1A4UA

Alcohol dehydrogenase from drosophila lebanonensis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
254
structure length
254
Chain Sequence
MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNTTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The refined crystal structure of Drosophila lebanonensis alcohol dehydrogenase at 1.9 A resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords ALCOHOL DEHYDROGENASE
total genus 92
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 1998-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1a4uA00
1SOWA 4YJGA 3JQCA 4NQZA 4MKZA 1JVBA 1DHTA 4M8SA 3TNLA 1UAYA 2B37A 3DZHA 3DC2A 2WYVA 4CMBA 4YJDA 3ZI0A 2BMAA 1AHHA 1MUUA 2B5WA 2GN9A 4NH4A 4OSPA 5DNAA 3DTTA 4JBHA 1ULUA 4Y9DA 5AXAA 3H9EO 5JAQA 2EKLA 4DQUA 2ZQYA 2Q3EA 5CDYA 3BMOB 3U3XA 3WMWA 5CEEA 4KUHA 3MJCA 3ETGA 4CMIA 3V2GA 1DOHA 3ZW9A 4JXKA 4BKPA 2YV2A 1F06A 3MCVA 4FR5A 1Q0HA 5J23A 1G0NA 4OYRA 1DAPA 5EQFA 4YDRA 4B4WA 2VHZA 4MVJD 4BVAA 1OI7A 4E21A 2VWQA 2WE8A 3DQPA 2NTVA 1UJMA 1KY5A 1B26A 4BNMA 4D46A 2DBZA 2E48A 2NACA 2WE7A 2HSDA 5KJ6A 4K6CA 1T2DA 4S1VA 4FB5A 3H2SA 4IDFA 3GH3A 1X7HA 1SMKA 3O8QB 3U9LA 3JTMA 4HP8A 2PR2A 4XQCA 1KETA 4RORA 2EJWA 3DL2A 3F47A 5DCWA 3OA0A 1M6HA 2IZ1A 1U7TA 3UUWA 3ZHBA 2O7SA 3WGYA 2VUTA 4GVLA 3GOHA 1Z45A 5CAEA 2EXXA 3JQAB 2WEKA 1FDTA 3OJEA 4NBVA 3AOEC 1FDSA 3WICA 4FC6A 2AQKA 3GN2A 3RFVA 1VJTA 1RWBA 2BLLA 4RPJA 1UUFA 4OGWA 4G81A 6ADHA 1EBUA 3BAZA 3FNGA 4MVJM 3RKUA 3GGPA 4AJ1A 5C5IA 2Y1DA 3NV9A 4WPGA 1ADGA 5JDCA 4Z0HO 4PIVA 2CMDA 2Q49A 3DXFA 2J6IA 1IYZA 3P2OA 2CDBA 1QP8A 1X7DA 2NUAA 3C1OA 1B2LA 3LQFA 4NDNE 1HT0A 2PGDA 2UYYA 5IDWA 4IJVA 3EK2A 4FFRA 5GZ3A 3E82A 3HE3A 2B4RO 4PLFA 2POQX 4NBRA 1P1FA 4IGFA 2H6EA 1E7MA 3ITDA 4QT0A 4AJHA 1P33A 2HJSA 2A35A 3PIDA 1FDUA 1LC3A 4XB1A 5F1PA 1DIHA 4RLHA 1ZEMA 1NM5A 2Y1FA 1E6UA 1N7HA 4J9VA 1LLCA 1O8CA 2X4GA 2Y05A 2D4AA 2YYYA 3B20A 1ZSVA 1ULSA 1R12A 1PIWA 1NWCA 2HK9A 4AVYA 3IIEA 4GX2A 3I4FA 1WZIA 5BNTA 2C7VA 4HKTA 3P5SA 3ICPA 4XIYA 1DRWA 1UXIA 1HDCA 3KETA 1UXKA 1YB4A 3GHYA 1TEHA 2NU9A 4HWKA 1PL7A 1H6BA 1RYEA 1Y8QA 3JQGB 1KS9A 4D3FA 3KEQA 1W8DA 1PGPA 3PDJA 3U62A 3PLRA 1Z7BA 4YWJA 3PK0A 4IDGA 1MC5A 4Z9FA 1YVEI 4XGNA 3D4NA 5TJHA 2PZLA 4R51A 2H1SA 1C1DB 1JWBB 5ADHA 3HZZA 3GZ4A 4CM7A 4R5HA 1B16A 2PZMA 3O9ZA 5GMOA 1GYQA 5LCXA 3I3OA 2GO1A 1E5QA 1VL8A 4O63O 4CV3A 3WFJA 1EQUA 1PGOA 1VL6A 3PJFA 1HE5A 2XXBA 3EUWA 3T4XA 4ALMA 3OQ6A 1PR9A 4IDBA 4CMEA 4BNJA 4DVJA 5KTKA 1U2DA 2ZB7A 3F3SA 4CMHA 3FTNA 5C3MA 3PJGA 3U4CA 3KLMX 1BMDA 4RVGA 4RZHA 4XQ9A 2Z95A 5COQA 1OBFO 1YDEA 4KDEA 4Y6RA 1HE3A 1T26A 5DBIA 5THQA 1HEUA 4H16A 1P74A 1RJWA 3G3EA 4IJKA 4ONEA 3U4IA 5F21A 1T24A 4IMPA 3RAJA 2D8AA 3LYLA 4DRYA 2YUTA 2EG9A 4IJUA 1XELA 5DOZA 2EWMA 3E8XA 1EEHA 4DQVA 4FFPA 3GG2A 1H2BA 4I5DA 3C24A 3WBFA 1XA0A 3ON5A 3ZWCA 4CMAA 5KVSA 1R15A 1SEVA 1AUPA 3BTSA 2P9GA 1WPQA 1YOVA 3ZCXA 3DHEA 1O5IA 4ZQGA 5ILGA 4JBGA 4BO4A 2JAPA 4MVJP 1WVGA 4EYEA 2C29D 5I8ZA 1J4AA 2YV1A 4ZA2A 1CRWG 1DIAA 1E7WA 3QVOA 3SJUA 3RUIA 5A05A 1XKQA 3ANMA 3I5MA 3OJOA 3L0DA 1P0FA 4DIOA 1R37A 4OHUA 3TZHA 3UXYA 3WQSB 3KYDA 1EVYA 1DC4A 1P1KA 3S55A 4M87A 3VPSA 4AL4A 2QRLA 1EE2A 1M75A 4Z0PA 5CDTA 4B4OA 4Q3EA 2VT3A 1PWZA 3PVZA 3IDSA 2C07A 8LDHA 2BFAA 3ST7A 4CQLA 4BNKA 3TDKA 1XQ6A 3QA9A 1Y1PA 2JJYA 1N92A 3ETEA 4BKUA 1NXQA 4FPXA 3AI3A 5FFFA 1LDGA 3CEAA 2E49A 1C0PA 5FI3A 4J16A 1JTVA 4LISA 3ZV3A 1PU2A 2BGLA 2GR9A 3CH6A 2VRCD 2VZ8A 4AJKA 3VDRA 4JK3A 2O7QA 4LSMA 5DOVA 5DULA 2P91A 4EGFA 2Y93A 2HCTA 2RAFA 4BNYA 2LDXA 4JJIA 3GNTA 2PWZA 5T5QA 2FWMX 3M1LA 7ADHA 2QZ9A 2RHCA 1C14A 4PCVA 5H83A 3G49A 3RROA 4L4XA 1S7CA 3ZZNA 4UUNA 2OZPA 4CR7A 3GT0A 3JQEA 4E31A 4IIVA 4ALNA 2QX7A 2VCYA 1YJQA 2Y1GA 4ZGWA 5JO9A 3WS7A 4I9HA 5BSFA 5C7LO 2JHGA 4XR4A 3UF0A 4A73A 1R0KA 4I9UA 1MA0A 4W9NA 3VKUA 1Q1NA 3GN1A 4RF4A 1T2CA 1BDBA 1QSGA 4XRGA 2QYTA 4YTEA 1GQYA 2AEMA 3MJVA 1LDNA 4QTZA 3CIFA 3TF5A 2HQ1A 3MJSA 4YPOA 3NJ4A 5TNXA 4WE3A 3RD5A 4XGKA 