1A4RA

G12v mutant of human placental cdc42 gtpase in the gdp form
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
190
structure length
190
Chain Sequence
MQTIKCVVVGDVAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nucleotide binding to the G12V-mutant of Cdc42 investigated by X-ray diffraction and fluorescence spectroscopy: two different nucleotide states in one crystal.
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords G25K GTP-BINDING PROTEIN
total genus 62
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1a4rA00
1G64A 5DI9A 2XNDD 2VO1A 1HA3A 3BGWA 4OL0A 2QP3A 4TYPA 3WNBA 5J4LA 3AVYA 5IK2A 1NMZA 1YRAA 2AL7A 2F43B 3SJZA 1HURA 1DPFA 1VG0B 4M1SA 4YC7A 4V0MA 4JLKA 1II8A 1KI4A 1KNXA 3IHWA 4RZ3A 3U3MA 4XSGA 1E2DA 2ODEA 3ZD7A 3ZQJA 3EZ9A 1W4CA 1DAGA 4I99A 1XD2A 2DFKB 3QG5A 1Q44A 4LCBA 4LJ8A 3QI2A 4LOAA 1IN5A 4I1SA 3H1TA 4HZIA 2G3YA 4HB4A 2FEOA 5B58C 1IXSB 1Z83A 4C2UA 4UNNA 2HDNB 2RGBA 4G01B 3U4QA 2JLZA 2XNDA 4HYYA 1G3RA 3AM1A 1N5JA 3GP8A 3VNUA 3ZLJA 3CRRA 2QGNA 4CEJA 1ANKA 2KWIA 1GNRA 1GRQA 1PV4A 2VP2A 2CVFA 3KQUA 2D7DA 2B8WA 1U0HC 4OK5A 3GLHE 1EFHA 1T6NA 4URXR 4FMCB 3QSYA 3K09C 3GMTA 4V0KA 1YR6A 3VMFA 3VKGA 2BM1A 2GF9A 1II0A 1RE0A 5UKDA 4NTZA 1U0JA 3JVUA 4OQFA 1XCGB 5SZIA 2QAGC 3RWOA 1AKEA 4DIEA 3M4YA 1JEEA 4QGAA 4IEEA 1S1MA 4JKIA 5EZ5A 4UNQA 5CIQA 2VP5A 1E2QA 3NEYA 4WOPA 2FDCA 1QRAA 1G3QA 4A0HA 1COWD 4DC9A 2AFHE 4ZKEA 4QHTA 2RGNC 1CS4C 2GF0A 4JT4A 2OSBA 4HDQB 3F0TA 4NYJQ 4FN5A 3HPQA 2VHJA 1X8JA 2JA1A 3U7GA 1YZUA 1CIPA 3FPAA 1XPRA 3B9PA 1S3GA 2FFHA 2V55B 1ZYUA 1W5TA 721PA 1WP9A 4EQ6A 1SZPA 3BH0A 3FB4A 3PENA 3AP3A 1NLYA 1NBMA 2EU8A 1TUIA 1Z22A 1T3LA 4MRPA 1GL7A 3B82A 2D4HA 1WMSA 2V6IA 4DCVA 4I1OA 3X1ZA 1MOZA 4PQFA 5CLLA 1E9DA 4QHSA 4NCHA 3KKMA 5F98A 2PT7A 3AVTA 3AP2A 4WIAA 3RLFA 3ZZTA 1N0UA 2P6UA 3X1YA 2A78A 4HAVA 3IDQA 4P32A 4JS0A 1G7RA 2A2ZA 2R62A 1U81A 2BC9A 2WJJA 4QOSA 1C1YA 1CJVC 2FSGA 2ZI9A 3VX4A 3FFBA 3WYAA 5C18A 1UAAA 2J7KA 4MRSA 5JHHB 2IYLD 3IIJA 2B7BA 3OFND 5DNYB 1N6KA 1FNMA 2FG5A 1K6MA 2J0VA 1KO8A 1H8EA 5DHFA 4TTPA 2AX4A 4TL7A 3I73A 4YXWD 5KOYA 1MRNA 2R6FA 1KI9A 1ZCBA 2IYUA 3A1WA 3M0EA 2PLFA 4QJ4A 4EAQA 2IS2A 5AUNB 1VCNA 4JKYA 2CXXA 2IYXA 1YR7A 1GKIA 4AI6A 2NIPA 1G3MA 2AN9A 3FKSA 4GFDA 3HPRA 4TL6A 1XCPA 2X8AA 5FPYA 3IPYA 4B3CA 4ZDJA 3U4QB 3PUYA 1T0JB 1NRJB 1VYUA 3VR1A 2CL7X 1GSIA 1QBKC 2E9SA 2IYZA 3VU9B 4BGDA 2RGNA 3LQRA 5LBIA 4OKSA 1VCMA 5FOSA 1XTRA 2OCYC 3LY5A 2QP4A 2VTKA 2JIZA 4CW7A 3CH4B 5KNDA 1X1SA 3CWZA 4E22A 3L0OA 2DBYA 4E03A 1IAQA 2IS4A 4GSYA 1P2UA 4Q9JA 3CF6R 3TSOA 1ZD1A 1ZM7A 2PCLA 1PJRA 3FFAA 1E2FA 2QAGA 2FNAA 4E5UA 3OE7A 5FTLA 1V43A 2F1JA 1KNQA 1ZC4A 3CO5A 1G5PA 4L16A 4P4TA 4QC2A 2BVNA 4EPVA 5FBVB 1JALA 2Q3HA 2XNSA 2C9CA 1U94A 4TSFA 4TZ0A 3QF4B 3T5DA 2A5YB 4GP6A 2QTFA 5EUMA 3KKPA 2BJVA 1E2LA 4YQFA 5FOVA 4IXNA 4RD6A 3ND9A 1HQCA 3ZGXA 3THXB 1UKZA 3MG9A 3TNFA 1EX6A 3E70C 3ZZUA 1R2QA 3NXSA 4JLOA 5LB4A 1E0JA 3UWOA 3MCAA 4LBZA 1OFIA 4WXPA 5DHAA 1COWA 2VQSA 3CF0A 3NBFA 3N2IA 3WY9A 3W8RA 4ILEA 2ZS8A 2WMOB 4JYCA 2C77A 3CRW1 3O8CA 2JJ1D 2QRZA 4KODA 2FPMA 1UFQA 2H5EA 3AKCA 3C16C 3BBPA 2ZANA 3QPWA 4ZPXA 5D3QA 1R5NA 2WMNB 1NBME 2C78A 5FTJA 3E1SA 1UBCA 3C41J 1KI6B 4OHXA 1QHYA 3A4LA 3NHAA 4CT5A 1RW4A 3RS0A 4Q4AB 1NMXA 2Z0MA 1JR3E 4KLNA 3PEYA 1JECA 2CHGA 2H16A 4NONA 1Z0AA 4DLTA 1E1QD 3K9LA 4BQSA 4KVGA 1RC8A 1DG3A 1FMLA 1UM8A 2WKQA 1S4QA 2ASEA 3TKLA 2E87A 1KSJA 4BZXA 2H1LA 3CBQA 3KUCA 3KZ1E 2HCJB 5GADl 3X2SA 5EXPA 3AGPA 5BYJA 5FBQB 1J90A 3WYFA 4IHQA 4Q1DA 3AGQA 3KKQA 4PZLA 3R9WA 4B6EA 2GBLC 5JFGA 1OV4A 3R9XA 3IGFA 4NL4H 4F4CA 4Q00A 3U44B 1E9CA 3UIEA 1ZC3A 2D3WA 4OHYA 5D3MA 1W5SA 2GWHA 3KJIA 4TTQA 3LA6A 1N6NA 1B0UA 2EFDB 3CPEA 4EPWA 2IEYA 1TF5A 1G5TA 2OFXA 2PL3A 1M2OB 2GA8A 4TMWA 5CITA 5JRZA 1G6OA 2QEQA 4D25A 4HAYA 1XXHA 2CK3D 3K0SA 4PC1A 4F7WA 3MLEA 3Q85A 1JAHA 4D81A 1RJ9B 3SDZA 3KQKA 4AG6A 4C4PA 4OI4A 1KMQA 4N0EA 3T1OA 3AP1A 5FPKA 2CL6X 4CYMA 6Q21A 1P61B 3NC1C 3U60B 3ADDA 1TX4B 2IA5A 4LY6A 5SZKB 1TEVA 1IQPA 4CEHB 3CZQA 4LHYA 2IS1A 2EFCB 1XD2B 2D2FA 1G3UA 2XEXA 1AZSC 1OYWA 5BN5A 1XX6A 3UATA 2VF8A 4Q7KA 3FMPB 3VKHA 4CVNA 2W0MA 421PA 5AJWA 3FGNA 3WHLA 2CLSA 3ZH9B 2ZYUX 3B13B 1LS1A 4I1UA 1OIVA 1Z0KA 1R5OA 1VYTA 2IK8A 1ZUHA 2NO9A 1FP7A 3MGCA 2MSDB 2CBZA 4JLDA 4CRWB 4HUQA 2GILA 1XMVA 3LAWA 4WW0A 3ZQ6A 4DDWA 1DOAA 2OBNA 4KAXA 4XTRA 1GKUB 4WA7A 3OEEA 4B6FA 4EPXA 5HKKD 1XMJA 1F5NA 1ZAKA 1QF9A 3OEED 2YWHA 1YRBA 1Q1ZA 1K5GA 1Z29A 3IBYA 2J0UA 3OEHA 1OB2A 4B43A 2C03A 4LWZA 2YC4C 3LDAA 4JJKA 1Z0FA 2CE2X 1IONA 3ZIAD 3EXAA 4DXAA 2RB4A 3LO5A 4YMSA 3OIYA 5CM9C 1MABB 1Z6GA 4TQ9A 3AVXA 1EGAA 4L4UA 4Q7MB 1E69A 1E9EA 1CTQA 1IJFA 1OIXA 4TLEA 4Q1EA 4ASUA 2CDNA 2JJ1A 1HTWA 1GOTA 1J8YF 1SVLA 3NDBB 4TYNA 1KSGA 4G5OA 4JIMA 4QKQA 2CVHA 5FPHA 2QBYB 2ZJ5A 3DL0A 2ZROA 4PTLA 1JJVA 2W6JD 1NVXQ 2CNWA 4G1UC 4PZYA 5FI0B 4D6PA 4EUNA 4QBFA 3ICQB 1US8B 2WIBA 3L82B 4ZDKA 2BMFA 4LV6A 4M4SA 3GQBA 3GFTA 1BYUA 1FQJA 3LX5A 3U3RA 1KMHB 1NVVQ 1E3MA 3U44A 4MKIA 4R2IA 3X1DA 3X1WA 5JJIA 2OEPA 2WAXA 2YWEA 4RD1A 1G21E 2FE4A 5K8LA 1N6IA 3I32A 1P6XA 5HCIA 