1A4UA

Alcohol dehydrogenase from drosophila lebanonensis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
254
structure length
254
Chain Sequence
MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNTTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The refined crystal structure of Drosophila lebanonensis alcohol dehydrogenase at 1.9 A resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords ALCOHOL DEHYDROGENASE
total genus 92
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 1998-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1a4uA00
2I99A 3ZNOA 1VLLA 1WNTA 2I5PO 1R4NA 2DQ4A 4HADA 3ZWVA 2ZB4A 3CTMA 3BHJA 4L4SA 4OO3A 1JKFA 1AE1A 1X7GA 2VN8A 3GDGA 3UXYA 3U4CA 2EG9A 3L6DA 1DIAA 3ONFA 3U49A 1MGOA 4TMFA 4CODB 2BHLA 2O3RA 3CE6A 4OMUA 4XR9A 3I23A 9LDBA 5HRUA 3HB4X 1T2DA 2JFFA 3HB5X 3VPGA 3B70A 3JYPA 3WSWA 3ZWXA 4CUZA 4WJZA 4CL3A 1GV0A 1ZJYA 4G65A 2VNSA 4NMHA 3QVOA 2YDYA 4RL6A 4Z9YA 1XWFA 4R1SA 2PD4A 2YFQA 1PS9A 2FSSA 3DHEA 4WCDA 4DIBA 4R5MA 1K89A 4K26A 3WX0A 4CMJA 4BNIA 5IDQA 4NBUA 3LVFO 1PR9A 3B1JA 5FYDA 3KTDA 1E7MA 4WEOA 4BGUA 2VUSA 4M55A 4MVJF 3W4KA 3DZBA 5JSFA 2J6IA 3B1FA 1R4MB 1N1GA 3L07A 1OBFO 4P4LA 4Z0HO 3OIFA 1YDEA 1A27A 5DT9A 3PIDA 3IP1A 4PG7A 3NX4A 1B26A 4PZDA 3PPIA 5A9TA 1DC4A 1NAIA 1I8TA 5DF1A 1E5LA 4UUOA 4E5KA 5BNTA 1NR1A 1NFRA 1DPGA 3VKVA 1YQGA 1M6HA 1C0PA 2DTEA 4I5EA 4DQUA 3ADPA 4KTVE 2DVMA 1VKOA 3FR7A 4ONEA 5JDCC 2EJWA 5TF4A 1YJQA 1RM0A 3G1UA 5H82A 2EW2A 1K2WA 2GZ1A 3CPSA 3JQFA 3UCXA 4KWHA 3V2UA 4ALKA 1NVTA 5I9NA 1C0KA 3NTRA 3IC5A 4CUJA 4NIMA 2FR8A 2O2SA 1MA0A 3ZWYA 1A7AA 5ER6A 3PJEA 1JN0A 2JJYA 4L4RA 4XWYA 2GN4A 4I5DA 4CMIB 2AMFA 1FDSA 2E48A 4BOYA 5L9AA 2H9IA 4BQRA 3H5AA 4AJ1A 1HYEA 3P2OA 4MIEA 4EEZA 2FPGA 4E13A 5CDUA 2P5UA 3RI3A 1ORRA 1PJTA 1GQYA 5IFLA 3RFXA 1EUZA 1FF9A 2PR2A 5BT9A 1ZK2A 2DTXA 2OUIA 5THQA 1F14A 5DDIP 2J3KA 4II3A 3KLMX 3FR8A 1VE9A 3KSUA 1LSUA 3AOEC 3A4VA 4Q3DA 4QFCA 4EBFA 5CDYA 5A03A 2WEKA 4TRRA 4R51A 5ENDA 1I30A 2VUTA 2XOXA 3BHMA 1LDNA 4PN3A 3DONA 4JP2A 5TIIA 5ENVA 3K73O 4J2OA 3E6AA 2GGSA 4CV0A 2CF5A 3TF5A 4I8XA 2F1KA 3AU8A 5DNAA 2UVDA 3QJ5A 4CLDA 1JWAB 1ZCJA 3OEWA 4A03A 4CMCA 2NU7A 3FNEA 4NPCA 4YJHA 1EFKA 1HSOA 2BFPA 2BFMA 4DYDA 3IL2A 4D0SA 2C20A 4RVDA 5JMWA 1A5ZA 4FR5A 4ZQBA 1PS8A 3MCVA 2B35A 4EITA 1WDMA 4KUEA 1L7EA 2C82A 3JSAA 1GUFA 1EBUA 1PZFA 3E1KA 4W99A 4J16A 4B3JA 3HE3A 4IDFA 4NBVA 1H9AA 4WECA 1X13A 4BKUA 1V3VA 3D0OA 3WB9A 2Q45A 3GHHA 3U3XA 3ASVA 1XG5A 5JYEA 3B1KA 2AQKA 3GN2A 3WGYA 1GV1A 1H2HA 3NUGA 3TZHA 1G6KA 2W2KB 4D41A 3ANLA 2XPCA 2IRWA 4QO7A 2Q1WA 4IM7A 2GDZA 5A9SB 3CUKA 1Y9AA 3F5QA 4NR0A 4IJWA 4BO8A 3QW2A 4AJKA 1N5DA 1N7GA 1ZKMA 4PZEA 4JBIA 4XYLA 5I9LA 2C29D 3NJ4A 3GVHA 1U3WA 1ISIA 3H9GA 4OAQA 3LC7O 4MVJI 1IPFA 4OOFA 3WDSA 1YONA 3NDRA 4WNIA 1LLQA 2AEMA 4WK6A 3T7CA 5JDIC 3GNQA 3H7AA 1QP8A 4HKTA 5EESA 2OFPA 1HE5A 3G3EA 1ZK0A 1XU7A 2XAAA 3K5PA 4ND1A 1PZHA 1LLUA 2WYVA 4BNKA 2QZ9A 3FSRA 1WAMA 2Q1SA 5JAZA 2OHXA 1G0NA 1UXGA 2Q4BA 3AM5A 3GRKA 3PHJA 4NJMB 3D5TA 1AN9A 4OIMA 1E5QA 1BW9B 3G0OA 3X2EA 4MVJP 4L0QA 5EL0A 1XSEA 2NQ8A 4LISA 4WLEA 4FFLA 1DEHA 4B8ZA 3KEQA 2W90A 1VL8A 3KRTA 4Z3KA 1T24A 4WLOA 4TROA 2NU9A 4IDEA 1QV7A 4DUPA 4AJOA 4OGWA 2A35A 3HN2A 4DLAA 1M6WA 1WLYA 1DC5A 1QR6A 2J5KA 1CQIA 5JFOA 4JX8A 5JPIA 1F8FA 3A14A 5JY6A 5F5LA 3UUWA 3QWHA 1O94A 4X54A 5KVQA 4CM8B 1PQPA 3QV1A 4FS3A 2D1YA 4K28A 4CMBA 3KYDB 1YL5A 3MJCA 3AOEA 4AJJA 4I5GA 3G79A 4XB2A 3IIEA 2CMDA 3NKLA 3OSUA 2X5KO 3IJPA 3O8QA 2FMUA 2QHXA 4PLTA 4EJ6A 2JAPA 4OQZA 4QO8A 5L4LA 4Q3AA 2VZ8A 3MOGA 5BSGA 2O23A 4Q3CA 4XYEA 1GQ2A 2D5AA 4CJXA 4Y67A 4GSLA 1F17A 2D59A 4CLOB 3AY6A 1ZNQO 3F9IA 2G82A 4QXMA 1U1IA 3JQAB 1Y5MA 1UAYA 4FQ8A 2DT5A 3WGQA 4DMLA 4E5YA 4EJ0A 2WJPA 5AOVA 2W2LD 1NX6A 3JQCA 1R4NB 2LDXA 3G1TA 5GY7A 4BGEA 4BKQA 2CDAA 2DPHA 3VKUA 4O5OA 1ZIDA 3OJ0A 1Z7EA 2X5JO 4O1MA 4AL4A 3K6JA 5G0VA 5L40A 2BF7A 2WE7A 3GY0A 4J49A 4YAIA 4IS2A 1EQ2A 1PIWA 2BGLA 3AK4A 3DOCA 1GZ4A 3RBXA 5GMOA 4ZD6A 3DBLA 3W8FA 4UREA 3E5RA 4TSKA 4U6SA 4CMAA 5BNIA 3RC2A 5IZCC 2O4CA 5JCXA 1KEPA 3JD2A 5I7VA 2DBVO 3EZLA 3L9XA 1YB5A 2VYND 3E9MA 5ITVA 2WYUA 3ULKA 4W4TA 1NASA 1EUCA 3BHIA 1E7SA 3JQAD 4GX2A 1LTHR 2O7SA 1NXQA 1PJ4A 1ADCA 5K6AA 4UUNA 4ZRMA 3C85A 3PEFA 4NU5A 4J1NA 4E12A 1OFGA 3HUDA 3WQRA 2I3GA 2FP4A 3BMQB 3FNFA 1E1LA 4B4VA 1PU2A 1E6WA 3HNPA 4A0SA 4B3HA 3LU1A 2ZTVA 5B12A 3C8MA 1HE3A 2JL1A 4RF4A 3TZ6A 3RWBA 4BO4A 2PY6A 5A3VA 1QYWA 2AG5A 3WTBA 3QP9A 2X9NA 4RZIA 1N1EA 4B7CA 1BXKA 4MP8A 3TSCA 4DPKA 1ULSA 5EINA 4PVCA 4WASA 2PKQP 2D2IA 4RVFA 2OORA 4J43A 3LDHA 4DGSA 1O8CA 1SMKA 2NTVA 5KJ6A 1NHWA 5JAIA 2VCYA 1Y8RA 2JCXA 4A27A 1Y5RA 4H15A 4PGFA 2VT3A 2Q2VA 2C0CA 1H6AA 1P77A 4K6CA 1WP4A 1V3TA 3M1LA 3RSHA 4ND5A 4FDAA 4B3IA 2QG4A 4Y6PA 4ZJUA 3UAGA 4XGKA 5JC1A 3ADOA 3WWYA 4BS9A 3VH2A 1PQUA 5DCYA 2XXBA 1PJ2A 2CDBA 1Z74A 3DWFA 5DP2A 2JAHA 3TQHA 5H81A 5JAMA 1E3SA 4JIGA 2DBZA 3KYCA 4TZTA 4JJIA 1TT7A 1TT5A 2G76A 5DN9A 1HDZA 1M76A 3EUWA 4R3WA 4E5NA 1P74A 4BGVA 4WCFA 2IXBA 2D8AA 5HTOA 1U4OA 1MX3A 3VVCA 3SJUA 4BQPA 3AM3A 4M89A 3EHEA 1Z75A 4AJLA 4CM7A 2O2YA 4R9RA 