1A4RA

G12v mutant of human placental cdc42 gtpase in the gdp form
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
190
structure length
190
Chain Sequence
MQTIKCVVVGDVAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G25K GTP-BINDING PROTEIN
publication title Nucleotide binding to the G12V-mutant of Cdc42 investigated by X-ray diffraction and fluorescence spectroscopy: two different nucleotide states in one crystal.
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 62
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1a4rA00
3BJIC 1NVWQ 2BM0A 1OHHA 4EDHA 3NBZC 5FBQB 4WZ6A 3VHXA 1B0UA 1P5ZB 2IBMA 4M9QA 4PC6A 3RS7A 3X1WA 2X2EA 2O0HA 3WP0A 1CF4A 2HLDA 4G5GA 5CJ2A 4G5QA 3A4LA 3IQXA 2A7QA 1I4TD 3FFBA 3RRZA 3SHFA 3SS8A 3I5YA 2XSZA 1M1YE 2YV5A 1EFUA 4XJXA 4QBGB 1T8UA 4H1VA 3IBGA 2WAXA 4HSEA 1W5TA 4EFMA 5B2ZA 4IRUB 5LPNA 2JIZD 2QL6A 4XD7A 1OT3A 721PA 1MRNA 3E2IA 3LO5A 1JAIA 3REGA 4LY6A 2QPAA 2V1UA 2IF2A 3EIQA 3KXLA 3KKNA 3QF7A 2DFKB 5E7IA 4XVQA 1XTQA 2FFHA 1NMYA 3QG1A 4FI3C 4ASUD 4OK5A 3U6KA 5IRCD 2IHYA 1SGWA 4D25A 1JQJC 1W47A 4A8JA 3I3SR 3AGPA 2Q0HA 3BFVA 2BKUA 2EFDB 1KI6A 2CCGA 2IX3A 1SKYB 1RJ9A 2YKGA 1RKBA 2IYLD 3EC1A 2WJYA 2QAGB 3QEJA 4A92A 1LB1B 2AK2A 1XZQA 2OG2A 5CK4A 4TMKA 1JR3A 4KFUA 4NP6A 3PUZA 2GESA 4KYIB 1LW7A 5SZKB 3VHLB 1FFHA 1K6MA 2RGGA 3THWB 3L0SA 2OFWA 3WXMA 1OXVA 2IHBA 3WBKA 2I4IA 1E9RA 2QNRA 4JVNA 2F3RA 3VR5A 2ZETA 1L7VC 1VIAA 2FOLA 2QN6A 4PSAA 3T61A 1W4CA 1XTIA 2FZLA 2OCYC 5H8WA 2CL7X 3U61B 3NWJA 1RFLA 1JPNA 2ANBA 2WKRA 3CNLA 3PFIA 1YZQA 1XXHA 3A1TA 4QM7A 2NO9A 3LVRE 1N3BA 1MKYA 3GPLA 2JLSA 2J1LA 2PLRA 1A5TA 2RGEA 2CNWA 3E5HA 2C9YA 4MYCA 3H4MA 2B8TA 1GZSA 4QBIA 2NPIA 1MH1A 1UJ2A 2GDJA 1LF5A 5C2JB 1ZM7A 5KPJA 1R5OA 4P4UA 4YQFA 5L3RA 4MDFA 4GP7A 3VKWA 4MRRA 4XVUA 1S1MA 2Z4RA 5J4HA 3AP1A 4TT3A 4LUCA 2FV8A 5E95A 4P4SB 2QMOA 2ZS9A 3QBVA 1XMVA 4Q19A 2RHMA 1MO5A 4YC7A 5FR2A 2A5JA 1GM5A 1EGAA 4QXAA 3QNUA 2FG5A 3TNFA 3NKVA 4KBFA 4M22A 4B3CA 5ELXA 5K8TA 2IYTA 5DYGA 3TR5A 1VMAA 2RGBA 2W0SA 3WNDA 3B5JA 3VR3A 3EIHA 1WF3A 3ZD6A 1TF2A 2XNDD 1T8TA 2AFIE 2D2FA 2YJTD 2X8AA 4A8JC 4A36A 4RFSB 5DISB 2O8EB 1J90A 1Z07A 3QPWA 4TQ9A 1DOAA 5CM8B 2IA5A 1OH5A 1DAKA 1KI1A 4AG5A 3VNUA 1XRJA 4IEEA 5LB4A 2CJWA 2ERXA 2QQEA 4PAMA 4XSGA 1TEXA 2ZRCA 5K8UA 2C5LA 2REOA 4PC2A 1GL7A 2D4HA 4TYQA 4S35A 4M53A 1NG9A 3C5CA 3RS3A 4C2UA 3BH7A 3CH5A 3UKDA 3WYFA 2Z5FA 3W3AA 2VHUA 1G18A 1P9NA 3GLGA 1LNZA 4Q1FA 3WY9A 4XWOA 3ADBA 1FTNA 1N0UA 2NO6A 3EPLA 3RLFA 3LXRA 3W3ZB 5CYOA 1G5RA 1NVVR 2BKEA 4C0KA 2UZIR 3SJZA 4AYTA 1ZP6A 2YHSA 4N1AA 4G5OA 2HF9A 5CLLA 4KV9A 5JI2E 4AKHA 2PZGA 4M1MA 2R62A 1SKQA 2H7VA 1OKKD 2V55B 1XEWY 4V0LA 4EPYA 1ZNZA 3V4FA 3U44A 3B13B 5FR1A 3TW8B 4CEIB 4US2R 2A5YB 3MSXA 5A4JA 2KI5A 1P72A 2ZI3A 1Q3TA 1CR2A 1G3IA 1I4LD 3CPHA 1JR3E 3LLUA 4QBHA 1JECA 2H8KA 5TY0A 3VTKA 1HY3A 3WRYC 4DBLC 3B1YA 2IUSA 2OBMA 1KY3A 4P33A 1YJ5A 2GJSA 2AX4A 4LHZA 5E4FA 2WWYA 3QVVA 4Q21A 5EXXA 4B2LA 4KI0A 1XTRA 3NBFA 3OFND 3IGFA 4UNSA 5FL7A 5AUNB 3U60B 2IYVA 4TTRA 2OAQ1 1SXJD 2IYQA 5F9FA 3Q85A 1R0YA 3HR8A 3DL0A 5B30A 4X8LA 4RFSA 5FPHA 1TQDA 1KIMA 3EA5A 4GZLA 1FX0B 3WMFA 4Q02A 2D74A 3IHLA 221PA 1XXHE 4KCGA 3LWNA 4ASUA 1YQTA 4A6XA 1OB5A 1OB2A 3DOFA 1UEIA 4P3YA 4IOKA 1U2RA 1BH2A 1GVNB 5FFMA 4EIWA 2HF8A 1NJFA 4JLDA 3QVUA 2J7PD 1G5PA 1R10A 1JI0A 4HB0A 5GJVC 5LD2B 4LJ5A 5LBIA 1VPLA 1NG1A 3EXAA 1TTTA 3W34A 3BFXA 2OE2A 5AUPB 4TN1A 2FGKA 1UBEA 1WCV1 1XEXA 2CL0X 1NIJA 2XZOA 4ZI2A 3UPUA 1Z29A 3B9PA 1FPMA 2PH1A 4FCVA 3T12A 1US8B 1P9RA 4M1SA 1E9BA 1AZSC 1BYIA 3MFYA 2F9MA 3N2IA 4DB4A 821PA 4OQMA 2DYKA 3AH8A 4AKIA 4OK3A 4I4LA 5DH9A 3ZLJA 2P6RA 3HPRA 1BYUA 5EZ5A 5IK2D 1NSTA 4AY2A 2PJRA 4HUTA 4FIDA 3K0AA 1AGRA 2G0NA 5IHPA 5KSOA 1U94A 3WHKA 1NN5A 4R98A 4LV8B 3GLIA 4QFMA 3K0FA 5C4MA 4DLVA 4CEJB 1Z47A 2F6RA 2I3BA 1U98A 3F3YA 3IDQA 4NCJA 4OKSA 3AM1A 3ICQB 2QBYA 2BOVA 4TL6A 1XMIA 3K09C 1LVGA 1IQPA 1M2OB 3LW7A 3H1TA 1NMZA 3GLGE 1O3YA 1E32A 3TR0A 2WV9A 2N42A 4I1OA 2PT5A 3RYTC 4DIEA 1IBRA 2FSGA 4EPRA 5L3VA 1VDZA 1KNXA 1GKYA 1IHUA 1XD2A 4LV6A 4JLMA 3NDPA 4TQAA 2JLZA 5EQTA 1VCIA 1HURA 3X1YA 2CHQA 2G88A 1GNQA 1WDTA 4NE2A 1FX0A 4ABYA 1N6OA 2QAJA 3SJAA 2CVHA 1VECA 4V0MA 4JSYA 2FE4A 1Z0KA 2NPFA 2BJVA 4KU4A 3LY5A 5EP2A 1ZC3A 3OEHA 1H65A 3CONA 4DUGD 1QHHB 2DFTA 3LH5A 1E1RA 1Z2CA 1SHKA 5F9HA 1IXSB 2FU5C 4NCKA 3FTQA 2DWPA 3LX8A 2DB3A 1EXMA 4Q4HA 1DVRA 2ZREA 3ZIAA 3OIVA 1K5DA 2JJ8A 4P4TA 5CLQA 1KKMA 2VL7A 3P4YA 5DO9A 2ORIA 2CE7A 2OZEA 3AVWA 3VKHA 2XAUA 1MT0A 4TLAA 4HLUC 3E1SA 4FMBB 4RZUA 3OIWA 1R0XA 3W9YA 1JJ7A 3A36A 3NHBA 4DHEA 2GXAA 5FBWB 4QKQA 1OFTA 3CF2A 4B74A 3HDTA 1YRAA 1NMXA 3K70C 3B60A 2P5SA 2QROA 2ZRGA 4UQOA 4HAZA 1VYUA 2W58A 3IQWA 2GK7A 4JVSB 1Q1EA 4KITB 1AIPA 4D80A 1OFUX 3E70C 2ZRKA 4M0LA 3NEJA 4MYUA 4OI4A 2ZTSA 2ZITA 1X8JA 4EAQA 1E2DA 2FSHA 3GLFA 4IFBA 3F8TA 4PZYA 4ESHA 4ERNA 2F3TA 1G19A 3CKLA 1JNYA 4LHXA 2H5EA 1OFIA 2HJGA 4U02A 2CLSA 1JBKA 2D2EA 3IPXA 2O52A 4A82A 3AVYA 4B73A 1EWQA 5JJIA 2BEJA 3RWOA 3NDBB 1FL9A 3CWZA 4BFWA 3QBTA 4Y0VA 1F6BA 3AKDA 2O8DA 621PA 3OFNA 1D6JA 2F9LA 3B1WA 5BYJA 