4BNWA 4CODB 5CDGA 5EERA 2F1KA 1JKFA 1BDMA 2DPGA 2GD1O 3FNHA 3JD1A 1ZXLA 2XOXA 2D1YA 3VDQA 4IDAA 3RI3A 4PLGA 3GEMA 4ND2A 3GDGA 2CZCA 4L0QA 4TRNA 3FPLA 2I65A 3FPCA 3I1JA 4RF5A 1FDWA 3QJ5A 2AE1A 3PIIA 4BGEA 3RU7A 3H2ZA 2OOSA 4F3YA 4CM4B 3FR7A 5G4KA 4AJPA 1OFGA 3GLQA 1UZNA 3OJFA 4M49A 3ADPA 3UW3A 2WYUA 3M6IA 3NEPX 3FNFA 1W6UA 2Q1SA 4PZCA 5T57A 1QMGA 3RWBA 1E0DA 1E1MA 3ZGYA 4CL3A 4HX5A 4HADA 3UGKA 3WYBA 3ROMA 5HA5A 3RC1A 3E6AA 2RBEA 3JQFA 3ZWXA 1I32A 1CYDA 1XR3A 1PJBA 4MP6A 4NBUA 4FJ2A 1KC3A 3GAFA 4UREA 1XCBA 3F1LA 4OIMA 4C4OA 4GQAA 2X0JA 1GYRA 4IPTA 3L4BA 3VZQA 1K6JA 4LVCA 3ZU4A 3PFFA 5KWEA 1RM0A 2G17A 2PH3A 3BYZA 3L6EA 1CF2O 4JP2A 3PRJA 4ZRNA 1ZJYA 3DZKA 3KSDO 4U0KA 4UEJA 4PG7A 1P1IA 3Q1LA 1DC5A 2PKQP 4D0RA 4BMVA 1NX6A 1U1IA 3TQHA 3C7AA 3ZV6A 3A9WA 3KUXA 1PS9A 2NSDA 4E6PA 3C85A 5JE8A 1H6DA 5AYVA 3VHRA 5A9TA 3UKOA 2D2IA 3WLFA 2Y0CA 1AE1A 2Q2QA 3DBRA 3HN2A 4J7UA 3RSHA 4RF2A 2ET6A 2QIOA 4ESOA 3RBVA 3JQAA 4A10A 2TMGA 4ND3A 4CM3A 1F14A 4ILKA 5JY1A 2DTXA 3WWZA 2AG8A 3S2EA 4A5OA 4GSKA 4A27A 5L95A 4IGEA 3V2HA 3X2EA 4AJIA 1JA9A 3C7CB 1BVUA 1NQAO 4MKXA 5CEJA 1EUDA 3N74A 1ZK3A 4TKMA 4QO7A 4R1UA 5T64A 3G79A 3NRCA 4XQEA 1HDYA 1ISGA 1GUYA 3FF4A 3ROQA 4QFCA 4IZHA 1L7DA 5HWSA 2JCYA 3BMOA 4D43A 3HWRA 1ONPA 4G2NA 2DTDA 1U8FO 3ASUA 5CG2A 4FC7A 2VYND 1MV8A 1ENPA 3GVXA 3H5NA 3LLVA 1KEUA 1I2ZA 1R4NA 2EF1A 5F5NA 3VPXA 3HFSA 1A4IA 1HDXA 2Q1WA 3VZRA 2YHIB 3U4HA 3HDYA 5C37A 1C3VA 2QG4A 4LCEA 1U28A 2JD1A 5A5EA 1UXJA 2YQ4A 4DPMA 5JDIA 4ID9A 4EUHA 4YJFB 2SCUA 1YO6A 2QW8A 1ADFA 2Y1CA 3VZSA 2C7GA 1XLTA 4R9SA 3VTFA 1HZZA 4C7KA 1X7GA 5FF9A 5FI5A 4FW8A 1QYCA 1DLJA 1VL0A 3WMXA 3VVBA 2O3SA 1T4DA 2BELA 1LQTA 1ZMTA 4YVFA 4BNTA 4CUZA 4RJTA 3HDJA 3CKYA 3G1TA 3MEQA 3OQBA 3JQ9A 3SEFA 1HDZA 3PGJA 1ADBA 3QWBA 4N5LA 2BFMA 3WWYA 3NTRA 4EEXA 4EDFA 5LDHA 1GZ4A 2P68A 3WJ7A 1K6XA 5K6AA 1I24A 1AHIA 4OXNA 4PZDA 5JC8A 4PLVA 1D4FA 2CD9A 1N7GA 1FK8A 1WMAA 2IXAA 4RVSA 2OGUA 1NASA 1IE3A 1TXGA 2B35A 3GQVA 2AHRA 2IXBA 3IUPA 4J9UE 3ZU3A 4MVJH 2D5AA 1Z6ZA 3OEWA 3LC1O 4R16A 2BFOA 1PZFA 4R1TA 5DCYA 4U7WA 1BW9A 1SAYA 3NDJA 4B4VA 3C8MA 3NT2A 4DYDA 2OXIA 1QV6A 3KYCA 5KOIA 3G17A 3ASVA 4RO0A 2OP1A 5CEFA 4HUJA 1IOLA 3K96A 3V1UA 1X15A 2FSSA 5ITWA 1LU9A 1QYWA 1W73A 4HNHA 2D3TA 4GX0A 1PWXA 3H9UA 4E5YA 3H7AA 2QHXA 1G0OA 1E3JA 4IS2A 1O0SA 1X0VA 2WD7B 3PWSA 4LMRA 4IUYA 3MZ0A 2FHSA 4BO3A 3PYMA 3ZV4A 3G0OA 2CF6A 1XQ1A 4XYBA 1FXSA 4LRTB 2NNLD 3CUKA 3PQEA 1YBVA 5L3ZA 3VPHA 1Q0QA 1VE9A 3AWDA 4GGPA 5TS3A 3JQ8A 1WDKA 3JQ9C 3BTOA 3F9IA 3BMCB 3DOCA 1X1EA 3QVTA 4J7XA 2AA3A 4E2ZA 3PZRA 3SC4A 7MDHA 3E48A 4J3FA 3BHJA 3ANLA 3EGOA 2IZ0A 3L4SO 4BQRA 3M2PA 1WWKA 2VT2A 3SLKA 1QLJA 2UV8A 4DPLA 5F3RA 2CY0A 1GADO 2HMTA 2Z5LA 4B4UA 5THKA 1G1AA 1D8AA 4KTTE 3RKRA 2PFGA 3EVTA 1E5LA 2V7PA 3FWNA 4O6VA 2BGKA 3EYWA 4L76A 1BVRA 4AICA 3ROPA 2Z1MA 2HRBA 1E6WA 3WGTA 4YQZA 5IG2A 3W8EA 3WTBA 1UP7A 1NVTA 2CSUA 3DZIA 3UVEA 1A27A 5HS6A 3ZWBA 3FBTA 3K6JA 1DBVO 2O50A 3MTJA 4J7CA 2Q1UA 3LDHA 3OICA 1E3LA 5ITVA 4MKRA 5AVOA 2HLPA 1H94A 2I6TA 2ZIZA 4WCDA 4XB2A 4YQYA 1NYTA 3TL3A 5ILOA 3UH1A 1BTOA 5G0UA 1C0IA 1HSOA 3NDIA 4J2HA 3WQRA 3OIDA 3PJDA 1A5ZA 4KMSA 4LMPA 3WGGA 4UAGA 1LC0A 4TRJA 2O3UA 2W2KA 3GDFA 2DVMA 3SVTA 2Q46A 3F4LA 3CXRA 3WB9A 1NR7A 1P1JA 2EHDA 4BMSA 3KRTA 1I2BA 4R54A 4BNXA 3AU9A 4YR9A 5A06A 5JW6A 3TZKA 1YJ8A 2Q45A 4LRSB 1YS4A 1BW9B 4ROSA 4IDEA 3VC7A 5GY7A 5DF1A 2DBRA 1Z74A 4FJ0A 1VI2A 4WEOA 1ZNQO 3KM0A 3TZQA 1F12A 3S2GA 4FIZA 4BNFA 4GMFA 1B14A 3HUDA 4FFOA 1LDYA 1HRDA 1O9BA 4YJHB 3WXBA 4CLRA 1MFPA 2CDAA 2DPHA 3AI2A 3LVFO 4GAEA 2DTEA 4Y8VA 4CMKA 4NJMB 3MOIA 4TROA 4XRRA 2CVZA 3HDHA 4N54A 4L4RA 4Z3KA 3LT0A 1KC1A 1NPYA 3E5MA 5DT9A 4A0SA 3FN4A 3BMQB 3HB4X 4MVJA 3GMDA 3K8ZA 1D1TA 2C2XA 1B8PA 3E5RA 3I6IA 2EW8A 5BSGA 3DBHA 1T1RA 4BNZA 4I1IA 2Y99A 2VOEA 4NMHA 1B3RA 3PI7A 4BO8A 3WGQA 2OBNA 1MGOA 2EV9A 2CDCA 1ENOA 1P0CA 4D41A 4I5FA 4FCCA 2X9GA 4JLWA 1J0XO 4Z3DA 3AFMA 4O1MA 9LDBA 3KZVA 4IXTA 4CQMA 3QSGA 2EW2A 2DFDA 