI4A 1XTIA 2NO0A 3D6TB 3DHWC 2ASEA 4FCTA 4TMTA 4A2PA 2QMEA 4QM6A 1XXHB 3N70A 3THXA 4EPTA 4KVGA 3AVWA 2BEJA 5EE3A 3UWKA 2OCPA 2DBYA 1NI3A 3V4RA 2A5DA 4QBFA 1Z6YA 3FMIA 3L8YA 5D3QA 1KSHA 1QVAA 2FV8A 4GZLA 5E4FA 4EJSA 2WWHA 2HCJB 1NSFA 1E2PA 2EU8A 4US0R 5AUPB 1AIPA 121PA 2C8VA 2OE2A 4IW3B 3VHXA 4OK6A 1TPZA 3B5JA 4TLBA 1XRJA 4AYWA 2VHJA 2ZPTX 1G8YA 3VX3A 4BASA 2UZIR 2FGJA 1KYIA 2B7CA 3PEUA 5KNBA 5F9FA 2IS6A 4B34A 4GP7A 3RS7A 1G3MA 3HU1A 2WSSA 2OFOA 2CVHA 1XEXA 3DOFA 3EARA 3U5ZB 4TT3A 2ZJ8A 1R5NA 1XPOA 1ETUA 1JXOA 5AK0A 2EFDB 1FPMA 5CYPA 1SGWA 2HJGA 4C0SA 4TMVA 1JI0A 1VCOA 2YWHA 4NYIQ 1H65A 5DHFA 3SDZA 4DBLC 3AGPA 1IOZA 3U3KA 2IS4A 2A3RA 4HAVA 1US8B 4C7OB 3A6PC 5EXSA 2W6ID 1E2JA 1E9RA 3QKSA 3B1YA 1I4DD 2ZRFA 4M1KA 4BPBA 1NBMA 1F3OA 1GFIA 1RVDA 1OFIA 4XJXA 3E70C 4BFZA 3RS0A 3O8BA 2JLZA 3EPLA 1A5TA 1ESMA 2ODBA 1DG1G 3T1QA 4P4SB 1XJQA 3EWSA 2VSXA 4DCUA 3UWOA 2OAQ1 4OJKA 3DM5A 3MFYA 1NY6A 2WIAA 2BBSA 2F1RA 5BW8A 2WKQA 2H57A 1WCV1 2BM0A 2ZREA 3MJRA 2NQ2C 1W0JD 3RSOA 3D3QA 4UXHA 3WYFA 1TQ2A 2IK8A 4OHZA 4OYHA 4M9SA 4Z8YA 1UKVY 4MRRA 4UXIA 2HT6A 3W3AA 4B6EA 1EFRA 1KO5A 2QBYA 3THYB 4HZUA 3SC3A 4R2IA 1Z83A 4ARZA 2GCOB 3CX6A 4OJQA 3TUJC 2V55B 1VIAA 3TLXA 4QL3A 4WBSA 3Q7PA 3ADCA 4NHOA 2F9LA 2GCNA 5FBVB 3EPJA 3ZIAD 5JBQA 4G0NA 1K6MA 3CUEF
chains in the Genus database with same CATH superfamily
3B78A 4HPWA 3MWYW 1VMKA 4E2ZA 3P2OA 2OD2A 2WE8A 3JZFA 1E2UA 1OAKA 1USIA 4GP6A 3TLKA 4Q66C 3U39A 4BX0A 4G81A 2VRWA 1EUCA 1RWKA 5EI5A 2VYVD 4MQFB 7ADHA 5DNAA 3A4VA 2D00A 3THRA 2OLKA 1XEFA 2I6TA 5KNBH 2PX2A 5FL3A 2QRLA 4YJFB 3UM9A 5KIAA 4U7PB 3GRVA 2G07A 2I29A 5CRIA 4CCYB 3QX8A 2IOYA 3BGDA 3O26A 1DTEA 1PWXA 1RKBA 2ZSUA 4OI2A 1Z5UA 4LUCA 1ZHFA 5BNIA 1JKJA 1XTBA 4I7EA 4GECA 2I87A 4F5DA 2WAYA 5D2CA 4EYSA 1L5QA 3VSAA 5CA0B 1I2ZA 1GN8A 1TRKA 2R8YA 2IS1A 4H6PA 2ZGVA 4IIYA 5TY0A 4Q01A 5AM3A 3NXSA 1YXMA 1YFKA 4C08A 3FMFA 3KSMA 4OYRA 3MC1A 1CS0B 1R0RE 2O8EA 1AK9A 2HQ1A 2J7PD 3O1IC 1F0NA 3ES9A 2UUPA 4LCEA 3ZJ4A 3VQTA 5HS6A 3AIKA 3QBTA 1KEKA 4Y6GB 2QTVA 4YWJA 1P5ZB 3JD1A 5EPEA 2YKGA 1SAYA 2R8EA 4A15A 4KQWA 3W5AA 4ARCA 2IGBA 3QWFA 4DV2B 1SC9A 4RX1A 4YDSA 5EFZA 4MDEA 2AHRA 2QN6A 1P9OA 3PNPA 4YAUA 2UXBB 4F86A 4U7HA 3HJUA 4K9RA 2NP6A 3U80A 1ML3A 2B34A 3KQSA 3KV1A 4L5BA 2DU8A 4N8DA 4OHOA 1YBAA 2KLBA 2OCLA 3DZBA 3PFKA 4KTTE 2X0FA 2XMSA 4ZI7B 4YFVA 4UUNA 1XCOA 1KZ4A 4Y2UA 1QGUA 