3TLXA 2J45A 3EZ7A 1IY0A 1RPZA 3F8TA 1EFCA 2GBLA 1HE8B 2GJAA 1OIWA 4JBWA 4B3FX 2ZSEA 4OI0A 3OZXA 2CHVA 1J99A 1MRSA 1XJ0A 3OESA 2YHSA 3B8HA 1VKJA 5LB2A 4BUJA 1XCMA 3AF2A 4D0LB 1VHLA 4UNSA 1ELOA 4C0AC 2V6JA 4KO8A 2X19A 2Z4SA 3QF4A 5HKKA 2Z6VA 5FR2A 3ZJYA 2BV3A 1I4TD 3BWDD 2CE7A 2OCAA 3EWSA 3WMFA 1NIPA 3OHMA 3FMFA 3RC3A 5DIFA 2QAJA 2ZSFA 4HAWA 3TAUA 5IDVA 4MYHA 5G41A 3WNDA 2EFGA 3RC8A 3KQHA 2TMKA 2XOKD 3TUZC 1ZM4A 3FDIA 4PPQA 1VMAA 3WRXC 5EXTA 1MV5A 4DCSA 1FTSA 3UXMA 3NHBA 3UKDA 2PT5A 2RGEA 2I4IA 4BWYA 2IUSA 1KO7A 5CYOA 4DSTA 2H18A 3OAAD 2QTVB 3E5HA 1ZU4A 1J7KA 1TADA 1GKYA 4CF7A 5L3QB 2JJ2A 2QNRA 3MMPA 2QG6A 2HYDA 3K0FB 4HDOB 4B71A 4OI1A 3U7EB 1CR2A 3BK7A 2IUTA 1BYIA 3H84A 1M1YE 3QBTA 3VNVA 2JATA 5J47A 4BFYA 2ZE6A 1ZU5A 1FNNA 2XJ4A 4Z8YA 4ZIRA 1NG1A 4ZCMA 1H8HD 2QAGB 2WJVA 2Y8EA 4PANA 4DEYA 1D2NA 2XXAA 5FTMA 5KDDA 1AM4D 1NNEA 3D8BA 2GCNA 2ZRDA 2ZI5A 1HH4A 3PXGA 1UBFA 2W2VA 3ZVNA 2QE7D 4CDGA 3IIKA 2B6HA 4AKGA 2RGAA 2IT1A 1ZNZA 3B1VA 4LK2A 4BPBA 1QZXA 1SXJC 3ICEA 2QBYA 3UMRA 2ZRHA 3GLIE 1UKYA 1VPLA 2AD5A 2IYQA 4NYMR 5JEDA 1UKEA 5JI3E 1CP2A 1E98A 1KAOA 2O5VA 4LHVA 1LVGA 4EQ6B 4NMMA 3KQNA 3SHWA 1U8AA 1YVDA 5J4HA 2ZR9A 4Q4JB 1GG2A 2UZ3A 3GJ8A 4MYTA 1HEIA 5K8IA 2KBEA 2GHIA 3CWQA 3FHTA 3A8TA 1G18A 2CL0X 4JJZA 4CEJB 4ZDIA 2ZM5A 3Q7PA 3TRFA 3B2EA 1OH6A 4JVNA 5HTKA 5GJCA 3PQCA 1QHGA 2BCJQ 1G17A 1RJ9A 5FPSA 2D62A 4PZZA 1KI6A 4R71A 3HU2A 1NJFA 3AKYA 3CZPA 2XZPA 4D80A 3LLMA 4B3DA 1SKQA 4FXPA 1JJ7A 2GJSA 4AC9A 1Z6AA 2C8VA 4TN1A 4B32A 2YC2C 4G5SA 5K8TA 1KDRA 3I1FA 4LYFA 1ZM2A 3P20A 4TSFD 1GZSA 3NBZC 2GZHA 3A4NA 2WSMA 3FMIA 3ND8A 4MDEA 3CIOA 3IQXA 1OH7A 4URVR 2QY9A 2UZIR 5FUYA 4JVSB 1DAIA 1E1RA 3WBKA 1WE2A 1E9SA 5HE9A 3REFA 2JJ8A 1VIYA 1SULA 3A36A 2PJRA 1JI0A 4HLUC 2D7CA 4JL5A 2J59A 1Q22A 1DE0A 1RFLA 1T0HB 1U98A 2RCNA 3GJ4A 5EE9A 5JRJA 4NE2A 4TZ6A 2RH5A 1KY3A 4DDTA 2DWOA 2GAOA 2FJUA 2PMKA 2YKGA 2QL6A 4URUR 3QY0A 4DVGA 1F2TB 1Q3HA 4IKEA 3SN6A 1P9WA 2IF2A 4M1WA 4Q5IA 1KSFX 4O2LA 1Z0JA 1F48A 1NL3A 1XP8A 1W48A 1J70A 2G0TA 3CNNA 4PC6A 3TIFA 2G1JA 4MGYR 1E2MA 1CRPA 1XTJA 3K9GA 1Z2CA 3CUEF 3R8FA 2DYKA 3TVTA 3H4MA 2J46A 2FU5C 3SC3A 2PEYA 5C2JB 2VSXA 2VA8A 1AGPA 1XXHE 2X2FA 2GZDA 1KJWA 1XEWX 1TPZA 4CEHA 1M7BA 2C9OA 2HF8A 3BIFA 3Q3JB 1CJUC 4FCVA 2XZOA 3C5CA 2AKAB 3C7KA 2FX3A 2RGGA 4MQBA 2QI9C 2O0JA 3EIQA 2NOAA 2IF0A 5CB6A 4IJMA 3AEZA 2O8DB 2WWHA 4RY2A 5A5GA 3LFUA 2ZRLA 2DFTA 3QXCA 2O8BA 4D4KA 2GK7A 2IYWA 2WJHA 1IN6A 1BH2A 4MUBA 4OJQA 4JBXA 3GJ5A 1OHHD 3KTAB 2RGXA 4KSBA 1UPTA 4HATA 3P4XA 3RVBA 4CT4B 2ODNA 3CRQA 3OEHD 3TE6A 1ZINA 1XB2A 2VIIA 3ZDQA 1G6HA 4MGZR 3ZVRA 4DLXA 3TGPA 4DCTA 4BLQA 2OV2A 2YWGA 3THWB 4OQNA 5KHOC 2PBRA 3A1VA 1DO2A 2WJGA 3LW8A 3R9IA 2B21A 3PG5A 1OH5A 1G5RA 3C14C 4IDOA 4G3XA 3O8RA 4DLYA 4D26A 2IL1A 2ZVPX 4Q9KA 1ZIOA 1XF9A 4MDFA 3LWNA 3P1JA 3K0AA 3SR0A 1N5LA 2N46A 3THOA 1F3OA 3GLHA 4FMBB 5AJXA 3VHXA 1XNJA 1OYYA 3B1YA 3MFYA 2FSFA 2OO7A 1M6NA 2PZGA 3MWJA 3BJIC 3U7HB 1OB5A 1WQ1R 4GZLA 4MA4A 4G5GA 521PA 2VH5R 4RD2A 2IWHA 4ZO4A 3SU8A 4W7SA 2C04A 1P2VA 2WJYA 4QGHA 3U6KA 2GEDA 1YZQA 1D8TA 4M1OA 3EPJA 1Z6TA 3PFIA 3TW4A 2CCJA 3GEHA 2QPOA 5GVSA 2YWFA 1M8PA 5CJPA 1HQYE 1MH1A 3GJ3A 5FL7A 2O8DA 4KXFB 2XB4A 1SVOA 2GNOA 1FQKA 1R0WA 4HAZA 3NDPA 3PVSA 1E79D 2G88A 2IHBA 1E9BA 2ZRGA 5BWMA 1YU9A 2NZJA 4RZUA 3RRYA 3I5YA 3DHWC 3QE0A 2IX3A 4KBGA 3KXLA 4ZV4A 3TVDA 4ACAA 2O8EA 1P73A 5J4YA 5HZHA 3NWJA 2HCBA 3K70D 2P6RA 5TY0A 2IW3A 4XH9B 4JVLA 2RMKA 2BOVA 2IYSA 3FTQA 3PIRA 5JI2E 2XSZA 3K0AB 1E4VA 2G6BA 1F6BA 2GJ9A 2O0KA 2PJZA 3PR1A 1OPXA 3Q5DA 5EP2A 4DBLC 3NH9A 3C8UA 4P3YA 1OKKD 2DHRA 1QVRA 1G8HA 1T3SA 3K70C 2O8FB 3T34A 1S0UA 4U7DA 1N2CE 4ERNA 1WA5A 4G5RA 5J40A 2ZAMA 4PPGA 1OW3B 2NTYC 4FCWA 5DISB 2QMHA 1Z06A 2ANCA 2HT6A 4LHWA 4PHTA 5EP3A 4I81A 3I61A 1UF9A 2H8KA 5DI3A 5FOUA 2V1UA 3F3YA 1E1QA 3RS4A 3IHLA 5E7MA 2ZUCA 3LD9A 2VP9A 4DSOA 1ZM3A 3MJHA 2BHRA 5A0FA 1RRFA 5G40A 2QPTA 3DPUA 4RKEA 3PUVA 3LXRA 5KTYA 1Z0IA 3QKSA 4Y0AA 2ZITA 2C99A 1E94E 2ZE5A 1CU1A 221PA 4ZCLA 3R7WA 5C1BA 2BDTA 2Q9AA 4M1YA 1VIAA 3KFVA 4PC3A 3KTAA 4Q9HA 4YMUA 5FFMA 3T5GA 2QZ4A 3V00A 5JBQA 2J0QA 1I2DA 2G83A 1L4YA 1R7RA 1KO5A 1LV7A 1QG2A 1XMSA 2JDIA 2OCBA 1SXJA 2ZU0C 4FW9A 3DO6A 3QPUA 3K0CA 4TQAA 3THWA 2C96A 5JWHA 1TU4A 4E09A 4M8NE 4FWTA 2ZYVX 2QROA 1OLOA 4FMDB 5B2ZA 2PZFA 3ONWA 1Q57A 4EJSA 3A37A 3D6TB 3I3SR 1X1RA 2F43A 4JLNA 4V0ME 5L3RA 4KHZA 3LLUA 4S2EA 1II8B 4HAUA 4TL8A 3CONA 1AK2A 1M34E 2NQ2C 4DCNA 3U3OA 1DTSA 2IWRA 3GLHB 2GVDC 5FBRB 3W8NA 4P0TA 1KKMA 1SQ5A 2ZETA 3RDPA 1G7CA 3WBJA 4Q4HB 4FMDF 3TR5A 2ERXA 3VFDA 2CHQA 2JAQA 4JLBA 4A2PA 3UPUA 1T3HA 3CPJB 3AF0A 2WKPA 4DKXA 1QDEA 5KDLA 1L8QA 4Q1AA 2GEVA 3GLGA 2F1IA 3O47A 3L43A 2JLYA 3A1SA 4LYAA 1BMFD 4HZUB 3UG6A 1DAFA 2XOKA 4UXJA 2HLDD 4LYJA 2VBCA 5CDFA 1W47A 1I4LD 4LUCA 5LDDC 4AYWA 2XITA 2HYIC 1W49A 2IYRA 5JLJA 1FFHA 3TUIC 1C4OA 5DSZA 3BH7A 2GETA 2ZQ5A 5P21A 1VCOA 1H8ED 5EZ6B 2P2LA 5DE3A 2ZSDA 4PAOA 4RVCA 2NPFA 3AVVA 2OILA 1CLUA 1FUUA 2DFNA 5CYPA 2O8EB 1N5KA 1W2HA 1M7HA 2GEUA 3Q8XB 2R6AA 4KI0A 4ESVA 4C7OA 4GOJA 2HJVA 5KNCA 2O8CA 2OXCA 1N6LA 1UBGA 4TMKA 