1EESA 2WWHA 4L4UA 5EP3A 4L8GA 1GRNA 4WZAE 2PEYA 4NU0A 4BUJA 4NTZA 1W0JD 3EZ2A 5UKDA 3TAUA 4JVLA 4R71A 3GLIE 2JJ2D 1Q44A 1ZUHA 2XEXA 3Q7QA 5FTKA 1RE0A 3BS4A 3ZZUA 2ZRLA 3D7MA 3NXSA 5HE9A 3B9QA 1M7HA 3A1VA 4ZKDA 5FPSA 3HJNA 3THOA 4FMCF 2N46A 2VP9A 2ORWA 2F1HA 4MDEA 3BOSA 2HUPA 1EFTA 3OAAA 3M6AA 1Z0JA 5EZ6B 2A30A 3LDAA 4IDOA 3RS5A 2GK6A 2V7QA 4BEJA 3EPKA 1QDEA 5CB8A 2Z83A 1S1CA 1G16A 2FF7A 1PUJA 3U3JA 3HP1A 3D6TB 4Q66C 4DLTA 4GRAA 4W9MC 2OCBA 5CIWA 1TAGA 3ONWA 2GCOB 4BFZA 2YC2C 3AB3A 2WSSD 3GJ8A 4UNRA 2ZRHA 4G5SA 2BBWA 4V0ME 5IK2A 3BORA 3QKRA 3A1WA 3ZJYA 1KY2A 4C9BA 5DIFA 3QXSA 2J9RA 2ZRBA 2B21A 3K9GA 4KO8A 5J47A 3CBQA 2XXAA 2OAP1 4B3XA 1EK0A 1CIPA 2OBNA 3R7WB 5FOXA 5H68A 2ZJ2A 4OHWA 1JXMA 1FQJA 5F3WB 2JASA 2W00A 3NIBA 1OHHD 3QIAA 2G0TA 5L3QA 3AGQA 4DC9A 4B47A 4OQFA 1SVLA 1RPZA 2OT3B 1YU9A 3FGNA 4QJ3A 2WM9B 1FW6A 2L0XA 2CHVA 2FFBA 2HLDD 4DXAA 3D31A 1XD8A 3RRYA 2ZR7A 5DI3A 4HUQA 4AWXA 2F43B 2XSZD 1CTQA 4I1UA 2VTKA 2VPPA 3CZQA 1UKZA 2W83A 1QRAA 3AF3A 5G41A 4LYJA 4NKRA 1SVIA 2J0VA 3CM0A 5HCNA 5DNYB 1G64A 1E2IA 3SR0A 4XD7D 5SZHB 5DYIA 4V02A 4TMVA 4JJZA 3K0SA 3BD9A 4KFTA 1K5GA 2R6DA 3KX2A 2IS4A 1OIWA 2IEYA 3QUSA 4HB2A 1LFDB 1KSHA 2ZI7A 4WW0A 2ZJBA 3UANA 2AFHE 4WXPA 3I8XA 2G3YA 3GLFE 1PLLA 4TMZA 3I8SA 1ZCAA 1W36B 4DLRA 3GJ4A 1E2HA 1KSJA 2XTMA 2ZIAA 3PQCA 1D5CA 1H8HA 3KTAB 5AUQA 2D7CA 4XVRA 4OHXA 2IXFA 1ZD9A 1JR3D 2Q3FA 4PO1A 4RD4A 1PV4A 4HDQB 1ANKA 1E0JA 1KSGA 4HZUA 5JRJA 3SI7A 3SYKA 1E0AA 1NNEA 4F91B 1AZTA 3HYRA 1JEEA 1ZYUA 2V3CC 3A4MA 2GCOA 3BWDD 3GLHB 4XSHA 2VRWA 3ZVRA 1XTSA 2ODNA 5EXPA 1EX7A 4AURA 2WOJA 2ZR9A 4EPWA 3W8NA 1GNRA 1GAJA 5TB5A 4WIAA 1KMQA 1OH8A 1E2KA 4BLRA 2EFEB 1D2EA 2AKAB 4II7A 3UWKA 2ZJ8A 3SQXA 3LAWA 1JPJA 3IEVA 3ZZ0A 5JHHB 1KMHA 1NLZA 4PC1A 2ZUDA 2GVZC 1F2UB 4LJ4A 4KXFB 3W8RA 2C96A 2CBZA 2V54A 1EG7A 2ZJ5A 3FMOB 4DSNA 1T5IA 4TT3D 4JYCA 2EW1A 4IDPA 1QF9A 2R6AA 4X8HA 4Q1DA 1DADA 4BLPA 2ZU6A 1X3SA 2IS6A 4NCHA 1G21E 4LC0A 1RRFA 3MD0A 5C18A 1GSIA 2P2LA 3A1SA 4BPBA 5TVKA 2QI9C 1DARA 1KI7A 5JZVA 1TF5A 5SZJA 3TVTA 4M1TA 2J0UB 1JQLB 1RYHA 1U8YA 3HR7A 4HI0E 3WYGA 4A0GA 4DLYA 5LDDC 3DM9B 3LFUA 5HPYB 1E79A 1QHYA 1KSFX 1N6IA 2OFXA 3ASZA 3BRWD 1ZAKA 2P6UA 1Z6XA 1Y63A 3L82B 3OZXA 4B6FA 2FA9A 2E9SA 2F55A 2FFQA 4Z8XA 3SJCA 4GNKA 2IYZA 2R65A 3JVUA 3AVTA 3I72A 2CCJA 4EQ6B 3ADDA 2PX0A 2SHKA 3RS0A 1NSFA 2J7KA 2GRJA 2Q3HA 3LVQE 5FBRB 4B76A 1E69A 2IYYA 4AYWA 2NMVA 4X8OA 3KUDA 4DCVA 1AKEA 4IOMA 1KAGA 3AKCA 5FTNA 1AS0A 1XPOA 2XNSA 2IUTA 3W6PA 1ZUNB 4PQYA 4FCWA 1D9ZA 1UBCA 1S3GA 2ZR0A 3TH5A 1ESMA 1F2TA 4PPGA 3X1XA 2CHGA 3OESA 2ZSDA 2CK3A 3KQLA 2J3EA 1KJYA 4IDHA 1U90A 4DRZA 3THYA 2R2AA 4EJSC 4DDTA 4BGDA 5KDOA 1KI3A 1G6OA 2CLCX 4PR0A 3PCRB 1ZW6A 2RGXA 3LBNA 2CCKA 1Z0DA 1J7KA 2IF0A 4QHYA 2AR7A 2QA5A 4LV5B 3LQRA 1PJRA 2VHTA 1AGPA 2ODWA 3EASA 3L2OB 3KJEA 2YOHA 1QG4A 3AF0A 4BRWA 5B64A 4PHTA 1XP8A 4AIIA 4JBYA 4Q01A 3P32A 1II8A 4LJ7A 4NYJQ 2GETA 2J0SA 1HQYE 1CR4A 5FL7D 2WICA 4YDHB 5EJEA 3GMTA 1TU4A 1ZBDA 4HDCA 3ASYA 4NPHA 3TQFA 3U7EB 4R2HA 2IXGA 4DDWA 4LJ6A 4JL8A 4B71A 4MITA 1E2FA 5KNDA 2YOFA 1WA5A 1G6HA 2ZVQX 2ZJZA 4KODA 4WAUA 1GNPA 1JEDA 1R8SA 2KBEA 1E1QA 1GFIA 1M34E 1JALA 4QNMA 5P21A 5AUOB 3MWLA 521PA 3GQBA 3BH0A 4A2PA 3QXXA 3RANA 2ZI6A 1I2DA 3UMRA 4RZ3A 3TGPA 1BO6A 1M74A 1XWIA 2FX3A 4GOXA 4N0DA 1KNQA 1TQ6A 4KFRA 5EXSA 4BE7B 2MSCB 2J59A 1X8KA 5KDLA 4EQ6A 4ZV4A 3KXKA 5AJXA 2HXSA 5EXTA 5CDFA 3SEAA 2ZYTX 3ND8A 1E2GA 1YZLA 4C3ZA 2DR3A 4LOAA 2KWIA 1NRJB 4JT2A 1E2JA 2QENA 2HJVA 5FUVA 3T5GA 1Q20A 1KZGB 1M8PA 3NG1A 2ASEA 4RFVA 4JLAA 4RD0A 3IO3A 5JSZB 1UDXA 2I1QA 1N5KA 2B7BA 4UKDA 1A7JA 4OHZA 1PLKA 1GTVA 5JJLA 3U6BA 1KYIA 3PVSA 3HYTA 4QM6A 2YWHA 1DS6A 1MO4A 2ZSAA 1LF0A 3SJBA 3G5UA 4C0JA 1P75A 3BB4A 1G17A 1G3RA 4Q4AB 6Q21A 2CXXA 1OYWA 4DEYA 2MMGA 1CU1A 2BWJA 1G9XA 3EZ9A 4B44A 1QHIA 1TUIA 1JXOA 2ZYVX 1ESNA 4TYNA 3K70D 2IWRA 1S2MA 1OPXA 1OH6A 3SYNA 2XOKA 4NYIR 1U99A 4U5XA 3T35A 1U0HC 3MUFA 4O2RA 3B78A 3SQWA 4PC7A 4B3FX 3CPEA 4G01B 1B23P 3GJ0A 2YWFA 4LC1A 3B1ZA 1GKIA 2ZSBA 1IJEA 1P2SA 5IDVA 2G6BA 2J5XA 4JLVA 1Z22A 2ZE7A 2EFGA 1E96A 5KOYA 1PVOA 1DAGA 2WMNB 3IIKA 1VIYA 3D3QA 3TKLA 3PITA 1XPUA 2GJ8A 4DSTA 1GOTA 4F92B 1Q1QA 2VBCA 4Q47A 4M4SA 1HYQA 1GITA 4IXMA 2WTUA 3K0CA 4LI0A 4JBWA 4B3DA 1T6NA 4PPFA 1YZGA 4HAXA 1HE8B 4RJLA 3OEHD 2FEMA 3DOEA 4E22A 2BM1A 4DDUA 3GFTA 1E1RD 1BIFA 1KO7A 1OLOA 4TL7A 1VYTA 2IEZA 4EKDA 5JEEA 5EP1A 3WMGA 2YYZA 2QAGA 4NZYA 1A82A 1CR1A 4WXRA 4KFSA 1EWRA 2CLDX 3MWKA 4IKEA 4LHWA 3ZIAD 2REBA 3EZFA 2C95A 4JL5A 5BW8A 1Z08A 1Z28A 4URUR 2NIPA 5FI1B 3CF6R 3KKOA 2JLXA 1TL7C 2ZJOA 1U0LA 3A8TA 2D3WA 2GWHA 1QVAA 4LBVA 4K8OA 2QT1A 3THWA 4C2TA 4F38A 1OFHA 1UKVY 3I92A 3I4LA 4URXR 3AEZA 2LWIA 1OJLA 4A4DA 1ONBA 1VYVA 3ECCA 4CT4B 4TLCA 1VG9B 1KI2A 3T1OA 2GZDA 4O25A 4JLNA 3Q8XB 3CLVA 4JLPA 1HTWA 1TQ2A 4LYHA 2IYSA 5FI0B 4GOKA 2F1IA 4MKIA 1IN8A 4BFUA 5JMTA 4Q4AA 3WNCA 2AHOA 4AK9A 3KQKA 2ZANA 4FMDF 1Q3HA 3KUCA 3OIUA 2QTVB 3QXJA 1D2NA 3JZAA 4EPVA 4D0GA 3D8BA 4DSOA 2QTHA 3SOPA 4JKIA 3VMFA 2ZI9A 4QGHA 4BZQA 3IKJA 2QRNA 4MRVA 4UNQA 1RRPA 2A5FA 3LA6A 3LV8A 4DT1B 4EPXA 