1ZP6A 1YI1A 5DX8A 2JFNA 3OMWA 1EXVA 1XTJA 1FEZA 1CR1A 2IF0A 2JGIA 3GQBA 4WLUA 2BELA 4CL8A 1XDUA 4GBJA 1M54A 1VHDA 3N74A 3OLWA 1F3LA 3HU2A 1QE0A 1TFUA 3BRSA 4M1OA 1TM7E 1G5TA 1HG1A 1PJTA 3T95A 1GUFA 3FF4A 3F6EX 2X2EA 4G07A 3TZ6A 4Z0PA 4A8PA 3RAGA 2MSKA 2QTAA 2QRGA 4JUCA 3QTBA 3SYRA 3OKCA 2NT3A 2JLRA 4BNHA 2OZVA 1XCPA 1VMAA 4LBYA 3U61B 5EIXA 3K9HA 4CR6A 5FX2A 1NNEA 5DBHX 4EF4A 1Z6ZA 3GMTA 3IDSA 4XQCA 2WF5A 1LLUA 2Z0MA 2PX5A 5IEBA 5J1TB 2NU9B 4LISA 4UMEA 5TPZA 1VSUA 4FINA 2P68A 5K2MA 2BGTA 2HJWA 3SLGA 3X1WA 1KWGA 4FS8A 3FUVA 4TTVA 4I4TA 3GEMA 4OA5A 3H1TA 2N47A 4MARA 3GV0A 5KREA 4BLVA 3OOEA 2ZRBA 3L6DA 2C61A 4EG3A 1ID1A 4Y18A 1ACMA 4V02A 4ESEA 1H0SA 4L7QA 1CUCA 1SUCA 5F77A 5EWMA 8OHMA 4J94A 2C92A 4AK9A 1TLLA 3E35A 1L5HA 2W2NA 2DF8A 4XOIA 3TKLA 1XI2A 2VJPA 1D5WA 1E79D 4MHTA 4O0MA 4JVLA 4UC0A 2O8FB 3VGJA 1UT8A 2CXXA 2O6LA 1OLUA 1ZCFA 2G4LA 3DE1X 2YR0A 3ZBUA 3L1UA 1KKLA 2ONKA 4H1UA 3KG2A 5E7QA 5KOJB 2NZXA 3AXSA 3WX0A 3F5QA 3BF8A 1S7CA 1VKJA 2E1PA 2ECQA 1DTWB 3TMAA 3UMGA 4E31A 3CZ9A 4M21A 3D7SA 1E9BA 2FQYA 5B2ZA 3R9WA 2WNHA 1IOVA 5AKGA 1P2UA 4KDCA 2VUSA 3X1ZA 4ZHSA 1BMQA 3ONVA 3PC2A 4MAAA 3ICOA 1AS3A 3N5KA 5JZVA 1BXZA 3FM9A 4FLMA 1DBSA 3R41A 1UANA 1RHMA 3KE9A 3W4JA 1EFKA 5AVVA 1WW3A 3N0RA 1DEKA 1E0KA 3SZRA 3FA2A 2BI7A 1PF7E 4NZPA 4Q1CA 1W6UA 3KM0A 5LQAA 4K40A 4C43A 2JGDB 4HJRA 1Z7WA 2IUTA 4U7JA 1J49A 3HP7A 2ECOA 2ZPUA 1L1EA 1T35A 2IVZA 3RS3A 1ULTA 3N87A 1UEXC 4Q1AA 5ENDA 3IP3A 1MENA 1MCZA 2OO5C 1OFTA 1M1ZA 2F8LA 1OFVA 1LBTA 2WPDD 3ZD8A 1FTNA 3FGOA 3DOIA 4OJTA 1TC2A 4AZWA 1TAGA 5LL6P 4PC7A 4R9NA 2HKIA 2NP7A 1NJ1A 4Q7JB 4H18A 2BE7A 4OKIA 3ZLBA 4N54A 4AWBA 3HXPA 4HEJA 4RGVA 5FPQA 4B2IA 3HBMA 3GVCA 3K9LA 4M83A 2M6SA 1L5LA 4Q4JA 3ZHSA 2JI4A 1XD2A 3GVHA 3OCJA 4ZYUA 3GRUA 4LXIA 4TOIA 5JARA 1CUJA 1QH1A 3AF3A 1CU1A 3QKTA 4N5IX 5D6OA 3PRKE 5AUQA 3RC7A 3WNCA 5AOCA 3FTFA 2B0CA 4X64B 1BDHA 4JIGA 1MQ9A 3WMGA 2JBHA 2AQKA 5KYXB 1LEHA 2DC1A 3KLMX 3MGKA 3VKUA 1JFRA 5K05A 3LOUA 1NUPA 3AHGA 3NJ8A 1ZVVA 5LXTB 3DFZA 4O4LF 4J7XA 4ZRMA 3V1UA 5CFRA 1SCNE 1ZMOA 4PONA 3ZR4B 1Y9EA 2A9PA 1RI1A 1Z0FA 4KWHA 2HHHB 2EX0A 1VOTA 1T5SA 4LHWA 4BLQA 1NW5A 1U8ZA 4WASA 1FW6A 2AR9A 4DXAA 4G0ZA 5FB3A 2WHQA 3CRMA 3BDAA 3SIXA 5EUBA 4BNGA 1KDTA 1P62B 1BMTA 1I33A 4CIYA 5FL7A 3Q3VA 3RFCA 2GSDA 3LCMA 2AFIE 3TI9A 1ZJ6A 2ODPA 5KYWA 4GT1A 4D3ZA 2J07A 2X41A 1ZH8A 3AEXA 3KV3O 1N1GA 3PDJA 