4IFEA 3T1VA 1ZP6A 3OIUA 4A9AA 4GRAA 3AV0B 4L9SA 4K81B 4N3NA 4KYUA 3RYTC 3KXIA 2Q21A 3VX3A 1BKDR 3KX2A 3Q72A 1MO6A 1W0JA 2O8FA 4UJ5A 4BFTA 4JL8A 4X8LA 4KCGA 3B6EA 3KXKA 4PQYA 3RANA 3ZIAA 4V02A 1SVSA 2AXNA 2W2TA 4YXWA 4Q02A 3B1WA 3CRVA 5KNBA 2VF7A 4Q48A 4LBVA 4OQXA 5DI3B 5FOXA 2OBLA 3K0EA 4NPHA 1S1CA 1GUAA 3U2QA 4HZUA 2OZEA 4EFMA 4AKHA 4TT3D 3CKLA 2GK6A 4TT3A 4Q21A 1XBTA 1GIAA 5B64A 2GKSA 3IEUA 4IOMA 3QUSA 4CEIB 3TJZA 5AJZA 2Z83A 1JXOA 4H1VA 4HUTA 1U8ZA 3FE2A 4Z54A 1NSTA 1W7AA 2VSFA 3R7WB 1DARA 4J0QA 5EXXA 1ZW6A 2JGNA 2JLRA 3LRPA 4PO8A 5G3YA 4B34A 1Z28A 5JSZB 2BCGY 1NKSA 1YZKA 1VG1A 2ZI6A 5EP4A 5E4FA 2GCOA 3OE7D 2A9KA 4RZXA 2Q6TA 2FN4A 4NZYA 1FTNA 2J9RA 3NG1A 3REGA 3S1AB 4BE7B 1W36C 4MRNA 1LNZA 4BZQA 2JLQA 4F38A 2R9VA 3QXHA 1NJGA 5GJVC 1E2JA 3AUYA 4FWIB 1Q1BA 2ORWA 5C4GB 1U8YA 3BB3A 4Z51A 4R98A 3ADBA 3TSZA 5JWRA 1EFTA 4NCIA 3UK6A 3HJNA 1CJMA 3SFVA 3FYHA 3T15A 3WRYC 3GLFA 3WYGA 3DMDA 5FUVA 1KTVA 2GRJA 2CEAA 2XSZD 4LV8B 1W4RA 5FPTA 3QEJA 3K53A 3LBHA 3TW8B 4DJTA 2H7VA 4PAMA 4YONB 1F2UB 2DWQA 5AJYA 4W5HA 1PLLA 4LPKA 1RYHA 2Q0HA 1KY2A 1OHHA 1X8KA 4Q03A 1KZ7B 4KYIB 2ZUDA 1W0KD 1Z5ZA 3AF3A 2RGDA 2FGJA 3MWLA 1P3JA 2QGZA 3I92A 4D82A 4US1R 2ONJA 1EESA 4EPTA 1SXJD 3KKNA 4HDCA 3I72A 1IY2A 5JS7A 4IDHA 1NBMD 1P72A 4U5XA 2PZEA 4XJXA 1WCV1 2WWYA 1W4BA 1UADA 2A3RA 4PAQA 4YLGA 4AYXA 4US0R 2E1RA 1LTQA 3K8YA 1G8PA 1DVRA 4N1AA 1GVNB 1WDTA 1JAIA 2HJGA 3O8DA 4OQLA 5DH9A 4XVUA 1LY1A 3FWYA 2G1KA 3JZMA 3RWMB 1XEFA 2J3EA 2C9YA 3EC1A 5CK4A 1WBDA 1T5IA 2XGJA 2ZI7A 2ZRPA 3B1ZA 4JMPA 2VHTA 1WBBA 2JLVA 1EWRA 5EUQB 4C7OB 1W0KA 1CRQA 4A0FA 4LJ5A 1NIJA 2FFAA 4QNMA 1TF7A 1AZTA 2IC5A 1ZBDA 2ZI4A 5AR1A 1W46A 2ZUBA 4L15A 3K9NA 1R0XA 4NDZA 4B73A 1G4AE 1MR3F 4KVAA 3RSOA 2XXAB 4Q18A 1FOEB 3RABA 1A1VA 1G8GA 1JQLB 2WSSA 2LCFA 1EFUA 3NVAA 1M7GA 2ZTSA 1ONBA 2YINC 1T8UA 1UEJA 5TARA 1G291 2H17A 4LJYA 3AVQA 2DB3A 1D9ZA 3EW9A 5L3VA 1U2RA 1IN7A 2R2AA 3GEIA 4LI0A 4M21A 4A6PA 1NN5A 4OJKA 2KJQA 4G5QA 4GDFA 4TMZA 3M6AA 1TTTA 4Q19A 1KO1A 1ODFA 4JYBA 3WMGA 3I62A 4LBYA 1CKEA 1ZRHA 3LVQE 4JSTA 2FEMA 3L2OB 3BE4A 4IVQA 1UBEA 5SZHB 2I1QA 2REBA 3SOPA 5KSZA 1SXJE 2OE2A 2OHFA 3U3JA 4QM6A 1JPNA 1OT3A 1LB1B 2N42A 1M74A 2OG2A 1QHXA 1TMKA 1G1MA 1W0JD 2BBWA 2OFOA 2YNMA 1NY5A 1VECA 2UKDA 2P6NA 1Z3IX 2O52A 1WRBA 3BC1A 5DYIA 2KI5A 5LD2C 5H70A 3LQQA 3THYA 1UEIA 2CK3A 5J4VA 4MKHA 3EARA 4DDVA 2ZJ8A 1RRCA 3NBYC 3KQLA 2WTUA 2QORA 1NSFA 4EJSB 1ZIPA 1MT0A 2GJKA 2GESA 5JJKA 1KDPA 1W36D 4Q4LA 1R0YA 2EWVA 4C9BA 2XTMA 1PLJA 3A1TA 2YYZA 2W00A 2NO6A 3CLVA 3U6BA 3AUXA 3G5UA 2XTZA 1GDDA 1BS1A 3EIEA 2DCUA 3GLFB 1WXQA 4AIIA 5AUOB 3VR3A 3GLGE 1R0ZA 4M9ZA 2JLSA 4URZR 1P62B 5E7JA 3AH8A 3GLGB 2HXSA 1HV8A 1G41A 4LHXA 1Z47A 3LV8A 5F2EA 3L0IB 2IUUA 3MWYW 1JR3A 4MH0R 1OFTA 2ZRKA 2G77B 3W9YA 1OKKA 3K70B 3P4YA 1A7JA 4B2LA 4PSAA 3GLIB 3PEWA 4PO1A 4DT1B 4QNRA 3NEJA 1TEXA 1V5WA 3W3ZB 1YR9A 4P33A 3W6OA 4AK9A 4DCUA 2WV9A 3U5ZB 2O0HA 3K0CC 4PHGA 3DM9B 2QM7A 1AN0A 3CF2A 4B3XA 3BB1A 2AK3A 4H9GA 4LJ6A 4NCKA 4LDJA 2P3SA 1DO0A 3EWAA 2ZRFA 4WBSA 5HZKA 2QM8A 1ZVQA 1XMIA 4S35A 2ZS9A 3KJHA 1EXMA 3DM5A 2QQ0A 3WP0A 1P2SA 2NMVA 5GJWC 2IXGA 2J7PD 1KGDA 4KFSA 3RNLA 3SQXA 1XEXA 3QQ5A 1E2PA 8OHMA 2JIZD 1KHTA 2WWXA 3ASZA 1TAGA 3IEVA 2VP4A 2OT3B 4WZ6A 2QT1A 2XB2A 4PPFA 2QUZA 4DLZA 2N1BA 1E2HA 4NU0A 5M04A 2ORIA 1G16A 1E2NA 1XJQA 3B1XA 4JBYA 4URYR 1T8TA 1YQTA 3EASA 4LJ7A 4C0KA 2OUKA 3DOEA 2J5XA 4C0LA 5IRCD 4W5WA 4DLUA 4YDSA 3T61A 4Q1FA 4A0GA 1DAMA 1D6JA 1IBRA 4B2IA 2VP0A 2OLKA 2W58A 3JVVA 2HXYA 2WVJA 4JSYA 4IDQA 4IOKA 3QNUA 4DT1A 1P60A 2I1VB 4NYJR 1E96A 3D7MA 2JASA 4KJZA 2O8BB 4C30A 1Z6YA 2ZJZA 4HAXA 1MO3A 1GNPA 3G0HA 3KL4A 4LC0A 1JBKA 5AK0A 1PUJA 3U3KA 3BS4A 3BB4A 3RAPR 3BAFA 3JZAA 3AKEA 1Q3TA 4HB0A 4XSHA 3UMFA 1N6HA 2FPKA 4BFUA 4KITB 2ZR0A 3WP1B 1AQUA 2GZAA 4QXAA 4QBIA 1GP2A 4NKRA 3HU1A 2CNWD 4PC2A 3SS8A 621PA 2OFWA 1QHHB 3I8XA 4BRWA 1E9RA 4PR0A 2YOFA 1KK2A 3RRZA 3RRMA 1FX0A 4QRHA 2RHMA 2R6GA 2QRNA 2YOGA 4A36A 1PVOA 4XD7D 1B23P 5FUWA 1CF4A 4LZZA 4A0RA 3LH5A 4OBEA 3UANA 3V4FA 2F3RA 3GJ6A 3AF4A 2ECKA 4QJ5A 4IVPA 3QKRA 4BFSA 1AQYA 2GJ8A 4RKFA 4FIDA 4D0NA 2IS6A 1HE1C 1NVWQ 1US8A 4BLSA 4MRVA 1N5IA 1E99A 3SYLA 4DLWA 1N25A 4WZAE 4D0GA 3EC2A 4HB3A 4JZKA 3R20A 4XWOA 4BLRA 3DEFA 1XZQA 2ZJAA 1BO6A 2VRWA 4UXHA 4EIWA 4Q47A 1N6RA 1NVUQ 3DVLA 3IIMA 4ZI3A 5BYKA 3U7FB 1S8FA 3NTUA 4NYMQ 4C0QC 4XIGS 1E9AA 2XAUA 2P0EA 3AB3A 3H2YA 1PUIA 2B8TA 1U90A 4W9MC 3F5FA 1F2TA 1NP6A 1TL7C 3T12A 4DUGA 4TLCA 5AUQA 3QXJA 4TTRA 1AIPA 1JQJC 1OSNA 2GCOB 1N3BA 2A7QA 4LGMA 4URWR 3L8YA 4OK6A 4Q9IA 2ZVQX 5AJVB 2J0SA 1P9RA 1D2MA 1N0VC 4DLVA 3FHOA 1KSHA 4P4SB 1U0LA 1G7SA 1KDOA 1NKTA 1NMYA 2BMEA 3KJEA 5JWOA 4DSUA 2EVWX 3AVUA 4PHHA 2KBFA 1LF5A 1Q1QA 3LXXA 4Q4HA 1XDBA 3PITA 2QENA 4R9UC 1KJZA 4BLTA 5FTKA 3L0SA 5EQTA 3EPKA 3QENA 4LPSA 5EE0A 5JCZA 3U61B 1R5BA 2D74A 2GXQA 4R2HA 3UWKA 4BFVA 3GLFE 5H8WA 2BEJA 4WZBE 1AS0A 1JEDA 1LF0A 1RYFA 3NIBA 2ZI3A 2G9NA 4GOXA 4AG5A 2DR3A 3BERA 1IHUA 4A8JB 1Z8FA 4DHEA 5KUTA 4M1KA 3IQWA 5EJEA 2V7QA 4DIDA 1JR6A 4NYIQ 1ZNWA 5L3QA 2PCJA 4AYTA 4XTCS 4B47A 1W44A 3QBVA 2QPAA 