4AFNA 1WXDA 5BSFA 4AJ2A 2PLAA 5EMHA 3IUSA 1VRWA 1P3DA 4J9VA 1VJ0A 2RHCA 1XR3A 1O95A 4D0RA 1B8UA 1XEAA 3ETEA 3PI7A 3I83A 4HP8A 4F46A 2YV2A 4FBGA 1R12A 2I66A 1U3UA 1DHRA 4J6FA 3MJ4A 2EWMA 5F21A 3LSYA 3GVCA 2WMDA 4HXYA 4E2XA 3PFFA 4E32A 3MTGA 4RF3A 1H6CA 1ISHA 1GCOA 4P22A 4UUMA 1EVYA 3QVSA 1N9GB 1SAYA 3I9JA 3ZV5A 1VL0A 4ALNA 1G0OA 2VRBA 1ZK3A 1F0YA 2D0IA 4XJSA 5BSEA 1D4FA 5DCWA 1T26A 2ZCUA 4RF2A 3RCBA 4BMVA 4PG5A 1ENOA 4TKLA 4XGNA 3L4SO 3INGA 3JQ7B 2DBQA 3DTYA 4EUHA 4L9RA 1E3WB 6ADHA 4FW8A 4D45A 1ADGA 4DWVA 3DQPA 3OQ1A 1Y8QA 3VPHA 1NYTA 3ZV4A 3H3FA 5HM8A 1B3RA 1GYRA 3JV7A 1LC0A 3LLVA 4BV8A 4E6PA 2EERA 3BA1A 1ZXLA 3ZV6A 5F1PA 1C14A 1D7OA 4BO1A 4XZ3A 2EF1A 5TQVA 1EVIA 4BIIA 5K6AC 2JD1A 4Q9NA 2PTGA 3BYZA 1XHLA 4RDIA 1D8AA 2UAGA 4BO9A 3ZWWA 3MJSA 2C2XA 1TEHA 1XDWA 1X1EA 1ML3A 4RDHA 2X0IA 4XYGA 1AGNA 1NWHA 4XGIA 2WD8A 1EMDA 4YXFA 1DRVA 3TZCA 4XIJA 3ZZNA 2X23A 3GLQA 2J3IA 1FXSA 2VWQA 2HK8A 1U2GA 2O7QA 3WMWA 1E6EA 1T1SA 2X7HA 4FFRA 4JROA 4E2WA 4QQRA 4RZHA 1U5AA 2YHUA 2JHGA 3AU9A 3S1LA 3TJRA 3PYXA 2DKNA 1B0AA 4DLLA 3GEMA 1F06A 3WS7A 4B7XA 5DOZA 3H9JA 3DB2A 3VDQA 4PLGA 2OO5A 2CUKA 3F4BA 1EE2A 1ZUD1 3SEFA 3EDMA 4CLRA 1EEHA 1LRLA 3VZPA 3AWDA 1TT5B 3E9QA 3OECA 4D44A 5KOIA 5KJCA 3LQFA 3C24A 3ABIA 5KKAA 2ZKLA 2QYTA 2NQTA 3DOJA 1GR0A 2EEZA 4RLHA 4XQCA 8ADHA 1BDBA 2LDBA 2O3SA 5IXYA 2OZPA 3LF2A 2E82A 3QWBA 2PZKA 3EVNA 3IQDB 4W9NC 1JQBA 1LI4A 5LC1A 4AJHA 4BNHA 1NHGA 3RJ5A 3H4VA 4RO0A 1KYQA 4BKOA 3QQPA 5TX7A 3PGJA 1TXGA 3ZW9A 3VPXA 2V6MA 1FDTA 1R0KA 4R41A 2PZLA 1GDHA 5FI5A 3RROA 4CM1A 1GPJA 4J7XA 2OP0A 4D42A 4DBZA 1W8DA 2VHWA 4WLNA 4CMIA 3AY3A 4M86A 1I32A 2HJSA 3KB6A 2ET6A 4B4OA 3DAGA 2ZTUA 4IY1A 3GZNB 1EVJA 4U0KA 4BNNA 1E6UA 3DL2A 1Y9EA 3EW7A 2NU8A 1R16A 2Y1DA 4BNWA 5K0ZA 4MVJG 4ROSA 1ZEMA 4RVSA 3P5SA 1CIVA 1A7KA 5BSHA 1JTVA 3FRJA 3V1YA 3DBVO 3ZU5A 2GSDA 3VZQA 1BXGA 3I6IA 4ZU3A 2YW9A 5KWEA 2AXQA 1OC4A 4M49A 1U7TA 2W8ZA 3A1NA 2PH3A 1GY8A 3NT5A 5AVOA 2Q4EA 1GCUA 3WOHA 4Y9DA 1ZW1A 3VH1A 1KVSA 2UUPA 1DLJA 3BIOA 3W4JA 3I4CA 2Q2QA 1P0CA 1MFPA 2O4UX 2VOEA 4DXHA 5EPOA 4CPDA 4M87A 3NEPX 1HDGO 4IXTA 1QRRA 1Z6ZA 2NWQA 1IY8A 3IUPA 2YFHA 1ZK1A 1VM6A 3H5NA 4DQXA 1YGYA 2JFGA 1HXHA 3GVIA 2Y05A 2X9GA 2AW5A 3KZVA 5A5FA 3GGOA 2BGKA 3V1TC 1H6BA 3CXRA 2QRJA 4LGVA 1YOVA 1KETA 1HL3A 3E9NA 3H5RA 1D1TA 4QT0A 3TFOA 4UEOA 1XYGA 1ULUA 1WDKA 3H2SA 3IKVA 4IQ0A 1X0VA 4J0FA 4J1TA 4OYRA 1DHTA 4XEHA 5HBRA 3DTTA 2VWGA 1LDYA 3DXFA 3V5NA 1YBVA 4J3FA 1MFZA 3JQ8A 4NBTA 5JLAA 4O0LA 1D3AA 5KJFA 4GBJA 1EQUA 3L4BA 2CF6A 3RBZA 1NQOA 4CQMA 2BI8A 3B20A 3MJVA 3IDSA 4GLOA 2H5LA 4B4UA 3DHYA 1YBMA 4CMKA 2VRCD 4BNTA 3I6QA 3NRCA 4I5FA 1KEWA 1DIBA 4BNXA 1LDGA 2NUAA 1PL6A 4JQCA 4W82A 5B4VA 3TOXA 1DC3A 4WLFA 4ALLA 3V2HA 2EHDA 3OMLA 3Q3CA 1CF2O 4HNGA 4C7KA 1UZNA 4LMRA 2CZCA 1I2CA 3DR3A 4NHEA 3NDIA 2WD7A 1CQJA 4BL5A 1M75A 1LX6A 1UAGA 1EFLA 1WZIA 4UAGA 3Q6IA 4IMPA 4Y6SA 3WYEA 3H8VA 4B7UA 5A1TA 4W6ZA 4WCFB 1O0SA 1DDOA 2GUGA 3D3WB 4U7WA 1F8GA 2AE2A 3D5QA 3UVEA 2AE1A 3MTJA 4XQEA 2O48X 5C5IA 3U09A 3VOSA 1Q2XA 4I9UA 4EGFA 1UXIA 3WFIA 4CR7A 2Q50A 4CM6A 3LT4A 3DMTA 4EJMA 1NWCA 2BRUA 3IJRA 1T25A 1J49A 1DIGA 1LNQA 5B4UA 5IZCA 4B8WA 3D64A 4YAGA 1LC3A 2GD1O 1JVSA 3ON5A 4DIOA 1A71A 4GGOA 5IAAA 3K9QO 4BKRA 1Y81A 1HF3A 2NM0A 5T6BA 4UVDA 3JD3A 5CEEA 1NP3A 1J5PA 1CJCA 3VH4A 3WLFA 2Y0EA 1PGPA 1GEGA 5A02A 2B5WA 4YDRA 2RH4A 1ZZEA 3FBGA 5A9RA 4PLYA 4TWRA 1MLDA 2GO1A 4GI2A 5CHEA 4GWGA 1P1KA 4RGBA 4YAJA 2FZWA 2HAEA 2J5RA 3RVDA 1YDWA 4DRYA 5C7LO 5LDHA 4YT5A 3ZW8A 2HDHA 1I3NA 1U8XX 1LRJA 1O5IA 3QWAA 5JCJA 1OI7A 4II2A 3EY4A 1TLTA 1HKUA 1P1IA 4NK5A 1U3VA 2P9EA 3QVTA 2V6FA 2DBRA 3DFZA 4OJNA 3WFJA 2P5YA 3UF0A 3INRA 2DC1A 1PJCA 4YT8A 2ZQZA 3O9ZA 3WBBA 1ZVMA 5AYVA 5JY1A 4EUFA 1MC5A 3AJRA 1I10A 2IDZA 2XXJA 1VSVA 2VYNA 1CEQA 1I3MA 3GDFA 4IGFA 4IZIA 4E0BA 1W4ZA 4YAKA 3RKUA 1H0KA 1TA4A 3G49A 1OMOA 4OOEA 3OJLA 3CZMA 1Q7CA 2A92A 3KO8A 4UEJA 2BMAA 5G0UA 1JW9B 3UICA 2FPIA 3W8DA 1SB8A 2YV3A 1VKNA 2QZZA 5CP8A 3ZNQA 4N5LA 1LSJA 1NM5A 2I76A 2VQ3A 3LC2O 1PGNA 3WYBA 3NAQA 3WJAA 4IXWA 2C7GA 3JYNA 1EZ4A 2B5VA 5DOVA 1DO8A 1EDOA 4GLLA 5KJ1A 3GDOA 4FB5A 2NLOA 5DBFA 3GEDA 4YYZA 3VHRA 4FN4A 1ZSNA 3BXXA 1EK5A 3DOOA 4BNJA 1PQWA 4YRDA 2H63A 2VHZA 2OBNA 8LDHA 2PV7A 1H6DA 1W73A 1YWGO 2FN7A 2Y1FA 2EP5A 2PKRA 3ZWAA 3EYWA 1KVQA 2Z5LA 4LSWA 4YPOA 4CV3A 2X0RA 2GN8A 3Q11A 4XDYA 3OH8A 3GVPA 3OFSA 1PL8A 2NADA 2Y93A 3JD0A 3OHSX 4JNKA 3AUAA 1SCUA 3H3JA 3PLRA 1HTBA 1T2FA 3F5SA 1J6UA 2FOIA 2EV9A 5JAQA 1IZ9A 4ZA2A 5DBGA 1EVZA 4LMPA 2Q2WA 3KHUA 3OIDA 3ONDA 4PLZA 3X2FA 2WWRA 3JQDA 5B4TA 5IN4A 1NBOA 3WGOA 1ZMOA 5HWSA 3KSZO 1KERA 3GVXA 3WIDA 4L8VA 3JQEA 3GPIA 4Z0TA 1WVGA 3TRIA 2IODA 4MJLA 2HKIA 1A72A 4F3YA 4CLRB 3JCZA 4J90A 2E37A 3LYLA 5ICSA 4GWKA 3DEYX 4MO2A 5JO0A 4BUCA 1UXJA 2W2KA 3RC7A 1AHIA 5IZ4A 1PS0A 3EAGA 4O63O 3QVWA 1C1DA 3R3SA 3R6DA 3ZWMA 1NNUA 5IF3A 1BW9A 3KV3O 3FPCA 3GG9A 4NJMA 3ZCXA 1Q0QA 1XQ1A 3PVZA 4WPGA 3AUUA 3AOGA 1QYVA 5CPBA 2GF2A 4YR9A 1PJSA 1YKFA 1GYPA 2YY7A 1E3LA 3PFWO 1KC1A 3DZGA 3OEYA 4HUJA 7ADHA 5CEFA 1ZMTA 4RCVA 4UVEA 5BQFA 1KY5A 4CLEA 2DUUA 2CNBA 2NU6A 4MVJH 