5F1OA 1T1SA 3DZBA 5U1PA 4CM9A 5IFLA 3EMKA 2HK8A 3LT2A 1PX0A 2RH4A 3DWFA 4HFJA 1HYHA 5K6AC 1NR1A 4K28A 4GX5A 2VN8A 5CFZA 1IY8A 4IMRA 2W2KB 4UEOA 4B3JA 1HLDA 1GU7A 1D1SA 4L73A 4NIMA 3RVDA 1GR0A 4UULA 5IXSA 1N9GB 5BT9A 3KTDA 2JHFA 4GBJA 1P1HA 3AUAA 4MVJE 2J5KA 3UHAA 1DC3A 4BB6A 4E5MA 4EI2A 4AJ4A 2DM6A 2H5LA 4WOJA 3VH4A 1N1GA 1EDOA 3WOHA 2O23A 4GSLA 4XYGA 1B0AA 5L7TA 2HKIA 3R6DA 4W7HA 4O5OA 2HMUA 2EKPA 1LNQA 1YGYA 5IJZA 1ZFNA 5A03A 2BGMA 3PTZA 4BNGA 1XU9A 3I9LA 3D0OA 4XA8A 2DKNA 1Q7CA 4PFJA 2PD4A 1YRLA 1KVRA 1Y8RB 1LQUA 4PLWA 5I7SA 2W98A 2J3HA 5U4QA 3HG7A 4UEKA 2HUNA 4CMIB 1JQBA 1VC2A 3INGA 4D0SA 3B1FA 4Q3BA 4RVDA 5KCZA 3GRKA 1PJ2A 2RHRA 4B8WA 3B1JA 1GV1A 3EZYA 3HN7A 2C59A 1DRVA 1QXSA 3PHGA 2C0CA 1YWGO 4DC1A 3IJRA 4ZU3A 4OQYA 1HE2A 1EMDA 3GPDG 1V8BA 4E2YA 1ISJA 3LLSA 3N7UA 4NHEA 1PL8A 4RVUA 1UH5A 4PG6A 4UUMA 3I9KA 3NTQA 1AGNA 4J1TA 3DOJA 3QWAA 3DAPA 3S2IA 2GERA 3SXPA 1K89A 4J1QA 2JL1A 1WDLA 3A14A 4RQUA 5L7YA 3HHPA 3HNPA 1X13A 1DRUA 2E37A 5AXCA 3VPFA 2FR1A 4XYEA 1Y7TA 4L75A 4HFRA 1ONNA 1NBOA 4P22A 4Y98A 3K5PA 4KOAA 4CR8A 3JQDA 3KHUA 3JCZA 3RUAA 4B7XA 2IE0A 4OO3A 4EUFA 1PEDA 2Q2WA 4JROA 2Q99A 2V6MA 1DPGA 1GYPA 3AOEA 4Q3AA 4Y6SA 5TRTA 3NTOA 5A9SB 4RQTA 3JYQA 4FQ8A 3ULKA 4YAIA 2W4QA 1VPDA 1PGQA 3PHIA 3EZLA 2Q4BA 1M76A 4XZ3A 3Q9NA 4CL8A 4DREA 5GZ1A 5DZSA 4JCOA 4E5NA 5A5FA 3BZUA 3FBGA 3VH1A 1PQPA 3I9JA 1M67A 1LRLA 4GPD1 4OL9A 3QQPA 4WECA 1NTOA 5FYDA 2PV7A 3WIEA 3PWKA 1YB5A 1VKNA 4AJOA 5L4NA 2ZB4A 4F6CA 1N2SA 4H15A 2V6GA 1JN0A 1XIVA 2DBVO 2I3GA 2W8ZA 3DHYA 1JAXA 3I9MA 4TZTA 4UUPA 3U49A 3ZWPA 1GUFA 4O59O 1DHRA 3JD4A 3GZNA 5ICSA 1U3WA 2VWPA 3G1UA 3P2YA 4NJMA 3OSUA 9LDTA 2W2LD 3HFGA 4FBGA 4OH1A 2BD0A 1R16A 4BO9A 3OIGA 1V3TA 4JNKA 3D3EA 2HJRA 1YONA 2EJVA 2FPGA 1LRJA 2P9EA 2WDZA 3RIHA 4BO1A 3JQ6A 1NAIA 1NHGA 1QV7A 2XXJA 4S3MA 2NWQA 4WASA 4PG8A 1TLTA 4JGBA 4BIIA 4DMLA 5KJ1A 3BHIA 1A7KA 1DFIA 1CJCA 4BGIA 3NYWA 3RFTA 2CNBA 3IL2A 1GL3A 4FFLA 4XJTA 1T4BA 2VRBA 3V1TC 3E03A 2R00C 3JQBA 4UVIA 1N8KA 1Y5RA 3FHLA 3TOZA 2D0IA 3OH8A 1HYGA 3A1NA 3VPGA 4U0JA 4TZKA 4E5KA 1Q7GA 3D4OA 4MVJF 4BNUA 5A1TA 2VQ3A 1H6AA 1KEVA 3JD2A 1KVTA 4M54A 4P8RA 1GD1O 4NU6A 5DBFA 3R3SA 1NPTO 2GZ2A 2XAAA 3ENNA 3P7MA 4I5GA 4UVHA 2AMFA 4RPGA 2O2SA 1A72A 1ZK4A 2O2YA 4IM7A 3AW9A 3MOGA 4R01A 3U09A 4WK6A 1PSDA 2VUUA 3OECA 2J5RA 4MVJG 3V8BA 4I8XA 3SC6A 4NFHA 4GLLA 4EUEA 1VKOA 2B5VA 4LGVA 1OMOA 2ZB8A 1IULA 3GVPA 1LUAA 1U8XX 3IOYA 5DBGA 5AOVA 2HMSA 4PGFA 5TX7A 3D5QA 3RUFA 1E1KA 3ONDA 1LSJA 2RCYA 2YZ7A 4QFDA 2P5YA 4AJNA 2GDZA 5KIAA 5KKCA 5BQFA 1ML3A 3FI9A 1LSOA 4CM8B 4CV1A 4WOKA 1YOVB 4BOYA 1LDEA 3NT5A 3ONFA 1HTBA 4WCFC 4CLXA 2AG5A 3AM4A 1U3TA 3W4IA 4DQXA 5I7FA 5JXWA 3KVOA 5TT1A 1NPDA 1FJHA 4TRRA 5B4UA 4IXWA 3DBRB 3NAQA 4TKLA 4IS3A 3F5QA 1RM5A 4L9RA 1R0LA 5G0VA 3STHA 3ICCA 1SOVA 4CLEA 4EJ6A 2NM0A 4JBIA 5C7OO 3ZNQA 4OOEA 1C1XA 3PQFA 4CPDA 3BTVA 1J6UA 1ZK1A 3DEYX 4U8GA 1EUZA 3EVNA 1EVJA 3PP8A 3D5TA 3WSVA 4OAQA 2WD7A 3DHNA 5FWNA 2C5AA 2GLXA 4GX1A 2FOIA 1L1FA 5IF3A 2DLDA 1K2WA 2PD3A 1PJQA 3KLPX 1KEPA 4N5MA 3LZ6A 1HZJA 4CLHA 2X5JO 1TB4A 1DC6A 3GG9A 5ICMA 4BO0A 3CMMA 2WTBA 1YBMA 2ZCVA 1Y9AA 5HBRA 2X9NA 2NLOA 3AJRA 1NFFA 1PJ4A 2VHYA 5ER9A 4PN3A 1NAHA 2AE2A 3U4DA 4IQ8A 5CDSA 4MOWA 2FSVA 2R00A 3JQBC 3KEOA 2WMDA 1TA4A 3KXDA 1KVQA 2EGGA 4YAJA 2BHLA 3Q11A 5KVQA 1LLDA 4XQGA 1Y81A 2EKQA 2CVOA 1PTJA 1UDCA 3IJPA 4XD2A 4OQZA 1ZH8A 3ZNNA 4CM4A 5JDIC 1TT5A 1FDVA 4KWIA 3EHEA 3Q0EA 4BHTA 3PGXA 3DO5A 4CLOB 4J90A 3N58A 1PJTA 3AY6A 3K31A 1XDWA 1ISMA 4ZHSA 1MG0A 3F46A 2UDPA 4OKIA 2O48X 1PJCA 3KBOA 5T8KA 1L7EA 4J6FA 1PJ3A 5H81A 1BXKA 4OKNA 5IN5A 1E1LA 2F00A 1LX6A 4XR9A 4UVEA 4DBVO 5L51A 3R1IA 2BI8A 4DXHA 3BTUA 5L4LA 2J8ZA 2OUIA 4DLAA 4IIUA 1K0UA 2GNAA 4E0BA 2I99A 1DFGA 4LSWA 5COBA 1Q7BA 4ZQHA 3JQAD 4KWHA 4OXKA 3F4BA 8ADHA 4R3WA 3UCEA 3KB6A 3QE3A 4RL6A 5BSHA 5BNFA 1M6WA 1ZO8A 2RIRA 3GC6A 3PZBA 4YACA 3SX2A 3U5TA 1JVSA 1V0JA 1SEPA 3OHSX 1EQ2A 3IMFA 1MFZA 3PJEA 2DQ4A 3H65A 4B3IA 4NZ9A 