4WXRA 2DPXA 3SJCA 2DFLA 3K0FA 1VDZA 4KSCA 3PUXA 1IM2A 3N2EA 4PHFA 4QJ3A 1XPUA 2F9MA 2F9LA 1X86B 4IDPA 2WSSD 2HUPA 3OIWA 4M2LA 5E95A 2ZIAA 4M0LA 1EWQA 5L3SB 2WIAA 3B5JA 1N6OA 3CRMA 4DUGD 2JDID 1TQ2A 3MSXA 4PSKA 2WHXA 3D31A 1KAGA 2QU8A 2YV5A 3X1XA 3ASYA 3QXXA 2A5DA 1MO5A 4GNKA 3GJ7A 5FL7D 4BFWA 2FH5B 2VHCA 1DAHA 1FW6A 3I4LA 3CR7A 5IT5A 1O87A 2OXRA 3GFPA 2ONKA 5JEEA 5G3ZA 2ZJ2A 4Q66C 1JNYA 5E3HA 1JXMA 1YKSA 4LX0A 4A82A 1NF3A 1NVVR 2ERYA 4CEIA 1D9XA 5BQ5A 2CLCX 4IRUB 3VAAA 3EPHA 1ZD8A 3SBEA 4MYUA 1DEKA 1DELA 1W2GA 3IILA 3IPXA 4TL9A 1QVAA 1G4UR 1E4YA 2AD1A 5JSZA 1HY3A 1KI1A 2FPLA 3GJXC 3ZS9A 4GI7A 3VR4A 3D3QA 3E2IA 3KUDA 1K8RA 3EZFA 1QHIA 1TQ4A 5TB5A 4EPRA 4V0OA 4C0HA 3S1AA 4GP7A 1ZNXA 4BECA 3THYB 1E0SA 1Z2AA 3OAAA 4JT2A 1BIFA 2R6DA 2V7QD 1Q20A 3KKOA 3VHLB 1GILA 1Q21A 3VTKA 2ZRCA 1KI8A 5SZJA 4ZI2A 4RFSB 4QFMA 5DLQC 1ZM9A 2BBTA 3PCRB 5CDFE 4P4SA 1ZUNB 2QMUA 3ADCA 3GJ0A 2KB0A 1Q1EA 3QKUA 1FL9A 2QQEA 3CM0A 4GZMA 2G0NA 4LJ4A 1E79A 4KFUA 5FUXA 2GVZC 3LW7A 2VL7A 1E32A 3IBGA 3TK1A 4M9QA 4GPTA 1LFDB 3THXA 4KBFA 4L8GA 3LVRE 4UNRA 2PX3A 2NPIA 3NKVA 1E0AA 2W83A 1SVWA 3AKDA 3QKSB 2YZ2A 4EPYA 4MKFA 3UG7A 1GRRA 1XTQA 3TSWA 4BEJA 4KFRA 4PO9A 1X8LA 2JEOA 4F92B 1A2KC 5J4KA 4KFTA 1Z08A 4LYHA 121PA 2BBSA 4C3ZA 5KDOA 1KZGB 1P7CA 1KK1A 2FA9A 3GFOA 3UMSA 4JLVA 1FPMA 1QHHA 2QT0A 1ZCAA 2ZRNA 3ZVLA 2FWRA 4TMXA 3BFVA 4DDUA 4C2TA 2A30A 5FBLB 3EPLA 4RFSA 4Q4AA 2XZLA 5L3SA 3PJRA 2ZRJA 5KU1A 2F3TA 1P4SA 2F7SA 1XEXB 3LNCA 2OAP1 3HU3A 3KB2A 4BLPA 4B33A 2W6IA 1K5DA 4IDNA 3RSLA 4A8JC 4RD0A 2R8RA 2QSZA 3BORA 1E2IA 1JB1A 4P4UA 3I5XA 2WBLC 2YJTD 5J5CA 5KPJA 2FSIA 2ZAOA 4JLAA 2V9PA 1YZTA 2BWJA 1SHKA 4PX9A 4OI2A 1F2UA 3SE0A 1NY6A 4WAUA 3KFXA 2WICA 4KU4A 1Z6XA 2C95A 2VP6A 2EWWA 3SI7A 1SKYB 3TMKA 2CJWA 4TMVA 3A58B 5EE1A 3ZZ0A 4RZ2A 2ZYTX 4O3MA 3DZ8A 2DWPA 4OQMA 2Q9BA 5TDHA 1RKBA 1S2MA 2W2XA 4A2WA 1DAEA 2WOOA 2C5LA 4NP6A 4B3GA 1XJCA 3QEOA 2VSOA 3DMNA 5BN3A 2WPDA 3QIAA 1DS6A 1BMFA 3IUYA 1IN4A 4M53A 2GTPA 2Z5FA 2REOA 5C46F 1P2TA 2MSEB 1KO4A 3G82C 3B78A 4Q9LA 4B2PA 1TNDA 1EG7A 1G19A 2AWNA 4LC1A 1II9A 4ITRC 4A2QA 3SEAA 2Z43A 1E1RD 3EG5A 5CK5A 4QGGA 4Z1MA 2ZPTX 1OFHA 2XTNA 2CLDX 2ATXA 3C5HA 4ON9A 2HT1A 4EKDA 4ASUD 2KSQA 1WF3A 5EP1A 1TUEA 1GWNA 4A92A 4F4IA 2P67A 4A1FA 2ZREA 1DAKA 1D5CA 5DYGA 5KO2A 4MRRA 1XTIA 1QHSA 1UJ2A 4OHVA 4B35A 3B9QA 2ZE7A 1TQDA 4D2IA 4U02A 3SJBA 3CNLA 1ESNA 4XWAA 5JS8A 4QHYA 3QKRB 3RHFA 2I3BA 1P75A 2YVUA 1G3IA 1D2EA 1OXXK 2MMGA 2R65A 2ZSAA 3VR5A 3N70A 2GXUA 4LSGA 4I4LA 4PXAA 2WWGA 3MD0A 4X8OA 4A8JA 3W6NA 2J7PA 3NBXX 4JLMA 2FF7A 5FH9A 1SVIA 3CNOA 4EDHA 1VG9B 3SNHA 1J2JA 2EYQA 5JJLA 1R6BX 4YMTA 2JLWA 2ZRIA 1MKYA 3LX8A 4POAA 3J81k 2BBOA 1KIMA 1IN8A 4X8MA 4D4MA 1E0KA 3SQWA 1KK0A 3BRWD 3Q7QA 2IYYA 4G0NA 1DG1G 2VEDA 4LBWA 1Z07A 3L8ZA 4L9WA 3W90A 3P27A 5JZVA 4PSVA 5KPDA 1GL9B 4A4DA 2GDJA 2ZRBA 3RRNA 4DB4A 4KLZA 821PA 4LJAA 4ARZA 4V03A 1T4GA 2FGKA 5CIWA 2IXFA 4IVRA 4YMVA 3GD7A 4UJ3A 3MJRA 4MUAA 1E2EA 2GXSA 3K9HA 2HEIA 3MRSA 4TLDA 3TH5A 3FOZA 4QL3A 5L8VA 4FD2A 3DZDA 3FKQA 4LV5B 1KI2A 1GITA 2VHQA 4PPNA 3SHFA 5A4JA 3NH6A 1UKVY 4IW3B 2W6ID 3QF7A 1YZGA 4RFVA 2B92A 2V4ZA 2FZ4A 2FZLA 2MSCB 4O0MA 4DEXA 2CJWB 2JJ2D 4RSGA 1KYIA 4KV9A 2BJWA 1AJEA 1CR1A 4MKGA 2WWWA 1A5TA 2FSHA 4RD3A 3GEEA 3DOFA 1G8FA 1TQ6A 3C4JA 1BOFA 1FMJA 2IYTA 4XWKA 1S9DA 1IOZA 1E2GA 1FP6A 1ETUA 5FR1A 2AXPA 5TXGA 2RAPA 4B3BA 1A4RA 3EA0A 1SXJB 3RS3A 3QVVA 2WJIA 3IO5A 3PEVA 3AVPA 5BW8A 1W36B 2GXAA 3QVUA 2KE5A 2V3CC 1CXZA 4HLDA 4U00A 4UXIA 1EFRD 3HWSA 5GVRA 4Z1MD 5K8UA 1O3YA 1TU3A 1CJKC 5H1YA 4MGKR 4FCTA 3K09A 4Y0VA 5FTNA 1OJLA 5KSOA 3ETLA 3AVWA 3KJGA 2V8OA 1S96A 1NLFA 1AGRA 3IO3A 2J1LA 3TQFA 2GAAA 2IYVA 1AKYA 4K46A 2WPDD 5FI1B 3ZYCA 4DLSA 2ZRMA 3C15C 2PEZA 2P5TB 3T1QA 4RCYA 2D2EA 3WHKA 4DZZA 5HR5A 1XFAA 1CR0A 4QG7A 2QTHA 3WXMA 3ZD6A 3SYNA 4XD7A 3HYTA 4DWJA 2ZRAA 1E9FA 2OBMA 1KI3A 3QPVA 4XVRA 2F6RA 4M9XA 5HCNA 2BMJA 1OFUX 1SKYE 3FKSD 4RJLA 4GL2A 2X1VA 4IXMA 4JL6A 2K5UA 4HLUA 4OHWA 3AF1A 3TQCA 1XRJA 4US2R 1T9HA 2P65A 1RVDA 3ADKA 4UNPA 1NN3A 4OK3A 3EX7C 3EIHA 1XD8A 1L7VC 2B7CA 3DDCA 4DRZA 1NLZA 3KB1A 2OAQ1 1AA9A 2F55A 3HP1A 3OF5A 2OM2A 2PMDA 3B7GA 1SGWA 2L0XA 3H86A 2O8CB 2ZU6A 2VYFA 2W6JA 4V0LA 4QBHA 2WWFA 2BMDA 4OHZA 4K8OA 3HDTA 3P26A 3CB4A 2BKEA 2RGCA 2H92A 1SVKA 3CR8A 1ESMA 2ZR7A 1KKLA 1FX0B 1R8SA 2EW1A 5ANRB 5KSYA 4NBSA 4UKDA 4AWXA 2PX0A 3GPLA 5EE3A 4HB2A 4NHOA 1UDWA 2EFEB 1LW7A 2NO7A 3EZ2A 4XOIA 5FL3A 4ZKDA 1ZUIA 4O25A 5JHGB 3VQTA 2LKDA 1OXSC 3CW2A 4D4JA 2LWIA 2PH1A 1IXRC 3EAQA 2R44A 5HE8A 2AFIE 1MO4A 1TF2A 4JVMA 4LRWA 1VG8A 4HSEA 4LJ9A 1HT2E 3PUWA 4XVQA 5KSPA 4GOKA 4RD4A 5ELXA 1GM5A 4BLOA 1XWIA 1JPJA 3GLIA 1Y3AA 3WMEA 4NCNA 1A82A 4YDHB 4CIDA 4B76A 1ZD9A 4E07A 5F9FA 5DN6A 4TYQA 3B60A 5BN4A 4Q4JA 1XD9A 2NO0A 5DGXA 1W1WA 1ZJ6A 1YHNA 3CPHA 2AWOA 4OYHA 4GMDA 5CB8A 1KK3A 4FMCF 3ZS8A 1IXZA 3B85A 2VHUA 2ORVA 4BRUA 3M1IA 1VYVA 2CCKA 2ZYWX 3BD9A 3CX6A 2ZJBA 1SVMA 1XU4A 3AQ4A 1RZ3A 4MYCA 2ZXUA 3SZRA 3V4RA 3W34A 4BZPA 4WVFA 3BFKA 2C2HA 1U9IA 4AKIA 2BIFA 2HF9A 1Q0UA 4PFSA 2PLRA 1R10A 3Q9LA 1OF1A 1CULC 4JLPA 2DY1A 2QA5A 1AS2A 