4EW6A 4KR6A 3UUFA 2QQ5A 5IVIA 4GR4A 1ZIYA 4XB2A 1AX9A 4BKOA 2ZS7A 1YR6A 3W8EA 3QPWA 2P0AA 3C3KA 1W7AA 2R6DA 2ZUVA 3DC2A 1RHRA 3DMHA 4X84A 3AYXB 4DLYA 9ABPA 3AESB 4TMYA 4E22A 2HSEA 4RKFA 5EA2A 2PFKA 4J3JA 5FBQB 1NQAO 2I8AA 1M7HA 3HY4A 4H7IA 1KETA 1QLHA 3LQKA 4TYPA 5J5VA 4AAYA 3ONEA 3Q2IA 5LOVF 1MUUA 3CA8A 3LY8A 3Q7TA 3UJ9A 3F9IA 2QAJA 3OOYA 4J49A 1MT3A 1O4VA 1JAIA 2ZRJA 3EEOA 3HPQA 4JP1A 4M37A 2C7GA 3EPHA 2B4QA 3SXUB 1ZK0A 3UAYA 2Z1NA 1TA4A 2G6TA 4RPHA 3BXFA 2HBZA 4MV3A 1YB7A 1NUHA 1TYDE 3ENVA 2PU5A 4WD3A 1XJCA 1A9PA 1GAEO 1HNNA 1I2CA 2B5VA 4JLMA 1AKWA 4LJAA 5HRAA 5JROA 1YZLA 1JHDA 4GS5A 1ZIOA 4FLEA 4FZ3A 4Q16A 1N0IA 5DGCA 1W5BA 2G28A 2VT2A 4XZ3A 4A10A 4C03A 4R2LA 3R0QA 1TU3A 3AP2A 2E6KA 4BP9A 3AHFA 4MDFA 3WL5A 4ME6A 3KSBC 2G9NA 4HQKA 4C5BA 2JW5A 4BEWA 2LDBA 5DNDA 3KT3A 1Z13A 5ERGB 2IUYA 2A84A 4W7HA 2OQRA 3DBLB 2NPIA 2YZMA 1J25A 2WI8A 1OI7A 2RAPA 3O91A 4MKRA 4EHLA 2P2ZA 2DQ4A 2SNIE 4EW2A 2AJ8A 4WK2B 3MB5A 4YUXA 4MR7B 3AWIA 3CEHA 3DBVO 1ADCA 2QVGA 3R3ZA 3HVHA 4IBOA 3WV4A 1ZU4A 1O9HA 3EGDB 3WZMA 4B35A 1TA0A 1N2HA 4ALJA 3GLFA 3G68A 4XXHA 3UMSA 4I14A 1FFWA 1FP4A 4EQ6A 5IANA 2DWOA 4YP7A 2VNJA 4YT8A 3HXOA 4UBIA 1J39A 4LMAA 2IZOA 4ZT6A 2OBFA 5EVJA 1T8RA 2JLBA 3D4LA 5KNLA 4XIYA 4C05A 2AE2A 2P9ZA 4K6KA 3V33A 5ICSA 5CIYA 1I1OA 2K5UA 2HFJA 2ZB8A 3KRTA 1NKTA 3OP4A 2OYRA 1ZC4A 3ADPA 4AY3A 1EFVA 3ANLA 5AI0A 3V34A 4EF6A 1DBWA 3BQ9A 3CF2A 3KOXA 5LA6F 1SXJA 4HVLA 5HKBA 3OZ7A 5KPDA 1OWPA 2BYTA 4XD7A 2Y71A 3ITNA 3KVRA 5DSTA 1TK3A 3V5NA 3ZE0B 1R9MA 1PW5A 2Y0BA 4RMJA 2XOKA 4PY2A 1V1RB 3B2QA 1A71A 1IN5A 1X77A 4MW5A 3BZWA 3VO2A 1WU8A 5A9TA 3O47A 1PR3A 2GD2A 1QZTA 3I39X 4G9EA 3S2YA 2VHTA 1W73A 3LQRA 4RJTA 2HCTA 3TUZC 2EWMA 5K8LA 1DIGA 1REQA 1NI5A 4FR2A 4LVUA 4PX3A 3RUAA 2FP4A 4LBVA 5I7SA 1TF7A 2PWYA 1R6BX 3AUXA 3EQZA 1J24A 4WKOA 3ZCUA 1R7RA 4IG4A 3OQ1A 1ANKA 3DAPA 4BVHA 5H9VA 1XZPA 2XB8A 5G0TA 2I1WA 2PUEA 4TZ0A 4FD2A 2CV0A 1FUIA 1WOYA 2PSFA 1F4VA 1ZM2A 3AHDA 4KMRA 1G9SA 1OW3B 3VH2A 3O1HB 2JFFA 1MJGA 1QONA 1TA9A 1XN4A 2PH7A 2VF7A 3IKMB 3R5FA 5EIEA 1UPBA 2J09A 1W6RA 2YWFA 4KMSA 2FOIA 2H0RA 3HLYA 3BQMB 3OMXA 2JLXA 2IJGX 2B92A 1YMVA 1JVNA 2WG1A 1PDVA 1TD1A 1TKCA 3A1CA 1XGKA 4ND3A 3TRFA 2PVSA 4KWEA 5THQA 1E6LA 4O2RA 2Z98A 4P33A 1NR1A 4CM4A 5EP1A 4DLVA 3VOTA 4QXMA 3PRJA 3O75A 4JJ4A 2FCAA 5CM2Z 3RIXA 4ZYVA 2JCSA 3O4VA 3W3ZB 1CT9A 2BP7B 5FLEX 1DPFA 2Q1XA 1GAQA 