4YEDA 4IINA 1DEHA 4Z0TA 4WKGA 4PLYA 4BO2A 3PWZA 3B1KA 3CSDA 1SNYA 1PZEA 4XCVA 5B1YA 1P77A 1NQ5A 4CM5A 4OSOA 4CMGA 2B69A 5JY6A 4N7RA 3QVWA 3P19A 2OFPA 4EJMA 3O4RA 3DFZA 4XDZA 2R6JA 4ZVVA 3WLEA 3JQFC 4ZQBA 5HM8A 2QRKA 5KKAA 1EFLA 4D3DA 4XYMA 4JN6B 2XF8A 2DAPA 3LT4A 4ZQEA 1H9BA 4LN1A 1ARZA 3H5RA 1HL3A 2O3RA 2A92A 5AQ1A 2C82A 1M2WA 1KEWA 5JLAA 3NGLA 2NVUB 1UP6A 2VHVA 3GUCA 3AUSA 2NQTA 4YRBA 4E4YA 4XWYA 1ADCA 3NKLA 4II3A 1W0CA 1ZBQA 3W6UA 4E5PA 1MX3A 5A02A 1YQXA 5HTOA 1HLPA 3AUUA 1ZW1A 4MINA 1DJQA 4PG4A 1IPFA 3LK7A 5JFOA 4EITA 1GCOA 3DBVO 1A9ZA 1C0LA 2NVBA 3E9QA 3H9GA 4PRKA 5TF4A 1DLIA 2R2GA 3GA0A 1WXDA 3AUTA 2DUUA 4GWKA 3D7LA 3L6DA 5JCJA 3W4JA 3RFXA 1F8FA 1QORA 3LSYA 1QYVA 3FR8A 1PGJA 1E7SA 2IYOA 2FN7A 3ZNPA 4NI5A 4QEDA 1N9GA 1EDZA 2EIHA 4KP7A 1NVGA 3PHLA 4YJFA 1DB3A 4FGWA 4NBTA 2VYVA 1BXGA 1GQ2A 4J4HA 3RC2A 3L77A 3TFOA 3RBXA 3TPCA 4FGSA 3KYBA 1T2EA 3ZHYA 4MO2A 3C7DB 4R3NA 2VWHA 4TSKA 4BS9A 1U2GA 1VRWA 4WUVA 1NFQA 4W82A 4ND4A 4PLPA 4AG3A 3WNVA 2AW5A 3ZV5A 2BH9A 5G2OA 2I5PO 5L4SA 3SLGA 3M1AA 3SJ7A 2AEFA 1AN9A 2OP0A 4BV9A 1DIRA 2YDXA 1ORRA 3LF2A 4W9NC 4DPKA 3AI1A 3ADOA 2ZTUA 3ZWVA 4CV2A 1ID1A 1WP4A 2W90A 1UXGA 1HDGO 3NDRA 5I9LA 2BI7A 3EDMA 2CVQA 3PHHA 3WSWA 1I36A 2WD8A 2ZTVA 3ANNA 1VM6A 1F8GA 4DUPA 1EE9A 4YJHA 3KV3O 1DDOA 4P38A 5EL0A 2C20A 2GF2A 5JYDA 3AOGA 1BWSA 1CETA 4CLOA 2ZTMA 1UDBA 4G5HA 1UZLA 2J3IA 3LF1A 2E6UX 1KYQA 1I30A 5JNLA 1XHLA 2JD0A 1XEAA 5T8KC 1DIGA 1DXYA 3W4KA 5I8WA 3DDNA 5A4DA 1V6AA 1W4ZA 1X1TA 1D7OA 1U3UA 1JDJA 1ZK2A 4H3VA 3F1KA 2TMDA 2X22A 3MJ4A 1ZUD1 5I9MA 3BMCA 2DUWA 3BXXA 3UICA 3GFBA 2BFPA 3HJAA 1XWFA 2AQIA 5B12A 4A7PA 3GUYA 4BGUA 2EP5A 4WGGA 3H3FA 3W6ZA 2G82A 3TWOA 2QYSA 4QXMA 4YBZA 3GNQA 4B7UA 2YJZA 3S1LA 5KVVA 4LW8A 4XYLA 3IKTA 1QLHA 5L7WA 3FTPA 4CMCA 4GLOA 1I3LA 4FD3A 1LRKA 2JFHA 3WYCA 2PTGA 3F5SA 5KNLA 3GGGA 2P9CA 3ZDFA 4ALJA 1SO8A 2Q2VA 1YL7A 3LT1A 4WCFA 1BG6A 2PZKA 4Y67A 4GMGA 4KQWA 1RKXA 3DBLA 4GKBA 4NR0A 1DJNA 1I2CA 4HY3A 1NWHA 1MC4A 1ZSNA 1GDHA 5IDYA 5JCXA 3S2FA 3CE6A 3PXXA 2NADA 3OM9A 1R6DA 4DC0A 3LC2O 1MB4A 3S8MA 1ENYA 4NBWA 4ALKA 1OC4A 3WGOA 2IEDA 2IODA 1U4OA 4FJ1A 4AJ2A 1HF3A 1PR3A 5TLSA 1NQTA 3GPIA 3DONA 3GF4A 3OBBA 1LDBA 3JSAA 4UVDA 2Y68A 2XPCA 4NK4A 4YYZA 1F0YA 3B70A 5DCUA 4BNVA 1NQOA 4ZN6A 1ISIA 4IQGA 1HYEA 3H9QA 3JYPA 3OF2A 3ZU5A 4ZRMA 2GN6A 2ZTLA 2G0TA 2A9FA 4BQPA 2NVWA 1E3EA 4EZBA 5BNIA 2B4TO 3A06A 1GEGA 3IP3A 1I3NA 1HKUA 1LSSA 1R66A 2ZKLA 2ZCUA 3WQQA 4CM1A 2IDZA 1ISFA 3CZMA 1C1XB 3H6KA 3OJLA 4CQMD 2VTDA 1HWYA 2V6FA 1A4UA 1PQWA 4BL5A 1YKFA 4CM9D 3E1KA 2DFVA 5EESA 4C7JA 2IYPA 2PNFA 1SB9A 2VHWA 4J2OA 4YT2A 1IHXA 2B0JA 4YJGB 3FNEA 3JYNA 1X0XA 4L8VA 1MXHA 4RVFA 3I23A 1DIBA 1CDOA 4FFNA 5EN4A 3OP4A 2B36A 4KQXA 4WLUA 2ZB3A 1HSZA 2WSBA 3NJ8A 5G4LA 3V5NA 2IEBA 3CTMA 4CV0A 4DIFA 3ZWOA 4CUKA 4Q39A 1P9LA 4GH5A 5A3VA 1ISHA 4BO7A 3I52A 4CMJA 5IZCC 3Q6IA 1X14A 4W6ZA 4YRDA 3DOOA 4IDDA 2QZZA 3VZPA 5MDHA 1LLUA 3H9JA 1I33A 3KOUA 3UAGA 1C0KA 4I5EA 1QR6A 1WNTA 1YQGA 4J1NA 4B8ZA 2X5OA 3L6OO 3CZRA 1DFHA 2YY7A 1PJLA 2HMVA 1IZ0A 2VOJA 1FMCA 3I6QA 5ENDA 1ZSYA 4Q3DA 4XIJA 2JD2A 1I0ZA 2FRDA 4R5MA 1SB8A 3QRWA 4RLSA 1KOLA 2D59A 2B83A 2X9VA 4TVOA 1C1DA 4XGIA 3GZNB 3RBZA 2JFFA 4PRLA 1KERA 2X1HA 1T2AA 2ZYDA 2FZEA 1EZ4A 2G5CA 1XG5A 3QWIA 2X7HA 3TZCA 2OHXA 3UFXA 1I01A 1LEHA 3UCXA 4QX6A 1DAOA 1P31A 5G4KB 5L53A 2O3JA 2LDBA 1CWUA 5K9ZA 3UOGA 4J4TA 4ALIA 3VOSA 3D4PA 3EW7A 3D3WA 3LU1A 4TMFA 4E13A 3DZFA 1V35A 5T6BA 3AM5A 5DP2A 4W4TA 3QIVA 4NPCA 3INRA 1TVEA 4XDYA 4IY1A 5IN4A 1GPDG 4A2CA 4DMMA 4EEZA 4WJZA 1H5QA 4H7PA 2CF5A 2EP7A 4OJNA 1R4MA 4YT5A 3WDSA 3FCOA 1UDAA 5F1KA 2AQ8A 5I7VA 3MTGA 1AXEA 4R41A 5AXDA 2A4KA 2YHIA 3GHHA 4O0LA 4RGBA 1JAYA 3DZGA 3CPSA 1GQQA 2YDYA 5EMHA 1JW9B 4CJXA 5TIIA 2PZJA 3BMQA 4HBGA 1O6ZA 3TN7A 4DGSA 3BA1A 1HXHA 1PQUA 2PY6A 1NP3A 1YQDA 3C1AA 4IDCA 2WYWA 1JLLA 1ZIDA 4D45A 4WCFB 4CM6A 4B3HA 2HAEA 2GUGA 5TJ9A 2EGHA 4JJFA 4Y6PA 1QYDA 4BNLA 2J5QA 2PGJA 2DU8A 5CP8A 4FOOA 4J91A 2A94A 