1KJYA 3VKWA 1JR3D 2BKUA 1L4UA 4O2RA 3W5IA 1GNQA 2Q9CA 2IEZA 4EFLA 4MITA 5LPNA 2ATVA 3LBNA 5JCPA 4PC7A 5HPYB 2RHDA 3H0KA 1XZPA 1E2KA 4FINA 1XTKA 5EXSA 2FMXA 3MUFA 4BASA 1KOFA 2V1XA 2ANBA 1GL6A 2V54A 2RKOA 2WZQA 2ZE8A 1G9XA 2HV8A 2QMEA 3PUZA 1YZLA 1HT1E 4TLBA 2JCSA 3DKPA 4TMTA 3SJAA 2W0SA 1C9KA 5CLQA 1OE0A 4JLJA 3EA5A 1S3SA 4EFNA 1XTSA 1VCIA 5KYKA 4ZDWA 2ODWA 4NYIR 5TMPA 4HLQB 1QG4A 2EFHB 4PQRA 4AKEA 4CZ2A 4HEJA 1CBUA 2QE7A 1RRPA 1ZNYA 1NN1A 1FUKA 1GAJA 1VTKA 4C0BA 1P5ZB 3CX7A 3FMOB 2QMOA 4QGFA 4BFXA 1KDTA 1GTVA 3QXSA 1DADA 4ARZB 4Q7JB 2BEKA 5GJBA 4W5JA 1NG9A 3RS2A 4L5BA 3W3AA 4M1MA 4AURA 4F4JA 2WM9B 2C98A 2ZEJA 2ODBA 3BFXA 1G20E 2AK2A 5AUPB 2Q3FA 2CCGA 4B74A 3DKVA 2AKYA 2QP9X 3MWKA 2FOLA 2WOJA 2MMCA 5C4MA 2QSYA 4A6XA 2Q3MA 1GFIA 2IBMA 2AHOA 3CX8A 5B30A 2UVQA 1RIFA 4GBMA 3T06B 3TAHA 2BM0A 1GRNA 4DB2A 1QHNA 4IOLA 3QG1A 4B75A 1DBSA 3ZVMA 2NG1A 1LS6A 1ZMXA 5JMTA 1WB9A 2CMKA 4II7A 3AVOA 2NZ8A 3VU9A 4ESHA 4F91B 1EFRA 5D3MB 1CJTC 1NN0A 2LKCA 2EQBA 4H1UA 1XPOA 4QM7A 5AWFC 5TV2A 4HI0E 1CEEA 2AR7A 1N0WA 4D4LA 1XXHB 5LD2B 4CGZA 2IHYA 3SBDA 4Q01A 3HYRA 3R8CA 2ZJOA 2J0UB 4N0DA 3A6PC 1HYQA 1YE8A 3QJYA 5EE5B 1T91A 1MABA 2VPPA 2H57A 3HR8A 3TR0A 1PLKA 1Q12A 4AY2A 1NI3A 3L0PA 4IEIA 2NGRA 3QOFA 1G8YA 2OLJA 4Q1BA 5CJ2A 1A2BA 3TUJC 1S9HA 4C0JA 2GCPA 3N5CA 1R8QA 4GMXA 5FOWA 4EJSC 4TWZA 4X8HA 1OXTA 2WWIA 1U9IC 4A15A 1KI7A 5B57C 4IOJA 5F9HA 2XX3A 4NCJA 4M9SA 4MGIR 1EK0A 1T5LA 1UDXA 5E7IA 2R6CA 1OXUA 1PZNA 2OESA 4IFBA 4YMWA 2XJ9A 1N6PA 1KMHA 3CH5A 5IF9A 2A5GA 4TYYA 5JECA 1R4AA 2FV8A 3EZ6A 2D06A 2YOHA 4F93B 3A4MA 3BXZA 3GCGA 2X77A 4BFZA 4GT1A 4P31A 2J87A 1Y63A 1IJEA 3QKTA 4HUQB 3A1UA 3TBKA 4R7ZA 3IKJA 5IK2D 3VR2A 3K1JA 3PEUA 3PV0A 4UQOA 1X3SA 3Q5EA 4NH0A 5IHPA 2A5JA 2FFBA 3RS7A 2WAYA 2F1HA 5DN6D 5FBWB 1X6VA 3P32A 4DLRA 1YJ5A 1J8MF 1SHZA 2NO1A 3MAAC 1IY1A 2JLUA 3T35A 1EX7A 1FZQA 3I8SA 5FOTA 2ZJYA 4RCZA 2SHKA 3W5JA 4ABYA 4HLCA 2OCPA 1E6CA 5BXQC 3BH6A 1CR4A 2VLIA 3RS5A 2ZS7A 4M22A 5TVKA 1P9NA 3FVQA 1YR8A 1W4AA 1L2TA 4ACBA 4BEBA 4ZCIA 1I4DD 1AS3A 1XEWY 5CM8B 3FHCB 5G53C 5F3WB 3WNCA 3V9PA 3BOSA 3W6PA 4ZIRB 4TQUS 5H68A 3NC0C 1YZNA 3T1TA 2FFQA 2Z4RA 1H8HA 4Z8XA 3KDSE 2QN6A 2HLDA 4TLAA 3LBIA 4Q1CA 2JLXA 1G7TA 3OIVA 4FI3C 1Z0DA 2EYUA 1OXVA 4DSNA 1HUQA 4B48A 4V0NA 4C0SA 3OFNA 4QBGB 4AD8A 1I2MA 2WKRA 5DO9A 3SFZA 1VHTA 3O8BA 4B44A 1H65A 4Q7LA 1Z63A 4I1VA 1RRGA 3VR6A 2IXEA 2P5SA 3SYKA 1U99A 4TYWA 2X2EA 2J41A 3HR7A 2F1RA 1OH8A 2REXB 2A5FA 1F60A 4M1TA 2ZSBA 4LHZA 3ECCA
chains in the Genus database with same CATH superfamily
1KZ6A 2MINB 2WUFA 2E4VA 4JC4A 4ZVSA 4E5DA 5J4LA 3R23A 5EERA 1F0PA 1VKRA 3P2MA 1BCSB 1YRAA 3SJZA 1R88A 1ZOPA 2MR6A 2Q2OA 3OQ6A 4GPBA 4KK3A 1QAOA 2DUUA 1VJCA 2O7VA 3C43A 4M1SA 5CGZA 3U1VA 5CXQA 5AVTA 5L6MB 3MXOA 2EBUA 4CMIA 1E2DA 4FGZA 2ODEA 4WOCA 4UQPA 1DC3A 3FZGA 3EZ9A 2QK4A 4MS4A 1SNYA 1FY2A 2DFKB 2F1KA 3AETB 4I99A 3ZXSA 1WCIB 1Q44A 5FPQA 4LCBA 5C3UA 1EJBA 3QI2A 5E9WA 4FN4A 1JLLA 2HU2A 1L4MA 4HZIA 2YFKA 3JQBC 2XEDA 1CERA 2YHAA 3ORYA 4L7VA 4EARA 4WBNA 1KEPA 5ICEA 5IT4A 2OHGA 1Z83A 1A5BB 1BEZA 1PWEA 3CE6A 4IPTA 1OX5A 4BY9E 1VBNA 1Z3CA 2JI4A 3Q12A 4G01B 3T3HA 2N0SA 3OFJA 4F4DA 3AI1A 1ZJJA 2VF4X 2GZ2A 4UU7A 5BW6B 3VC3A 3AM1A 5LXTF 1MRZA 1T8RA 1E1YA 4OUKX 2WWVD 1NYLA 3VJKA 3S27A 2PBZA 2CLEB 2KWIA 3D4IA 1MX1A 3S2ZA 1PV4A 4CM3A 3TEMA 4P3KA 1YF3A 2B8WA 4BUZA 1P3DA 1U0HC 4OK5A 1DO8A 1T6NA 1XJWA 2VDJA 3NDJA 4K9NA 4FMCB 4HPXB 4XE5A 3UFXA 3VSDA 3W5AA 2WNHA 4AW9A 3BMNA 4U5QA 3AHJA 1KJ8A 5BT8A 1PAUA 1UBOS 3ESXA 4CCYA 4G0PA 2HNKA 4NTZA 5C8YF 1U0JA 5COAA 5CDUA 3JVUA 3F3SA 3LKDA 5HIKA 2XBMA 1L5KA 5C5EA 1PQWA 1XCGB 4L4RA 2WWTA 3GLUA 3UCFA 3GUZA 1IRXA 1HLDA 1AKEA 1O6FA 2FX2A 3BWXA 1GLGA 3RWOA 3ZIUA 4DIEA 1JEEA 2DZDA 1ZL0A 2XVMA 1O03A 5T4FA 1S1MA 1NUTA 2A0FA 3ANYB 3F7OA 4FYYA 1T34A 2H06A 4IO1A 4QYTA 2P4UA 4RPIA 5KX5A 3CEMA 4A8HA 2MT9A 1OU0A 2FZKA 1KS2A 4CMEA 3A4IA 3A6DA 4ZKEA 5CXUA 2OSBA 1JZSA 2I3DA 3HPQA 4BCBA 5JIBA 5J63A 3Q3VA 3U7GA 3U0BA 1CIPA 2YYSA 1GCIA 3SLKA 4O4IB 4CGYA 5AJHA 2G25A 2HQOA 1XPRA 5SYNA 3DCNA 1BW9B 1SK8A 3W5HA 4EQ6A 1L7XA 3I5AA 3OKPA 1KTIA 1P0CA 1VL6A 1RJDA 2OTCA 1Y9JA 3AFOA 4X90A 3HNRA 4Z3DA 2JGAA 3OH8A 2HPZA 1Z22A 1T3LA 3MTIA 1E1CA 1VSUA 4UVDA 5ECGC 3EWIA 3B82A 2JVIA 4IM7A 2V6IA 3GFGA 4ERXA 4JA2A 3H1AA 1MOZA 1VKOA 1N8SA 2CZQA 4CETA 1CY6A 1V1RB 1ZIXA 1E9DA 1JG6A 3B3JA 1GTZA 3COPA 4GL4A 2O3RA 3AP2A 4JR1A 4QPCA 2G6TA 1DQRA 2AIRA 1EFLA 2NWQA 2JGDB 3JYLA 2PMEA 1EUZA 3RLFA 3W8EA 3IDQA 1DMSA 1RLMA 3EVTA 4JS0A 4OXRA 2OO5C 4RLHA 3UGQA 2PSJA 4EEXA 1R6VA 1KOLA 5B1YA 2PAAA 2MSLA 2O3JA 2ZDHA 3BCUA 3DE0X 3CEAA 4BKQA 3C6XA 3K73O 4JMLA 4MRSA 3IIJA 2B7BA 4R1MA 3ESYA 5DNYB 2J9FA 1FNMA 1K6MA 2CJYA 3D7NA 3MTBA 4QDZA 4AMYA 3IIEA 5ITVA 1H8EA 1QSGA 2QRGA 1MEJA 3I2IA 3NETA 3D1VA 3HJCA 2AOXA 4ZRMA 3E7XA 3LLCA 4BJ1A 3L0BA 4EAQA 1LDYA 5KOYA 5HG0A 1X77A 2JCGA 4ZQHA 2ZT8A 4CNQA 2IS2A 1M67A 1K63A 1PDVA 3ZD8A 1YR7A 4K6GA 1KP9A 1M2FA 2WYHA 1G3MA 4GFDA 4IDEA 1L5SA 2E37A 5M34A 1XCPA 1AMOA 4BXOA 2A9QA 2PZBA 3FTFA 4LJKA 1WJGA 3KYDA 1SB9A 2JC3A 4QUEA 1DRJA 4TLMB 1JAZA 4D5GA 3RKSA 