4JBIA 1G64A 4LY0A 3G8BA 4GC9A 5EZQA 2RG7A 2SECE 1DQPA 3NBKA 5LQMA 1ZRNA 4QDOA 4RV4A 3WAGA 2QQGA 4HQ6A 5C53B 5ADUS 1WPRA 4K1XA 1NFQA 1KZGB 3KQTA 1QCZA 2HEGA 2QZPA 1M76A 1JDUA 1WY5A 5DM4A 1FTWA 5JD3A 3ODGA 2C82A 5F2OA 3F3KA 1Z4QA 2C8LA 1V4BA 4EUSA 3WY9A 4KE8A 1RJ9A 3EGOA 1O4WA 2QSZA 4FKMA 4JLOA 5AVRA 4H7EA 3CVVA 1ULZA 5DNWA 1NLMA 3IA2A 1L9KA 1M2OA 4N18A 1LFDB 5KKCA 1IL0A 2LWIA 4ID9A 1PD1A 2PEYA 4LMPA 3DP7A 1XZIA 1G21E 3QVWA 4LECA 2N42A 2IPLA 3AU8A 5UKDA 3TRKA 2VYCA 1RI2A 1D2RA 2XCLA 4MUXA 2O52A 1ECFA 2O2YA 4WVLA 1DG3A 3U3DA 1W46A 3ZH9B 1ZJWA 2Z6AA 2WU1A 3RRZA 1OYWA 1BE0A 3LDUA 3UMFA 4DJDC 1LC0A 4Y2JA 4F3RA 1F14A 1L7DA 2VHUA 3HP1A 3WKCA 4D0RA 2HDHA 1II0A 3II6X 3OFSA 4MMYB 4M89A 4CKYA 3E53A 4D8XA 2JLWA 3CTPA 2P1ZA 5JTUA 2D0OB 4MP3A 1XFAA 1VPVA 3MF4A 1B0UA 3GT4A 4JI6B 5FI3A 1XFDA 4C1BA 1MZPA 3PEFA 1IEXA 1P44A 4K1LA 2B99A 3DR3A 2F3RA 2VJQA 4EB3A 2IHZA 1DV1A 5F73A 4G0XA 3TK1A 1VJGA 2NACA 4ZAVA 4D9IA 3CT4A 3LHSA 1MOZA 1GN9A 1CB7A 4JYPA 5LP6B 4XM0A 4Y2PA 4C4AA 3DYVA 1RKVA 1YHZA 2C88A 3IUEA 2EGGA 4GO1A 5AVTA 4JFAA 1PZHA 3JQAD 3BRWA 3U4IA 3I52A 5AYVA 3V55A 1NKVA 2CVOA 4BB0A 3JYPA 5LD2B 1UDXA 1U3FA 3K0KA 1ZK1A 5JS1A 2X77A 3AINA 1JAZA 1MORA 2AD1A 2WUVA 3EGWA 2J3EA 3IP5A 5DM0A 4AP9A 3M83A 2HNBA 1QK5A 5KYKA 1G3IA 2AZ4A 2EGUA 3HFGA 3R6GA 4NBLA 5BW6B 3G59A 5BR7A 1ZUNA 1B74A 1AM4D 1YJ5A 1E2DA 3LO8A 3ONDA 4HGQA 1O08A 1VBFA 3CF6R 1WCIA 3PXAA 1LW7A 2BZGA 5IJAA 4XA8A 1IY2A 3PJEA 3T7SA 2QRMA 5FPYA 3OTIA 1G3UA 1IHPA 3C3EA 1B73A 2FSVA 4KHZA 4E5PA 3SJ7A 2FSUA 4DM3A 2P79A 4RIIA 3B51X 3LY7A 4R0VA 1YFLA 3BE8A 2SHKA 2FEMA 3OEHD 4J2TA 1F60A 1CJBA 4G1FA 3L4KA 4D8YA 3ELWA 1E1NA 3U9TA 3GUHA 4YGYA 5FI1B 4AO7A 4G5GA 3S2EA 2J8ZA 1R9GA 1XQ1A 1XMJA 2QAIA 2G70A 3E9ZA 1ZBDA 3P0JA 4BEVA 1E3LA 2H9AA 4UD2A 3NEJA 3O8DA 2FJPA 2ZIAA 3M6UA 5ALKA 1DG9A 1MHPA 3COJA 3LGXA 3ZWNA 1QCDA 2PZEA 1JHPA 3HB7A 3CX3A 1BCSB 1EVKA 3F97A 1MJHA 3PK0A 4AMGA 1OE0A 4ACAA 5C46F 3CVYA 2YDXA 3C6QA 3FAKA 4FEGA 5HTOA 1JTFA 2L82A 1M7GA 2VSQA 4HBGA 3S44A 2Q62A 821PA 10MHA 4XLLA 5BW5A 3GJ3A 3LW7A 5EHQA 1W5FA 2QTTA 3UOAB 4G4SP 5AI5A 3WHIA 1W2WB 5TQJA 2B1IA 5BRNA 4O5OA 3FVVA 2PX0A 3M4ZA 5C8YA 1YZKA 3E7DA 1EG2A 1UUFA 3GPBA 2PX4A 2NO6A 3PRYA 3F0TA 1ZNZA 3LC2O 3FLMA 4CN8A 1JQLB 1QKKA 2GXUA 2XVAA 4MS4B 6NULA 1GYRA 4W7SA 2UUBB 1QNFA 1XVAA 4Q3OA 3TH5A 4BFUA 5CW2A 3DDNA 4GX5A 4QDUA 2QQEA 1XMPA 3QKSB 4NJEB 1EDOA 