4WLVA 5TJ9A 1SZJG 2X5OA 1RKXA 4R69A 5ES3A 2AQIA 5T67A 1BMDA 2DLDA 3PHHA 4NNJA 4A73A 1Z73A 1XA0A 1HT0A 4BB5A 4XRGA 2ZJ1A 3NJ8A 1H5QA 3RAJA 1LU9A 2BELA 1YBAA 2IZ0A 5DBIA 3IS3A 3ZNNA 3FBTA 4J4BA 4EUEA 3E18A 1IYZA 1IB6A 4S1VA 2VHYA 3FI9A 4GL4A 4I9HA 3AY7A 3H2ZA 3R1IA 2HRBA 3JQ9C 4CV2A 1QMGA 3LT2A 1LSSA 5ADHA 1E7YA 1X15A 1GPDG 2Y67A 3TL3A 3OICA 1FDWA 2HMUA 5T8KC 3WQSB 4TRMA 2G17A 4M8SA 4OXKA 4Q3BA 1NFQA 3BAZA 5A04A 1RYDA 1KC3A 3ITKA 1NQ5A 4J0EA 2ZATA 1C1XB 2PGDA 3ZI0A 1BDMA 5U4QA 4ZQHA 4RQTA 3ENKA 3ETDA 1XCBA 2VOJA 1P1HA 4WNCA 2IZZA 3DMTC 4CLXA 4KP7A 3BMNB 3CEAA 3C3XA 3JQAA 1SEPA 3RC1A 4BNFA 4CR8A 1NPTO 5JE8A 4DYVA 1BVUA 4WCFC 2C5AA 4WKGA 1JWBB 1XGKA 3PP8A 1W0CA 1KY4A 5COBA 3KUXA 2IE0A 3PYLA 4R3NA 4JN6B 1LSOA 3KOUA 2ILTA 3VC7A 3KLPX 3T7EA 1XELA 1LDEA 5CDTA 1V8BA 1A4IA 1HEUA 1DLIA 2PGLA 4FFPA 1GUYA 4D3DA 1I2BA 4KDFA 4DIFA 3GUCA 1DJQA 2PNFA 3DZIA 3GH3A 2VZ9A 4TRJA 4RVHA 4FC6A 4FJ0A 2O3UA 4J4TA 3ZN2A 2CFCA 1HDRA 1PJ3A 4PRLA 5HS6A 2JD2A 4RV9A 1X7DA 1ARZA 1N7HA 4QFDA 1UZLA 2NVWA 1R4MA 2Y1OA 3STHA 1WZEA 1UP4A 3SVTA 2NTNA 3H65A 4QECA 2SCUA 1QORA 1ZXBA 3C1OA 3O26A 3OF2A 4M54A 4YRBA 1X0XA 1V0JA 4YJGB 1FDUA 2ZTLA 3WJ7A 4CM9D 2YDXA 3JYOA 4GMGA 1I5RA 3BMOB 4PVDA 2CY0A 1LUAA 3FCOA 3K2BA 3RBVA 4HY3A 2EW8A 2RAFA 4PG4A 1A9YA 5CDGA 5C7OO 3WGZA 1DRWA 4NU6A 1R0LA 1SBYA 2C7VA 3BTUA 1LEHA 1QYDA 3GFGA 3ZHYA 4DC0A 2Y1GA 1WDLA 2EGGA 4W9NA 4E30A 1Z82A 4D3SA 4YAEA 2DU8A 2BLLA 2QW8A 3ROPA 1L7DA 3WQQA 1K0UA 2ZQYA 5EJ2A 4BNZA 4R9SA 3MJEA 4GQAA 2GLXA 1RYEA 3H9UA 5DZSA 3K2EA 2GERA 1OC2A 1ZO8A 3DFUA 1J0XO 4CM9A 4ZQEA 1P9LA 3JTMA 4HFJA 4Z3DA 1PL7A 1GZ3A 3WMXA 4OKNA 2VYVA 3MJTA 1L1FA 5I7FA 2BKAA 4TKMA 3GHYA 1NQTA 2WYWA 3PLNA 3D4OA 2B4RO 2ZB3A 4U5QA 2GRAA 3HWRA 3CSDA 2NTJA 1DSSG 2IYOA 3VTFA 4A5OA 5IXSA 1EDZA 2OL4A 3ETGA 5LDGA 4DPLA 4E5PA 1GU7A 4RVGA 4UVHA 3PTZA 4NZ9A 5BNFA 3WBFA 2HQ1A 2JD0A 4KZPA 5IN5A 5TNXA 1LRKA 2CD9A 3NDJA 1M67A 3KETA 1B2LA 4R1NA 5AXAA 5JW6A 1KVUA 3GA0A 3ORFA 1YVEI 2A9FA 3GPDG 1IE3A 4GSKA 2YV1A 2X9VA 2HK9A 2J5QA 3U5TA 1PR3A 4U0JA 3LZ6A 2FHSA 2HO5A 4E21A 3PJGA 2HMWA 4JGBA 1DIHA 4MINA 4LK3A 3F1LA 4W7HA 3W1VA 4GGPA 1CYDA 2YYYA 3JQ9A 1ZBQA 3K30A 3VDRA 2CDCA 3GK3A 4PLFA 2TMGA 3RUAA 5EERA 2G1UA 4YACA 3PWKA 2B83A 4IBOA 3S55A 2H1SA 2O3TA 1D1SA 1B3BA 3L6EA 3GNTA 1N9GA 2Y68A 4TRNA 1X1TA 2YQ5A 3WIEA 1VJ1A 4TVBA 3EC7A 4QEDA 3U4IA 4KUGA 2YHIA 1LXCA 1NAHA 1MG5A 4XD2A 4LRTB 1RM3A 4E3ZA 2HMTA 2QYSA 4IDCA 1XKQA 3M6IA 4BO3A 4LVCA 3IKTA 1JKJA 1SPXA 2VWPA 2BGMA 4JJGA 3F46A 4NBRA 4EW6A 5T64A 5TGDA 2PFGA 3KYBA 3EVTA 4FOSA 2RHRA 3C1AA 3PDUA 4JBHA 4M1QA 2NVUB 3L9WA 1R66A 2NNLD 1BWSA 2FWMX 3N58A 3QY9A 1FDVA 5TLSA 2GN9A 2Y1EA 4CL8A 3WTCA 3EGOA 4RVUA 3PJDA 4P38A 2BI7A 3RUDA 4J4HA 1IHXA 3DZHA 1I24A 5ER9A 3D3WA 5JO9A 1SNYA 5TS3A 5FF9A 1E3JA 3PHLA 5MGBA 3TL2A 3UH1A 3H9EO 4Q39A 1PX0A 3WGHA 1SO8A 3C7CB 3NGLA 1XQ6A 4INAA 2RCYA 1NPDA 3BZUA 4CQLB 4UULA 3JYLA 4ID9A 2BH9A 1BVRA 4Y8VA 3UCFA 1HDCA 3ZWCA 2Y99A 1WWKA 2X58A 3AI3A 1GEEA 5TT1A 1M66A 2FR0A 4KDEA 5EQFA 4J9UE 4IZHA 1ONPA 3HZZA 3CH6A 4PG6A 5ICMA 3P7MA 4ESOA 1VSUA 2FR1A 4N5MA 4L4XA 1B8PA 5IJZA 1Q7GA 4XQ9A 4MP3A 3S8MA 1DFHA 2QX7A 5FWNA 3C7AA 3LC1O 3NYWA 1V9LA 3UCEA 2P2SA 3RU9A 3TPCA 5DCUA 4D46A 3ZWBA 4PFJA 4OSPA 2I67A 4CQMB 3DZFA 3L6OO 1HLPA 3VH3A 4O59O 2P91A 4IQ8A 4O6VA 3K8ZA 4EI2A 5FEUA 2H6EA 2Y0DA 1IZ0A 4OQYA 5A05A 1H94A 3HDQA 4GX0A 5AXDA 2JCVA 4RF5A 7MDHA 4YJFA 3WYCA 3LT0A 1SB9A 3AM4A 2GCGA 3BMNA 4PLVA 3VZRA 3F4LA 3I52A 3RUFA 1HETA 3GN1A 1ENZA 1ZK4A 1T1RA 2YJZA 3PJFA 4R54A 4N54A 1R37A 4XX0A 4I08A 3AUSA 4YJFB 5TT0A 1KIFA 5MDHA 3HQ4O 1V3UA 1P31A 3HG7A 1P45A 1GTMA 3EZYA 1MP0A 2C5EA 4DLBA 3TDKA 2CSUA 4MVJE 3WG9A 4U8GA 3TN7A 3WNQA 1LBEA 5G4LA 2D3TA 4DQVA 3UKOA 3I9KA 1TI7A 2ZK7A 4YA6A 2W4QA 4CM4B 1C1DB 4CLHA 4XJTA 2E6UX 1RM5A 3SC6A 4FSHA 5FI3A 1Z7BA 3RUHA 1VL6A 4TVOA 3W6UA 1N2SA 1E3IA 2NACA 3GOHA 5CDSA 1E77A 4ZRNA 3ROMA 4PZCA 5G0TA 5KIAA 2Z95A 4OL9A 2HU2A 5IDXA 1JAXA 2B69A 2D5CA 4L74A 4Z6KA 4LCEA 2CVOA 1YOVB 5KVSA 3W6ZA 3E82A 1JU9A 3UHAA 5T5QA 1EK6A 1KVTA 3BMCB 1OZAA 1F12A 1YJ8A 3PDJA 4MP6A 3S2EA 2OXIA 4WGGA 3PZBA 1LLCA 4J2HA 1X14A 4D3FA 2C54A 2VTEA 4I1IA 4E5MA 4XA8A 2QRKA 3JQFC 5TRTA 2GZ2A 4YJDA 3U4HA 3QLJA 1I33A 1KS9A 4AJ4A 2AEJA 1K6XA 4E4YA 3I1JA 3P2YA 5KVCA 3WGTA 3OJFA 1BTOA 4AJEA 1HSZA 5IDWA 1Q1NA 2R2GA 5U1PA 3PGXA 4J1QA 2UYYA 4ZN6A 3PIIA 4NI5A 2C2YA 4AJIA 1P1JA 3GT0A 3LF1A 1XLTA 2EKPA 3CMMA 2JCYA 1UDCA 4KWIA 3PXXA 5JNLA 4NFSA 1A4UA 3ZU4A 3ZU2A 4XQGA 1C3VA 1I36A 3PZRA 1ID1A 4OH1A 3JQBC 1SOVA 4FFMA 3O03A 1EUDA 1GQQA 4KUHA 4YQYA 4QTZA 5LCXA 5GZ3A 3JYQA 4BNMA 4H3VA 1A9ZA 3ENNA 1K5HA 3WLEA 2WTBA 2ZYGA 3AI2A 5JS6A 4GVXA 1K6IA 2A94A 2ZB8A 2FY8A 1H9BA 2B36A 3FTNA 1LDBA 3DBRB 4IQGA 2IXAA 1OAAA 3I4FA 2Z1MA 4BNYA 4I9NA 2FZEA 1YE3A 4P4NA 5F3RA 5C3MA 2I3AA 1JKIA 2YQ4A 4FJ1A 4MVJA 4RJTA 5ILGA 5F1KA 4DPMA 1NTOA 1Z45A 4C7JA 1NPYA 1P0FA 1DAPA 1WMAA 3M2TA 2YHIB 5THKA 1QYXA 3NV9A 2GASA 4S3MA 4ILKA 4AICA 3DMYA 2Q99A 1CERA 3PWZA 1YB1A 2NVBA 4YEDA 5I8ZA 5J23A 4BGIA 1JDJA 4G2NA 5JMPA 5A9SA 1ZFNA 2P4HX 1W6UA 3OA2A 3FNHA 4A26A 4EYEA 4E2ZA 4URFA 2VTDA 