1JFRA 1ZVKA 3IC5A 1QBKC 2E9SA 2FFJA 2WAMA 3MW8A 4UBJA 1UWVA 2OV6A 2V7TA 3AJ9A 5JVDF 1CVLA 1NQ5A 1W88B 3ELYA 2IIBA 1UXGA 2GD1O 4N6OA 5DOZA 5FOSA 1GPLA 2QP4A 4ENPA 3QEOA 4CW7A 1WUKS 3ZI0A 2QRLA 2OV1A 4IICA 4F2PA 5C35A 4E03A 5JNRA 2GZ3A 4MDYA 2R84A 4GSYA 1WCXA 2H0AA 3CF6R 5JV5A 3OETA 4XPIA 5K0LA 4QDJA 2PCLA 2CVQA 4JQYA 4P3OA 4E5NA 1LDGA 2VTVA 2GERA 5FQNA 2C8JA 1EI9A 4GYKA 1ZC4A 1ZOLA 4PR3A 5FFFA 3VYVA 3P19A 4E1BA 2Q3HA 1BWPA 2QM0A 4GMGA 4WN3A 1GQSA 4JCOA 4P98A 4UVHA 1XDSA 4OM7A 3QX3A 5B1DA 4UU0A 1HXHA 3GMDA 2AJDA 4R1NA 5JJBA 1E3LA 4GP6A 4OBWA 5EUMA 3KKPA 4YQFA 5G0VA 4D8VA 4CMCA 4FC7A 5D6NA 1YR2A 3K32A 3ND9A 1A4IA 3MPOA 1SZDA 2RK4A 3UPDA 1C30A 2RHHA 3ZGXA 4BHTA 5DLYA 4C4XA 3THXB 2BFBB 1UKZA 2IEGA 3LY9A 3MG9A 3TL2A 2OECA 5KHLB 5ALQA 4C3VA 5FNVF 3UBMA 5JOQA 1RC0A 3KL2A 3VU3A 2WAAA 1AZLA 2FSSA 3CGWA 1OFIA 3NBFA 3CLRC 5JXHA 1IN1A 3WGZA 2WINI 5EL0A 3KQVA 2WMOB 3MBIA 2C77A 3CRW1 4JYCA 4LVCA 4ENUA 2FX5A 3ENNA 4K9KA 4KODA 3VZSA 4JDUA 4AJIA 4BPRA 3W5CA 3AKCA 4B4OA 3BBPA 3P9QA 4JROA 2WMNB 1NBME 2OO3A 3QUBA 2ZWAA 1Q11A 1A9QA 4J2HA 4KV7A 3WGVA 3C41J 1JTFA 4DQ0A 5K0ZA 1KI6B 3HXLA 3U7JA 3EZXA 5I45A 2P1ZA 4J03A 5K2MA 1QHYA 2VYVA 1AV6A 3HB0A 1MDFA 4Q4AB 4FFMA 3AOEC 4U7HA 5IWCA 3VMMA 3PHJA 4JI3B 4NNOA 4ZO8A 3ZR4B 3UH1A 5BWCA 1ESEA 1Z0AA 5BVGA 5A3QA 3PBKA 3G85A 4PINA 2JFGA 4MVJE 1BCRA 1BU8A 2EDAA 4MJLA 1IMOA 4MPTA 4PX5A 5AW5A 4BQSA 1PJQA 5FAKA 4BE4A 2QNBA 2GLXA 1CY8A 1I1OA 3DG9A 2E87A 4YA6A 3TKLA 3H2ZA 3IT3A 3QEMA 3KUCA 3RSQA 4Q9DA 3D5TA 4Z3KA 2NUAA 3ODGA 1HZZC 2SNIE 3LECA 4HRYA 5CNJA 4DANA 5KEIA 1XMPA 4QUDA 4KQFA 1E4OA 4BMCA 2E2WA 3KKQA 4J0JA 4PZLA 5A2GA 4MMZB 1R4MA 2B2CA 1MTOA 2W4IA 3HEAA 4HH1A 2AZTA 1TAQA 1NFQA 4HWRA 4WKGA 5EJMA 4EKIA 4QUKA 5DOVA 4YRIA 2IOFK 5EIOA 4OHYA 2C5HA 4EG5A 4XFKA 3RREA 5E3JA 3UA4A 3M1LA 1H6DA 2QX9A 1B0UA 2ZWOA 3UWDA 1AX9A 2BTQA 1HNWB 2IEYA 1TF5A 2PL3A 3H2KA 3A70A 5CITA 1L4LA 3O7MA 3VV2A 1V8FA 1X13A 2QEQA 3V8PA 4HAYA 2X3YA 1XXHA 1XSEA 3ANSA 2XA1A 3C3AA 1UIMA 3L6OO 4F7WA 3VPDA 2ZXEA 1CF9A 2PGDA 3QI7A 4D81A 3SDZA 1CR6A 3IAHA 3LPAA 1E6KA 4YJ2A 3KQKA 3ZG6A 4M37A 2RBGA 1YZHA 1Y6JA 4OI4A 1KMQA 1VDMA 1TEZA 3KSMA 1N2EA 1ADFA 3OQ1A 1XA0A 4JHLA 3ZWCA 2X5NA 1QV6A 4B87A 5EHXA 4C14A 2SKEA 1KERA 3FYTA 3NC1C 3TL3A 4PZAA 4BLUA 3GVIA 2IA5A 3KV3O 5SZKB 3NW9A 3RFXA 2P0YA 4RLFA 5K0CA 2X4IA 2Z2KA 4CMIB 4S1OA 4LMAA 1QQBA 3TPCA 3QEMB 1G3UA 4FYHA 4X7BA 4D74A 4ZOLA 5DLEA 2JRLA 3WGHA 5EJ7A 4ZP1A 2ZYRA 1P0MA 4MPPA 5FWYA 3JZDA 2NLOA 3MMZA 2VF8A 4Q7KA 5CCDA 4CVNA 4HQ0A 4DNOA 1ZD3A 1RXUA 3IE0A 2JNWA 421PA 5AJWA 1FFAA 5ARBA 5JFOA 3ZCTA 3ZDCA 2MYPA 4B6JA 1YA6A 1IDOA 3R4CA 5TMDA 5I8WA 4CF6A 2D8MA 3EH1A 4EDFA 1FJXA 3B13B 3O0TA 3I09A 3B48A 1HG0A 1ZUHA 4KKXB 1FMCA 2MSDB 4E32A 2GILA 3IESA 1XMVA 1WG8A 4WW0A 3SQMA 4DDWA 2B25A 2O7SA 3VZCA 1N9KA 2NM0A 1ZN2A 4XTRA 3FNBA 3WWPA 4GLOA 4YYEA 3ZCVA 1PZGA 4JEHA 4LHSA 5AM0A 1IZZA 2AA3A 2HMVA 3IQDB 4HCJA 1D1PA 1V5IA 2FW1A 1DQNA 1X1QA 2A86A 1F5NA 2ZSIA 2EF0A 2PTHA 3M3PA 5B1SA 3E3OA 3K6SA 2GHRA 2WWRA 1K5GA 3AF5A 1THTA 4P8RA 2OFFA 1OFGA 4LWZA 5C37A 2CE2X 3BGDA 3DDNA 5E6RA 3ZIAD 3QP9A 2C31A 4EI2A 3FCAA 3UAXA 2RB4A 4DMUB 3G2IA 1L7DA 2V7VA 3ILHA 1RRMA 4TQ9A 3C6BA 1EGAA 4L4UA 4KMSA 4Q7MB 1E69A 1E9EA 3RVSA 1NBOA 2FR1A 3FCUB 4MB2A 5CW2A 2ZFUA 4Q1EA 3WOVA 1JHOA 1GOTA 5A7GA 3RVMA 1G63A 3NDBB 4TYNA 1IBLB 4IUBS 5DX1A 4G5OA 1JLRA 4JIMA 4DM3A 3HRIA 5FPHA 2V7GA 5DZSA 4ZV7A 3NIGB 1JBEA 1UPCA 1B8OA 1NVXQ 2JIRA 2W6JD 3Q0TA 4PZYA 3UT5B 3LOQA 4EUNA 3ICQB 3C7TA 5J2UB 2PRJA 1WSDA 4LOKA 1UKAA 2I29A 1MAWA 4M49A 1BS9A 1ZL2A 4P58A 4M4SA 2OOSA 2QS9A 2EZ9A 4OXNA 3HO6A 5GP1A 2ZT6A 3K4QA 3TM5A 1KMHB 1UC8A 1WZNA 2FF5A 3DGFC 2Q3LA 4CHGA 3DTYA 4K28A 1FYWA 5FP0A 2P7HA 1PRYA 1G21E 3C74A 3PXCX 1N6IA 5FI5A 2WP0A 3H2JA 1KETA 1DFIA 3EZ7A 4Z7NB 4OQQA 2I5PO 3WICA 2D1RA 3E22B 1VL5A 2GJAA 3N8IA 1P74A 2MINA 2PYIA 4R2KA 4B3FX 5ENDA 1U0GA 4BP8A 2JFPA 3JR3A 1XJ0A 3LO8A 2YHSA 3NCTA 4JZYA 5HIJA 1SHUX 4X84A 1T13A 1ZUD1 2B3TA 2K2QB 3C85A 4BUJA 2JVKA 5KWVA 1RWQA 1SCKA 2V6JA 3NLLA 4C7XA 2A4KA 3OTIA 5I7EA 4U2KA 2ISSD 5FR2A 1M1UA 2BV3A 4I9HA 1I4TD 3BWDD 3TLKA 3U3XA 1PUXA 3EWSA 3EQZA 3WMFA 2B9VA 4AQDA 3OHMA 3TD9A 2BE7A 4DR3B 1JLLB 2H1VA 3R0JA 5HILA 1KIAA 4RTRA 5DIFA 3ED5A 2QAJA 2WG1A 2DJ5A 3ROGA 3GUUA 3TAUA 3W06A 4MYHA 3HZRA 3RC8A 3R3SA 2OENG 3BPSA 4UVIA 1ZM4A 1QP8A 2YS7A 3IELA 4QO8A 5DU2A 4OXIA 5K6AC 5EXTA 4BNNA 2J32A 2GM9A 2N3ZA 3E2MA 2X23A 3AW9A 4LCEA 5PGMA 5D01A 2YTZA 2PT5A 2I4IA 4J0HA 1QQ6A 3BSYA 2IXAA 4DSTA 1S2DA 1RAIA 1U5CA 4IHAA 3PI6A 1W73A 2DTXA 2PAFA 3FJOA 1SCDA 1XC7A 4NENA 3ZE8A 4D57A 3CJQA 3D3JA 4UMVA 1EBUA 2QNRA 5B2EA 4K9PA 1CPYA 4J0IA 2WY2D 3EF1A 3H5WA 4I2NA 1S8NA 2QDXA 3EUAA 3HL0A 5TF0A 1YFJA 5TJ9A 3FB1A 1JSRA 2P78A 3WK9A 4I1YA 4AF8A 3F3KA 1FK8A 4NH4A 3NRJA 2ZE6A 1C9EA 4FBMA 4BFYA 5KKCA 1WNFA 3S8YA 2WILA 1CVIA 1ZU5A 3GRPA 3KQOA 4LNAA 4QYXA 5D86A 1V71A 4R01A 2EKLA 1H8HD 2H5JA 5JBQA 1HNZB 1P4HA 4IRXA 2JD0A 1I3NA 4GQBA 1USUA 5K4HA 3W8DA 3ZY2A 3HZHA 4KWIA 1TU0A 4GVLA 2G70A 2X40A 1AXGA 3BZBA 2VSNA 4QOFA 3D8BA 3VOBA 2ZRDA 2ZI5A 1HH4A 3H6GA 2LD4A 5JALA 3VYTB 3PPVA 4AKGA 2RGAA 