2WOOA 5A5GA 2V6IA 1G4UR 2GTPA 2PX3A 3R20A 1NN1A 4P4SA 1OW3B 3UATA 2FFAA 2JGNA 3EA0A 1VCMA 3KDSE 2WIAA 5AR1A 3O8CA 1GRQA 4RD3A 3L8YA 4H9GA 2JLUA 2GZHA 3K0CC 4D26A 1UF9A 3C14C 1ZM2A 4NL4H 3MGCA 1TF7A 1WP9A 2D06A 2G9NA 2O8EA 2O5VA 2LKCA 3CR8A 1CJKC 1IJFA 4XWKA 3BERA 1UM8A 1GL6A 4PHFA 4ZIRB 5C4GB 1IY1A 2QAGC 4DCUA 3K9NA 2HDNB 2O8CB 1DAMA 2GHIA 3FOZA 1J8MF 1KKLA 2XJ4A 1Z8FA 4G1UC 4PAQA 1AN0A 1W0KA 2WMOB 3I61A 2IK8A 4EFLA 2ZUCA 2VP0A 3FHCB 4I1VA 3TJZA 1JR6A 3IO5A 4F4IA 1WE2A 2ZU0C 4QNRA 1KZ7B 3OAAD 2P3SA 5FTMA 2GXUA 2ZVPX 4PPNA 5E7JA 4BZXA 2O8FB 1G7SA 2RB4A 4L15A 2V7QD 4M9ZA 2IS1A 2QZ4A 4XOIA 1N5JA 1KI4A 4NYMR 4UXJA 3OF5A 4QBFA 4M21A 4FMDB 1DELA 2B6HA 3VR4A 2OCPA 5JWHA 1XB2A 3EZ7A 1JB1A 1H8EA 3NH6A 5C1BA 1F60A 4BEBA 2KE5A 5EP4A 3NBXX 5BN3A 3EW9A 1CJTC 2VO1A 3GJ7A 3HU3A 3U3OA 1QHSA 1CRQA 2QE7A 1XTKA 4V03A 4Q00A 1E0SA 1DG3A 1XCGB 5FOWA 2WWXA 3CIOA 3MJHA 4HLCA 1MV5A 5TV2A 5FOVA 5HZKA 4YDSA 2QPOA 1SKYE 1NVUQ 3M1IA 4R2IA 4CEIA 1W48A 3RABA 3BFKA 3H86A 2B7CA 3P26A 4IVQA 1VKJA 3C8UA 4LHVA 4X8MA 3ADCA 1N25A 3EG5A 1YR6A 2BBOA 1KTVA 4C0HA 2EWWA 3HPQA 2HYIC 1P73A 1XJQA 4O0MA 4POAA 3U4QB 1XEWX 2R44A 1OH7A 2PBRA 2ZAOA 3FMFA 4R7ZA 4TLDA 3SE0A 1IN5A 1Z83A 1G8FA 4U00A 5K8IA 2OESA 1II0A 2ZI4A 1Z06A 1ODFA 1OXUA 2DBYA 3MG9A 4ARZB 3F5FA 2ZM5A 2JAQA 3B8HA 1E9CA 421PA 3QXCA 2HXYA 2Z43A 5BYKA 1JAHA 3CRRA 3CZPA 3SC3A 1XFAA 3Q5EA 3QKSB 4Q1EA 1DPFA 3SN6A 3LBHA 2EVWX 1SXJB 2KJQA 2J87A 3EZ6A 1ZU5A 3R8FA 3CX8A 1H8HD 5AJWA 1D9XA 4URWR 4XWAA 2OO7A 2QUZA 3VX4A 1E2EA 2CVFA 1E2QA 1IY2A 4NMMA 4LBZA 3GEHA 2OHFA 5EE3A 4ZDWA 1BS1A 1YZTA 5SZIA 1US8A 3L0IB 3EAQA 4PO9A 2LCFA 3QG5A 3RVBA 3DKVA 3VX3A 4DIDA 4EPTA 2NGRA 3QPUA 1OXSC 4V0KA 2ZI5A 1D2MA 3QI2A 4FN5A 1MABB 2A9KA 1RZ3A 4LRWA 3GEIA 2IUUA 2ZROA 1VTKA 2G1KA 1U9IA 2IYWA 4HATA 2JLYA 4CEJA 3WYAA 2OXCA 4UJ5A 4LJAA 1GUAA 1TQ4A 3FKQA 2EYUA 4UJ3A 4AI6A 1CJUC 1HV8A 1NVXQ 4Q4LA 2QMEA 2V8OA 4AC9A 2RGCA 1T0JB 1W46A 2FMXA 1J99A 4G3XA 1LY1A 4ZDIA 3SZRA 1XMJA 3CNOA 3TVDA 3PG5A 4E09A 1R7RA 2WIBA 2ATXA 4DCSA 1U0JA 2C98A 4NDZA 1MO6A 3LLMA 5D3MB 1UKYA 3AQ4A 3UMSA 3BAFA 4PQFA 4NBSA 4Y0AA 1Z2AA 4Q7LA 4JMPA 3FKSA 3AVQA 3RRMA 4MYHA 2IWHA 3UG6A 5JWRA 1SZPA 4W5HA 4TWZA 3CRW1 3FWYA 3S1AB 5L3SB 4CZ2A 4HB3A 4MUAA 4RVCA 4BECA 3Q9LA 3ZS8A 4MKGA 1NVVQ 3CPJB 4JLBA 4PC3A 4Q4JB 3TBKA 3PENA 5LD2C 1GL9B 2GBLA 1QHHA 2BMDA 1E79D 4BLOA 3TSZA 1A4RA 3QKSA 4KLNA 5J5CA 4LJ8A 4LCBA 3TUZC 1IXRC 3FHOA 4PSVA 1RVDA 2C99A 3LRPA 1SVSA 4UXIA 5BQ5A 1G291 1QHXA 4M1WA 4B43A 1N6PA 4OI1A 2R6CA 3PEYA 2V9PA 4MGYR 2WPDA 3ZYCA 5J4KA 1OIVA 2IW3A 2X2FA 1KDPA 1MR3F 2FSFA 2E87A 3B7GA 3DO6A 3G0HA 2H18A 2W2TA 3GJ5A 1E99A 4K81B 1ZD8A 1R5NA 4ITRC 2C77A 5FUWA 5FTJA 2GNOA 2ANCA 3GP8A 1ZIPA 3NEYA 3VAAA 1YZUA 4ZDJA 1T9HA 1U9IC 2QT0A 2REXB 2ZRDA 3DVLA 4IEIA 5DHFA 5HTKA 2AD5A 4MH0R 5B57C 5HE8A 5J4YA 2RGDA 1CLUA 2HEIA 1YR8A 2G1JA 4DWJA 2GKSA 3WBJA 1FNNA 3P27A 4MRPA 2O8BB 2CK3D 3Q72A 3KJGA 4WZBE 4AKGA 3TK1A 4IW3B 3ADKA 1ZMXA 4L5BA 4B35A 4C7OB 1T3HA 3U3MA 2ZXUA 3KJHA 3JVVA 2IYRA 2YINC 1P7CA 3OE7A 3T1VA 3CRVA 4LHYA 2YC4C 1XJCA 1E3MA 3IIJA 1Z3IX 3P4XA 1F3OA 3TSOA 1GP2A 4NHOA 1QHGA 3U7FB 2X77A 4Q1CA 4KBGA 4OJQA 4CRWB 4OQXA 1TADA 2JA1A 4LYFA 1WRBA 2E1RA 1ZCBA 4TL8A 3T15A 4ESVA 2OUKA 4PZLA 3KL4A 1UADA 4BWYA 3ZD7A 1TEVA 1V43A 2QEQA 3N5CA 1E9AA 4HAYA 2GBLC 4UNNA 5TARA 3GJXC 5KTYA 2GAAA 4TZ6A 2QGZA 1Z6AA 3CH4B 5HCIA 1NBMA 1NY5A 1G20E 3B82A 4B48A 3DDCA 4AD8A 2ZJAA 3HU2A 3LX5A 1AQUA 3NBYC 1NF3A 5CK5A 3R9WA 1S8FA 2VEDA 4L9SA 2WAYA 1E1QD 4LPKA 1TPZA 1JJVA 3OEEA 1XCMA 3TLXA 1XF9A 1LS1A 2J46A 2D62A 1SVKA 1PUIA 5KPDA 4GI7A 1AKYA 1FMJA 1G7CA 3GEEA 1UPTA 2JATA 3VR2A 2RCNA 1G8GA 2WJHA 4MRSA 2CMKA 4LYAA 4YMTA 1NI3A 5G53C 1ZM9A 2F1JA 1U81A 4F4CA 3O8DA 1ZVQA 3SBDA 4JVMA 2QSYA 2YWGA 4RZ2A 3UG7A 4MGZR 2W6JA 2MSDB 3KKQA 1FOEB 1G3UA 4MQBA 4A6PA 1WBBA 2OLKA 1KDTA 4IDQA 3PEWA 4RCZA 5AJVB 1CP2A 3MLEA 4Z1MA 3T5DA 1RC8A 1S3SA 3BC1A 1UFQA 1EFRA 5JEDA 4Q5IA 5E3HA 2VP5A 4Q9HA 2CEAA 1NJGA 1ZD1A 1TMKA 2O8BA 2BVNA 3GD7A 4MKHA 4TYWA 3CRMA 2BBTA 3FFAA 3PEUA 1DAIA 4B2IA 4GP6A 2UVQA 2JLRA 3B1XA 3R7WA 4QG7A 4MUBA 4D4MA 1NL3A 2ECKA 3DEFA 3KFVA 3CX7A 2PCJA 3AF1A 3QENA 5DI9A 2A2ZA 5JLJA 3AUYA 3TRFA 4ZCLA 2NZJA 2ORVA 3VU9B 5JECA 1C9KA 3EPHA 5JCPA 2XOKD 3ETLA 4M9XA 2OM2A 4MGIR 3MRSA 1N6LA 2PJZA 5GJCA 4RCYA 4NH0A 2DWOA 1Z0AA 5GVRA 5KSPA 1RRGA 1E2NA 4OHYA 3MWYW 2F43A 2BCJQ 1P9WA 1Z6TA 4GL2A 3ZS9A 4YLGA 1LS6A 4M1YA 3SYLA 2GILA 1CR0A 2QY9A 3CX6A 3QEOA 3ZVMA 4E5UA 1R0ZA 4LZZA 4XTCS 4HAVA 2ZSEA 5G3ZA 2WKPA 1A2KC 5GJWC 1P2UA 4A0FA 3AVXA 2VHQA 2QM8A 1AJEA 4JJKA 4PO8A 1HQCA 2PL3A 4PZZA 2VF7A 1TU3A 1W49A 3O8BA 3P1JA 3SHWA 2VHJA 3VQTA 4D4LA 3AKYA 3J81k 2BBSA 1IOZA 1GG2A 3NHAA 4YMWA 3EARA 1N6NA 1DBSA 3BB1A 3CF0A 3WNBA 4EFNA 1IN6A 3SFVA 1T3SA 4A0RA 4Q7KA 1Z6YA 2VH5R 2P0EA 1COWA 1E2MA 1XMSA 1HEIA 2BHRA 4YXWA 3X1DA 3KTAA 1KK1A 3G82C 2JLQA 2PMDA 4DEXA 2QG6A 5EE1A 3FPAA 2NO7A 4PX9A 3X1ZA 2C8VA 1W44A 2AWOA 3EPJA 3UWOA 1SHZA 2QSZA 1IY0A 2QMUA 5EUMA 3UIEA 2ZRIA 2BMFA 3M0EA 4XIGS 1K8RA 3CO5A 3GLHA 2FH5B 3IBYA 5ANRB 3Q5DA 1XBTA 2UZ3A 4Q1BA 4A8JB 4CVNA 4B3GA 2IS2A 