4AJPA 3T4EA 2EGHA 1E1NA 2X86A 3GZ4A 4BO0A 4BNGA 1Y8QB 3WICA 3V1UA 1KBZA 3T4XA 4PG8A 3GEGA 3O38A 9LDTA 5GZ1A 3I3OA 4PLHA 1ISMA 1IHYA 1I3KA 1U8FO 4ND2A 1YRLA 4NH4A 1C0IA 3OJEA 1BRMA 3TFQA 3NGXA 1MUUA 4NJOA 3TNLA 1YQDA 4ZQGA 3OQBA 4LRSB 1ISGA 1UJMA 4CM5A 2EP7A 1E7WA 4FD3A 4J7CA 4K9DA 3SXPA 2PD3A 4HV4A 3WGIA 3OBBA 2OGUA 4F45A 1TB4A 3GR6A 5AXCA 2DFDA 2A4KA 3Q2KA 2JKVA 1PWZA 1QKIA 3SBOA 2DAPA 1MXHA 5ILOA 1ADBA 3UGKA 1B16A 1QLHA 4XYBA 3QRWA 1PTJA 3A28A 4IDDA 3RD5A 3AUTA 3I9LA 1AXGA 2B37A 5DP1A 3QA9A 4XCVA 3D1LA 4FFOA 4P4GA 3JQGB 1PGJA 3JQ6A 3ICCA 4PLCA 4RQUA 2DTDA 3VPSA 2V7PA 1H2BA 3WR5A 3M1AA 1QXSA 2Y0CA 2HSDA 1SEVA 5L45A 5CFZA 1YQXA 3GNSA 4BB6A 1K6JA 4IDGA 1O89A 2RH8A 3WNVA 4GMFA 1YH3A 3Q1LA 2DUWA 2VWHA 2Q46A 4GPD1 5L51A 3RASA 2X0NA 3MOIA 2PGJA 4AG3A 4MIOA 1NVMB 4YT4A 4N18A 2X6TA 5COQA 5TJHA 4NBWA 4NFHA 4DL9A 5DULA 4E2YA 3NTOA 2I65A 4W7IA 3U0BA 4LN1A 4ALJA 2DFVA 3OIGA 1HZZA 3VTZA 1I2ZA 3FHLA 4BHTA 3C7DB 3F6YA 3DDNA 3KXDA 4XYMA 3ANNA 1BGVA 2B0JA 3QWIA 1DBVO 4DTIA 2GPTA 2P9GA 1HLDA 4ZVVA 3VAZA 1UXKA 1DC6A 3GC6A 2VHXA 3ZWPA 4D43A 1KOLA 1EE9A 3NT2A 2OP1A 2X1HA 1LA2A 4N5NA 2YZ7A 1PSDA 3KBOA 1P33A 1E92A 3ZHXA 4H16A 1HRDA 3BTVA 4MIYA 3ITDA 3GAZA 2RBEA 3OETA 2HLPA 4GKBA 1E7QA 3GUYA 4R68A 1I3LA 1NR7A 1U28A 1U5CA 3R3JA 4RPHA 4MDHA 3O4RA 1U3TA 1V6AA 1GYQA 2G0TA 2V6BA 4QSMA 5G2OA 5I8WA 1C1XA 3W4IA 3ZH2A 1V35A 2Z1NA 4MKXA 4HX5A 3HFSA 4K1LA 3UN1A 3UW3A 3SC4A 4FC7A 4XRRA 4YJHB 3AFNA 3NT4A 1HDOA 1P1RA 2G5CA 1E1KA 3AI1A 4N7RA 4RORA 2EKQA 4WUVA 2EKLA 4FIZA 1JVBA 3H9QA 4Q3NA 3FWZA 3HJAA 4HFRA 2VYVD 4A10A 3CIFA 1GAEO 3SJ7A 4WE3A 1AUPA 5JDCA 2O3QA 3CZRA 3SLGA 4DC1A 1P44A 4JK3A 1P1FA 4ZICA 3CINA 3ST7A 4ND4A 4E33A 3DAPA 4E31A 4EEXA 1TVEA 1PZGA 1PZEA 2IZ1A 1UDAA 1NVGA 4GAEA 1B8VA 1UH5A 4YTEA 3E03A 2VHVA 5CAEA 2EJVA 3GF4A 4CV1A 3VPFA 1N92A 4IJUA 4MOWA 1QG6A 1ZSVA 4BKPA 1LQTA 1T2EA 2OBYA 4MVJM 4EDFA 4U6QA 2PZMA 1WW8A 2UUOA 3I9NA 2W2LA 4WOJA 2PWZA 4BMSA 2B4TO 3PYMA 4RPGA 3WGGA 3Q0EA 1CWUA 3GZNA 2NV6A 3OP4A 2QRLA 4JP3A 4MKRA 4LSMA 4YJGA 5L7TA 5L7YA 1VC2A 1CDOA 3HDJA 2DPGA 2NVUA 1Y1PA 1GUZA 2FRDA 2PD6A 3VVBA 3DC2A 1M2WA 1DOHA 5L95A 4NFYA 3KSDO 4BO7A 5L7WA 1ONOA 4OHUA 2E49A 1LJ8A 4YRAA 1UP6A 5EQDA 5AQ1A 1E1MA 1U4SA 3OJOA 3RU7A 4J1SA 4F6CA 3ICPA 1MXFA 1QLJA 2OOSA 2E4AA 1IOLA 5CPFA 1PJQA 4CQLA 5CG1A 1ZJZA 4ALMA 2BD0A 1IUKA 1U9JA 4QX6A 4HFMA 3HN7A 3KYCB 1Y6JA 2AEFA 3L4BC 4XB1A 4CMEC 1YL7A 5IDYA 5K9ZA 4BO5A 3ZDFA 3DBHA 4Z0PA 2I9PA 3WSVA 2WE8A 1GZ6A 2GR9A 3OM9A 3F3SA 3JQ8B 2AA3A 1UDBA 1YB4A 1YL6A 2V65A 3PQDA 5HA5A 1GFSA 2BFOA 1XU9A 5KNLA 5JYDA 3JQGA 2HMSA 3E8XA 3GG2A 2EXXA 3EK2A 4BV9A 3DZJA 1WMBA 4NG5A 4CMEA 1UUFA 2HRZA 1UP7A 2GZ3A 4HBGA 3DAFA 3GQVA 2GYYA 3FF4A 1U7HA 1MC4A 1QSGA 2AQHA 1BXZA 2W98A 3BMCA 4CMGA 2QIOA 3ONEA 4UEKA 2PH5A 1HYGA 2AG8A 3PQEA 3QVXA 3UOGA 2EIHA 3ZNPA 1DIRA 3CKYA 3IMFA 1JLLA 1U2DA 1KEVA 4ALIA 4JCOA 3DBLB 2O3JA 4KMSA 4MKZA 4OXYA 3ZV3A 4R1TA 2FPPA 3RFVA 3BTOA 4KTTE 1ENYA 4NDNE 2GNAA 3I9MA 1IULA 4CM3A 3F1KA 4Q3EA 4BMNA 3I9OA 5B37A 1R6DA 3WWZA 1Q0LA 3UFXA 1ADFA 3D7LA 1WPQA 1HDYA 3JD4A 1ISFA 2BFAA 1BXGB 4IPTA 3ZHBA 4PLWA 4R16A 3TWOA 4EZBA 1Q0HA 2Q1TA 1DFIA 4IJKA 3FTPA 5I7SA 3S2FA 1XIVA 4CLOA 1RWBA 3FWNA 2GN6A 1KVRA 2OMEA 3I5MA 3QIVA 3FNGA 4WEQA 2I6TA 5L53A 1LDMA 1DRUA 2PZJA 1Q7BA 3RC9A 1I01A 3K96A 3ZHZA 4IGEA 2CVZA 4GH5A 4CM4A 2P9CA 1PEDA 3KM0A 3RUIA 4PLPA 1B14A 4UVGA 4YCAA 2ZIZA 4BNLA 4OKIA 3COSA 2V6GA 1R15A 2UDPA 4IMRA 3JQBA 1BG6A 1YXMA 3MZ0A 5JBIA 3FPLA 1BHSA 4R4JA 3ZWNA 3INTA 1MB4A 4LW8A 5KJEA 4FGSA 4JJFA 1AXEA 4KOAA 3GMDA 3MWEB 4GX1A 3GAFA 4GX5A 4XR4A 5F1OA 5C37A 3JQ7A 3SLKA 4BO6A 5L4NA 1R0SA 3O8QB 4GVLA 2O50A 4TQGA 3F47A 3H6KA 1DB3A 1B15A 1J4AA 1E7RA 1DAOA 1SC6A 2C07A 2R00A 3Q9UA 1Y8RB 4GKVA 3DBRA 1G1AA 1UR5A 3TZQA 4CMHA 2ZTMA 4L73A 5EN4A 1VI2A 4DMMA 3E48A 4PIVA 2IYPA 4CR6A 1HE4A 5U9CA 2J3HA 2AQ8A 4IDBA 3VZSA 3DBHB 1E3EA 5A4DA 1QYCA 2F00A 4ND3A 1SOWA 3HDHA 1H93A 1PJLA 1RM4A 2C59A 3A06A 4IDAA 1CRWG 4ZQFA 1Y7TA 3IAHA 1AHHA 3GGGA 2PK3A 2WD7B 1NQAO 2P68A 4RPJA 1JA9A 4YVFA 3GFBA 5TSDA 5KTKA 3DHNA 4FCCA 2P4QA 3Q2IA 5JC8A 1CETA 1HZJA 4R01A 3C1TA 5BR7A 1FK8A 2D4AA 1LLDA 2Y1CA 4JXKA 3LT1A 4WOKA 4J7UA 3Q9NA 1PGOA 4ZHSA 1T2CA 3R0IA 1B7GO 1C0LA 3P19A 4UVIA 3V8BA 2JHFA 3FD8A 4NQZA 1NFFA 4H7PA 4IIVA 5CG2A 4AJNA 4Y6RA 3L77A 2QQ5A 3D3EA 3S2GA 3GMSA 4BNUA 5EIOA 3PRJA 5FFFA 1JAYA 2ZCVA 2X0JA 4XIYA 5COAA 3U9LA 2VT2A 2POQX 2JFHA 3ROQA 3DZKA 2YUTA 1ZH8A 2HK7A 2Y66A 3BMQA 3PK0A 3PHIA 3IP3A 1E3WA 3CMCO 2HUNA 3RQSA 1DJNA 2Q1UA 2RIRA 2J3JA 2PA3A 4DA9A 3S2IA 4R1UA 5H83A 3NTQA 4LCJA 5JCJD 5JDIA 4IIUA 3RFTA 1I0ZA 4HFNA 1ISJA 3BTSA 1OOEA 3D4NA 2FSVA 2AHRA 4DBVO 4FOOA 3U4DA 4CUKA 3KVOA 5TC4A 1PWXA 2ZYDA 3ROKA 4PRKA 2IEDA 3LK7A 1E0DA 2NSDA 2HJRA 4DVJA 5A3JA 3TOZA 1T4BA 5AXBA 3W8EA 3K31A 4UUPA 2ZB7A 1EBFA 2VZ0A 4G81A 3RUCA 1LQUA 3PHGA 4YBZA 5KCZA 2UV8A 4FFNA 5A5EA 3ANMA 3PWSA 3WXBA 4PCVA 3RKRA 3D4PA 1HWYA 3G17A 4YT2A 3U62A 4C4OA 3FN4A 3AFMA 4OXNA 5GZ6A 2WM3A 4DREA 3HHPA 4AVYA 3ZGYA 1GADO 1S6YA 5T8KA 3EMKA 2WDZA 4D7AA 3DO5A 4P8RA 4WLUA 2X4GA 1KEUA 4FPXA 4BO2A 1GL3A 3IOYA 3V2GA 1MV8A 