1S4QA 2B4RO 1T4CA 4ISCA 3SWWA 1LTKA 1N36B 4MMXB 3MYYA 1J0DA 4C4PA 4C0JA 5CLGA 2XQJA 3DMYA 3ND6A 1U7PA 3WNQA 4B2LA 1V8PA 2ZIFA 4Q82A 4DMUB 2BH9A 3Q3HA 4F3YA 4HN4B 5A6SA 4I50A 5BSUA 4ER7A 5BSGA 5CAEB 3GLGB 1JJBA 1BROA 2P0YA 2ZI7A 3GJXC 5IC5A 5DM70 2AI2A 4UW9A 3I83A 4XCXA 4CL0A 5JFTA 4AY5A 1XVIA 2IEGA 4TTSA 1QOQB 1SCUB 1M1YE 4GGPA 4TMXA 5EJ5A 1IIRA 5JEDA 4TVBA 5U4QA 5JNVA 4RMNA 2APJA 5FWYA 2O0JA 2DUWA 1BE8A 4MHOA 1QS0B 3EGCA 3LC0A 1AZSC 3EPPA 2I78A 3M2TA 4KNWA 4HSGA 2QBYB 4PVCA 2ZG6A 3ZGZA 3AQIA 3AEQB 4HTAA 4OMCA 4JOSA 1MGOA 1EXNA 5M3BA 5EZ6B 5KU1A 4ZREA 1V25A 2LV8A 1UBLS 2VHEA 4GWGA 3BWEA 3ZJYA 1OWOA 3UQZA 1R0XA 2ECKA 2I3GA 3H0CA 4G5SA 4UE6A 1K7EB 4AYWA 4WZ6A 4DUZB 5ECWA 3IAAA 2XXAA 4ZU6X 3ZCPA 1L5FA 5DT2A 1QAQA 3CC8A 5JSZA 2XVYA 5E2AA 2JLAA 3T5CA 4ODIA 2WVAA 2YYYA 1U1GA 3ZJVA 1WPQA 1Q3TA 3DDUA 4TKUB 3OZFA 2BEKA 2ZI5A 3OIFA 4NCXA 5AM1A 2O54A 1UM9B 1Y89A 3F6CA 2QUAA 1MJNA 4O4IA 5DGHA 3T7JA 3WL4A 4XVRA 5FBWB 3LDFA 2VBIA 5FKJA 3SKXA 1OFUX 4FFSA 4QDXA 3DL0A 5JS8A 2G08A 4PU0A 3PQ2A 4K9MA 5JXHA 2QRVB 1ZH2A 4UFNA 1AO0A 1DO2A 3WLOA 5HG0A 2XD4A 3EXG1 2I2DA 5K3SA 1LRJA 2D2FA 2XUQA 4W1RA 1Q7EA 3S55A 3MYRA 2G5PA 3OT1B 3T3HA 4WA7A 1U0EA 1QB8A 1QKIA 1SOWA 3KOUA 3MS4A 3HK2A 4P80A 4K9LA 4KI0A 2EIXA 3IEXA 1NVMB 4MPTA 4RAOA 3RSGA 3VHQA 1WP4A 4EFDA 2CLDX 1LH0A 2RE8A 3BMQB 1RPTA 3GMIA 2HRDA 1KFJB 2COUA 4IOLA 3ZCRA 1ZI8A 4YPFA 1UT6A 1II8A 1YBFA 2IYVA 3AYZB 1N2BA 2FE4A 2LPMA 3AOEA 3QV2A 4RTOA 1YRWA 1B14A 5G53C 1VXRA 3L06A 2FZLA 2QU7A 3FD8A 3KPWA 3D7LA 1U2EA 3MLBA 4MWEA 1AXEA 3M49A 4JL8A 2EF0A 4FOTA 1EK6A 4LI3X 3UJ7A 1Q92A 3KXIA 4IYRA 1CRWG 3F46A 4MVJM 1O2DA 3OP1A 5C81A 1DL5A 3EIXA 1XKTA 1URPA 3N2EA 5AW4A 1P8JA 2PXAA 3CEAA 4HEA1 4QOJA 4NI5A 4QDKA 1V2GA 4QYIA 3JALA 3SR4A 1YBVA 3ZS9A 5AM5A 5KKNB 3GL9A 5ISMA 2NUAB 4AMBA 2SKDA 5FO0A 2A9QA 1TQ6A 3DV2A 5BURA 3RC8A 1W4AA 4Z3OA 3AOGA 3PFHA 2DBQA 3T3DA 1M83A 3V7UA 1XAGA 1GKUB 2CZGA 4GPAA 1OH6A 2P40A 1OPRA 3BIOA 4NV0A 1YE5A 3FYSA 3GEDA 1WEKA 2UUOA 4NRDA 1HLFA 4QG3A 2XDWA 4C7OA 1AKNA 1GRQA 3UB2A 1Y42X 3ZTWA 2XAUA 4IMJB 4RTKA 1N6HA 1PT5A 3N3BC 4FOPA 4KQFA 1HH4A 3GYGA 5BSRA 3STXA 4ZMBA 4R6XA 1A88A 1O7JA 1DKRA 1P0CA 3OHSX 4HH0A 2IU6A 2EVWX 3HU5A 3TN7A 1JHAA 4JKYA 5C80A 1LDNA 4B09A 1WP9A 5IZCA 4JEHA 3OM8A 4E1AA 4YRCA 3GEGA 2BFEA 2NU6B 2F2TA 1KR5A 1L7PA 3DCNA 1FFDA 1T3LA 3BZBA 4PBSA 3SJAA 5ES4B 1CHNA 3SVTA 4DV4B 1RXIA 