2DFLA 1Q57A 3B6EA 1NBME 2WWIA 3CWQA 4JLOA 1KI6B 1RJ9B 3K0EA 4I99A 5FUXA 2RGNA 1KGDA 1OF1A 1L4YA 1VHLA 2R6FA 2Q9BA 3U7HB 2XITA 3I62A 4BLTA 1T3LA 1Q12A 4Q1AA 5CB6A 5KNCA 3TUJC 1BKDR 1ZU4A 2WWWA 4BFYA 1MOZA 1F2UA 3QY0A 2XB4A 4TQUS 4A0HA 4KVAA 2HCBA 3RC8A 4M8NE 3EWSA 3LNCA 5JS8A 1M6NA 5FOTA 3IPYA 5FPTA 5CYPA 5D3QA 2ODBA 5AJYA 3O8RA 3GFPA 4DDVA 1N6RA 3V9PA 1UKEA 1R0WA 1QBKC 3B85A 1XXHB 4KYUA 2ONJA 5BXQC 3JZMA 2BCGY 2VLIA 1N5LA 1VHTA 2AD1A 2NO1A 3CNNA 4FD2A 4JS0A 1KJZA 2KBFA 4AYXA 1RW4A 4FINA 3BXZA 2BC9A 1VG1A 4D2IA 4H1UA 4DVGA 3B1VA 4B32A 3TAHA 1W36C 2QORA 5EE0A 3T06B 2DCUA 2J0UA 2Q9CA 1FP7A 1LV7A 3BH6A 1S96A 3M4YA 1E4YA 1CS4C 1E94E 1R5BA 3UXMA 4NCNA 4RD2A 1ELOA 4GZMA 1TUEA 2V6JA 2W2XA 1W2HA 4CYMA 1CBUA 2QU8A 4P0TA 1W0KD 2VF8A 2AXPA 4RD6A 2R8RA 4ILEA 4NCIA 3W90A 2QP3A 5F2EA 5FTLA 3DMDA 1DO2A 2C2HA 1SVMA 2IC5A 3SFZA 2IL1A 1E4VA 4C30A 3K1JA 4TSFA 4BFTA 4GT1A 1IM2A 2P6NA 1VG0B 3H84A 5FPKA 3H2YA 1AQYA 2OXRA 4JLJA 3L0PA 2CJWB 2RGNC 1I4DD 4HYYA 3U2QA 2X1VA 4IHQA 2MSEB 4Q9JA 3PXGA 4QC2A 5IT5A 1BOFA 4ZDKA 3CB4A 3PV0A 4PHHA 1FUKA 1H8ED 4C0AC 2A5GA 5DLQC 2A78A 2F1RA 1R8QA 1UBGA 2NZ8A 3AKEA 5JFGA 2QE7D 4B6EA 3VKGA 2QPTA 4OJKA 2OCAA 2IXEA 121PA 3GLGB 4DCNA 4JIMA 5BN4A 5GVSA 2WKQA 1P6XA 5M04A 1P62B 4PSKA 3AF4A 1G3MA 4RZXA 3PUVA 2WJGA 4B34A 4GMDA 1E9EA 1FQKA 1DAEA 2QP9X 2XJ9A 4LK2A 3FB4A 3C15C 2VSFA 2GEVA 3C7KA 5C46F 2VYFA 1HH4A 3GLHE 4MA4A 2QP4A 2JDIA 3T1TA 2IT1A 3AP2A 3K53A 1F5NA 2Y8EA 5HR5A 4LPSA 1ZINA 3W5IA 1IXZA 3U44B 4D0NA 4PQRA 2ZRFA 1LTQA 2W2VA 1HT1E 2H16A 1S9DA 4DJTA 4JBXA 3DZ8A 1HT2E 5KU1A 3RAPR 3QSYA 2I1VB 5BWMA 1E2LA 4D82A 2Q6TA 2W6IA 4V0OA 4R9UC 4BQSA 2XZLA 4BFXA 2Q3MA 5KYKA 1KO1A 2WJVA 1YR9A 3KB1A 2QMHA 4TL9A 4BLQA 4CIDA 3U5ZB 1BMFA 2FSIA 2XX3A 4WOPA 4C0LA 1J70A 4CGZA 3NH9A 4ZCIA 5TDHA 2ZQ5A 3L43A 3DHWC 1G8HA 3HU1A 3IILA 3TUIC 2Z6VA 2JLVA 1ZRHA 4B33A 1Z63A 4QJ4A 1G3QA 1OV4A 1CJVC 4CT5A 1S4QA 4G5RA 2H92A 2GXSA 3FMPB 4OK6A 1N5IA 4WA7A 4LJYA 1IN7A 5JSZA 2WSMA 4JYBA 4P32A 1J8YF 3U7GA 3QKTA 2HYDA 1ZNYA 3ZH9B 3TIFA 3W6OA 3TW4A 4FWIB 4QGAA 3R9IA 3CW2A 4DLZA 1C4OA 5HKKA 2NOAA 1FNMA 2WBLC 3C41J 1X1SA 4JL6A 3P20A 4Z54A 4W5JA 2B8WA 1OXTA 3V00A 1DTSA 2GF0A 1XEXB 2GZAA 3I1FA 1NN0A 2R9VA 4ZKEA 4PANA 3ZVLA 1ZM3A 1YRBA 2JJ1D 4KJZA 3R9XA 1NN3A 3N70A 1EFHA 1KHTA 3UK6A 1KO4A 3LW8A 5CDFE 4U7DA 4QJ5A 2PCLA 1QG2A 1C1YA 3RS4A 2X19A 4QRHA 3SBEA 3U3RA 1CRPA 4ACBA 4K46A 2ZSFA 2HCJB 4BZPA 4F93B 1R2QA 3K0AB 5L8VA 2F7SA 4Q03A 1XD9A 1G7RA 2CDNA 3GLIB 1ZUIA 1WQ1R 5DN6A 1KO8A 2K5UA 3K0FB 3T1QA 3KKMA 2KSQA 3KQNA 3K70B 4G0NA 2TMKA 4A2WA 4C0BA 5EE5B 2QBYB 3FKSD 2W0MA 4I1SA 1UAAA 2AL7A 1D8TA 2AN9A 3NTUA 2C04A 2J45A 4PTLA 2H17A 1KAOA 1XU4A 1G1MA 3AV0B 1ZM4A 3L8ZA 3ZZTA 1NLFA 1W4RA 5EE9A 1E9DA 3DM5A 2ZE8A 4M9SA 2EQBA 4B75A 3NC1C 3SDZA 4IOLA 3K09A 3Q7PA 1XD2B 4BFSA 2PT7A 1VCOA 2JIZA 1KK0A 3LQQA 1HA3A 4WBSA 2WJIA 1YZNA 4QGGA 3KZ1E 3BGWA 3MCAA 3Q3JB 3THXB 3PR1A 4PFSA 4Q9IA 2QQ0A 2WPDD 4URYR 1R6BX 4TLEA 4P31A 4QHTA 1G41A 2OFOA 3W6NA 2XZPA 1CXZA 1OSNA 1ETUA 4V0NA 3KXIA 2NO0A 2QGNA 3DZDA 4A1FA 3IUYA 1SVOA 2WWGA 5DSZA 1NP6A 5IF9A 1CULC 1Z0FA 4UXHA 1X6VA 2BMEA 3QJYA 1P2VA 5EUQB 1AA9A 2NQ2C 4Q4HB 1AS2A 3ICEA 1YZKA 2FN4A 4D4JA 1XEFA 2A5DA 2R6GA 4IXNA 3TQCA 1KO5A 1S9HA 2V1XA 4OHVA 1KDRA 2ZRMA 1A1VA 3MAAC 3UMFA 4ACAA 3TMKA 2BIFA 3OE7D 4TMXA 4Q9LA 5GJBA 2G83A 1OYYA 3R8CA 4TZ0A 4DT1A 3ND9A 1L4UA 1X86B 3KFXA 2JCSA 4TTQA 4Q7JB 2HT6A 4D6PA 3PIRA 1E9FA 3PUWA 2WWFA 3I5XA 1CEEA 5FOSA 4D4KA 4HLUA 4QL3A 3KKPA 4RY2A 5FBVB 4TYYA 4RKEA 2VHCA 1II9A 2ZRAA 1S0UA 4B2PA 3GLFB 1U8ZA 4ZPXA 4DLXA 1KK2A 1Z6GA 4MKFA 3EIEA 1NBMD 2XTZA 3K9HA 4ZIRA 4MYTA 2J0QA 5AK0A 2C03A 2O8CA 1XPRA 2EWVA 2PMKA 4M2LA 2VA8A 5K8LA 4FWTA 3GJ3A 4WVFA 2VSXA 1DE0A 1XX6A 3FYHA 2Q21A 4HEJA 3I32A 4JT4A 4QGFA 3OEED 5KSZA 2EFHB 3RHFA 1NY6A 2O8DB 4IDNA 2J41A 1OIXA 2P67A 1GWNA 4OL0A 5AWFC 2XNDA 3W5JA 2GXQA 2O8FA 3LXXA 4E03A 2YZ2A 3THXA 1MRSA 3VR6A 3FDIA 2ZS8A 3A1UA 2ZAMA 4O2LA 5KO2A 1GKUB 4F4JA 4ON9A 5TXGA 5BN5A 4NYIQ 2AKYA 4US0R 1AK2A 2W6JD 3AP3A 4W5WA 2YVUA 3FMIA 3RS2A 3AVOA 4HLQB 2IYXA 4Z1MD 2WJJA 1EX6A 1T4GA 1KK3A 3BB3A 1N0WA 1A2BA 1HUQA 1YR7A 4C4PA 1EFRD 1DEKA 1T91A 3LD9A 4S2EA 3V4RA 4Q48A 1TNDA 4B3BA 2VP6A 5G40A 4BFVA 1J2JA 3GFOA 2AXNA 1G7TA 3DKPA 4KSCA 4CF7A 2JJ1A 4BASA 4LBWA 3RNLA 5CM9C 4A9AA 4W7SA 4Q18A 1DO0A 4O3MA 3OHMA 2JLWA 2DWQA 1ZIOA 3AVUA 3A4NA 3ZQ6A 4RD1A 1QZXA 3BE4A 3EX7C 2H57A 3AUXA 1YKSA 1P2TA 1I2MA 5JCZA 3U4QA 3ZGXA 2ZYUX 3QKRB 3VR1A 1ZNWA 4ZI3A 1G8YA 3WP1B 1OKKA 2XXAB 1KI8A 2O0KA 3BBPA 4GFDA 1FP6A 5E7MA 1P3JA 1UDWA 1XJ0A 2OBLA 3DMNA 3REFA 1KI9A 1G5TA 4ZCMA 4C0QC 4DB2A 2O0JA 4ARZA 5L3QB 4MRNA 3QE0A 4BRUA 1G4AE 2EYQA 4MGKR 4LSGA 1YE8A 1YHNA 1RRCA 3SNHA 1T0HB 2C9OA 2FWRA 3RC3A 2ZS7A 5DI3B 4HUQB 4HAWA 5JS7A 2QM7A 1W36D 3CR7A 3AF2A 5H70A 3VNVA 2Z0MA 2ZEJA 2OV2A 3HWSA 3IHWA 1E2PA 1COWD 4YXWD 1SXJA 4TTPA 3T34A 1Z5ZA 2LKDA 2NG1A 1RYFA 3RWMB 5J4VA 3AVVA 5GADl 4Z8YA 3FHTA 1EFCA 1GIAA 2GEDA 5FUYA 3A6PC 4RKFA 1WXQA 2ERYA 2WZQA 3QPVA 2MMCA 4EUNA 4GMXA 1M7BA 2GA8A 3MWJA 4TMTA 4C0SA 2FPMA 3KJIA 3F0TA 3CUEF 4KVGA 4YMSA 4FXPA 2BJWA 