3HSKA 3L0DA 4B79A 1O6ZA 4Y98A 1HE2A 5T57A 4HNHA 2IEBA 3N7UA 1T2AA 5L4SA 4TZKA 5KVVA 5KKCA 2XF8A 3K92A 4G5HA 5F5NA 1PGQA 4KQXA 2HMVA 3MEQA 4J91A 4YB8A 1DXYA 4RLSA 4A7PA 4B4WA 3HADA 1FJHA 4IINA 3N74A 3MWDB 4HWKA 1O9BA 1FMCA 2VNAA 5IG2A 4ITUA 2WSBA 3GRPA 3KYDA 3JD1A 3TZKA 3ZU3A 1IPEA 5I7EA 3A9WA 4L76A 2VRCA 4BVAA 1IL0A 1ZEJA 4OM8A 4R5HA 4MVJD 4IS3A 1HYHA 1RPNA 5CEJA 1UXHA 4CQMD 4FJ2A 5G0WA 1S7CA 4Z9XA 4FGWA 1RJWA 5B1YA 6LDHA 5A06A 1VPDA 1YO6A 2CVQA 3OQ6A 2B4QA 4QUKA 4JBGA 3RJ9A 3ASUA 3QWFA 3M2PA 4NK4A 3HDYA 5G4KA 1HDXA 2X22A 3PQFA 3HFGA 2TMDA 1ONNA 3QHAA 1X7HA 4ZGWA 5G4KB 3E5MA 2J8ZA 3LLSA 2Q3EA 4RPKA 5I9MA 1VJTA 4CM8A 2ZJ0A 2HCTA 3KEOA 3BMOA 4KQWA 3QE3A 4LVUA 3RIHA 2Q49A 2PKQO 3SX2A 1MG0A 1YS4A 4IJVA 4OSOA 2R00C 2R6JA 3ZWOA 4IUYA 1ZSYA 4RPLA 4MPDA 5ITWA 2VUUA 2ZYAA 5HS4A 4YWJA 5C7IO 4XKJA 3OA0A 5L3ZA 1N8KA 1ENPA 1QV6A 3AW9A 4XDZA 4D79A 3GGPA 4K6FA 1DFGA 2X8LA 5G0SA 3B6ZA 3RUEA 5JXWA 4JLWA 1GD1O 4YQZA 1K3TA 3QSGA 2DM6A 4L75A 4Z9FA 4F6LA 1BSVA 4BNVA 1PJBA 1T4DA 4A2CA 1UZMA
chains in the Genus database with same CATH superfamily
3HACA 4ER3A 1VLLA 3TTSA 3B1XA 5A5GA 1R4NA 2DQ4A 4B0OA 3PXGA 1INLA 3CTMA 3DMRA 3HJGA 4OO3A 2QP3A 4DS3A 3GDGA 2A88A 3UXYA 2GBLC 4LVOA 3T52A 1R0BA 1JQDA 4K05A 4QUEA 3KOMA 2JFYA 1C4WA 1AGYA 3L6DA 4YJ3B 5AI4A 3T7RA 1KZ6A 3ESAA 3ONFA 4F5DA 3X1WA 3C3DA 1ZR2A 1MGOA 4F2WA 4YONB 5CLHA 2F43B 1CCWA 3LXXA 3DVLA 2BFCA 2O3RA 4X3PA 1NXTA 3CE6A 1TYEB 2WA2A 1OCEA 1RABA 5HRUA 1U7DA 4J3JA 1FXWA 3JQPA 2JFFA 2FU5C 3B70A 3JYPA 3WSWA 1MF7A 1NOJA 1WMFA 1T29A 5DYNA 3SHWA 3LQYA 4J29A 2GVNA 1NLUA 2P1ZA 5JSUA 5FX2A 2H85A 4JL6A 5EWMA 1FL9A 1WOYA 1CR2A 4WCDA 4RJIA 4DIBA 1KDOA 4K26A 3PNLA 4O4HF 4CMJA 4BNIA 4PHCA 5IMBA 4NBUA 5IDQA 4F3CA 3QBDA 1U2RA 3B1JA 2NW6A 2ZRCA 1WRBA 3NXSA 1E7MA 3HBAA 4IRXA 4WEOA 5A4KA 2HBYA 1CBUA 1NUQA 3SZ3A 1DQYA 4LYYA 2FW9A 5BQOA 1YFLA 3IXQA 4RTMA 2WJGA 4HAYA 5HK9A 1C9JA 1NUPA 1XOIA 4DNXA 1OYYA 1YDEA 2Q6LA 1YI1A 3DEJA 3NX4A 3L6RA 1FBNA 2VBCA 1PT5A 1UXOA 4DUZB 2E4YA 2PEZA 4HYTA 4B8YA 4HS9A 4L5AA 4I50F 4E5KA 5BNTA 5AW2A 3ZDAA 2L69A 3DKPA 3FZQA 1LBQA 4UM5A 4I5EA 2QA5A 3K5WA 2FFBA 3VAAA 3FPKA 4OI4A 2MT9A 3H6GA 3W77A 2ONZA 3GA5A 3KZCA 4B2PA 4KVAA 1XZBA 3G1UA 4ZMRA 1M6EX 2Z8ZA 3I3SR 4JXJA 4PIMA 5H82A 3VHXA 4LHXA 4ZDIA 1M1NB 5BPFA 1OXSC 2JA2A 4OHPA 4HAIA 4ALKA 5I9NA 1XJ0A 3NTRA 3SS9X 5CD1A 3K4HA 2OSBA 3UENA 2O2SA 2WJZB 5E3HA 4O4IF 1DINA 2XQVA 4RH1A 4MV7A 4M1EA 4DLXA 3U7HB 2ST1A 3ZX5A 2FN8A 4ZOLF 4YUAA 5KQSA 4EHNA 5FUQA 1D2GA 3SQDA 1LBTA 1Q6YA 5JS8A 1Z8NA 5K6TA 4CMIB 1O54A 2AMFA 1FDSA 1D0SA 3PQ3A 3LWZA 4BOYA 5JQGA 2RGEA 4PNHA 5DT2A 4BQRA 1GXSA 3QMWA 2TMYA 4PM4A 2PKWA 4AJ1A 4MIEA 3E3NA 2OHFA 1Z34A 1BMFA 2K87A 4XLLA 3LYUA 4Q19A 1WW3A 3RB8A 1BE8A 1ORRA 1BEEA 3GXOA 1GQYA 5IFLA 2PR2A 4B6EA 2DTXA 3BK1A 1MMFB 4NOJA 1F14A 2ZZKA 2J3KA 2RBKA 3AVWA 1GR1A 3NETA 1MIOA 2ABWA 3FR8A 3W3AH 4ENTA 4Q3DA 3ID6C 4KSYA 1SG9A 3RHFA 5AUOB 2FK8A 5LLSA 4FMCB 1M34A 4R51A 1KMQA 3MPOA 4ZCQA 3V00A 2AZDA 1U7XA 3BHMA 1D2NA 2ZS8A 4Q7QA 4BLTA 1HT1E 2YJTD 3UMVA 1JL3A 2WWGA 4FR2A 1G5RA 5ENVA 3K73O 4HH1A 4C0BA 3WLIA 2CF5A 4DMFA 3GLIE 1E8MA 3LIIA 1WZCA 4TL6A 2M6RA 3PDCA 5HTKA 3GT4A 4CLDA 1ECGA 3CEJA 3IT1A 1PJZA 3USES 1ZCJA 3OEWA 4HX9A 1F1BA 4ZVUA 5JHHB 5IUNC 3QE9Y 5CT4A 4NPAA 2XLCA 2NU7A 2ZU6A 4NPCA 1CHDA 2ORIA 3TBHA 4BFXA 1EFKA 5I3ZA 3ZI7A 4DYDA 3LBIA 1USVA 5BV7A 1L4HA 1HE1C 3GELA 3SKXA 3K0HA 1PS8A 4EITA 3M3DA 3TXAA 1WDMA 4GZLA 2D0PB 1P5RA 4KUEA 1Q5PA 1EBUA 4L3OA 4W99A 5C46F 4J16A 5ITZB 1YTUA 3QFRA 1NTRA 4FOPA 4IDFA 4LJ4A 4O2BA 1XEWY 2Q45A 3WRWA 1U0OC 4IJQA 3GHHA 5CNJA 1KPGA 2B1JA 1XG5A 1IZ8A 1ZUIA 1ZN9A 2QJRA 1GSHA 2GB4A 2KE5A 3B1KA 3HU5A 4JJZA 2WINI 3GJYA 4UBKA 3R5XA 5K3DA 3WGYA 5I7UA 1RZ3A 4G4JA 4OQXA 2W2KB 2RAUA 3C5EA 3IAS1 2XPCA 2JGMA 3ZGVA 3VO9A 2WHPB 5JU6A 1XP8A 3CUKA 1NXPA 1Y9AA 4WZZA 4TV9B 3C4QA 4IJWA 1L7XA 2G04A 2NVOA 3NWJA 4M6WB 3UMFA 4DCMA 3OFVA 4MQFB 1AGRA 4NCIA 1GKLA 1DXQA 1N7GA 4RFVA 4CTOA 4RVNA 5HF6A 5I9LA 1ODJA 1WLSA 2XV1A 3QTTA 5IKPA 2QL7A 2OLKA 4BWFB 1NVVQ 5K3EA 1IPFA 3FRHA 1YONA 3NDRA 1PFKA 1L7BA 1DKQA 1LLQA 1H1LA 2R8OA 2JAXA 4A6XA 1H2EA 5L3VA 4UFOA 2WVHA 4GDFA 2YJGA 4WNAB 5ALWA 5LP1A 4YCNA 1V16A 4GM4A 1TADA 1NI4A 3CNOA 4LJKA 1E32A 4BNKA 1Y4DE 2QZ9A 2Y1XA 1WAMA 2Q1SA 1KR2A 3U4GA 3U9SA 3L40A 5JUWA 1YS2X 3MS7A 3A1EA 3D5TA 4OIMA 1D7AA 5P21A 3WI7A 2VTBB 2Q4TA 5TQJA 1MU0A 2XGOA 3RFCA 2K2WA 2E7ZA 4ZKEA 1CV2A 2A6PA 3ZXUB 4OP1A 2C83A 1U3FA 4FFLA 1W4LA 4HC4A 1R1DA 3M33A 4HDSA 4N5IX 4OAOA 2I2XB 2OT3B 1MAAA 1TCCA 4JLUA 1GTSA 3KEQA 1OZFA 1SFRA 1VL8A 3KRTA 3LOQA 3RNOA 1VDMA 4DDHA 5JCOC 1YB2A 4WLOA 2NU9A 2IEYA 1RIIA 2WMYA 4TT3A 3D6NB 4KL8S 2I7VA 3DEZA 1BE6A 4LYJA 1WLYA 1VXOA 1A50B 3UJPA 1DC5A 1Y4ZA 3HXLA 2G9NA 5B6IA 5CD9A 1X8JA 3JU3A 2FQWA 4WI1A 2WM8A 1J8FA 1DEAA 4TV8B 1H42A 4F1KA 2I7TA 5KJCA 5JPIA 1F8FA 2V7UA 2YW2A 3O1JC 5JY6A 1G5IA 1KSJA 2G9ZA 3I9V6 1C29B 1BYUA 3HKDA 3ZWQA 2QUIA 4Z4FA 2R4QA 4FHZA 4US0R 1DKUA 3A6EA 4CWAA 4TL8A 2BGWA 4R9NA 4KK4A 1V3QE 1ATZA 1DG3A 4Y2YA 1GFWA 2Q2NA 3TEMA 3ZHVA 2O5RA 3AOEA 3CCBA 3ZJTA 1WMEA 3KHSA 1J7JA 1J1ZA 3MCZA 4Q01A 4XB2A 