4JY7A 4NG4A 3ZC3A 5J2UF 3WS7A 2F6RA 5AXDA 4F1JA 5TMPA 3TBKA 1F8XA 3RYIA 4O2BB 5DSZA 4URFA 1OZAA 2I9PA 3O73A 4YT4A 3IE1A 2OY0A 3N53A 1PR9A 3EXAA 2JLSA 2YJ3A 3P32A 1NLZA 1A2OA 1Z2NX 2QT0A 3UNXA 4TKVA 5C1IA 2O5CA 4QFDA 3VXKA 1BA3A 4LFBB 3TM4A 2XT6A 3RRFA 4IX9A 4W6ZA 2C07A 4JI2B 5DRTA 2IP1A 4UOZA 3CB4A 2HV8A 2C5FA 2QHXA 1SKBA 3UH0A 4TTPA 1GGEA 1LLFA 221PA 2I2CA 4CBVA 4E7PA 1XD8A 4PLHA 4URUR 2GI4A 4YX9A 2V6MA 2A8YA 5F4ZA 4MUKA 4CJXA 4G6ZA 2I3DA 4RC9A 4EYQA 7MHTA 1W30A 3F47A 1C7FA 4CV2A 3B5EA 1I14A 3DB2A 4MIYA 4JC5A 1US8A 2OENG 4KXXA 4JGIA 1K1EA 3E8MA 2GLTA 1NLUA 3TNJA 5DASA 1YH3A 1XRLA 3E1KA 3NHZA 4P5PA 4RJLA 5E9QA 3SP1A 1GPUA 3E7PA 2HV9A 1ZKMA 4NFYA 4TSFD 3MMXA 1YB5A 2OBMA 3N7TA 2PKRA 3QLJA 4BNNA 3NDPA 2IKQA 2B3DA 1XQYA 3AC0A 4YUZA 5LFAA 1M1XB 2AFIA 3GWGA 1KMQA 1O95A 721PA 1H5NA 4BVLA 4MV5A 2G4VA 2BDTA 4C0LA 1R6UA 3MCAA 3ROKA 1K88A 4P34A 2OGTA 2FRVA 1CJSA 2QPAA 5IAGA 4WXEA 4CEJB 4R0MA 3GNTA 4DLWA 4XCQA 5JAQA 1X0VA 3HG7A 2QD5A 3KDAA 4P2GA 4U0JA 1EA5A 4BKRA 1G20A 5JH7F 3G5MA 3RIYA 3U7RA 3N9IA 4AUMA 5HZHA 1M5UA 5BW4A 1E1DA 3CUKA 2ZYWX 3PF8A 3WK7A 4JBWA 4ZZ1A 1AJEA 3K32A 3L7JA 4BVAA 2X76A 4JGGA 3RIMA 3GGDA 5EJ8A 1JA0A 2FX2A 4A7PA 1TW2A 2Q5OA 2ZITA 2XVXA 3OH8A 1NSTA 4TYMA 2BGJA 3G0GA 1RD4A 3PHHA 3IMEA 4KSYA 4BBAA 3NC1C 2FQXA 2ATCA 3LUGA 4UBMA 2NUBA 4X24A 1YJQA 3NONA 4KLRA 1SVKA 3X2EA 4Y30A 4MVJP 1Y81A 4Q1EA 4PO8A 3SXPA 4UEWA 3DMPA 1W0KD 1KI7A 3CNEA 4LMRA 4NG5A 1DVRA 3EXFB 4GI1A 1FVFA 2IOHA 3I2YX 1ZNYA 1MQSA 4MCAA 3CLSD 4S1TA 1J42A 3TKYA 1R5JA 2C04A 3N0VA 4WY5A 4L5IA 1YQGA 1BQ4A 3KB1A 1IDOA 2Q5FA 2RHOA 1TTHA 4PSAA 5E3JA 3QX3A 4KW7A 2O8DB 1I2MA 2WJVA 4UCFA 1KRHA 2YC4C 2G63A 1EEHA 4OAQA 3VMFA 1USVA 1WG8A 3L5OA 2OV6A 3WRXC 3ZU5A 4TT3D 2C97A 4DXHA 5AW6A 3L8CA 3UV7A 3RK4A 1JYEA 3ZXXA 4UDXX 4BO5A 1A4UA 3ZZTA 3CEJA 2DHRA 1QVZA 5AW0A 4C2BA 4L02A 5H02A 2EEZA 4HG2A 5DCUA 4P0TA 1ISFA 4FJ0A 5CDGA 1RLOA 3N5CA 1O9BA 1IXSB 1OBVA 1KARA 1OH5A 1M73E 4BN4A 1FYFA 1XC7A 3LUCA 1XJ5A 4UARA 1CZOA 2ADFA 1RQNA 1NLYA 5AVXA 1SBHA 4FZJA 1DC5A 4OXKA 2DE0X 2Q28A 4FNMA 1J8YF 3L0IB 4N4AA 5EXTA 3VNBA 3CLHA 2XKKA 2G8LA 3R0ZA 2WJ4A 1RMYA 4XWYA 3Q8KA 4O8ZA 1AGRA 3H9EO 5ETJA 3GRZA 1X1EA 4WCFA 3HLTA 3V7FA 2ZYAA 3UCXA 2PWPA 4PQRA 4EKDA 1VIYA 2L19A 1EWTA 3HFJA 2YWRA 4HVAA 521PA 3JXEA 5JLJA 1AUPA 1VMEA 2OQVA 1LLCA 1SCDA 5DI3A 2BGUA 2XNDD 4H17A 4X1YB 2I2FA 2FXIA 2SCUB 3UJ8A 2BKXA 