3QF4B 3TE6A 4LJ9A 1O87A 2J7PA 1KDOA 3RSLA 2FPKA 1RIFA 1Q1BA 4LWZA 3MMPA 3FVQA 1E98A 1MABA 1FMLA 3KB2A 4D81A 1N6HA 4NYJR 4US1R 2GCPA 4AKEA 2PEZA 4KSBA 2VIIA 4JLKA 1VCNA 4JZKA 4LDJA 1W4BA 1XNJA 2G77B 1L2TA 3A37A 3QOFA 4HZUB 2GF9A 3TSWA 3ZDQA 3QXHA 4NONA 2P5TB 4HB4A 5KDDA 4GOJA 2ONKA 2IYUA 2P65A 3L0OA 4GPTA 5CJPA 1GRRA 4A15A 3NC0C 2RH5A 4Z51A 4OI2A 4XTRA 4GBMA 2ODEA 2VSOA 4URZR 5D3MA 1E9SA 2BMJA 2OLJA 3WMEA 4TMWA 3RSOA 2OEPA 1Q22A 4HLDA 4Q7MB 1ZNXA 2ZRNA 3CRQA 4J0QA 2RAPA 1HE1C 2VP4A 1KMHB 2AWNA 2ZYWX 2V4ZA 5KSYA 5F98A 2YWEA 1ZJ6A 1QHNA 5L3SA 4NYMQ 3S1AA 1UEJA 3QKUA 1SVWA 2ZE6A 4L16A 1NLYA 4EJSB 1CKEA 4Q4JA 1SXJC 4HZIA 2FGJA 2D7DA 1NKTA 2JEOA 5CIQA 2GEUA 2B92A 2QRZA 1KJWA 1Q1ZA 4CEHB 1SULA 1SQ5A 1FUUA 3B2EA 3EWAA 1P61B 2C78A 2C9CA 4GSYA 4BLSA 2FDCA 2Z4SA 2VQSA 4JKYA 1E0KA 2YOGA 3KQUA 1YVDA 4DLSA 3MJRA 1Q0UA 1VG8A 4FMCB 1GILA 3WRXC 2WHXA 4HAUA 4TSFD 3BIFA 3X2SA 1TX4B 1W2GA 4L9WA 3ZVNA 4OBEA 4DUGA 1U8AA 3BK7A 2XB2A 3PEVA 3QF4A 1L8QA 1P4SA 4I81A 3I73A 2RKOA 2FJUA 1OE0A 1W7AA 5A0FA 1W4AA 3GJ6A 1FZQA 2PZEA 4FCTA 4LBYA 5H1YA 5DHAA 1R4AA 5JJKA 1F48A 2GCNA 2KB0A 5FL3A 2FNAA 4TLBA 3K9LA 1X8LA 4PAOA 1OXXK 4C7OA 1E6CA 1Y3AA 2BEKA 1DAFA 2ATVA 1UBFA 4YONB 1N0VC 4RSGA 2XTNA 4LGMA 4ZO4A 3FE2A 1IN4A 4FW9A 4N0EA 4URVR 1SXJE 1X1RA 4XH9B 3SU8A 2ZPTX 5DGXA 3A58B 3C4JA 1Q21A 4AG6A 1F2TB 2WVJA 1W1WA 2QTFA 4IOJA 4PPQA 3WHLA 5FPYA 4D0LB 1M7GA 1CJMA 2VP2A 2ZRJA 3K8YA 5J4LA 5TMPA 1QVRA 2H1LA 1N6KA 3U3KA 3THYB 1IONA 4QHSA 2JDID 2PZFA 4TYPA 2FEOA 2OSBA 4Q9KA 1GDDA 1XCPA 2FPLA 1V5WA 2CNWD 5KNBA 3RRNA 2DY1A 1DAHA 1NKSA 5JWOA 2RHDA 1XZPA 3C5HA 5B58C 5KHOC 2RMKA 4QOSA 5FBLB 4EJSA 3PJRA 1WB9A 2HT1A 1G8PA 3H0KA 2A3RA 2ZE5A 2GJKA 3EC2A 4IFEA 5KUTA 4M1OA 3N2EA 3RDPA 3IIMA 2NTYC 1IAQA 5CITA 1WMSA 4CEHA 2W6ID 5J40A 2RGAA 4OYHA 2GJAA 2BDTA 4DLUA 4KAXA 1II8B 3AVPA 4PXAA 2OILA 2DPXA 1BMFD 4IVRA 3VFDA 5G3YA 2AK3A 1N2CE 1PLJA 4OI0A 4OQLA 1KOFA 1AM4D 1DG1G 1W0JA 4HDOB 4DLWA 2JJ2A 5JBQA 4F7WA 2GVDC 2YNMA 1AS3A 2CE2X 4E07A 5AJZA 1NIPA 3OIYA 3C16C 4M1KA 2ZUBA 3DPUA 3IEUA 4KLZA 2GAOA 4KHZA 1PZNA 5HKKD 2Q9AA 4CW7A 3PUYA 4LX0A 4GDFA 1WBDA 4IJMA 4CDGA 4PHGA 2CL6X 4JSTA 4UNPA 1Z0IA 5JI3E 8OHMA 2FZ4A 2DFNA 4DSUA 5DE3A 4N3NA 4A2QA 2WSSA 3LBIA 3VU9A 2EFCB 5FOUA 3ZQJA 1ZC4A 2HV8A 2EU8A 2BV3A 1T5LA 1XTJA 4DZZA 3NVAA 5JHGB 5JRZA 4OQNA 2PLFA 2ZRPA 1MO3A 2N1BA 5FH9A 3GCGA 3PUXA 2XGJA 4DCTA 1W5SA 3KQHA 2GJ9A 2DHRA 5HZHA 5LB2A 1XDBA 3O47A 4YMUA 3QQ5A 2ZJYA 4YMVA 1P60A 2UKDA 4DKXA 5DN6D 4IVPA 1FTSA
chains in the Genus database with same CATH superfamily
1MC4A 1NVWQ 2RHCA 3OPXA 4GE0A 2M2IA 2BM0A 4KO4S 3A3KA 3H65A 4U6NA 4EDHA 1O03A 1OTHA 3ROZA 1KRXA 5FBQB 4WZ6A 1GHTA 1M1NA 3X1WA 4BBZA 3GZ4A 1KXJA 1V11B 2OQ2A 1V8ZA 1H0RA 1NT2A 3EEOA 5CJ2A 4RPCA 2ZB3A 4XFJA 3FFBA 1YDGA 4WWHA 1ISPA 1VYHA 3CEAA 3D81A 2PGIA 2FR1A 4FN4A 3F6YA 3IBGA 4GBGA 4ZV7A 1I0LA 3SHQA 1JA9A 1GXSA 3WL6A 2YNMC 5CA0F 3I0NA 5JYBA 3DLBA 1J8QA 721PA 4A6EA 2Z1NA 3E2IA 3U0VA 1JAIA 3GT7A 4EH1A 2C82A 2QPAA 4LY6A 2AQ8A 5EHQA 3KXLA 3EY9A 1AV6A 2DFKB 5E1MA 1RXVA 2FX5A 4XVQA 3HJTA 4FI3C 4GF5A 4G36A 4ZVUA 1N4AA 1QUEA 1Z8NA 4GUAA 4IYRA 2FFRA 2QUKA 2WNIA 3KBBA 5LQNA 4W1SA 4MMYB 2XUDA 3UC5A 4NIMA 1CQIA 3KSZO 4L5AA 4X61A 1R9JA 3C3YA 3ES9A 3AUJB 2D1RA 1QGUB 3AGPA 2OYCA 4MPDA 1HE3A 4X95A 3L46A 3OQNA 4B2YA 2XB6A 4KKVA 5B1SA 5LQKA 3U4DA 5FA6A 5I45A 4DJ5X 2Y99A 3EC1A 4E5DA 1RCFA 2EF0A 3FVWA 3KEFA 3EB9A 5JRDS 3WL3A 1NONA 1Z5PA 2AK2A 1NVGA 3AJDA 5DBOA 3PQ4A 3U4AA 4WBNB 5KHLB 1Z9BA 3C3DA 4F06A 3R3UA 4CFZA 4DCCA 2IODA 1QFSA 4DILA 4V1CA 2GESA 3IPCA 2E18A 1VXRA 1XKXA 4YHBA 1M6VB 5BVGB 4DKJA 1K6EA 4G2TA 4CU5A 1KBOA 1OXVA 4BQIA 4Y6LA 3E81A 1X7YB 1PWXA 3OQJA 1L7VC 3SZ3A 4PSAA 4AL4A 1JWAB 1U7UA 2C0PA 2ETXA 5FV7A 4GG1A 5CCEA 3M6WA 5H5JA 5J2TF 4Z4HA 4DEVA 3NWJA 4G26A 1JPNA 2WKRA 4OMDA 2QVCA 3A1TA 3PYXA 2A4KA 4H6WA 4QM7A 4QTZA 3GPLA 4RH0A 2O2CA 4TXNA 3DV2A 3OCCA 4FIZA 1WUJS 2CNWA 4RXTA 4J7AA 1L8AA 4EHBA 1B14A 2WIFA 5IABA 4Y1FA 3MMZA 4MYCA 2HRBA 3WFIA 1Z6ZA 1WM1A 2NPIA 4QBIA 1UJ2A 5K0NA 5BUSA 5C2JB 3HHEA 5ALZA 1TKBA 1JPUA 1ZM7A 2HH9A 1CQJA 2ZW9A 1D0VA 2VC2B 3I5MA 3WL4A 4G0XA 4YQFA 4O5OA 4MDFA 3VKWA 4MRRA 4HRYA 4XVUA 2H4WA 4BNGA 4BB6A 4IH1A 3M4ZA 1QWOA 2V03A 5I9SA 4IR7A 4OTZA 1MO5A 4YC7A 5K3FA 2A5JA 4EUKA 1GM5A 3PDIB 3TNFA 3H42B 3D0QA 4NCXA 2FLWA 2IYTA 1M1UA 3WLEA 3TR5A 3UH0A 4Z51A 3WNDA 3RVNA 5BURA 3VR3A 1YI0A 4K6FA 3WSVA 1R9NA 1WF3A 1TF2A 4HCJA 1M9NA 2AFIE 2D2FA 2YJTD 1QLJA 4A8JC 4B45A 4A36A 1MGPA 2ZG6A 1M76A 1J90A 1BEEA 1GKKA 4IQGA 4MOWA 1ZK2A 1GA6A 1TGYA 2G1PA 1JWBB 1P9OA 5ALJA 3DL7A 1XRJA 1T9ZA 2QN8A 4IEEA 1FRZA 4FU0A 4J03A 1NQTA 4RABA 2QQEA 1D04A 4CKZA 3HB9A 2OV1A 3AERA 1DKNA 2C5LA 1XJWA 2ATEA 1PJLA 2NU6A 3F6EX 1GQFA 4D3DA 4RW0A 3TIGA 3FOEC 1GL7A 3CSDA 4QYXA 3FPKA 1ADGA 1XVVA 1EDZA 1K0UA 1P1FA 4J0JA 4YCAA 1TA4A 4TWRA 4HXEB 3RS3A 2XRYA 1U4NA 4XLTA 2GHRA 2XUZA 2TYSB 3BJMA 4PY2A 3O8QB 2IHJA 4Y67A 5KOHB 3ZTTA 3R3HA 1V71A 1G18A 3EZGA 4JEUA 3MGBA 4FEGA 3P9SA 5JSFA 3BQ9A 5A3VA 3PYLA 3VSCA 3B6ZA 3F5MA 4L22A 1F8UA 2Z5LA 1FTNA 4OHKA 3WQHA 2QUBA 4O4HB 4B40A 3W3ZB 3JATB 4RTQA 