1CUBA 3NKLA 5B1DA 1AVTA 2IXGA 4OFZA 3OSUA 3HVHA 2G08A 5IJAA 4C6TB 1IBKB 1T0JB 5BSVA 1VP9A 2P8JA 3SYNA 2VZLA 4AWXA 2QHXA 2GEVA 4PLTA 3K0EA 4EJ6A 2JAPA 4GR9A 4KBGA 3MOGA 1VJRA 2JPDA 2WJ6A 4EATA 3NNDA 1GQ2A 1Z3IX 3T3DA 3Q40A 2FDRA 4CN8A 1EUCB 1OGIA 3NDBB 2I7CA 5HKOA 3BFJA 4I81A 5HZHA 4HNQA 3F9IA 3K0FA 4W5HA 3AR6A 1JSLA 4L27A 1IM2A 1UBOS 1IHUA 4Y0AA 2GHTA 4B3TB 1IJFA 4FQ8A 1G20E 1Y5MA 4E5YA 2DT5A 4RXTA 1OX4B 2OB2A 5I48A 5HOQA 1N2XA 2GPAA 3QUQA 1UMCA 4OMFG 1C3JA 3OCWA 2BJWA 1NN1A 5AOVA 3T7DA 5LU9A 1R4NB 4BKQA 4KIFA 2CDAA 3GLHA 3U2QA 3VKUA 3OJ0A 4A0FA 2VT7A 2R7KA 5DLQC 4BFTA 4BPBA 1I4LD 4N48A 2WFLA 2X15A 5B7QA 5ELLA 3K6JA 1U8CB 3FTCA 3G5LA 4H4DA 4CHTA 3LLUA 4DCJA 2HF2A 2BF7A 2AZTA 2ZUWA 1U2GC 5AK3A 4Z7JA 5L40A 1T9GR 3HWX1 2V58A 3OKFA 5C4MA 1ZD2P 1NDUA 3AK4A 4RA6A 2GETA 1HT2E 3ZR4B 4RY9A 1FP1D 4UREA 4PYOA 3N2EA 2AN4A 4TQAA 2O4CA 3WSTA 5IZCC 1KEPA 4CQJA 3KLBA 2C31A 1A9XB 1NG1A 3MTAA 3EZLA 1N8NA 3BA6A 1L5MA 3FIJA 2CL7X 4FGUA 4PPFA 1XLWA 4MVXA 3BUSA 1WQ3A 1HORA 2Q5QA 3WL6A 3MT7A 5ITVA 4TPKA 4Z4HA 3G2KA 2PGOA 4OFWA 1CUEA 2WHYA 2C4VA 4D8VA 5KDDA 4GX2A 2O7SA 4Y1FA 4GZMA 2FMHA 3D2BA 1ADCA 3OZTA 4MUMA 1EFTA 3OMXA 3PUXA 4ITVA 2QGFA 4UUNA 1JJVA 5T3YA 4R1LA 4ZRMA 5CA1B 3PEFA 4C0JA 1XUOA 3AXTA 4NU5A 4Q66C 3OIVA 4MWSA 4NP6A 4R1PA 3U0VA 3TW6A 1E79D 5CB4A 4PZYA 3OBIA 2TMKA 3WQRA 1V41E 2FP4A 3R41A 4RIIA 4MCHA 5KNBH 3LBHA 1CRZA 1TYZA 5FPHA 2AR9A 5LBUA 3SICE 5EHZA 3AEKB 2PIDA 2P9HA 3AF1A 2PR7A 2ZTVA 2BR4A 5B12A 3TZ6A 2JL1A 4EIWA 3MM4A 1CDEA 5JS1A 3RWBA 1QYWA 2UYGA 2NO9A 4Z8YA 3R7LA 3R7SA 2PSEA 4FQ7A 3C2QA 3ASYA 1O95D 2MINA 5GJWC 2ZSDA 2C9DA 3E84A 4KNVA 1N1EA 4B7CA 5AVQA 1RAEA 2OHGA 1XZEA 4PVCA 5JRJA 1JDTA 1BU8A 2D2IA 4P9NA 2R7MA 1EGMB 1AOXA 4QELA 4BZQA 5B7NA 5E2BA 2XUHA 1D2HA 1T3SA 3FOAA 4RESA 2H65A 3BREA 3BGIA 4RBNA 1GL6A 4V0MA 4QUGA 1NHWA 2H9YA 1UPAA 4V38A 4I50A 3WRYC 3ZJYA 4AF7A 1Y5RA 5A4FS 4PGFA 3HXTA 4LRUA 1KFKB 1YCGA 1V3TA 3OZFA 1FTNA 3RSHA 3H97A 1EXNA 3NPMA 3PICA 1XZLA 4UEQA 1KMCA 3F78A 1ZOOA 2CVHA 1N32B 3O4GA 4XGKA 3L6BA 1OH6A 1MX9A 5JC1A 2AXNA 3I30X 3G88A 2CDBA 3QNUA 1KJYA 5FDFA 1G4UR 4BYGA 1Q0SA 2WVGA 2EZ8A 2JAOA 1U2ZA 3KYCA 5AJXA 4D1YA 5EIAA 3BQ9A 2WABA 1U1FA 3CUUA 4JJIA 4EO9A 1TT7A 2G76A 4MQMA 4YMLA 1FU7A 3EUWA 1NF8A 1FW6A 3PKJA 4NNPA 4IDNA 3VGJA 1DQRA 3K9CA 4EG5A 2ID8A 4M3NA 4BGVA 1TYBE 3TXYA 1MX3A 3WNBA 1RHJA 4PPQA 2XHEA 3SJUA 4U2GA 4ZDKA 4JP1A 3CX8A 4I1RA 3VPDA 4FFDA 4M89A 2HW8A 4UBMA 3B53X 5ALXA 1Z2OX 2ZUUA 4K9SA 3IURA 2Q27A 3TKLA 1XLTC 5J4HA 1QO0D 2C7BA 2PMBA 2PLAA 5EMHA 5FWAA 5A4JA 3ZE1B 5KPDA 1I7LA 2Q3FA 1BA3A 5P8WA 4PYQA 1YZQA 4G5GA 1AK9A 1NIJA 2C3UA 4HQFA 3ZCVA 3HB0A 4GPZA 1PK7A 1SCQA 1EX6A 3ETEA 4HP8A 2O0LA 1GPWB 5EPUA 4XWWA 3TS1A 4KGVA 4M46A 4KIGA 2ZRAA 3ZUPA 4L16A 1HOXA 1YHNA 1VZ3A 2WOOA 2EWMA 2XWQA 3FZEA 2YBEA 3EGEA 2WMDA 5F21A 3R75A 4E2XA 1T1JA 3MA0A 2ZT7A 2Q1YA 3KOOA 1A9RA 4F4JA 4Q24A 4OU5A 3L8HA 4ZVRA 1EVYA 4UHFA 3RT1A 2ZGVA 1SAYA 3QEMA 4ICIA 3ZV5A 1UJNA 4JUDX 2WQ6A 3DUFB 2IS1A 1SCBA 1Y9DA 1BH6A 4F9TA 2ZBGA 2MYNA 1D4FA 3NRBA 2B1IA 2JVJA 1CJUC 4IHKA 1WO8A 1DAHA 2VSOA 4PS1A 1KYYA 4MGKR 4QG7A 4UHEA 3RCBA 2C00A 2OTCA 2IH5A 1PR1A 3OQNA 2QB5A 1ENOA 4UNPA 1XDBA 2A9KA 2J0EA 3CYFA 4PSDA 3TR5A 1GZ5A 5G02A 2VDKB 1UT5A 5DYTA 2LD4A 2XOKA 1JQLB 4MI6A 3Q7TA 1XCMA 2DBQA 4INPA 4L9RA 2LKDA 1VCHA 1T13A 1E9EA 4HYYA 4D45A 1GT6A 5AMXA 5E7QA 4DWVA 1M0EA 2CWDA 2HN9A 1G4AE 1X6VA 1Y8QA 3DLCA 3L1IA 3VPHA 3BJIC 3STVA 3ZV4A 4B5LA 3H3FA 1KZ9A 1OJ7A 2FF5A 4MI1A 1GYRA 2ZVQX 4MPPA 3ZE6A 1DQNA 4S1NA 1DX4A 3I37X 3IUYA 5LQRA 2N75A 2EERA 3BA1A 1ZXLA 4Y6OA 4COOA 1YBHA 3A1FA 3MSXA 1C14A 3R5KA 4N03A 1BCRA 5FWXA 3AYZB 1Q77A 2PGNA 3ILVA 3ZX4A 4N01A 4BIIA 1ZR4A 4Q9NA 1II8B 2FX3A 1VG1A 1ZDMA 5AJZA 3GB9A 4ARZA 1VG8A 3MJHA 2XI4A 1U0EA 3MJSA 1AT1A 1DMSA 2XA2A 1RPAA 3IDOA 1X1EA 5LMZA 1AKTA 2QNIA 1ZA2A 1VCIA 2XGMA 4G86A 4M98A 5FV7A 3SZLA 2Z6QA 2WD8A 1EMDA 4Q9IA 5LMCA 1DRVA 1OV4A 3TZCA 1NQVA 3KELA 2ILVA 4JOQA 5H80A 1JQAA 2XZDA 2HK8A 3S1AB 4RSRA 1E6EA 1T1SA 4FFRA 3V42A 4C3ZA 4E2WA 4L4YA 4YN3A 5JH7B 4RZHA 5K1ZA 3W2FA 1E2JA 5K0TA 2QK4A 1SUPA 4I3GA 3AF5A 2H2DA 2NZXA 3S1LA 5KKNB 3UMMA 2Q41A 5J1TB 2AFIA 2PRSA 4CHGA 1QU3A 4OQ4A 1NVUQ 4LHYA 1TKRA 4P3XA 1G3RA 2GN1A 1SKYB 1JWLA 4D26A 1FJGB 4K9OA 4NG4A 5JROA 2W6PA 3PG5A 3AF2A 1K08A 3EDMA 1G3IA 3I6BA 2QTRA 2QRMA 2X1MA 3TSWA 4GC9A 1TT5B 3E9QA 3Q5GA 4D44A 3IR5A 1ELOA 3K1JA 4HN2A 3T7AA 3E22B 4CT4B 3LQFA 1JHUA 5DVZA 2WKPA 3WHLA 5AKJA 5G3ZA 5KKAA 4MPJA 4YMHA 1IN6A 3NVAA 1SWWA 1BCSB 1POWA 4RLHA 4U2DA 1T2VA 4A8JC 4UBNA 3U17A 1NOIA 3ZYZA 4OUDB 1ZIPA 3IQDB 4W9NC 5LC1A 3T5PA 4GNRA 3U7QB 5WRFA 3CLSC 4MYSA 4BNHA 4UUAA 4EKNB 1X39A 3RJ5A 1MX1A 4FHEA 4LJLA 4RO0A 2J67A 2QTMA 2RBGA 3QQPA 4RXMA 3ANYB 3PGJA 1TXGA 1EA5A 1GA6A 1ZX1A 3VZCA 3ZW9A 1QIMA 2OY0A 4RSHA 1UZAA 3GO4A 3AG5A 2PZLA 3TLEA 2ZYSA 5KYYB 3C98A 3QBEA 5JD6A 3DF9A 3TLKA 3N0RA 3RRNA 3F9RA 2PT5A 2ZDQA 3H86A 1AK2A 2W6ID 4DBZA 2B9EA 4GG1A 3ZCSA 3HP7A 1TNDA 2DWCA 4CMIA 5C8YB 1FYVA 2HJSA 3CEHA 1T36A 3A6KA 1YMQA 3DAGA 1GZVA 5BYBA 5K45A 1SWVA 3DKRA 4D8UA 3P9ZA 4S1WA 3R8FA 5J40A 1E63A 1XTIA 2X9LA 4HI0E 4U0KA 