1SC6A 4RV9A 3HADA 2VNSA 5B4VA 2O4CA 1ZXBA 1XGKA 4U6QA 4YT8A 4U6SA 4M55A 1YBAA 2Q50A 3ZHXA 4R1NA 1O89A 4YRAA 4YA6A 3QVXA 5T67A 1LI4A 1Q0LA 2G76A 3QHAA 4F46A 1P3DA 3FRJA 3U0BA 1B7GO 2W2LA 1LLQA 3PLNA 4Q9NA 1H6CA 2X23A 3WBBA 4HNGA 1JKIA 5BSEA 3A4VA 3F6YA 4IJWA 1S6YA 3DB2A 3RQSA 3MJTA 4KDFA 1Y8QB 3GDOA 3JQGA 3MJEA 5IDQA 4J0EA 4DYVA 4A03A 4DA9A 1H93A 5KVCA 5CPFA 5LDGA 3I4CA 2ZQZA 5A9SA 1NFRA 4I9NA 4J43A 2IRWA 3ZNOA 4RPLA 3RUDA 4BNNA 2X0IA 3DAGA 1I3KA 4MVJI 3PEFA 1CEQA 1E7RA 2GSDA 1T25A 1IUKA 1CQIA 1PZGA 3IC5A 1U3VA 3IQDB 3Q2IA 2OL4A 1E3SA 3V1YA 3IAHA 4LK3A 3VH2A 1BXZA 3MWEB 1DSSG 2OO5A 3E9NA 3KYDB 5CPBA 4GWGA 5CG1A 1A7AA 3QVSA 5BR7A 2Y1EA 3AM3A 3GFGA 3I83A 1O94A 5MGBA 2GRAA 3K9QO 3D3WB 3DAFA 4I08A 4DIBA 3ZWYA 1GAEO 4UUOA 1BHSA 4NG5A 2NVUA 4PLZA 1KIFA 5JSFA 1IB6A 1IHYA 5IDXA 3VVCA 1KBZA 1U5CA 4K6FA 4NK5A 3RUEA 3HQ4O 2GCGA 4JX8A 4ZICA 1N5DA 4BUCA 3ZWNA 1QRRA 1YB1A 5IZCA 2HU2A 1WZEA 3OETA 4KZPA 1R4MB 4CQMB 4B7CA 2UVDA 3GNSA 4D7AA 2GGSA 4GGOA 1E7QA 3Q9UA 2ZATA 4FFMA 2BKAA 2D5CA 2FZWA 1U4SA 1B3BA 3DR3A 4IZIA 1KVSA 1Y9EA 3K2EA 4DL9A 3R3JA 1GCUA 1EVZA 2NV6A 4WLOA 3QWHA 3EC7A 1T2FA 2PKRA 4JP3A 4II2A 5DP1A 2YHUA 2V6BA 3RC9A 3ROKA 3V2UA 1LTHR 1SZJG 4LCJA 5JO0A 4YCAA 4P4NA 5DN9A 3E18A 3GVCA 5HS4A 1K6IA 3Q3CA 4GKVA 4AJEA 5JYEA 1OC2A 4B79A 5JAZA 5L40A 2Z1NA 3RJ9A 3DMYA 1GUZA 4P4GA 3LC7O 1ZEJA 2Y0DA 3M2TA 5JMWA 3RUHA 2VHXA 2X6TA 4AJJA 1I3MA 4JQCA 2O3TA 4URFA 2OORA 4DLLA 4UVGA 2CFCA 4WLEA 2DT5A 4K26A 4CQLB 1I5RA 4RF3A 2AEJA 1YXMA 1NHWA 4BV8A 4QUKA 4D3SA 1HDRA 1UZMA 5KJCA 2Q1TA 4CM8A 4PLHA 2UUOA 1YL6A 1RYDA 2HK7A 3WGIA 2JAHA 1ZMOA 3HB5X 3C1TA 3ZW8A 4KTVE 1G6KA 2FMUA 2PKQO 1SPXA 5LC1A 5TQVA 3NX4A 1KY4A 3UCFA 2QRJA 3O38A 4TVBA 2HDHA 5G0WA 4WLFA 4K9DA 4DLBA 3JV7A 3KSZO 4J0FA 3UN1A 1RPNA 1JWAB 4BKQA 1SCUA 3DMTA 1UR5A 4BGVA 3DBHB 1R0SA 1EK6A 1V9LA 4RDHA 3ETDA 3L9WA 2FPIA 5ENVA 3W8FA 4J49A 4Q3CA 5A9RA 3KO8A 4AFNA 5CHEA 2PA3A 3EAGA 4NNJA 3OJ0A 4CMEC 1VJ0A 4NJOA 1IZ9A 2NU6A 4XX0A 2FR0A 4BNHA 5EJ2A 2VRCA 1AXGA 1MLDA 1ZCJA 3BHMA 3WIDA 1YH3A 3DZJA 1I10A 1Z7EA 3WX0A 5K0ZA 4Z6KA 1WDMA 5IAAA 1OOEA 4MP3A 4E3ZA 5JAMA 4DWVA 1OAAA 1U9JA 3CMCO 3GEDA 3A28A 3E9MA 4L74A 4OOFA 4DBZA 3K92A 2JKVA 3TSCA 2EERA 3QW2A 2P4QA 1MP0A 2GYYA 4W99A 3AU8A 4M89A 3ZHZA 1BRMA 1I8TA 3W8DA 4CLDA 2P2SA 4Z9YA 3WFIA 4LVUA 3WGZA 5L9AA 3KYCB 1K3TA 4GI2A 1GY8A 4WLVA 3ZN2A 3PHJA 3K30A 4BO6A 1JKJA 1PS0A 2EEZA 4JIGA 3ZU2A 3JD3A 1PZHA 1H9AA 1XYGA 2Y0EA 3HSKA 4PLTA 3T7EA 5JS6A 2VZ9A 1MXFA 4P4LA 1NVMB 2G1UA 5CDUA 4R1SA 1V3UA 2GPTA 3D1LA 3Q2KA 3SBOA 3GVIA 3VKVA 3JYOA 3OA2A 4Q3NA 5GZ6A 1IL0A 1ZJZA 4L4SA 5COAA 1B15A 1Z75A 1WAMA 3IUSA 1ZVMA 3NGXA 2OMEA 3GEGA 3O26A 1LJ8A 3VAZA 3NUGA 4J4BA 3FSRA 3BMNB 3D64A 3KSUA 3EY4A 5L45A 1ONOA 1CERA 1VSVA 3GY0A 1YDWA 1R4NB 1CIVA 4D79A 3PYXA 3ONEA 4NFYA 4F45A 4N18A 1VSUA 5TSDA 1TI7A 3PDUA 5A3JA 2QQ5A 2E4AA 4BB5A 4QSMA 2X5KO 1ENZA 2B4QA 3OIFA 5F5LA 5JCJD 3WG9A 1Z82A 3VH3A 1H0KA 1A9YA 2FR8A 2E82A 1E3WA 1Z73A 3ENKA 4RVHA 3DTYA 1H2HA 4PVDA 2YFHA 2ZJ0A 4FOSA 5JC1A 3X2FA 3DBLB 3JQ7B 1IPEA 4WEQA 5EPOA 1E7YA 1V3VA 2VYVD 5EQDA 1MG5A 2J3JA 2V65A 3B6ZA 2NU7A 3JYLA 2FPPA 1QYXA 3IKVA 4A26A 1J49A 3ABIA 1E92A 1N1EA 3PYLA 5G0TA 4DTIA 3GK3A 4ZJUA 4R68A 1GZ3A 5IZ4A 4XKJA 4CR6A 2YV3A 4NU5A 1F17A 1QG6A 4MIYA 2H9IA 3RCBA 5U9CA 4N5NA 4K1LA 3GVHA 4YB8A 3W1VA 2X58A 4MIEA 4PG5A 2I66A 3K2BA 3H4VA 1PL6A 1ZZEA 5I7EA 2NTJA 3TL2A 2AQHA 2PK3A 1BSVA 4BO5A 4RDIA 2X86A 4YXFA 1BXGB 3BMNA 4YAEA 5A04A 5ES3A 4IQ0A 3QP9A 4PLCA 2YFQA 1PGNA 2I67A 3AFNA 6LDHA 4KUGA 2GZ3A 3WNQA 3R0IA 1M66A 3JD0A 2FY8A 4FSHA 4ZQFA 3RC7A 3OMLA 3TFQA 3WGHA 1HETA 3H8VA 3PQDA 4E12A 4QO8A 3QLJA 2NQ8A 3L4BC 1NNUA 4PVCA 3NT4A 3WJAA 5FEUA 4HFMA 3OFSA 4D42A 3QV1A 4W7IA 4F6LA 2IZZA 5DDIP 1E3WB 4AJLA 3RASA 3DMTC 1GV0A 2VYNA 1EK5A 2P5UA 3L9XA 4MP8A 3JQ7A 5ER6A 5HRUA 5AXBA 3ZWWA 3JQ8B 3C3XA 1TT7A 3I9OA 4TWRA 2C5EA 2ZYGA 3RJ5A 4BKOA 1A71A 2BRUA 4Z9XA 2GZ1A 1HDOA 1LXCA 4RZIA 1GTMA 4JJGA 4IBOA 2NTNA 1P44A 2J3KA 2AXQA 