3SK0A 3TB4A 2ZJ4A 4L95C 4C0KA 3E53A 2Z2JA 1Z25A 4YRCA 3SJZA 2HL6A 2XI4A 5L51A 1ZGGA 1ZRSA 4G5OA 3A11A 1KVTA 2Q2QA 5FADA 4RY8A 3WJ1A 5CLLA 2G71A 2WHYA 4RE5A 1WXEA 4AZWA 4AKHA 2PZGA 3FFWA 5L7TA 1JHQA 1B15A 1WHSB 3D7LA 1HQDA 3LZ6A 4Z2YA 3M5DA 1L5HA 4EEZA 1X39A 1XEWY 3S2EA 4BCBA 1DTEA 3DBRA 4OAOA 3AEUA 3B13B 3C7TA 3MILA 2H48A 2JCBA 3OU7A 1PDOA 4CEIB 5TQ2A 1GTMA 1XZIA 2A5YB 3MSXA 5KVSA 3QVLA 2C29D 4N5NA 4UBOA 2XTAA 1U1CA 2GEBA 1U8CB 1WUHS 2EEPA 4QBHA 4D3XA 1EJ2A 2FLVA 3QFRA 3VTKA 4CG1A 1N5RA 2X6QA 5ALUA 8MHTA 1XAIA 4F45A 2ARKA 2H1IA 2CFSA 4NE9A 4YCLA 3BDIA 3BWVA 3MTEA 5ICEA 4KI0A 3IGFA 4QFCA 1IVNA 2IOHA 4HEQA 4IIJA 4PSDA 4TTRA 3U60B 3H1AA 2IYQA 3RODA 3V8EA 1AY0A 5F9FA 3TNDA 1B1CA 1EMDA 2C84A 4M88A 4NI5A 3U1BA 4X8LA 1O95D 3ET5A 1QVVA 4RFSA 2AF3C 1KIMA 4FOOA 5FPHA 3Q4GA 2J85A 2DKOA 1T4CA 1S5PA 2D74A 1Q17A 221PA 3C3BA 4KCGA 1GRCA 4PCAA 2JCVA 3NBUA 4W63A 1QG0A 2OXIA 4A6XA 4BTVA 3LBFA 1OB2A 4P3YA 1UEIA 4BPRA 3R3VA 3OT4A 3V8VA 3L4KA 3OOJA 3O0DA 3GRKA 3FDFA 4BMPB 1BH2A 3FUWA 5KU7A 4BMCA 3H1BA 1GVNB 5FFMA 1UKBA 5FWXB 3O82A 2HF8A 2ZTUA 5CNJA 1NJFA 3BJRA 3EBOA 3DZKA 3RASA 3TL6A 2PRZA 1G5PA 2JCXA 1XKQA 2QNBA 1HLDA 3B20A 1VPLA 4PG8A 5AVTA 3T3HA 4IFTA 1F14A 1IPEA 2FDXA 4G0OA 5WRFA 4TN1A 4ZT6A 1IQUA 3AESB 5DWVA 3ZK8A 4R2LA 3SC4A 1C7EA 1V3UA 1R64A 1L4BA 2CL0X 2XADA 2J9GA 2HREA 5B53A 1NIJA 1GNTA 1Z5WA 3G89A 5CVDA 4PYOA 1L5KA 4EEXA 1FPMA 4FCVA 5BP7A 4KDEA 1L7DA 5B37A 1C7FA 4M1SA 5EJEA 3AV3A 4EGSA 4UE6A 3MFYA 2JFWA 2JK1A 3EFBA 3O4FA 5A9SB 4DR5B 1TYDE 4E4RA 1H3EA 5AOBA 4OK3A 2Q62A 3W5BA 1YE3A 1JXQA 2BW0A 3RVRA 3HPRA 1BYUA 3HL4A 3PHIA 3SM3A 1NBHA 1NSTA 3K16A 2I2AA 5PGMA 1NURA 3K0AA 1DIOB 5TSDA 3PD0A 3U19A 1SUEA 4N49A 4R98A 2VDLB 3UHPA 2XZTA 4I9NA 3HNPA 1GFWA 1LJ8A 2Y1OA 1Z47A 4NCJA 2EJTA 4ND6A 5DKFA 4HQRA 3ULKA 3LGSA 4ZAGA 2QSJA 4HDRB 2X42A 3LU1A 2UYYA 1UZLA 2VYQA 4KQKA 1BAPA 3VC3A 3G2JA 3FDJA 3QKWA 4RF3A 5FUQA 2X5OA 3B9RA 1XMIA 2JVJA 4NBVA 3I9KA 4DLAA 4U39A 1UDRA 3H9CA 4YQZA 3D43A 1QH8B 3Q5GA 1CJSA 2BRUC 1O3YA 1ISJA 2MYPA 3EPRA 2QL9A 1QO0D 2CUKA 3IRVA 3PQ7A 1LBHA 3RYIB 3ZBPA 1AQLA 2PT5A 4BX9A 4EPRA 3STUA 1ABEA 4EHDA 3DWFA 1GKYA 1IHUA 1DKPA 1XD2A 2C42A 3BRCA 3KO8A 3CLHA 3P94A 3R74A 2A58A 3NDPA 1KBZA 4XQ9A 5EQTA 1XHEA 2IY7A 1Z5UA 4OXQA 2G88A 1KJQA 1GNQA 5LA6F 1R0SA 4NE2A 1Y9AA 5TQ0B 2PT6A 5IHXA 3ODPA 1N6OA 3SJAA 1TJNA 4R9RA 1CUWA 1PZHA 4EHLA 4RTPA 2HW8A 4WKNA 1QC5B 2NPFA 1QLHA 3QVGA 1CLEA 4UPDA 4RTLA 4V38A 5EP2A 1ESEA 4DUGD 3CONA 3DHVA 2DFTA 3ABZA 3RVQA 4QEKA 2AJDA 5ABPA 1UC8A 2WK1A 4PLFA 1Y1TA 3G8YA 1JYSA 4DJDC 2W43A 3AFIA 4ZPJA 2XQGA 3AY3A 1XMQB 1FFWA 3LX8A 2DB3A 3N8NA 3AETB 4Q4HA 3ROXA 1QH1B 4WLOA 4D9JA 3TGWA 2C2MA 3ILVA 2FJPA 2C5FA 3ZIAA 3I01A 1RI4A 2O14A 5CLQA 1DX6A 4HG2A 3DQQA 1V1JA 2FUG6 2CE7A 3FHJA 2C5HA 1XI2A 3DWEX 3LWBA 3O3NB 4B6PA 3OP1A 1IRXA 2P0AA 4DREA 5C3MA 1LFAA 4HXGA 4HLUC 3E1SA 2XVYA 3KAQA 2VJPA 1K92A 3GRYA 3DFIA 3JSAA 4OY3A 3W9YA 3OEYA 4BMYA 1P7YA 2HSJA 3NHBA 3H5IA 4CHGA 4FS3A 4DHEA 5FBWB 3G3EA 3T9EA 3CF2A 5EMKA 1NMXA 5AK3A 3K70C 4RPHA 1X13A 2RIRA 3A1FA 1DX9A 4HAZA 1EXVA 2W58A 1JL3A 3M6FA 4PLPA 3UV6A 2PANA 2NV2B 2GK7A 2C4WA 2JD1A 1Q1EA 4KITB 3B70A 3CA8A 4MWDA 2AZMA 4J49A 1EGHA 1QGDA 2BZSA 4IH9A 3AHEA 4MYUA 4EAQA 3VZPA 4LVNA 4RHYA 3T99A 2FSHA 5EXEA 4QYMA 4NPCA 5AKIA 1Z73A 3R76A 1Y33E 2BEWA 2I87A 1JNYA 1QB8A 1C7QA 1CVRA 1AKTA 1I8TA 1N8NA 1E3WB 2HJGA 2RAUA 4GECA 4U02A 2I78A 3IAHA 4A82A 1QFJA 3AVYA 1WB5A 3KUXA 3QI7A 5JJIA 2HFKA 4FYMA 2OY0A 3IA2A 4CMKA 1LI5A 5B1DA 5TPWA 1C8VB 1FL9A 3CWZA 3H6HA 3OP4A 5I3CA 3QBTA 1GG8A 5HG0A 2O0MA 4WCFB 1N9GA 2VDWB 4YCCA 2O8DA 3K2EA 1D6JA 4CKWB 4XCQA 2F9LA 2PG3A 3TSAA 5C1DA 1Y1QA 4DWOA 4N41A 4LVCA 3FCEA 2XQVA 4EL5A 5BYJA 1I0ZA 4ZICA 1EESA 2WWHA 1DV2A 4NS1A 1E4OA 2R47A 3LQ4A 3VSAA 1C1HA 5JW6A 4L8GA 4MRMB 4P2GA 3UXEA 3V1MA 5C1OA 4DV3B 5JV5A 2PEYA 4IDCA 4R71A 4NTZA 3EZ2A 3NHZA 4BV8A 4EB8A 4JVLA 1L5YA 2WJ6A 3CE9A 3GLIE 2JJ2D 5AVKA 4AUMA 4BBPA 1RD4A 1P8AA 1RE0A 3C98A 3K9BA 3ZZUA 1QVZA 5EOVA 3WYBA 3O8LA 3EGXA 1BVYF 2NZ2A 4NE7A 2OCIA 1U7OA 5FPSA 1U2QA 1ZVKA 4HRXA 4AY6A 1KEVA 1IWOA 3D8NA 3QBEA 1A71A 1VA4A 3GJRA 2ORWA 2F1HA 4FMCF 4ODIA 2V97A 2JRLA 2MOKA 3BOSA 4UC0A 1EFTA 3OAAA 4IHAA 5JUWA 2A30A 4M87A 1Z3CA 4GI3A 4DJAA 2DR2A 2V7QA 3L7AA 4BEJA 3EG9A 4B87A 1PNOA 1S1CA 3AJEA 1G16A 4FZRA 4AJ2A 1WWKA 3IR5A 3HP1A 4L78A 3OLQA 4DLTA 3C39A 1A4UA 3IJEB 1MZVA 1WXDA 5CIWA 3NHKA 4BO9A 2GCOB 4RYLA 10MHA 3GJ8A 3K6JA 5CW2A 5TGTA 3UTDA 1V3QE 1P5HA 1YBVA 2BBWA 2WHRA 4QLOA 3SQNA 4KR0A 3UO8B 4V0ME 3HDGA 3OSZA 3R7FA 5IK2A 2GN6A 3P9RA 4M7OA 1PFQA 3A1WA 3FWKA 2JGLA 2EZ8A 4LN1A 5CVCA 3IQDB 2FXIA 4BNZA 1ODTC 2RC6A 4HNRA 1WJGA 2IP2A 1U0NA 3IEXA 4B3XA 3UHOA 4DS3A 2OBNA 3CT6A 5H68A 3DONA 3DMYA 1XA4A 2Q49A 5G4LA 1QO9A 1FQJA 1M2HA 1ZN7A 3TZQA 2CGEA 3ZD9A 5AW6A 2XBMA 2W00A 4GZ3A 4YRPA 2G0TA 3AGQA 4DC9A 3QM1A 1F17A 4AJ1A 4B47A 4MKZA 3TKAA 2VYVD 2OT3B 2QG4A 5CXXA 5KAPA 3FGNA 4NRDA 4WKOA 2X0EA 3U7JA 5I7EA 5NULA 1W52X 4XPIA 2SICE 4Y1GA 4KR9A 1XWWA 3AW8A 4QOJA 4BX8A 3GMDA 1CSEE 1JHYA 1FDRA 1FFEA 1H1LA 1DEAA 1ZH6A 2B37A 2CDAA 2ZR7A 3RARA 4BNWA 3GA7A 5JY6A 