1Q0PA 1ZNZA 3VR6D 4IDFA 1QZXA 3U9TA 4PW0A 4X62B 3UMRA 3ZU3A 5HOQA 3LZ6A 4NS4A 2ZRHA 4OAOA 5P8WA 3GLIE 2OHHA 2QD5A 1UKYA 3L40A 4CV0A 5JEDA 1UKEA 5JI3E 1ZK1A 5BRAA 1NYTA 2B98A 3T7TA 3HA5A 2O5VA 2X6TA 3DW1X 4XOUA 4PLFA 3I8OA 1JEYB 1X7YA 4B0PA 5B53A 4DV7B 2NSJA 1W19A 4OQ4A 4PF1A 1ZK0A 1GG2A 3JPYA 2UZ3A 4XQEA 3L8FA 5F1KA 4MYTA 2C3OA 5K8IA 2HJWA 3A8TA 4ENVA 3D6VA 3AR8A 2Z2YA 1XV5A 1NNI1 3JZIA 1PR3A 4JB2A 1X1AA 3Q7PA 4MVXA 4EG0A 3QPCA 3PFKA 4JVNA 4WNYA 1YOVA 4Y2VA 5GJCA 2HU8A 5LMUB 3TL6A 4QDTA 4D43A 1XTTA 3H8WA 4GUAA 2D62A 2VJPA 1KI6A 1REQA 3RIEA 1CY2A 4Z9YA 4R71A 4FHGA 1NT4A 2XZPA 4HK4A 2I4TA 5EIWA 3IJEB 3FLBA 2W9XA 4U7WA 5KCMA 1K7YA 4URHA 2XTJA 1SKQA 1JJ7A 3FPBA 3SF0A 4RSMA 4ND7A 3OECA 2WW8A 4MLPA 3MF4A 3SZ3A 1M6YA 3BA6A 2CB9A 3TCKA 1TC1A 3EODA 1NQOA 3GZJA 1X7WB 4LY3A 4PX3A 1BHQ1 3TE7A 9ABPA 1RRKA 2GZHA 3A6KA 3DHEA 3K9FC 1D2CA 2WSMA 2TRSB 1WHSA 3MK31 3CIOA 2R5WA 2GSDA 1IHYA 3KOUA 1V4NA 1CUXA 4LK3A 3NBMA 4JVSB 3TTYA 4YRAA 4N3AA 3GOHA 6ADHA 4NEHB 3WBKA 1I7NA 1SQ6A 4CL3A 5C81A 2X0JA 3REFA 2WM8A 3ZUGA 1XNQB 1BGXT 2UDPA 3TSCA 3L79A 3DEKA 1MBZA 4W9NC 2PJRA 1B73A 2R7LA 1JI0A 3G5TA 4UUMA 3CNBA 2FXVA 1K92A 3KT0A 3ITDA 3C1TA 3SBXA 2G0AA 3N2KA 1U98A 1Z4MA 5JQGA 2HWYA 1Y6GA 4ZYTA 3WLNA 4XUDA 5KYWB 2Y9MB 3VC2A 3IXMA 3PRKE 2APJA 2DWOA 2GAOA 3WWEA 3ROFA 5L3SB 4W99A 2YH2A 4FFVA 4MWGA 2QL6A 4DVGA 3S81A 4N40A 1Z68A 1QG6A 4BNXA 5HIAA 4M1WA 2C84A 2CFCA 2FPIA 1VPVA 1LLFA 1Z0JA 1N3LA 1M2VA 1NL3A 1UFVA 1XP8A 3BWEA 4YRTA 3WADA 2B69A 3FBWA 2QJWA 1IB0A 5LVAA 2IHVA 3OQBA 4XLTA 3K9GA 1M5RA 4HEHA 3CUEF 4PXSA 4W7IA 1YJCA 2WTAA 1QKKA 1T5BA 2ID7A 2J46A 2FU5C 1KS9A 1Y4ZA 2PEYA 3P2JA 4WXHA 4BO3A 4CMGA 1GPBA 1PFYA 2VSXA 3ZTTA 1BDIA 1C7FA 2NU7B 3MTEA 4RBNA 3D3NA 2VA8A 3HKBA 3K1AB 4R3NA 5K6RA 1XXHE 3BMXA 3LYUA 2QJFA 4IZ6A 2WEKA 2VYNA 2WPNA 1S2GA 3EE6A 5CCEA 2PUAA 4DRXB 3KKKA 4W1QA 3BIXA 4CEHA 1PNRA 4YRDA 2QLLA 2C9OA 2HF8A 3EDYA 1CJUC 1LPAB 3LQ4A 1QWOA 4IDDA 4L51A 5K4GA 4I5DA 1PWHA 4QTUB 2RGGA 3P52A 3S28A 3WGJA 5BSWA 4KR2A 2B34A 4CFZA 4IJ6A 3EIQA 2ALJA 1CE8A 3CJTA 2IF0A 4HH4A 1M8JA 5CB6A 4AX4A 2OK8A 4ZMSA 4ZYUA 2FEPA 4QVKA 2Q7OE 1O58A 2WWHA 1QV7A 1YVUA 5A5GA 4F2HA 3NJ8A 5NULA 2O8BA 4I4NA 2WJHA 4N5NA 1BH2A 4HGRA 5CDYA 3FFXA 2NU6B 3Q3EA 2AFHB 3GJ5A 1FRQA 4KSBA 4P82A 1MOSA 1UPTA 3RVBA 3LCUA 1LCIA 1OAOC 1OWNA 1Y3DE 1XB2A 1NHGA 3ZDQA 2GBFA 5BSHA 2RHJA 2XGGA 4LXTA 4DCTA 1WW8A 2OV2A 3ROXA 3CLUC 4ZYYA 4YT2A 2OBXA 3CSUA 5CX4A 4EO9A 1ZD2P 4E11A 1RYBA 3QLVA 2ABWA 1YONA 1OH5A 1VPTA 2B21A 1GGNA 2ID8A 5JZ9A 4MZDA 3PQ7A 5AIAA 4Y7DA 4KR6A 1K2VN 2LGJA 2VXBA 4O4LF 4XGRA 3DZIA 1F3LA 5DT2A 2ACKA 3KTFA 3U0VA 1DUVG 3K0AA 3T8YA 3J7AC 3M2TA 3THOA 2H85A 3ZK9A 4X7PA 2QLMA 4P22A 5ETJA 3ZK8A 1FFWA 2I7VA 1OYYA 1BCRB 1JKMA 2XB6A 3B1YA 4ZAXA 3OWXA 3UB3A 1M6NA 3MWJA 5LLTA 1IFXA 3GA0A 1M0TA 1WQ1R 1K6IA 4MA4A 1OB5A 2JAOA 3D8UA 2X0DA 2ZWPA 2V9ZA 4RPHA 5BSGA 2G04A 5ICGA 5LMNB 1QUFA 1DUSA 5JZOA 1WLYA 3ND5A 2CVPA 2KLHA 3U6KA 2JJQA 2MHCA 4YPFA 1A9XB 1TMGE 2Q4TA 3EPJA 2Z57A 3GEHA 4F3RA 4Q3OA 2BFOA 1O95C 1M8PA 3GRFA 4RHEA 4R1SA 2O8DA 5FOQA 4W8OA 2I55A 4HRAA 1UMBB 2EZTA 1SVOA 2XB4A 3ITKA 3HUFA 4HAZA 2J4DA 2Q8PA 3NDPA 1L7MA 4UU1A 4JUDX 1YBHA 3FPLA 1P1BA 2XYRA 2H07A 2E18A 1WB4A 1JEOA 4MWCA 2NZJA 1J21A 4RZUA 4TUYB 3TLGB 3F97A 5ED4A 4WK2B 2PX6A 1KEUA 1AU9A 1WXDA 3C1OA 3ZU5A 1B8NA 3CVYA 4G0UA 3KXLA 5J4YA 3S5UA 1ZOSA 2HCBA 1M0EA 1JG7A 2JBHA 2IW3A 5TY0A 2IW1A 4FHEA 1LWOA 2BOVA 2IYSA 3NBQA 2R8OA 4WCFC 2I6GA 1VHDA 1J1ZA 3PIRA 5JI2E 3WKAA 3EVNA 3K0AB 4B4DA 4AN1A 2P9YA 5H80A 1GZ4A 3G88A 2AI1A 1PT7A 3BRQA 1GZ7A 2IZ0A 3NYWA 4XDHA 4L8WB 5CDSA 4U7DA 5BXYA 1IMJA 3ZHRA 3TWOA 4EY3A 1IIBA 1LPBB 3V4VB 4ZI7B 2QMHA 4JEIA 2NXJA 2ZIWB 2ANCA 3O2QB 2PKCA 3UUEA 3JQAA 5AW0A 5K1ZA 1X7ZB 3I6ZA 2B35A 3RSFA 4U7TB 4RYDA 4CLEA 3C1AA 2I33A 5E2IA 1E1QA 2XQGA 3RS4A 4CLRA 3AHHA 3IHLA 4P54A 3R5JA 2NUTB 2VP9A 3NWBA 4DSOA 4TKVB 1W5BA 2BHRA 1PNQA 1RRFA 3E8MA 5M5BA 2Y6VA 3OPQA 1OI2A 4DA0A 1MCZA 4RKEA 3ROQA 3KJZA 3QKSA 4IMJB 2ZITA 3GARA 2C99A 2L42A 1BHO1 2ZE5A 3Q40A 1FMFA 3UHPA 2BDTA 1QO0D 4XGNA 5AW7A 4EO4A 3IB6A 4MS1A 3KFVA 1SQ0A 2CDCA 3HO8A 3KTAA 5FFMA 1EP3B 2QZ4A 4MW5A 1Z16A 5F1PA 1I2DA 4OMFG 3BFJA 4ZA2A 5CA0F 5DNDA 1R7RA 2BFCB 4FDVA 1RI1A 2P9JA 3P2EA 1X14A 1LU9A 2X8JA 4OQYA 4FW9A 1PT5A 1VXRA 1O4VA 1H0HA 3WJ2A 5HRCA 4L7QA 2I0FA 2JFBA 3HY6A 1TU4A 4EMSA 5KQGA 1TM7E 2P11A 4BJ3A 2QROA 1OLOA 3STXA 3I04A 4EG3A 5B2ZA 4I5IA 2AOTA 2X0KA 3T95A 4I19A 4QG3A 3B5IA 3ZD9A 2IP2A 3D6TB 4EJSA 1X1RA 1KYTA 4EY5A 4KNVA 1CUAA 3L0DA 3R0VA 1FQOA 1ZAYA 1KORA 3PQ6A 4HAUA 4S2EA 1M34E 3PGA1 3V4SA 3FOZA 2CGEA 2XMRA 4R0MA 1SBNE 2GVDC 1PV1A 4AECA 3VGJA 1SQ5A 3QE4A 1RXEA 2ZETA 3BGVA 3UB2A 3SC6A 3HUDA 1G7CA 3QITA 3RDPA 1XVUA 3CKMA 4G8DA 5A3VA 3G13A 1A76A 1FU8A 2Q3EA 2WDZA 2E21A 3L8CA 7MDHA 2ERXA 4MAFA 2INGX 3AB7A 3N8NA 4JLBA 4L3VA 4QPZA 4ZALA 3E4CA 2VFAA 3AF0A 3M6XA 1QGOA 2D1FA 3NBAA 4V24A 4DKXA 4Q1AA 2GEVA 3O47A 2XD4A 1CP3A 4KB5A 3K16A 4UC0A 4Y6GB 1H85A 5AFSA 5LLSA 4DILA 3X1KA 2XOKA 1RLUA 3D6FA 1J8VA 1UUFA 4JHXA 4LYJA 4Z4CA 2FLWA 3JCZA 3EOBI 5JC1A 2R751 3TZHA 4NARA 1IUPA 5K0BA 4BZZA 