3T7CA 3VTZA 4HV4A 1EVIA 1LSUA 4TRMA 1FF9A 2RH8A 5C7IO 2GN4A 1YL5A 4E33A 1BGVA 2ZK7A 4E2WA 1E77A 5JBIA 1GPJA 1WMBA 5G0SA 3L07A 3CINA 4YT4A 4MPDA 1ZK0A 4PZEA 3GR6A 2PGLA 4GVXA 4E32A 2NU8A 3ZH2A 3OQ1A 1VLLA 3QY9A 1HE4A 2HRZA 1J5PA 2H63A 2P4HX 3RUCA 3MWDB 2WWRA 5H82A 1ZKMA 4INAA 4EW6A 1XU7A 2GASA 3WYEA 4YAKA 2Y1OA 5B37A 4TQGA 1CQJA 2YQ5A 1GFSA 2JFGA 2ZYAA 3K73O 3ITKA 4M1QA 2UAGA 4R4JA 3H3JA 3TZ6A 3WR5A 1U5AA 3O8QA 2WJPA 2Y67A 3GRPA 4FN4A 1O95A 4BNIA 5KJEA 1Y8RA 2C54A 5I9NA 5B4TA 4WNCA 5TT0A 2DBQA 4HXYA 1LDMA 4R9RA 3INTA 4X54A 2C2YA 4KUEA 3BIOA 4ND1A 1GEEA 4E30A 3FD8A 3ZWAA 4OXYA 2I9PA 1GZ6A 1WW8A 2JCVA 3GAZA 4ND5A 4BMNA 2I3AA 3AY7A 3TOXA 4G65A 2ILTA 1UP4A 1EFKA 4RPHA 4ALLA 1PJSA 4ITUA 2ZJ1A 4NFSA 1UAGA 1E3IA 4MDHA 1XSEA 4QQRA 4WNIA 5EIOA 4CLRB 3IP1A 3PPIA 3I9NA 4CUJA 1LA2A 1EBFA 4WLNA 4U5QA 4D44A 1E1NA 2PD6A 1P1RA 2X8LA 2Y66A 4EJ0A 1Y6JA 4XJSA 4BKRA 2X0RA 3PFWO 2BF7A 3FWZA 4R69A 4E2XA 1P45A 5IXYA 3RU9A 4GL4A 3HDQA 4M86A 1VJ1A 3WTCA 1E6EA 5JAIA 2JCXA 4QECA 1B8UA 2X0NA 3T4EA 2PLAA 5JPIA 3TJRA 2VWGA 5TC4A 4OM8A 3OEYA 4HFNA 1EUCA 5EINA 5KJFA 3DFUA 1DO8A 1KVUA 2O3QA 2Q4EA 4MIOA 3O03A 3AK4A 1Y5MA 4ZD6A 2CUKA 2DC1A 2VUSA 2OBYA 1D3AA 2HO5A 1TT5B 5JDCC 3COSA 1YE3A 2VNAA 1U7HA 5TGDA 2O4UX 3GMSA 1UXHA 2I76A 1RM3A 1SBYA 2FP4A 3QWFA 2HMWA 3IS3A 2YW9A 1K5HA 2PH5A 2WM3A 4EBFA 3ORFA 4J1SA 2VTEA 1PS8A 1QKIA 1WLYA 4OMUA 4XEHA 3AY3A 5JMPA 4YAGA 3GGOA 4RPKA 3TRIA 4RCVA 2UUPA 1RM4A 4FS3A 1OZAA 3H5AA 1Q2XA 1JU9A 4FDAA 4MJLA 3ZWMA 1LBEA 2VZ0A 2GN8A 1B8VA
chains in the Genus database with same CATH superfamily
4JC0A 1UC4B 2I7TA 1N2CB 4MGZR 3MMSA 4I55B 3DYVA 4X3PA 3O93A 1CJSA 3TNLA 5ALFA 2ZBQA 4JL5A 3JYHA 4G09A 4KWEA 4TL8A 1WOYA 4I7EA 1IONA 1MUUA 1K4YA 3R9XA 1S3GA 3AH8A 4JBHA 3LUAA 5AXAA 4RTJA 3MOSA 5JAQA 2EKLA 3BUSA 3EXHA 3GDWA 2WFLB 1CUUA 2GFQA 4DYHA 5CDYA 3WMWA 3TE7A 3S1SA 3MJCA 3PS9A 2Q5FA 2VG8A 1M5RA 2UZ1B 3ZE0B 3PUIA 1DOHA 4H1HA 4TS3A 3RSQA 4EVSA 1NDQA 5MGNA 2YV2A 4FR5A 4HXGA 5J23A 2VDRB 2ZUVA 5EQFA 1L5NA 3QTTA 3VR4H 4B4WA 2VAPA 1HT3A 1OI7A 2CBXA 2ZAOA 4RTNA 5AW6A 1OIWA 4J3NA 2AR7A 4BNMA 1B26A 4D46A 2WABA 2NACA 2N0SA 3D6AA 3GJ4A 4K6CA 3KU1A 1IBRA 2P2NA 2OXFA 1CJMA 3C3JA 3L8DA 4KWCA 2BONA 1C3OA 1NOIA 3KLBA 3H2SA 4IDFA 4BPRA 3U7IA 3DTVA 1FP1D 3GH3A 3OEEA 1EIWA 1SMKA 3O8QB 4B74A 3U9LA 1FFWA 1WE2A 2ZSDA 1YBHA 1E69A 3DEKA 1YA4A 1MAHA 3NKVA 4QJ5A 3ZCRA 3CLTD 4TT8A 3F47A 5FLEX 5CYFA 2C4VA 2QP9X 4YONB 4C0KA 4Y1GA 4G0QA 2R97A 2O7SA 4Z4GA 2BFDA 2VUTA 3AINA 3SQDA 1Z45A 1NW9B 3QMVA 4X66B 1YMVA 1FDTA 4WY5A 2ILVA 4PGMA 2E89A 2OY0A 1EFVB 2JGNA 1S3SA 1FDSA 2WQZA 1GSHA 4AKGA 2XSZA 2AQKA 3RFVA 5LBTA 2BLLA 4R6XA 4RPJA 4B46A 3WK6A 1UUFA 4NTZA 3SS7X 4CKWB 2CL6X 4N3CA 3C6MA 3OTIA 1NP6A 2NO1A 3RKUA 1N4AA 4C1BA 2XY4A 1GCAA 3IRVA 1DOAA 3L8YA 4X62B 3AFGA 1NY6A 4WPGA 3TXXA 2VPXA 3X1JA 2JASA 2ASVA 5C35A 4I50F 1YAJA 3LRTA 5ALIA 2CMDA 3C1UA 3EVCA 2NYVA 5FOTA 5CCXA 1I6WA 5CRIA 1WBBA 4MHTA 1RI4A 2B61A 2ZS9A 3QQ5A 1QP8A 1X7DA 1XTPA 2XX3A 2NUAA 5PGMA 2V9ZA 5ULLA 1B2LA 2BCJQ 4QJ3A 1M2OB 1MCZA 4V1CB 4RTLA 1P2VA 3IRUA 1W5BA 3K1ZA 1KGSA 3EW9A 4Y2PA 3RDPA 3OQNA 4IJVA 3V3TA 1J2UA 4NBRA 1P1FA 3QXHA 4QT0A 1JZSA 1U8UA 3A1FA 2A35A 2BI4A 2QAJA 1UK9A 3USES 1T0PA 4BEJA 2FEPA 3ETNA 2HQBA 3G5AA 1NXXA 3H2JA 1D9ZA 4J9VA 4YMWA 1TU0A 5HEKA 3WYGA 3ZVRA 1ULSA 2H59A 3JALA 3HGTA 4XD7D 1CZLA 3OQMA 1YKSA 2HK9A 1K66A 3AR8A 3I05A 1UM9B 1L8OA 4GX2A 2IEZA 1PFKA 4P31A 4RKWA 3SQOA 5DYTA 1XCGB 3W04A 1YC2A 5BNTA 3P5SA 2WF9A 3ICPA 3V7YA 4JDUA 1UXIA 1J2TA 2VT7A 4V0NA 3GBSA 5FEMA 4DF3A 3KETA 3O9VA 3GHYA 4OI2A 3MD9A 1E6LA 3BRQA 4M76B 4HPXB 4FT4A 4PC6A 2IV2X 1IEXA 4OQ4A 1PNVA 3KWMA 1IEVA 4ZYTA 1MC1A 1PL7A 1RYEA 2JH8A 2D13A 3EZGA 3JQGB 1G3QA 1RBZA 4KIGA 3FH0A 4RHUA 3UXEA 3KYIB 2L0XA 2VNHA 3DNFA 3U62A 1TA0A 1HUQA 1Z7BA 3PXUA 4ESEA 1P5RA 4IDGA 4Z9FA 3KOYA 3V1LA 1YVEI 3IR5A 1OB5A 5F3WB 3R3ZA 5JFGA 2OLEA 4ICIA 3CCCA 3EC2A 1HT2E 4CI0B 2ZS8A 5ADHA 2O0LA 4R5HA 1E6KA 2PZMA 1FFXA 2ZS7A 1VZ3A 3UAOA 