2GM5A 2F43B 1M2NA 4YUYA 4D0SA 1CTQA 4OV6B 3GBPA 3CZQA 3QKIA 4ZAXA 1QTNA 2W83A 1QRAA 4LYJA 4E15A 16PKA 1P1CA 3RAGA 1SVIA 2J0VA 4X1IA 3ZU5A 4QU5A 1X38A 4XD7D 3ZE8A 5DYIA 1NJSA 2CV2A 1EJBA 3ISVA 3ENVA 4TMVA 5I7FA 4JJZA 5DMHA 4KFTA 5DTMA 2CKDA 2WA1A 3IE0A 3GEGA 1EDDA 4BZZA 1XYYA 1K4MA 1OIWA 2J32A 3THRA 1MFPA 4HB2A 4EG3A 4OHOA 3VPXA 5K2OA 1BG6A 2QD5A 5LDHA 3ZK7A 3H75A 2G3YA 3EJ6A 3E3MA 3GCDA 2VPQA 3DAGA 1ZCAA 3I8SA 4MP8A 3UPTA 4KX5A 2XTMA 1KSJA 1UFVA 3Q87B 1RHQA 3PNLA 3PQCA 3GELA 4UDNA 1F0YA 1GARA 2D7CA 2AB0A 5AUQA 3WX0A 1CEXA 3JAMA 3V1YA 1KP9A 2Q3FA 3CQ9A 4PO1A 2J0QA 5AM3A 1Y9DA 5ELLA 2D5BA 1H22A 2JKZA 3SYKA 2A92A 4KK3A 2X9VA 4LYYA 2F8MA 3IR7A 2P27A 2IPNA 5JCJD 3BWDD 4TSKA 4E6EA 1T2DA 4XSHA 4IGFA 3L7LA 3ZVRA 2E5FA 5EXPA 1YGYA 1BFKA 1JDZA 2OBYA 5A3SA 5CCXA 3VR5D 3CV3A 4GYKA 1E6KA 4EO7A 2JJQA 4KXXA 4EPWA 1GAJA 1O0BA 5GONF 4A5OA 1ARZA 4HWSA 4RPJA 4DNPA 4IJVA 4BZWA 4WIAA 4QJIA 1KMQA 3BT7A 2W8ZA 3QPDA 1HZZC 2EFEB 3UWKA 2AKAB 2UZ0A 4XIIA 2ETVA 3LAWA 1N7IA 4H7DA 3V97A 5CA1A 4YJKA 2GD0A 3S1LA 3HCAA 2M6KA 5KVAA 4A7PA 1FK8A 2GVZC 1F2UB 3A9UA 2PSSA 3NDRA 4KXFB 2IYEA 1PR3A 3NAQA 4MWTA 3FMOB 1V25A 1M2GA 5CW1A 1B8VA 4RL6A 3DDZX 2QY6A 1T5IA 3C6MA 1Z8HA 5K0JA 3FKJA 4PRKA 4TT3D 1WDLA 2XB8A 4PX2A 1PYGA 1DTWA 4G0PA 4JYCA 3GVXA 3RTEA 1Q7CA 3T7JA 5ADHA 1EVEA 2R6AA 4BE4A 3WSWA 2BDEA 2VJKA 1NT4A 4X8HA 2NADA 4WXHA 3L7IA 4MVJG 1C5KA 4G9BA 4Q1DA 2WM2A 1HO3A 4RVUA 3ZQKA 2IS6A 1G21E 4ZHQA 2P2LA 1UPFA 4D8WA 2YWCA 2QB5A 5TVKA 1NQOA 3JW8A 1TF5A 3PFGA 4CUKA 4PG7A 1U7ZA 3DBIA 1OAKA 1UOEA 2J0UB 4HI0E 4BLVA 3WYGA 4RTSA 3DM9B 5JZBA 1H2BA 1PR6A 2PZAA 3RSQA 3FDXA 4GPBA 3CH7A 1M2JA 3ACCA 3VTFA 3WNVA 2ZWPA 2P6UA 2NWQA 1Z6XA 1Y63A 3L82B 1BA2A 3ZHCA 4BNNA 3AJ8A 1CUSA 1FDTA 2E9SA 1PK8A 3K5PA 5EESA 2IIVA 3SPXA 3SJCA 3DW1X 2IYZA 4GNKA 4F2DA 4DIKA 1K97A 1ENPA 2R65A 3JVUA 3PUIA 3AVTA 4N3BA 2GX6A 4CM7A 2CCJA 3WO1A 4CQMB 3FB1A 4LZPA 1GPMA 1NSFA 5ED0A 2J7KA 2GRJA 3H2GA 1SURA 2B8NA 3LTNC 5LQJA 4QLBA 2VHVA 3OO0A 2IYYA 4R2JA 4Z86A 1SWVA 1I1HA 4K7JA 2NMVA 3KUDA 2MYUA 4HMQA 1QP8A 1FF9A 3AKCA 1XPOA 2AJ8A 1T2NA 2OGSA 1ZQ1A 1DXOA 2AE2A 1QV6A 3ENZA 2OHOA 2A86A 1S3GA 3TH5A 5C4IA 4IM7A 3RSSA 4B6GA 5BR8B 4MEJA 4CL8A 3ROGA 5I7UA 7ABPA 5JROA 2ZSDA 4FDAA 2G4LA 2WHEA 3KOWA 3UJBA 5TPZD 3QK7A 3KQLA 3NMUF 2J3EA 3B9BA 4FKZA 2Q4RA 1U90A 2Y2UA 3THYA 2E48A 3R7AA 4F6RA 2W6MA 3LIPA 4BGDA 2OKCA 1EQAA 1G6OA 4M0MA 2GLXA 2CHFA 4AN1A 2RGXA 2QG9A 5JANA 1XTTA 5EHNA 3QU2A 1JG4A 2C92A 1J7KA 2HGZA 5FNVA 1Z7GA 4D5EA 2XT0A 3EDMA 5JY1A 4Z0NA 3L7CA 1AGPA 1SOUA 3EASA 3I9JA 4LWOA 4UMFA 4BX2A 1DWQA 1QG4A 2X2PA 4JC5A 1YBMA 1G55A 4CV3A 4F3CA 5BMOA 2GASA 3C6XA 3CW8X 1YHZA 5CCDA 5JS2A 1PHPA 2MINB 1XWFA 1II8A 4HWGA 2EW2A 4NYJQ 2DPGA 3R0XA 1XOIA 1RLMA 4N47A 1T6YA 1QS0B 2K87A 2PQ2A 2XCTB 4YDHB 1RYNA 5B7GA 4HC4A 1TU4A 3D8TA 2VFAA 2NLOA 1MC5A 1N5DA 4HDCA 5CH8A 2IXGA 3WC4A 4JL8A 3N0VA 5ITZB 1KYYA 4MITA 1I7LA 4M37A 4MZXA 4YAJA 5CFOA 1G6HA 5LYJF 3RC9A 3C8MA 5FAXA 1YF3A 3F9RA 5KX5A 2HLNA 4EY3A 5ALKA 4G37A 1SIUA 3PTZA 3VPSA 3ZW8A 1KVUA 3MWLA 4O6VA 3RI3A 3V46A 3N7UA 1UOQA 4L28A 3FH0A 1T9DA 3IDSA 3RANA 2GPWA 1KZ4A 3M6IA 3P2EA 4JJ6A 3B6MA 1RZRA 1BO6A 1M74A 1ZO8A 4N0DA 3EXIA 4PNHA 1KNQA 1TQ6A 2IXAA 4BE7B 5ERGB 1L4HA 1V8PA 4J9VA 5KDLA 3KXKA 5CDFA 1N2XA 3PGJA 3SEAA 2ZYTX 3ZE2B 1TFRA 4R3WA 4C3ZA 3UTCA 3JYOA 4GWKA 4D9EA 1KIAA 5D2CA 3IDAA 3A3PA 2CFRA 4FSHA 2GVNA 1KZGB 2OVBA 1M8PA 2P62A 3HB1A 3NG1A 1NXTA 2CZGA 3EMDA 5IVIA 1F2VA 4NBNA 4DNOA 1N5KA 2VJAA 4MQMA 4PIMA 2WABA 3L4EA 4Y30A 5JJLA 1ISRA 1OWOA 4FLMA 4KGDA 3HYTA 1CIJA 1G6Q1 1PS0A 4FUTA 1LF0A 4EELA 5LN1A 4KUGA 2ZT8A 2WU1A 1P75A 3BB4A 3C3PA 4IDBA 4KQ9A 3T3GA 1RAFA 5J2UA 6Q21A 2ZBEA 3LDGA 4PSCA 3VUEA 2O23A 4DEYA 1ZZGA 3KQOA 4D3SA 3EZ9A 4Q12A 2VDOB 1TUIA 1JXOA 4Q37A 1ZOSA 3BMCB 4B44A 3GP5A 1NJ1A 2GH1A 2WFMA 1NASA 3A6DA 3L1VA 3VI4B 1BHJA 1WKBA 1TYEB 2DTDA 2XVXA 3HMKA 1UJCA 3PTLA 4JITA 3HKBA 5H81A 3ESDA 4U5XA 3TB6A 3UV7A 3EWIA 4BKUA 1NW9B 1VLVA 1U0HC 4ZZ1A 4O4LA 3V1NA 2QTNA 1C9NA 4O2RA 1AD2A 1R4ZA 1IB0A 1DZ3A 2DF8A 4HX5A 1EWYA 5DMXA 2W7TA 1K9VF 2H0QA 1C1DA 3UHAA 4D3YA 1JZQA 4IWXA 1B23P 2A59A 1WSBA 2YWFA 4LC1A 2I5PO 5MDHA 2QN2A 4DRXA 5HX7A 2WT9A 5C5CA 1L5FA 1TZ2A 3E3OA 1Z7YA 1E96A 1F5SA 2WMNB 1DJMA 4ZO9A 2PVCA 5CLJA 1R0LA 3D3QA 4ZZ2A 1Y6FA 5E2IA 1GTRA 1J07A 4DA9A 5F64A 2FUG1 3H11B 2PYDA 1GT91 4DZRA 1M72A 2VHZA 4Q47A 1C7RA 4F9EA 3K0CA 1P7VA 3UGJA 2AA3A 1USKA 1EUCB 4B3DA 5AW9A 2WM8A 1EK1A 1HE8B 5DHRA 2DLCX 2FEMA 2QJFA 1JA0A 2BM1A 4M7RA 4C20A 4DDUA 2XMRA 1OLOA 4TL7A 4Z9YA 4EKDA 3BD7A 4RVHA 5TE9A 5L45A 1HYGA 1ZIXA 2Q4DA 3GQVA 2UYCA 5J9FA 3RTCA 2L18A 2XCLA 4PRZA 4R2XA 4WXRA 4ZMBA 3BILA 2QD1A 4QULA 1XIVA 4IKEA 2REBA 4JL5A 5BW8A 1Z28A 3BVPA 4XJTA 2NIPA 3KKOA 1TL7C 5DRYA 1PD0A 5EPEA 2D3WA 2GWHA 1QVAA 1FRQA 2C7BA 1DMRA 2FMFA 2QT1A 2XGSA 1UKVY 2YWDA 3GUCA 3I92A 3MSCA 4J2TA 4ISBA 4F38A 4UTPA 3L4BC 1ONBA 1QV9A 3O4GA 1Z88A 4I2NA 4TLCA 2FUNB 3ZWYA 4AQ7A 1KI2A 1ZJZA 3MWDB 1B6SA 1Y5IA 3E03A 1LPOA 2PUBA 5AMXA 4LYHA 5FI0B 4EA6A 1O89A 2BTOA 5JISA 1LZKA 4WGFA 3SMVA 4TMFA 4LYGA 4FBLA 3IIEA 2ZANA 3EZNA 3I2IA 3KUCA 5E1DA 3IMCA 