2PN1A 4GF5A 1G5QA 4DY4A 1W49A 2II6A 2IYRA 4Z7OB 5DCLA 1TUBA 4PN7A 1FFHA 4C21A 2Y77A 2ST1A 2CXQA 4DLKA 4RV9A 2DPLA 2I4RA 1SBHA 2XCTB 2XWPA 2P2LA 4JD5A 4RVCA 3K31A 2ECQA 3NTQA 2XMZA 3QZUA 5HKAA 5KJ6A 2GEUA 1SUPA 2GN8A 3CC8A 4RHTA 1YOVB 5ALMA 3S2UA 3L18A 4M7PA 5JASA 1KVTA 4B84A 3R3HA 3MB5A 4FDMA 3SZMA 1SH7A 1ZP6A 3OIUA 3BA1A 3EY9A 2PL9A 4N3NA 4L9SA 4UE6A 4P08A 4BO6A 2PO7A 5CBPB 3KSZO 4YCJA 3H05A 3VX3A 1U0EA 4GI3A 3HCOA 3SX4A 4I6JA 4X8LA 4ZGGA 1NUSA 3QFFA 4L6IA 1PZHA 2Y1CA 3D0OA 1QDUA 1QUEA 4KWTA 4U2FA 4NEGA 3GYBA 1MW8X 2YJ4A 3RI3A 3B7PA 4DIMA 4UQLA 1UDAA 4NMXB 1X70A 1V7QA 3B1WA 3CRVA 3WKEA 3L7OA 4Q48A 5DI3B 2OBLA 5F7ZA 2CUKA 1KBOA 3SSOA 4E5MA 3HXQA 4P93A 5GONB 3FCSB 4H1HA 5AVWA 1GIAA 2GKSA 3OZTA 3IEUA 4OYYA 1JMKC 3D7KA 3U81A 5G2OA 2O14A 1HKHA 3OCXA 3MERA 3EVDA 3HUEA 3TJZA 5K3SA 4N49A 3VC7A 4H1VA 3U49A 3ZOZA 1EP9A 1D1QA 1VC2A 5AK3A 3FE2A 1W7AA 2WU3A 2VSFA 1DARA 4WN9A 1ZN9A 3LYAA 3LDFA 4UTXA 3LRPA 5LA6F 3T5TA 4CCAA 1YZKA 3OU6A 1VG1A 4LY0A 2J6BA 1E3IA 2B99A 3GRYA 2A9KA 3JYPA 4L57A 4F3NA 2FN4A 4GPD1 1MX3A 2ZB4A 4IRMA 1RXIA 1T10A 1F4VA 4LSWA 5GV8A 2J9RA 4AJ2A 4AU1A 2D5CA 1WAMA 1BD3A 1S3IA 3GG9A 2BY4A 3BE6A 4ABTA 2PE5A 1DIGA 1ZONA 2DBZA 1MLDA 3MTQA 3OM8A 2JLQA 1T5TA 1AGNA 2QD4A 2B1QA 4RK5A 1LPOA 3QVMA 5GJVC 1E2JA 2XMGA 3DMPA 3AUYA 3KTOA 5A4AA 4FLMA 5C4GB 2ORWA 1U8YA 3BB3A 4Z51A 1U8TA 1QGAA 1CJMA 4H0CA 3W2EA 4WZBA 5CH5A 4J75A 4BNTA 5A02A 3FYHA 3T15A 3GLFA 1YI0A 2REQA 1GV1A 1KTVA 3DMDA 4L9RA 2CEAA 3T9FA 1XZGA 4LV8B 3WGGA 5TIIA 2DM6A 1PVDA 5T57A 3EIUA 4R0NA 4DJTA 1UH5A 4RU1A 4H4CA 2WD7B 3LT0A 1P3Y1 4W5HA 1PLLA 4LPKA 2Q0HA 1KY2A 2QL5A 3DJYA 3ZHZA 1I7DA 3AFIA 3ADOA 3WGMA 3I9OA 3CEPB 1NDQA 3COZA 2C7QA 1N2CA 1QK3A 2CUZA 1UK6A 3Q6NA 5FD8A 2ONJA 5AVSA 1XZCA 4JGIA 1U2ZA 3EEFA 1XQXA 4E4RA 2GN6A 3DHNA 1P72A 4XJXA 4J76A 2Q28A 2CNOA 1WCV1 3UOAB 1JU4A 3AESB 1W4BA 1UADA 1ZCZA 2A3RA 1I7LA 2B6NA 2HDOA 2ZDGA 3N87A 4RXUA 3VRHA 1FF9A 1LSOA 4D9HA 2Q0XA 2YJ5A 4HVAA 5H3HA 3QX7A 1GVNB 2P68A 1JAIA 3O8DA 4U8HA 3G02A 4XB1A 1NE7A 1LY1A 5AI4A 5DH9A 3UHAA 3ZJ5A 4F84A 4EEZA 3HKCA 5IAGA 2C9YA 2E89A 5GINE 1T5IA 2R1VA 4CF4A 1XHEA 1Z2OX 3NX4A 2VHTA 1WBBA 1EWRA 2A9FA 3GLVA 3UGJA 2JPDA 2PKXA 5MGNA 2QTZA 4C7OB 2HNAA 5IVIA 1C7JA 2ENUA 4R54A 4LJ5A 2FFAA 1L5HB 3LVFO 4TRMA 4A0FA 3H9UA 4X6LA 4YJFB 2ZI4A 5AR1A 1ZBDA 2C9DA 1JQ3A 3CN7A 4RH1A 4L15A 1QH8A 3I1JA 5I8ZA 3UWPA 1MR3F 2BHLA 3DHVA 3F7MA 1DEXA 4E5YA 3NFYA 2OY0A 1FOEB 4Q18A 3RABA 2HB6A 3T6KA 1A1VA 1BDBA 3ZWVA 3ZHBA 1G59A 4ND6A 5JT1A 1A9RA 1HLFA 3AEYA 1QYCA 4IXDA 5D5PA 1T8UA 1UEJA 3JQBA 3O1IC 3WWDA 1VM6A 2W2LA 1PDWA 3L6UA 2H17A 4LJYA 4RKQA 1Y1LA 3W7BA 4GI2A 5AXBA 3BULA 1C7ZA 1WEHA 3X2EA 3T5PA 1U2RA 4S05A 1IN7A 5CU7A 4M21A 4LI0A 2PVCA 1OZGA 1PKXA 2FSVA 3AMVA 2HCRA 3M6AA 2OHJA 3AJRA 4HDMA 2PKQP 5ICMA 3I62A 1UMBA 1ZRHA 4JSTA 4OTZA 3N2KB 3BE4A 5JQGB 1UBEA 4RE5A 1G8JA 4XWTA 3SOPA 4GBED 1T26A 1SXJE 3EW7A 3KE9A 4BB0A 3U3JA 5CDTA 1JPNA 2YIDA 3L8DA 5HP4A 5EIFA 2GH1A 2B5VA 2YNMA 4H7IA 4ZVOA 5EWLA 5CHEA 1NY5A 5DHRA 1VECA 1QRDA 2P6NA 5FJJA 3RGWS 2O52A 1WRBA 2Q5EA 3RAGA 3PPWA 4JFRA 2XDAA 5LD2C 3THYA 2IQ5A 2AH5A 1SBQA 1X7DA 3AVTA 3DYIA 1B1CA 1GZ5A 4F72A 4BO7A 1QK5A 2ETXA 3AUSA 5AK4A 5J4VA 1XZKA 3QV1A 3A9WA 2WB2A 2QORA 2WTUA 2AOVA 1MT0A 3KWLA 4WLOA 5IJ0A 1N3YA 4Y3UA 1V11A 2POQX 3F6CA 5JJKA 1MB2A 2EWVA 1ONOA 3PNOA 4P7BA 3USCS 2XTMA 1PLJA 1ESCA 2YYZA 2QRJA 5F4ZA 3RU9A 3EQ6A 3U6BA 1XDWA 1GDDA 2XTZA 3Q8KA 4HNAA 1NV8A 4QBTA 3EIEA 1WXQA 3FJYA 4EQZA 1R0ZA 5KYYB 1RCUA 2BL4A 4URZR 2H8GA 1P62B 1I10A 5E7JA 2G36A 1IVNA 1S2OA 3ZHOA 1BH6A 3O8OB 1G41A 1NJ2A 1Q7BA 2R5FA 2WT8A 1TJ4A 3NAGA 3QJ5A 3SCZA 5I4KA 1JR3A 2QLFA 4GW3A 3W9YA 3E84A 4AZ3B 2JG3A 4DR2B 4R40A 1A7JA 1B6SA 1BN6A 1J00A 4B2LA 1T6BY 2DOKA 3CVUA 2H2DA 4PG6A 3VR4H 3PEWA 1DQSA 1DFGA 3BJMA 4QNRA 4AJNA 4EX6A 3ADDA 2YVAA 2B78A 5E9JA 3W3ZB 4LFCB 4H6XA 1QCCA 1QTNA 1C1HA 4G0YA 4YDRA 4ZXFA 3MZ0A 1U9JA 2O0HA 4ESEA 2AZDA 3VBCA 3GK3A 3CF2A 2PWAA 4O5AA 2BFCA 1TJYA 5EIBC 3U4DA 1J49A 3BB1A 3IUJA 2FPWA 3GUCA 4PWYA 4YP1A 1T2AA 1MMFB 5PNTA 1WUJS 3EGVA 3EWAA 2IH4A 2ZRFA 5IJ0B 3WL8A 4H60A 1ZVQA 1TM1E 4S35A 2BKAA 5FJIA 5CCXA 3N74A 3VPXA 4BNDA 1W52X 4EUSA 3OJ0A 3HH8A 2VNJA 3P0FA 4W63A 4I0WB 3UWSA 4KFSA 1DBPA 1JHYA 1CUWA 1E2PA 1P4GA 3ZGYA 2VQ6A 3ASZA 1P1FA 1KE2A 2Z4TA 1SXIA 3M6LA 4HNAB 3LPLA 3OMXA 1JV2B 2CXTA 2JCVA 4PZUA 1UCFA 4PPFA 1DC4A 3GFSA 4EYOA 1QM5A 2W4QA 1ID8A 3WLMA 4NU0A 4Q6BA 5DBIA 1P29A 4BV2A 2XGMA 3IAUA 2CLMB 1G16A 1ABFA 1XJQA 1GDTA 4OHPA 1AY0A 4H3KB 5EINA 4BMYA 1QP4A 3OPVA 1ZHOA 4C0KA 5IRCD 4DLUA 4B6SA 4L5JA 3RPEA 5KBYA 1QJCA 2YQZA 1HFWA 3MS7A 1H2ZA 3ZCQA 2OLKA 4JSYA 3DMTA 3P0IA 4QLAA 4DT1A 2I1VB 3L4BA 4GQIA 1JKXA 2QG9A 1CZRA 4HQRA 4MQ6A 1H1LA 4C30A 1Z6YA 2ZJZA 4HAXA 2EKZA 4J0GA 2NP6A 1GNPA 1TQHA 3BWVA 2XW6A 3NKLA 3LG2A 1QHFA 1JBKA 2VT6A 1JTEA 4FDLA 3AEKA 4O5OA 4R1QA 3K8OE 3O83A 2B30A 4KBYA 1G20B 1UXHA 4RQTA 3JZAA 3AKEA 1Q3TA 4HB0A 4XSHA 5LWQA 3NVKI 1N6HA 1OI4A 3TMYA 4EKNB 4MUNA 1U04A 1YQWA 4YCCA 2GZAA 2KPOA 4QXAA 4YQEA 1LLCA 2CMHA 2Y4NA 4M86A 2R8XA 4W8HA 5KMGB 4PS0A 4YAOA 2CNWD 2ZWMA 4P83A 3EZLA 2WKWA 4PFKA