1Z4KA 1E6UA 4XFJA 5AM5A 1Y9EA 3EW7A 5AM2A 3F5FA 5H0IA 3H16A 3OPQA 5BRNA 1YZVA 2LIVA 3U6BA 4RVSA 1CIVA 3NHBA 2JGDA 3BL6A 3D3NA 3UJHA 3EODA 1Q50A 5D01A 3FRJA 4YALA 3ZU5A 4QDTA 3GCDA 5AT1A 2GSDA 4CDRA 5JSHA 2J0UB 3VZQA 4A23A 1Q0ZA 1ZLXA 3I6IA 2XGJA 4E11A 5JSQA 3BX1A 1XEFA 3GLFE 3NYRA 4YFVA 1ZD1A 2WF5A 3R7DA 2C57A 1GCUA 1US8B 3HYCA 4IH9A 4Y9DA 1RLUA 1X7WB 4C06A 1JP7A 2WAXA 4C5AA 1JHRA 1KVSA 1QC5A 1W0KD 3E0QA 1DLJA 3GZJA 2A1TR 4D4IA 4C4AA 2PG3A 4CI9A 4F11A 2O4UX 2PL5A 4EM6A 5EPOA 3BGSA 3M0EA 4ZT3A 4M87A 3ER9A 2QG9A 2EJBA 3M3PA 4DLVA 1F4LA 2PSSA 4BVGA 2QTWB 1Y1QA 2XBMA 1PYOA 1FPMA 4F12A 1ZK1A 1C3OB 4EECA 1A9PA 2P69A 4PZ0A 2P9TA 5AJTA 3AVUA 3GVIA 3GAMA 1J1UA 3WHKA 3L5OA 4RXUA 5T4HA 3ZZ0A 2VDLB 3MFQA 4ZOQI 4H27A 4Q7MB 4DGQA 3CXRA 4PYKA 1DNPA 3OQOA 1YOVA 4EYQA 1KETA 2R6FA 3QGMA 1NZFA 3E5HA 4HF7A 1D1TA 2HNBA 4HMQA 2D5BA 4NJEB 4UEOA 1VFNA 4TMZA 3TFOA 3QF4B 3I62A 4TTQA 4YMVA 5KHLB 4RSMA 4IVRA 4U02A 2VSFA 4OYRA 1LJLA 1DHTA 1JR2A 2DSNA 3OX1A 4AMBA 2GAOA 1YBVA 4AMUA 5F35A 2FGJA 3AHJA 3CW9A 3EEBA 4UNQA 3X1ZA 2FOXA 3EYAA 1PT6A 1V5EA 4WBSA 4OBXA 1W5SA 5KJFA 1ESEA 4ZVOA 2RKBA 3C41J 2PL1A 4H0NA 1PD1A 3PNQA 1HLGA 3GJ3A 2PX3A 3JX9A 2K6GA 3N28A 3GJZA 1V25A 1P5HA 1EJ0A 1ZOPA 3B20A 3G0BA 4M7RA 4FMBB 2QD5A 3TD9A 3AVXA 3U48A 1UQRA 3QELB 2WBLC 3I01A 4LDRA 2W6CX 3DHYA 4UM7A 5K3FB 3H4IA 3TZLA 3GP3A 2VQEB 3GEPA 5KTRA 3WZMA 3PVSA 4YJ2F 1KDRA 1CUWA 3ZDYB 4DHEA 4ABTA 1LDGA 4WVFA 4PPGA 4JJ6A 3VJRA 2QNBA 3NHFA 1DC3A 1HA3A 4WLFA 5GOTA 3TOXA 4ALLA 2BP7B 3OMLA 3Q3CA 3RHZA 4HNGA 4EFMA 1UZNA 1WZNA 5AVTA 1KTVA 4UQPA 4X85A 4ZAVA 2G9QA 2XAUA 4KO3S 2P2ZA 2X0FA 3LX6A 1CQJA 1HYBA 3OT1B 3NQ41 4DR7B 1QONA 5BWLA 1Y5IA 4N6OA 4Z8XA 1WZIA 3MUNA 4Y6SA 4ANFA 4WCFB 3QVMA 3QXSA 1Z2DA 1XMQB 1Y1KE 1F8GA 3UEOA 2YWFA 1CULC 2I4TA 3JRNA 4G97A 5DGTA 2IVFA 3UVEA 3CWCA 4EUSA 3MTJA 1DUVG 7MHTA 2O48X 3U09A 3KXLA 2XZTA 1JXQA 3I04A 5EFOA 3R7WA 4OLHA 4BNDA 1UXIA 3DBIA 3V7UA 4MW0A 1FFHA 1YULA 3B6JA 4X1YA 5HZKA 2FXVA 4Q7KA 2NXJA 4U00A 3T99A 1J49A 1LNQA 3M81A 4JUAA 1V5FA 2VHEA 4NY1A 4B8WA 3D64A 4KX3A 2IVZA 4DIOA 3OESA 3TR6A 3MINB 4GGOA 3ZBPA 1C9NA 1XVTA 1ZZGA 3RAGA 5JAOA 2AEEA 4BKRA 3LCMA 2OV4A 1K66A 5LQMA 4UVDA 3IP8A 1FE8A 3RUPA 5B7PA 3RABA 1VQ1A 2RCNA 2OG2A 2V7EA 2XRYA 3FFWA 4KR0A 1O4WA 1ZUNA 2AXPA 2R7AA 1THZA 4IL5A 4IYJA 2VQSA 2RH4A 4DT1A 4PYMA 4MWCA 2FPXA 4PLYA 4TWRA 1A97A 5HKAA 4GI2A 2B6HA 3LVRE 1USGA 4LWZA 1P73A 3SWWA 1JIXA 1L8AA 2ZI7A 1Y3BE 1YDWA 2M2IA 2MIIA 4Y1RA 3IAM6 4Y2SA 4DRYA 1I3NA 3ZXSA 2C8JA 4Y6QA 2ACKA 4EGCB 1WZ2A 3MF4A 5DTMA 1LRJA 5JH7F 1AN0A 3KD3A 3UB2A 1CUGA 1XV5A 2WNIA 1RPZA 2ZDHA 1OLUB 5F51A 4LGCA 2DBRA 1CEYA 4OJNA 3ZHSA 4PQFA 1XZCA 2BMDA 2G0NA 4FQ5A 2DC1A 3Q1KA 2DPMA 2DY1A 2CZGA 2ZQZA 3EG9A 1ZVMA 3WBBA 3SHOA 4Y2UA 2FRDC 5HR5A 1VGRA 1DGQA 3ZD6A 2XXJA 1C41A 1NUTA 1I3MA 4KQHA 1RYNA 4E0BA 1C50A 1K8ZB 1RR6A 1S96A 2BUCA 3IAEA 4YAKA 1JEEA 3G49A 4OOEA 4PSKA 3DEIA 1HNZB 2YX1A 3I32A 3EEFA 2A0UA 4UEJA 3TAHA 4HLQB 1ZJ6A 1SB8A 3MCWA 3FPSA 1UCFA 5TGTA 7REQA 1OXBB 1Z0SA 1VMDA 3V4LA 3F6EX 4H3SA 2QM8A 2ZOSA 4U2EA 4G09A 1GN9A 3WYBA 4GXRA 3TI9A 2XEDA 1SN7A 1VCNA 3EVFA 4IXWA 1YIDA 4REOA 1YQEA 2Q62A 5K0NA 3RIMA 1S3SA 3AHIA 3S27A 3LBAA 3LYAA 3ZQ4A 5EP1A 4L72A 3GLKA 1NRWA 1NUSA 1XQXA 2WUGA 1RAIA 4D97A 3HGTA 1UMCB 4FBLA 2HM7A 2HWXA 5DBFA 4C04A 5JWOA 4RTJA 1V71A 4ER0A 9ATCA 4G0VA 3C3CA 4F9EA 3BXXA 1EK5A 3RT7A 4OHMA 5KOHB 2A57A 2XNCA 1OB2A 1TQ8A 2IEZA 4YRDA 4N7MA 4AN4A 4NBSA 5DHUA 8LDHA 2KM1A 5EWJA 5J9FA 5TQ0B 5LZ9A 1NM5C 1V37A 2CXPA 1K75A 4QQFA 4WOBA 4E5UA 2ETXA 4INJA 4P4UA 3SBXA 2ZBFA 1CDZA 2Q6VA 2ZAOA 3CR3C 3UV6A 3PF9A 3X1DA 4C20A 1L6IA 2GN8A 2W6MA 4GBED 1Z3CA 3U3JA 1JHOA 3UWMA 3IQIX 4OI1A 3EXIB 3PS9A 1UPXA 1W76A 5FL3A 3LBNA 3CLUD 3TUZC 2JB9A 3OHSX 2GCEA 2XDQA 3RVLA 1QGOA 4AO6A 4HHEA 3AUAA 3PLRA 2WHRA 2WM2A 1T2FA 1GM5A 3CF4A 1ZCAA 1E6LA 2VPYA 3C3JA 1IZ9A 4UJ3A 2JFBA 4ZA2A 4AI6A 2YYZA 4YRPA 2GT1A 4ZGGA 1MR3F 4X93A 3BXEA 9GPBA 1O97D 1RJFA 2I62A 1E8DA 2E4VA 3IPCA 5HMLA 1AF4A 2YIJA 3ZBTA 1L7NA 3KEMA 4H6XA 2YN2A 2QVXX 1R0ZA 4KQGA 4KQKA 4CG0A 1NBOA 1LKZA 3EDYA 3TK1A 1FXWF 2OVFA 1F2VA 2DCUA 5JJIA 1ZMOA 3GVXA 1U9IC 1E1RA 3PE3A 2LZ0A 3A2NA 3NZEA 4Q4LA 4QOJA 2G88A 2IODA 3LPLA 5IJ0B 3OCXA 3R5HA 4F3YA 4CLRB 4H7HA 2VPTA 2WHQA 4X45A 1AMOA 2E37A 3EOAI 4MO2A 1OLOA 5LBTA 5JO0A 3I73A 4BUCA 1MRZA 5ALFA 4KWTA 1AQJA 2IOFA 1UXJA 3RC7A 4QJ5A 2HCBA 5A3RA 1EVLA 1P0PA 5IZ4A 1RYZA 3EAGA 2GAIA 1D0VA 1GUDA 1C1DA 3JZMA 3R6DA 4GOJA 1NNUA 4ZO4A 4Y2TA 3ZWMA 4BCDA 1FP4A 4MUYA 4C6HA 4EH1A 5IF3A 3EMBA 3S2UA 2ECOA 3A0RB 3PVZA 4RELA 3AUUA 4FT4A 2P77A 1ZISA 4RQAA 1NXWA 4WPGA 3M6VA 5KOJA 3R9XA 4G3XA 3BIWA 5AOAA 4D9MA 1E4YA 1GYPA 5SV2A 2YY7A 4FHFA 4O02B 4X1KA 3EPKA 3WLNA 2V5AA 4HGYA 2IS4A 4AROA 1ZMTA 3OOHA 4HLUA 4A16A 4K9RA 2R84A 4LCBA 5CFMA 4WLVA 1OWOA 1RPJA 3NHPA 1A8QA 3Q5EA 4KQ1A 5TJ9A 1XVVA 4R69A 4XPIA 1YS1X 3R74A 2DLDA 1MD9A 1OE0A 3ZWKA 3C6ZA 5E3IA 4AUKA 3TYXA 2AMVA 3C1UA 1XA0A 2ZXUA 1JFSA 2D2EA 1SZDA 4MQFA 3T1NA 3FROA 2JW5A 4KREA 1DIOB 4PZ9A 4LTNA 2ERYA 1H5QA 1TQ2A 1XL1A 4KO1S 2O8BB 3M4ZA 4TV9A 1SCNE 4RM2A 1RCTE 2OAEA 4GZ3A 4C9BA 2OXFA 