2VRNA 1TU4A 1RJGA 2P65A 3BIXA 3Q6MA 3QM1A 4LHYA 4LV6A 3ZWMA 1ZRMA 4EHHA 4ER0A 2DB3A 3LHKA 3UBTA 1SNYA 2AG5A 1R8SA 3U49A 3EE6A 2C77A 3A1EA 2YWDA 4JBYA 4LRYA 4DREA 3MWKA 2LD4A 3JQBA 3K4PA 3PNVA 4R8MA 5CFQA 1CLUA 5CCXA 3K7EA 3KOMA 3PFGA 5HX7A 2A5GA 4OGFA 3QVLA 3T9CA 1G59A 4MVJI 1Y8RA 3TTSA 2Y1DA 4EA6A 2BGKA 2HRRA 1KFBB 1SCJA 1HMYA 1T36A 4MULA 1NYLA 2WD7B 4YCBA 5EJ7A 4UAGA 4V2IA 5K0BA 1L4YA 1XOIA 4DV5B 4N5NA 3S1AA 4B3CA 4ZHQF 5EKUA 3DM9B 1YFJA 4OL9A 2PFSA 1TL7C 3GH1A 2Z56A 3OU6A 4MUIA 3UT5A 1CUYA 2EV9A 1POXA 1BDBA 1HURA 4MGYR 3RDPA 4JJEA 1AHPA 1YR9A 3ND8A 5DULA 4OQFA 3QWAA 4C6RA 2PGIA 4M3NA 2PL9A 4ZMSA 4BMCA 4E2WA 4RVSA 4UHJA 3ESQA 4C4OA 5LB4A 5JMTA 4PFJA 1N2IA 3CBQA 4QASA 2HYDA 3B60A 2FQWA 4FCWA 1EFPB 3GJRA 3SX0A 3O8OB 4ROTA 1I4OA 3ZGOA 3VPBA 1UXIA 4FQ8A 1E7RA 4IIEA 2WJWA 5CVUA 2W00A 3K0SA 1LK5A 1GNQA 2IBTA 3CX7A 3SD7A 1JV2B 3IX7A 4DOMA 2JEOA 1AE1A 1PEAA 3EVDA 2H16A 3IQDB 5IP5A 4B3DA 4HXYA 2QVLA 3IELA 2MSDB 2OECA 5JAHA 2EDAA 4S05A 1K98A 5JYEA 1MO4A 3DLHA 2Q6IA 1DO0A 3LW8A 2EOAA 2X19A 4MS3B 3ZLUA 3EEFA 1U9IA 4PEVA 1G21A 3R77A 3AVTA 2WF9A 1VJ1A 4I66A 2ZWVA 4GUDA 4MPRA 1Z4MA 3LL4A 4J0KA 3B3GA 5FIUA 4PSKA 3VX4A 4PG7A 1JHVA 3RQIA 1TLFA 1JBKA 4J07A 1UBTS 3GW8A 3A4YA 5GZ6A 4Q7QA 1BKDR 3BD9A 4ILEA 2WTEA 5FA8A 1KBZA 1HYGA 2C94A 5TARA 3E9QA 5U9CA 5JU6A 1L5YA 1ZLYA 4BLWA 2G71A 2XUJA 3DOCA 3SIPA 1JIVA 2OL4A 3CN7A 1PT6A 5HGXA 4G85A 2XMRA 2OYCA 1ZS9A 3WGYA 1E9SA 1OTYA 2YOGA 4JSRA 1EGVB 3PFCA 4ZVPA 3TNLA 2DG2A 5BT8A 4QJIA 1VLMA 5SICE 4IKOA 2Q2VA 3LO5A 3H2KA 4EJ6A 5CA1F 1PT9A 3LFTA 4NSNA 4DT1B 5A9SA 3KKLA 3QVMA 3WGKA 3MM4A 2PL5A 4XTRA 2OO7A 5LPNA 1RIIA 2D1SA 1IONA 3FI0A 1VYTA 4L0DA 4HAIA 5JDCA 5FFFA 1VYVA 2OUIA 3H1EA 3BCSA 1M0TA 5KJFA 3QVOA 3CU5A 3OQJA 4CEIA 1T13A 2ODEA 3U19A 3DDCA 3IMGA 4RFVA 5L3RA 1VCIA 2JFGA 1H4TA 2VJDA 1B2LA 2GFQA 4B7UA 3PX2A 3WKDA 2QPLA 4C88A 3CO0S 4Y0VA 3VDQA 4M0EA 4B40A 5DLEA 2JAWA 1SUIA 2J87A 1SOMA 1FOEB 1U2GC 1YGPA 2KBEA 3MRXA 1TDJA 4TQUS 4V0KA 2VHXA 4WINA 1Y34E 4ZT4A 4EX7A 1HL3A 5KJ6A 2V5UA 5I51A 2HDOA 1JSZA 3RSCA 2Q7XA 5E2IA 1G8JA 5HCIA 3I6QA 5GONF 5LZ9A 4F06A 1XWFA 2IPXA 1Q84A 2W8ZA 3QLTA 3EDCA 2VHCA 3LZDA 1TC1A 3SSOA 2R2GA 3VPSA 4DA7A 1GQSA 3HB0A 3H4IA 1G6Q1 4FLFA 4O1MA 3URMA 4LDRA 1Q20A 1Q0PA 4PSUA 3KSDO 5LUAA 1CY2A 2H1RA 1TCVA 1GZ5A 2WJAA 4HRAA 1B8UA 2SBTA 2QZZA 3V7YA 2AC7A 1A98A 1BXGB 3F8WA 3H5TA 4BP1A 3S5UA 4LJKA 