4OP2A 4X1OA 5AJHA 2I9KA 4OU4A 3KG2A 2XHZA 1H4TA 4MO2A 4X7BA 2AXQA 4ZAZA 3SOPA 1X1TA 4S1PA 5DBIA 3T54A 1MAAA 3CLTD 2QRNA 3TEJA 1RHRA 3OZSA 4DT1B 3QGMA 2GZSA 2YV1A 2ZIVB 2V6IA 2GTPA 1XDGA 5F76A 4YR7A 1F8GA 1YK1A 2AOTB 3UNXA 4HX9A 2JGNA 4RVNA 1U2GC 2VI5A 5EIBC 3O8CA 2WIAA 3CLKA 5AR1A 1GRQA 2PD4A 2QM0A 1ENOA 3CYFA 3OQ6A 4QXQA 2Q8QA 5JMOA 5BNFA 2GZHA 2QF7A 4NFLA 1UF9A 1NQWA 4O2BF 1LTKA 1JJAA 2C8JA 4WK6A 1TF7A 1I80A 3ABIA 1SQ0A 3M1LA 4BNXA 4BKQA 1TK2A 2O8EA 2O5VA 2OWEA 5FO1A 3SBXA 2JZNA 3MS2A 3DDSA 4F2WA 3TEFA 1UM8A 3L40A 2V59A 5BWNA 2Z8YA 4WPGA 4DCUA 1IY8A 2W9XA 2JFGA 4FDTA 2EP7A 3R44A 1TMOA 4C6HA 2H00A 3G1UA 2FSUA 2B34A 2GHIA 2C3UA 2V3WA 2Z95A 3IHTA 4MV0A 4F8EA 3U9TA 4PAQA 1W0KA 3GO4A 3HN7A 1WTAA 1L3IA 1YR3A 5DM2A 3I61A 3SVZA 2PUEA 5BPFA 3FHCB 5JCXA 2EERA 2PSHA 4H4EA 1ECGA 3BJEA 3IO5A 1SUBA 5JH7A 1WE2A 1AMUA 3ZYZA 1KZ7B 2HIAA 3ABRB 2P2NA 1WZEA 4CKBA 2Q3DA 5FTMA 4DG8A 2FPGB 5HP4A 2BKXA 4L15A 5DCWA 1F12A 3BG5A 3UJNA 2DULA 4W6ZA 1NJ8A 3QTTA 1OZAA 5K8CA 4NYMR 1DG9A 4G4SO 3MVEA 1I5EA 3P2JA 1HL3A 4BP3A 5HSGA 5IC6A 3LYUA 3N2KA 3VR4A 4AP5A 2Z3WA 1TJPB 3GHHA 3WGJA 3DC2A 4XKJA 1AT1A 5JQGB 3EZ7A 2ECFA 1H8EA 2FDRA 3BD8A 4FUQA 4XIYA 4RUKA 3PXBA 2C9ZA 2N1MA 4BEBA 2E4UA 4PVCA 3HO1A 1K06A 2W4IA 3DA8A 2FLKA 4B85A 2VO1A 3FWPA 1T1JA 4HDSB 4KL8S 2W6ZA 5K3CA 3TOSA 3GRZA 2TS1A 4CR7A 3CIOA 5BMVF 3MJHA 1VKRA 1LDNA 1K7XB 1FFGA 3N74A 4Q3OA 4ARAA 8GPBA 1OLSB 4R2IA 1U7HA 2FK8A 1C30B 1XZ8A 1W48A 1FA9A 3RABA 2QRMA 2BTQB 5I9MA 2HU2A 1VKJA 4X8MA 1JGTA 2GD1O 1N25A 3EG5A 3MS4A 4FX5A 3RV3A 2PXAA 4XCXA 4YDQA 2EWWA 3FIJA 4O0MA 4POAA 4CKEB 3U4QB 3T0IA 4NLLA 4OG2A 4GVXA 2EX0A 4GXQA 4DARA 2ZAOA 4TLDA 4DN6A 3SE0A 4F7DA 3RC2A 4U00A 5A02A 4DCOA 5HNKA 3RAEC 4KTVE 2BZ0A 3ZWKA 1II0A 1ZLYA 1V7ZA 1Z26A 1RC0A 2JKYA 1Z13A 1IOLA 1OXUA 3BMXA 1BEUB 2OPHA 5IKPA 3MG9A 5B4UA 4ARZB 3F5FA 5AVWA 2OB2A 1PGJA 3MMNA 2BFEB 2YXNA 3USES 3TW0A 2ZBPA 2DLDA 1MAVA 2Z09A 1XZDA 4LOHA 4N5HX 4BKPA 1GGEA 2AXEA 1NW8A 1ECJA 4KUEA 2HK8A 3HVUA 4BIMA 3CRRA 2RFLA 3CZPA 3OM0A 4S1OA 3E84A 1XFAA 4O1IA 3SC3A 5CFRA 5LP6B 3U3XA 2XCRB 1O5IA 2GM4A 5KWJA 2EKLA 3RF6A 4OP3A 5ICGA 5D7NA 4NX2A 3V4PB 4HS9A 1Z0UA 3DCJA 2A8YA 5KMGA 2KJQA 2J87A 4YRQA 3V4SA 2R0QC 4J6FA 1BMTA 2GKGA 1D9XA 2W8BA 4LKRA 4N5DA 5A4MS 1KA9H 2QUZA 1X0VA 1ZWLA 2QS9A 3VX4A 4BUZA 1GCAA 1HSOA 1LPMA 2C94A 2PPVA 1SFRA 2O4UX 1T2CA 1UJ5A 3FYUC 2BMWA 4BU0A 5KSWB 3ZOKA 1DRVA 4NMMA 2J30A 1ZK0A 1SUIA 3ORYA 4LBZA 5EE3A 1YZTA 3M83A 1T2VA 3B38A 4XX0A 5FCDA 3MK31 3D1VA 4N65A 3KZOA 4BFLA 2JCGA 3EAQA 3UT5A 3F2VA 3ISJA 1U3UA 2Q1UA 3O9VA 3QPUA 1PE0A 2A1UA 4V0KA 5CCBA 4YRMA 3L0YA 1QP0A 4ND4A 1V37A 2QYOA 5KREA 3W9BA 2A9KA 1BXRA 1E0DA 3GAAA 1M8GA 5CVEA 3DMRA 4O5AA 4LRWA 5IANA 4XUEA 3C6QA 2RI0A 4PYNA 1WXIA 4S12A 1RRKA 4CI9A 4KVFA 1VTKA 1U9IA 3V2IA 2DVMA 3FSRA 1OWPA 2AFVA 2GCEA 4ETWA 3JARA 5CXQA 2HPHA 5JAPA 1CJUC 5U1PA 1NVXQ 2QMEA 3C3CA 3PFCA 3DF7A 1KE2A 3VTZA 1T0JB 1RBQA 3LSYA 4BATA 3A9SA 1RU3A 2PZBA 5D5PA 3JYNA 2R87A 3N59A 1YDMA 3A7DA 3E0XA 4DCSA 2IDKA 3CZ5A 4KBYA 4NDZA 1GG5A 5KQGA 1PT5A 3LLMA 1YOVB 2B78A 3CKKA 4ZCQA 3OLCX 3QWHA 4MUJA 1QE0A 3DE7X 2Q1TA 1P7WA 3ITNA 4H1HA 4EW1A 2NO5A 2Q45A 2DTXA 1Z2AA 4MB6A 4UAUA 4Y0AA 5JAMA 1VQ1A 1ZR2A 1MV8A 1D1SA 3BXOA 1C3EA 2XB9A 5B5SA 4E12A 1BOOA 1SZPA 2H2DA 1PZEA 4IGEA 4B0OA 1YIOA 4BVGA 3L8GA 1YBHA 1Z17A 3A6HA 3OKCA 4MTCA 1QPBA 5F52A 5LC1A 3T8YA 1XELA 4PC3A 3TBKA 1DX4A 1XG5A 3AG6A 3ANYB 3ZX5A 1QHHA 5IT9A 3WWEA 4UHCA 1POXA 1E79D 2R7KA 3G8CA 2RHOA 4ITVA 2AVNA 4E11A 1WU7A 3DBHB 3EJWA 3VU3A 4ZCRA 1BX3A 1RVDA 4Q4CA 1Q3KA 1S3FA 4HTFA 4WL0A 4UXIA 3VNQA 2NUPB 1IHPA 4M1WA 2P2CA 2ZWVA 3ENKA 2O7VA 4NZMA 4WD3A 5TNXA 4B43A 4P93A 3TZHA 2YFKA 1OXBB 2XCQA 1P5FA 3G13A 4WESB 1BJKA 2O2XA 4CIYA 5B6PA 1GQYA 1A7AA 4N01A 5J4KA 5K45A 4IO1A 1UBMS 1QJ4A 1YJXA 3LCVB 1MC8A 1KDPA 2FSFA 1MXFA 2QRVB 3CLRD 3FVRA 3MC1A 3WLLA 1ORWA 3E5NA 4X60A 1ENYA 1ODCA 1E99A 3D4LA 4MQEB 3SEQA 1ZD8A 1KKUA 3DVRX 4GS5A 4NPAA 3ZW9A 4GX2A 1L7NA 2ZRDA 2QT0A 3DVLA 4IEIA 1I1QB 2Q2NA 4MH0R 3TOXA 5B57C 3CHYA 4QPJC 1CLUA 4PSUA 1YGPA 5AK6A 3WBJA 2P9JA 1FNNA 4OHCA 2VDPB 4RX1A 4YJFB 4MRPA 2AG0A 3Q72A 1HFJA 4AKGA 3KHSA 1BCSA 2IQIA 3KPJA 1XEAA 1ZMXA 1QO7A 3QTBA 4IW3B 2Y93A 4C7OB 1QTIA 5HHTA 1D6SA 3RKRA 2ZXFA 5L7YA 5JS6A 1LZLA 3KJHA 3JVVA 2IYRA 4JUDX 5JQGF 2NVWA 1P7CA 2EZ9A 2YC4C 1XJCA 4D9NA 3T4PA 3IIJA 2A6PA 1F3OA 3G1WA 4JK3A 3TSOA 3L3BA 1SC9A 1X7GA 4NHOA 3ZCVA 1RWQA 3NBQA 3LUBA 4EGJA 2PLAA 3L4SO 3KK0A 4CRWB 4E5PA 1P17A 1U5AA 4K9SA 3IUNA 3RT1A 2CLKB 1N2CA 3LYAA 3AW9A 5C5DA 4DDMA 4ZOCA 4RF5A 1LLUA 1XL1A 4FMPA 4ESVA 4E5KA 1N1EA 4HBGA 3T6KA 5GGYA 2YTZA 2NTEA 5I7WA 1UADA 4EFKA 5BOSA 4DV5B 2D2XA 1ZY2A 3DFUA 4ZAYA 1TEVA 2DPLA 2QEQA 2C4NA 2JFQA 3MBIA 4HAYA 4JDUA 5FO0A 1PT9A 2GBLC 3OX1A 3N2LA 1VMEA 3WDKA 4UM9B 2GAAA 2HQBA 2XWQA 1Z38A 3BMNB 1NBMA 5JVDF 1TD1A 5GTDA 5A4IS 1PS9A 3DDCA 3HYLA 1CQPA 1PZMA 3MEQA 4N12A 1HFEL 4I5FA 5CK5A 4R9NA 3F2IA 1AQJA 3IUJA 3MT8A 4EI7A 1E1QD 1KU0A 2DHEA 4J0KA 4ZAFA 5HRAA 1AXGA 3E48A 3BWYA 3WKEA 2ZB8A 1MJNA 3QX9A 3U31A 1KEZA 3IT0A 1LQ2A 5KPDA 2VF2A 2ZBDA 1KOLA 2X4GA 1L7RA 1Y3IA 4Y18A