5HCNA 5F51A 3S68A 2GHIA 4Q7EA 1KI7A 1HNZB 1VCIA 3NIDB 3GELA 3GLGB 1E5QA 2ACKA 4CV3A 3N7TA 3WFJA 3WL6A 1EQUA 3PJFA 4C4YA 3NIBA 4E51A 1EFRA 1KO1A 1T13A 1GSOA 2Z6QA 4HNRA 2R25B 2O5VA 1Q14A 1K75A 4CMEA 1RP1A 4OXQA 2ZRGA 2ZJAA 4BNJA 1C7EA 1RZVA 1R0ZA 1H05A 1T36A 2ZB7A 4W5QA 5ALXA 3IBTA 1Y3IA 3EXHB 2CNWD 2PRKA 3KLMX 3LXRA 1KQOA 4RZHA 2Z95A 1YDEA 4KDEA 4O1HA 3RWMB 1RBYA 1Y8CA 1A4RA 1ECPA 4PX9A 4C2AA 4ZZ1A 5K03A 3X1WA 4H16A 1P74A 3KLNA 3FJYA 3G3EA 1SUWA 1WLSA 3FPBA 3U4IA 5F21A 5ALHA 1UMBB 3SSAA 4F6RB 5JZSA 4AW9A 4ZOQI 2NZ2A 2YUTA 4RXTA 3ZDDA 3E8XA 1EEHA 1HMPA 3SYRA 3HCCA 3O5AA 4FGLA 3C24A 3WBFA 4X85A 3QU7A 4HYQA 3A9CA 3HC7A 3KJHA 6AT1A 1XN1A 4CDGA 3H97A 1GG9A 3PD7A 4UW9A 4D8XA 3UV6A 5CA1F 3GYBA 1H9CA 5AVQA 4TQUS 1M2GA 3PGKA 4L9AA 1O5IA 3O2JA 5DYNA 5ILGA 1CY0A 1KI3A 1ZGBA 3CLHA 1JEDA 2AJCA 4JBGA 5BN5B 2JAPA 4DUZB 4BBJA 1EX6A 1VPVA 3HR4A 2NXNA 5LL6P 5LP6F 2C29D 2Z6VA 1J4AA 4BFCA 3T5DA 1C80A 4QUBA 4WL0A 1A9OA 2Q5EA 3AP1A 4QYXA 4XFKA 4Q7JB 2OFXA 1MU0A 4V1CI 2ZI9A 4R05A 4CT0A 4EHAA 3BD7A 3I5MA 1P7VA 4PYMA 3QU9A 3L0DA 3DL4A 5CURA 2OENG 2XNHA 3C45A 4G01B 1R37A 4TTTS 3TZHA 4UATA 3UXYA 3ZHTA 5BN4A 2O8NA 4RV4A 4US1R 3ONNA 3S55A 4M87A 4DCJA 4AL4A 4KL8S 4KXXA 3MRSA 1DBRA 1JHPA 4EY3A 1G5IA 1Q15A 4TGLA 3IDSA 2BFAA 5E95A 1DOZA 1U7WA 1Y7HA 1Y5NA 5DHAA 2ZIXB 1H1TA 4BNKA 4EG0A 3PFCA 1JB1A 3QA9A 4UMFA 1R8YA 4WVLA 4GLBA 2BMWA 4K5QA 3ETEA 1VHJA 4H0CA 3QXCA 4FPXA 1DARA 1PJZA 1RWMA 5KTSA 3JVDA 3Q4GA 5ELLA 3TCNA 5FI3A 3QEKA 4D3YA 2QX9A 2HYIC 5K5EA 4L1KA 3ZV3A 4FB4A 4M1KA 5LSAA 4QTYA 1LBQA 2BKUA 2CV2A 1DQNA 2VRCD 1KMHB 2VZ8A 4OG2A 4XWTA 4IFIA 1L7NA 4TTVA 5KINB 2REOA 4ZTBA 4ZDKA 2VJKA 2WWWA 1R0BA 2GVDC 3FE2A 4MWTA 1CC1S 1D9XA 1T9KA 5DULA 4BZZA 4DZRA 4IP0A 7GPBA 2P91A 4EGFA 2Y93A 1VXRA 1CY8A 2XOEA 2CDRA 1XP5A 2HCTA 2XW6A 4MW4A 2LXNA 3IAFA 1TZ2A 4X7RA 5HX7A 2JLRA 3CZCA 4JJIA 3RYCB 2N47A 5IM5A 4B83A 4RGQA 3DEJA 3DWGA 1K7YA 2QUAA 2QZ9A 5AT1A 1C50A 1N7JA 2IH5A 1UK8A 3T95A 4RZXA 2J6CA 4OLHA 2ZIFA 1S5PA 1U2GC 4AIIA 4AZWA 1W36D 3N9IA 3VGJA 2DPLA 4PX5A 3ZEIA 3NAGA 2ZYIA 3MWJA 4E31A 4PONA 5DBEX 4RVOA 5C7LO 3D7NA 3CLKA 4ZGWA 4PEVA 5JO9A 4GE3A 3MCUA 2FMHA 3X1ZA 1NJFA 4RHCA 4I9UA 1MA0A 4V0LA 4W9NA 4C6TA 2QK4A 3DQQA 4QUDA 2EZ4A 4YTEA 1ZGGA 2P8SA 3HBMA 3LM8A 2I4IA 5K05A 3CIFA 3SY8A 1A95A 2D7JA 3MJSA 3GLFA 3NJ4A 1JQDA 3KU4A 1SIOA 2C2HA 2VHTA 4MKHA 3WRXC 1GCIA 4WE3A 1U0GA 1YIAA 3ANTA 4P3YA 2DQYA 4TXNA 4XGKA 1F0KA 1MTZA 2WFMA 4BLOA 4KGXA 1BDMA 5CNMA 3OU6A 1JTFA 2F8TA 4O4JA 3D7RA 4UEQA 3GDGA 4I81A 3DDOA 1C8LA 2ZIAA 3FPLA 3K8OE 1QP0A 3V32A 1OH8A 3CLRD 1C2YA 1FFBA 4YV1A 5KTTA 3GCDA 1GU0A 1JG1A 4GF5A 3TTVA 3T99A 1Y9ZA 4INPA 4O2BA 5JD6A 1GKUB 2PR7A 2B30A 4MS3A 1J1UA 2RGGA 1A8PA 1T1JA 3QFFA 4MQUA 2XITA 2ICAA 3E61A 4N0QA 1XQ9A 2CXUA 5AW7A 4Z8YA 2BRUC 5BWBA 2R7NA 2WHYA 4RK5A 1WHSB 1BKYA 3UW3A 1H85A 2WYUA 2JIDA 4AU1A 4HDNB 3LPDA 3R5HA 3NEPX 4KDCA 2ZIUB 2Q1SA 4F1WA 2BM9A 5T57A 3RIEA 5HKAA 3P2EA 3GNLA 2BEVA 4HJRA 2Z57A 4HX5A 4DRXB 2I6SA 3ZCSA 4MXDA 3WYBA 3RC1A 3ZHVA 4EI9A 2NU6B 2ZE8A 4G4SP 3GLUA 3H2GA 1XXHA 2RDMA 4FJ2A 3T35A 1JKJB 1H3NA 1RQGA 2PL1A 1ZITA 2Q5QA 3FA2A 4KWTA 1XCBA 4B81A 4C4OA 3ZZ1A 2E4UA 2WK1A 2X2PA 3FMVA 3VMFA 3PFFA 1SVWA 2ZIWB 2G17A 2WIFA 1E5TA 3QY0A 1VKZA 2XV1A 3BYZA 4GGMX 2A33A 2DFKB 1YU6A 2CLCX 3EZFA 1KYWA 4PG7A 4TVKA 3QYFA 2ORIA 4QBHA 3Q1LA 4KQFA 2PKQP 3JXEA 5E2BA 2R1TA 1C9YA 3ECCA 3LKBA 1FOEB 4CDRA 3NAZA 4X6YA 3GCXA 5HQJA 2BKEA 5BQOA 3NPMA 1TAUA 5JS1A 2GMWA 1U28C 3LDAA 3A9WA 1PS9A 2NSDA 2QE7A 3KEGA 4RD4A 4QYSA 2D06A 4G4JA 4H08A 1H6DA 1GTG1 1RLMA 3LJKA 5AYVA 1RFGE 2BMEA 3PXEA 4X41A 3RSHA 2BJWA 2HQOA 4J7UA 2ZBEA 4RF2A 4JP1A 3QNMA 3RBVA 3JQAA 2J5XA 5B58C 3ZXSA 3H42B 3ENZA 3U1VA 1CNEA 3A4TA 1MR3F 3T0FA 4S12A 3WWZA 3SJZA 2OT3B 4A27A 3OM1A 1SVNA 5AOCA 1ZRSA 5L95A 4RESA 4KZKA 5IH3A 4FZRA 2OECA 3KL2A 3V2HA 1WSWA 2BEWB 3KQYA 3WZMA 4TL7A 4O0MA 2JS7A 2IDKA 3MELA 3OPXA 4Q7QA 2FFHA 3C7CB 1BVUA 3PV0A 1HC7A 3F78A 2ZJBA 4HUQB 3RADC 1EUDA 2RGEA 2Q5OA 