2NXWA 1H6DA 3FOAA 1JLRA 1UF9A 3R3HA 3HNPA 2WSIA 4OM8A 1B23P 5EHZA 1N78A 2JI9A 2MWMA 1IQ0A 2ZUWA 4JR2A 3LUHA 5GOZA 3RUHA 1PFUA 2CVQA 2RGXA 2XB6A 4FMPA 4H1VA 2IZ6A 4OP3A 2A30A 1BGWA 3HCBA 1WLYA 3NHPA 2Z1MA 1HTWA 1Y7LA 2FMXA 2PH1A 4HTFB 1N2EA 3SM3A 2I22A 3UB4A 1EZ1A 4DC0A 1XKQA 3DBRB 3H2SA 3CYFA 2P1RA 3GMSA 3AF1A 2VEDA 5KYYA 4NXNB 5KX5F 1NI4A 2DLDA 4IV8A 4D9JA 2RD2A 4RSHA 1Y8CA 4HNTA 2OGSA 3PC3A 5HIIA 1A9TA 3EF0A 1KDZA 2OZPA 5A5DA 3OOHA 2ZYGA 5CFNA 2Q4BA 1ZD9A 1U8XX 2OXIA 3RVDA 2Q9CA 1ARZA 1O97C 1T0BA 3K0CC 3HDTA 4MH0R 1Z74A 1EP9A 3RUDA 4D82A 1NZFA 4D0LB 1PZEA 1DRKA 1PTJA 4P4GA 4CF5A 2C7OA 4CEHA 4WH0A 4WXPA 3PD7A 5KNDD 3CLTD 3P4XA 1KJ9A 2P5YA 3O5AA 5EE1A 5B2EA 1P4RA 1WA5A 4NBVA 2FPKA 3PXGA 2QLNA 4Y7DA 1UBGA 2YCBA 1TUGA 4GSLA 4F72A 1V3VA 3CJTA 5A71A 2R85A 2FR8C 5K99A 5JTTA 2ZU6A 1QM5A 2D1RA 1V9CA 1FE8A 3O8CA 1M1YA 1JTVA 3NPAA 4DYHA 1TVEA 2X0EA 4TTRA 1G7TA 5KOHB 4NK5A 3JQRA 5BN4B 1XZBA 3UUWA 3H9GA 5AUNB 4Q3AA 2VHQA 1AQLA 3G6WA 4L4XA 4Y0AA 1EUDB 3ZY2A 4L51A 1G6KA 4LWPA 4RU1A 3G2JA 5COQA 3VH3A 3HWRA 1ETHA 1CQWA 3AT1A 5K6RA 1XRPA 4GR5A 3DA8A 5IT9A 2AC2A 4ZOBA 3M7IA 3PQ4A 1N2JA 2WM8A 4B7XA 3JAMA 4KR9A 2FJ0A 2FRXA 3GGGA 1PR2A 3FE2A 4JJ8A 4RIEA 1XELA 3ZPXA 4E5VA 1C41A 1ZAKA 4OQDA 4LHXA 3R3XA 4QT0A 4YQFA 1DBIA 1F4LA 3EEBA 1P1BA 3FGPA 2VK1A 4FFDA 4RA6A 2DQKA 3TLJA 3R5HA 2CNDA 2WSYB 2X0JA 2A94A 1DAOA 2P9BA 3B1ZA 4RV5A 4I99A 4IQ4A 2WJ3A 4LHEA 1G8MA 5E8JA 4ISBA 2OZKA 4DWOA 3NHWA 2PMFA 2RI1A 3GPDG 4NS1A 4CQJA 1HI9A 4H0NA 5JISA 3KC2A 2PVCA 2O2SA 4P58A 3DXXA 1A9OA 3K0FA 4ZQBA 4JI7B 2V74B 4PLWA 2WJHA 3DKRA 3ZWAA 3O3OB 3B52X 2ZIUB 1RCTE 1SU6A 2CXTA 3KYCB 1MZVA 4RJ2A 4AMZA 4DR7B 4DNXA 1D2CA 4RM3A 3WSTA 1HG0A 3FR8A 3IHTA 1OPXA 1PJZA 2VDVE 1SCAA 1IZZA 5AI8A 1N6PA 1JFVA 1H0RA 3PUHA 3WISA 2PMCA 1E1RD 2LCFA 3WLLA 5LN1A 4GWKA 2W43A 4GMKA 3KEMA 4MPPA 1PJRA 2J32A 3LBIA 4HMPA 3RV3A 3D4PA 3NV9A 1E1KA 4OBBA 4EJSC 5GPBA 1K7CA 4E6EA 4DV1B 2ECFA 2VYVA 3GG2A 1FNMA 3B36A 3AZOA 3OTWA 3OETA 2VR1A 2XBUA 2J3IA 4IDGA 2BRUC 1ACLA 3AHEA 5EN4A 2C4HA 4O4HF 5I47A 1G0NA 1JR3D 2W7TA 3G7SA 4EECA 3HCFA 3M6IA 5E1OA 5TF0A 4BO6A 1VJDA 2JK0A 3K4HA 3BJEA 1L1RA 3LCCA 4WLFA 2Y1KA 4ZDIA 5K7SA 3WLHA 3WLEA 4IDAA 1YOVB 2R8ZA 3Q3JB 2BGWA 2W0MA 4HPJB 1N5DA 3EULA 2D54A 5D00A 4EUNA 3RNLA 1G7CA 3I9KA 3X43A 4RELA 2ZBVA 5DHRA 3T5AA 3VZSA 1VP3A 2GBLA 1B41A 1F48A 3LFUA 4RVOA 5CDFE 1V7QA 5KSZA 2ZRKA