3HZRA 1RLIA 3QUBA 3IS3A 1SVIA 2BHTA 2R8EA 3KALA 1N6RA 3E18A 3LQKA 1WDTA 5EHNA 1IB6A 5AI8A 4P58A 3UXMA 4AZ3B 3T35A 4GYWA 3MB8A 2VHYA 1QFSA 4M9ZA 4RMJA 2FHPA 2VL7A 4E4TA 3K0AB 3IQHX 4WD3A 2GJSA 3H2ZA 2HRBA 3LT2A 3QELA 1LSSA 5ALQA 5HMMA 3LUCA 5L3RA 1EP2B 3NC0C 3OICA 1UQUA 5T8KC 3HTXA 2ZI9A 3O9MA 4TRMA 4OXKA 4M8SA 4JI6B 3RU3A 5HKKD 2DQYA 2H8GA 1GOTA 3M89A 4QAJA 1RYDA 2A9PA 2ZP1A 1AQNA 1FDOA 3ZI0A 1C1XB 4OJMX 4Q4DA 2I71A 4MYTA 1XPUA 1K88A 2DE0X 1TD9A 2JI7A 3G2IA 1P1HA 1PF7E 3CRZA 4KNYA 1M1ZA 3W6OA 4OHZA 2JLAA 4JIMA 3WGNA 2AFHA 3NBZC 4ZT4A 5JE8A 3SX0A 4V0LA 3SDBA 2IKSA 2C5AA 2ZSHA 4BLVA 1ZRHA 4G1FA 4RPCA 1ANKA 1M1XB 5ERGB 5F3DA 3ZTYA 1EHIA 4CFZA 4YLYA 5M2QA 2PUFA 3KUXA 2NU8B 3BWYA 3V3KA 2FUG1 4HJRA 3KOUA 5ALOA 3JYHA 4NU8X 1OH7A 5CDTA 3TEJA 2C5GA 3CURA 3FVRA 3K72B 1Z6QA 1G8KA 4FCVA 4FFPA 1N2IA 2CBXA 3H0KA 1V7QA 4DIFA 2XSZA 2VZ9A 1A4XA 1T5IA 4YY3B 4FC6A 4FJ0A 4KIWA 3V2IA 4J4TA 5DGDA 3ZN2A 2E87A 3CLRC 2O06A 4NS4A 5H70A 2CFCA 3K1YA 3GJTA 1AQYA 5EUCA 5J2TF 4ARUA 3L7MA 4MRNA 2I2AA 4B81A 4DG8A 4AP9A 3S6JA 1IN1A 1OXVA 2H29A 1X7DA 2IU3A 2HHJA 4OQDA 1GNVA 1ZHHA 2XMCA 3LE8A 3NBFA 3EXFA 2H5IA 3A3KA 5H8WA 2GEJA 2PUDA 2DCMA 3O1LA 2I3BA 2NTNA 3WRXC 4EB6B 4GHWA 4QECA 2XB6A 4EG3A 1QORA 2GWHA 4E15A 1QDLB 1ZXBA 3KFVA 3NBYC 3OF2A 2WJIA 3PXCX 3U7EB 3WLAA 1G2QA 3RLFA 4YRBA 3CZ4A 4TZ6A 2EQBA 4GMGA 3JYOA 4WY8A 5GVSA 3WK9A 1LUAA 1AZTA 1IY2A 2HXYA 1GKKA 1GPAA 4HZGA 2CE7A 3LUAA 4KI7A 1T8SA 2V7WA 2WLSA 2ODPA 4ZAXA 1G55A 3OPNA 4JVNA 5ERYA 2V0CA 3QSYA 1QYDA 1VYTA 4DC0A 4BTLA 5FUBA 3COZA 5FLEX 4DZTA 3B9RA 1WTCA 1OBVA 2QVGA 2QX9A 3CZAA 4BVJA 2Y0PA 4DV6B 1CY6A 3RJZA 3IX7A 2DU8A 3GLTA 5FBQB 2BKVA 1L7DA 3E7XA 3ENZA 2ZQYA 2HRQA 4OHCA 2IBTA 4GQAA 2HLNA 3WGVA 3MAJA 3COWA 2YXEA 5C4IA 3Q8XB 5GM1A 4OJTA 4CIBA 1XTJA 2I4LA 4JUBA 2HA7A 4R3UC 4W5RA 1K7FB 1OC2A 4C7VA 1OX5A 1Y7PA 2A2ZA 2IV3A 4FYYA 5AQEA 2WF9A 2J0QA 1ZXXA 4F3KA 1P9LA 2ID4A 2XUJA 3EISA 3KJNA 5EJIA 4HFJA 3EPHA 5EP3A 3WMXA 3EX7C 3UAZA 2GJ8A 3MJTA 2B20A 2UZAA 3Q15C 2BKAA 4G0NA 4YP5A 5BO5A 3TAUA 5AM3A 4RTQA 3RC8A 3LP8A 4BX8A 2ZVPX 3AI7A 4KRGA 1E6MA 2VP5A 2WYWA 3EWSA 2RHJA 3PLNA 5AESA 5AW4A 3CRMA 2B4RO 1R0YA 2QM3A 5EJMA 2GRAA 5K6RA 2A5YB 3HWRA 3HM9A 1XO1A 2BTQB 1XKTA 4G0MA 4JR2A 3P2EA 3AJ9A 1EDZA 3HJNA 3ETGA 3G6KA 4R81A 1M7HA 2M1XA 2QTAA 1Q84A 4RVGA 5BW6B 2XYGA 3WBFA 2HQ1A 2V98A 4H60A 4BFLA 5I7WA 1GGVA 3EA5A 5TNXA 3YASA 5KYVA 3A6HA 1MCZA 2CD9A 3CUSA 3I61A 3NDJA 4UDYX 3JZIA 1Q74A 1M72A 4R1NA 1UPTA 1IJBA 4CIXA 3ORFA 1ZAKA 1CLEA 1CEXA 1GGNA 3N0VA 4PC7A 1QJ4A 2X9VA 2GCIA 2J5QA 2O2JA 4MW5A 3H2YA 2Q5LA 2XUGA 4LJ7A 2ZUCA 4JGBA 2BGIA 4L57A 5LLDA 1YRYE 4LK3A 4UPEA 2D13A 3IE2A 4C4RA 3W1VA 4CKBB 4F8JA 6PFKA 4QT4A 1CYDA 3SOZA 4N3NA 1HNXB 4PLFA 5C1IA 1TRKA 3T5TA 2G1UA 5EJ6A 1XT6A 4JS0A 2PX2A 2PLNA 4JJ4A 3S55A 4FFVA 3JWPA 3GNTA 3BWXA 2XODA 3FIUA 2CD7A 4X3CA 3UYKA 3QHPA 4BX2A 1Q0PA 1WXXA 1N2ZA 2EARA 1WUIS 4L9WA 4ZOEA 2X41A 3BJZA 1YMUA 1B8NA 4NE2A 1T6ZA 1PBNA 5EXPA 5FIUA 4ZZ3A 2FPIB 1JLLB 2DPYA 2YQ5A 3BXZA 3DW1X 4UOQA 1ZITA 1KU0A 1RKUA 3WIEA 4TVBA 3U44B 3U4IA 1KP9A 3P9SA 4KUGA 4MKIA 1K2VN 1WR8A 3OCZA 3TTTA 3FBWA 4EOGA 1D4ZA 1OPRA 1VPVA 4E3ZA 4IG4A 2OXEA 1CR1A 2OFFA 3EPJA 4UC0A 1NZJA 1SPXA 1Y98A 4FM9A 4IXNA 1KFJB 2OFXA 1AY0A 3EFHA 3ABQB 4OBEA 2HWKA 4NBRA 4EW6A 4QXQA 5T64A 2P41A 3AETB 4DBLC 5CYFA 3TM4A 5GONF 2RHRA 9LDBA 3N58A 3H13A 5EJ4A 2QSJA 1H8EA 2Y1EA 4CF3A 4CL8A 3D43A 2YYAA 3EGOA 1QHHA 4RVUA 2F1OA 1G59A 1EUQA 5HFAA 1Y48E 4UOEA 1VBMA 1FQKA 2CV2A 3C0KA 1U28C 3PPYA 3L41A 2WF8A 5JO9A 3BS4A 4LDAA 5TS3A 1E3JA 3DDZX 1SCKA 1Z4OA 4HGQA 4QTYA 1IMJA 1SO8A 3KJQA 4M1SA 3RFUA 1L4NA 1XQ6A 3O4JA 2F3UA 2FLKA 3WNZA 1XWIA 1QZUA 4WZAB 4UULA 1ZWKA 4HWTA 4AF6A 3R7FA 4KAFA 3PPWA 5B3LA 2P7HA 1WWKA 2XDQB 3EXFB 3R9IA 1WF3A 5L3QB 5KNCH 1GEEA 4JLOA 5FNVB 3HZZA 3I4LA 2YIDA 3MYRA 4PG6A 5IJZA 1ESCA 2BM8A 2FR1A 4N5MA 1B8PA 1P9OA 3GJ7A 4XQ9A 1ZG3A 4UD2A 3UUGA 2JBHA 3O2JA 4RGQA 4IEIA 1YR8A 3S8MA 1SOMA 3ZHQA 1NSFA 4J6FA 1XXHB 2A5LA 1E5TA 3ZKWB 3LC1O 1V9LA 2F6RA 2REQA 3H2JA 4PWZA 2P2SA 4YI5A 5A0VA 3ERCA 4QFBA 4LE0A 3ZWBA 3GRUA 2I67A 2W6JA 5FTWA 3FE2A 3HR8A 3TSYA 4YCLA 3M5CA 5DGXA 2PZEA 5A6SB 5FEUA 5AK4A 2CVFA 2WWIA 3LUHA 3EZ6A 1TEVA 4OQYA 3SHVA 4EP1A 1OAKA 1B41A 4P98A 5HK8A 3WLTA 3ADBA 4S24A 4GO1A 1KI4A 4WESA 3BH0A 3P2KA 4RMGA 4YJFA 4QOHA 3LT0A 3T3EA 3WYCA 2VPPA 3U26A 3AM4A 2VUHB 4PY2A 1WCIB 2GARA 1JDBC 2QU8A 2RMKA 4QQ8A 7ADHA 1CZOA 3RUFA 4CM5A 4GU5A 1II9A 1T1RA 3V46A 4R54A 3W6PA 1MDFA 4W5QA 3HQ4O 2JGJA 4L8WB 3HG7A 4KOEC 5EWLB 3T3IA 1U0RA 3OM8A 2P27A 2AR7A 2WA1A 3ANXA 3D2AA 2AOUA 4ZOLB 5JR3A 4DLBA 3G2HA 4C0AC 3H1TA 1UBLS 2CSUA 4ON9A 3RPEA 4B46A 4U8GA 4LXUA 1R5NA 1I1OA 1SOUA 1EAYA 2A5DA 2H4JA 5G4LA 3T9BA 3WNQA 2FEMA 4LDQA 2IYYA 5C0OE 4DQVA 4EHKA 4LZAA 3I9KA 3CN7A 2IPAB 1CQXA 1OSNA 1AURA 2O6HA 4CLHA 3TG2A 1NW7A 1A1SA 1Q3KA 4FSHA 5FI3A 3HDGA 4B6QA 2IU4A 2CCJA 5I5GA 4RWZA 1O9HA 3D4BA 4JA2A 1YC2A 1E3IA 4BAUA 1F2TA 4PZCA 2O5VA 4ZGBA 5HG0A 3L0PA 1RKQA 4K9NA 2H2AA 3PGKA 4BZZA 3WADA 5IDXA 1UJ2A 3CLUC 3E9EA 2YS7A 2B5OA 4MDFA 2XOEA 2AFVA 4L74A 5EI5A 1YF3A 3MWJA 4GVPA 1MKYA 4TUYA 1KYWA