3JR7A 4MVWA 3VDNB 5SZHB 5T64A 3C70A 2HIMA 2ZPAA 4XQEA 3S2YA 1MH9A 2PJRA 3ICVA 2OCKA 3P4YA 4FHZA 5CXUA 3CKKA 4QFCA 4IZHA 2JCYA 2H52A 2HA4A 4N01A 3WLIA 3ER8A 5C5DA 2DTDA 1JPJA 4YHBA 5CG2A 1XRRA 4FC7A 2NZ8A 3NS7A 3GVXA 1ENPA 4KB5A 3ZLVA 3UJ7A 3LLVA 1SU4A 3AEKB 4LJRA 2E1PA 1OJLA 2EBFX 4X60A 5CH8A 4DXDA 4RETA 1N8NA 2X5NA 2YIJA 2QTVA 4DOMA 3NOQA 2WIDA 4AJ9A 3G2NA 821PA 3N2NA 2YJ5A 2ZSEA 4U2KA 1PR4A 2G72A 3BRSA 3PX2A 4Q9KA 4JBWA 4Y6QA 5ERYA 4E46A 2WMYA 3R6TA 4F60A 1M1NB 1ZCBA 1KBQA 1POXA 1Y37A 1RW4A 1GT91 3UG6A 2O2JA 4ID9A 2VDQB 1N5KA 3JAWA 3W79A 2QW8A 4GWLA 2Y1CA 3NALA 1J0CA 1UPUA 3IVCA 2ANBA 3Q3GE 5FBZA 4ZHQB 1XLTA 1ICIA 3FVQA 4R9SA 4ND8A 3VTFA 1HZZA 3QXGA 1ZL0A 3HBAA 2CHVA 4X61A 1X7GA 1ESNA 1V95A 2OVBA 1EESA 4FW8A 1P29A 3WMXA 5EUBA 1QZUA 2O3SA 2OZLA 3SIRA 2BTEA 3RM3A 3X3HA 4RJTA 1LQTA 4YVFA 4BNTA 2PVSA 1V2HE 3G1TA 1J07A 3L8CA 3SEFA 1C81A 1HDZA 3SAJA 3PGJA 5M04A 1CY6A 2BFMA 4P7FA 2NSHA 4NICA 3T0GA 2O8CB 1H2XA 5K6AA 3A4MA 3TS1A 2PU5A 1AHIA 4K9NA 4MULA 3UMJA 4M8KA 2EZTA 1LF0A 1N7GA 1FK8A 2AOXA 4RVSA 2YS7A 4CIWA 2JIRA 3PC7A 3GLFB 1TXGA 2ZSJA 2B35A 2ZRLA 3AL2A 1QOQB 1R18A 3D6UA 3IE2A 3IUPA 1G63A 4L28A 4Q1BA 4MVJH 2D5AA 5FLXA 4TOIA 4WBNB 1Z6ZA 3OEWA 4UXJA 2YN4A 3OURA 4R1TA 1SQ0A 5EHQA 5DCYA 3CN7A 1YZLA 4I4TA 4HZUB 1VG9B 2GM4A 3NT2A 1W76A 3KYCA 4YFVA 4KR9A 2KQUA 3ASVA 1EGHA 1M2VA 2JVJA 3O82A 2AN5A 4L5JA 4DV0B 5ITWA 3OAAD 1X15A 3DR5A 1LU9A 2OAP1 4HNHA 4BMDA 5FV7A 5HUJA 3P9NA 1KK2A 3QVGA 3ZCTA 3K0AA 4BV2A 4G0MA 3W5AA 2WKQA 1A69A 3EA4A 4GVPA 4MV5A 2O2CA 1U7XA 4UDYX 1O0SA 4YUYA 6REQA 3QFHA 4BJ3A 3AR6A 3OCCA 2YXLA 1OLXA 2FHSA 1H2AS 2R79A 4BO3A 4Y6OA 5E2IA 4W8OA 3DL0A 3LIPA 3TVYA 3A2KA 5B3AA 1IXRC 1J06A 1HYQA 3SGLA 3G0OA 1XQ1A 4XYBA 2NSLA 3CUKA 3KPVA 1YBVA 4DCVA 4ZMRA 1ZUNB 4NARA 4HEHA 3BTOA 4E2ZA 3DOCA 1DMRA 3QVTA 4IHJA 2AA3A 5J40A 3PZRA 1CY4A 1K8RA 3CW2A 3W2EA 1L4EA 1H1LA 2H17A 3NC4A 1EB8A 1Q84A 2I7DA 3O8BA 1WBJB 1HA3A 3QBJA 1QLJA 1OTXA 1Z2AA 3OE7A 5F3RA 4P82A 4JLDA 5E9AA 2KJQA 5BMVA 3KQHA 4B6PA 3N05A 4CEIB 2HMTA 4ZEOA 5HUHA 3R4VA 4WTOA 5THKA 4ZYXA 1D8AA 1KOFA 2DMRA 1M8FA 1T10A 3WZLA 4HQOA 4O6VA 1JG4A 2Q21A 2GBFA 3LY7A 4F4IA 2DR3A 2Y92A 3PPWA 1SUPA 1UINA 2G9VA 5A4IS 3QVVA 1JAZA 2HRBA 2FWBA 2AGVA 3QKUA 3PITA 4FONA 4JU9A 3P71T 1CSEE 3WGTA 5FWXA 2YKGA 2XOKA 3AVTA 2IE8A 1NVTA 2CSUA 4FYHA 3DZIA 1E2BA 1G7RA 1BXRB 3AEQB 4XWWA 4GOOD 3K6JA 1DBVO 1V4VA 3O4JA 3BD6A 4KXQA 4DLWA 1GCGA 3OICA 2BZGA 2XCUA 1U1EA 1HFKA 4WAUA 4PHFA 3KBBA 5ITVA 1J8YF 1SGWA 1XMIA 2H00A 2HLPA 2I6TA 2G6BA 3U4AA 1VG8A 2Z04A 3RLIA 1NYTA 2PMDA 1KO8A 3F2VA 4EUNA 5KWIA 1C0IA 1Z0ZA 1FNBA 5JARA 3GJ5A 2WP0A 2QDKA 3PJDA 1A5ZA 5A71A 3UHJA 1SBTA 2REQB 3PUHA 2P65A 3PNVA 4J94A 4N41A 2W2KA 4F9GA 3FMOB 2ZXUA 2D2VA 3IKJA 3W1WA 3DHVA 1JXQA 2Q46A 1JBQA 1S01A 4RQAA 2FEAA 4FYYA 1WMEA 3WB9A 4EDHA 2YNMD 2ZRJA 4M0EA 3K70B 3FIJA 1YFZA 2EC5A 5JCZA 2N75A 4FCWA 2C92A 3WSTA 4PHTA 1L3IA 4YR9A 4INJA 5NLLA 4LRSB 5H9VA 3EXFA 3WRVA 2AHOA 4DMUB 1LZKA 3GBVA 5BT8A 3Q8MA 2ZP1A 2P75A 3ZEAA 5B1EA 1PZMA 2IDJA 1Z74A 5GQSA 3SIPA 4BWVA 1POWA 1V1MB 4UTRA 3DLBA 1GL9B 1B14A 4RADA 1LDYA 1HRDA 4YJHB 3WXBA 3TLJA 3JPYA 1MFPA 2CDAA 2DPHA 3CUUA 1UBOS 3DXYA 3HKDB 2OC9A 3ORQA 3B52X 5DPMA 4A0RA 2Z3VA 5C81A 5GVSA 2HADA 1NUAA 5BQPA 1EFDN 1KC1A 4UAUA 2AC2A 3RVRA 4TN5A 4AMGA 6NULA 3K8ZA 3I5YA 3CE9A 4OFZA 4ZCRA 4F93B 1GPKA 2EW8A 5BSGA 2CXSA 1E6CA 5AM2A 3KB1A 4R81A 6CHYA 2C4HA 3QUTA 1EFHA 1SZPA 4BO8A 3WGUA 4JR0A 4WXEA 2Q6KA 4AZ0B 4OIFA 2QXUA 2FN4A 1ECCA 5L6LB 3RNOA 4HDMB 1ENOA 2OAEA 4TV8F 2V4MA 4HLQB 4PZAA 5IUJC 4DCTA 1T9DA 1O2DA 1XJCA 4F4JA 4KR2A 2C7PA 1FTYA 3MMZA 3QSGA 3EWSA 4TSFA 2PLWA 2WTXA 3DZBA 5F1OA 4DG8A 1GN9A 3U4GA 5DM0A 5AVJA 4CKEA 1N8SA 1OFHA 1OLUB 2VF2A 1NXPA 3DWFA 2G83A 4HHEA 5CJJA 2QVLA 3HU2A 4CE6A 1NR1A 3OQIA 2ZW9A 1KR2A 2EFYA 2X3UA 2AYXA 4IMRA 1BFDA 2JI4A 3NNSA 4UEOA 3SLRA 2BMDA 4E7OA 2ARKA 2XSZD 3HCDA 3KPYA 3HYLA 3IO3A 3KFXA 1KGDA 3BSFA 4HD8A 4L73A 1QZ3A 2AMYA 2XZDA 2DRIA 2GWRA 4XUEA 3FFAA 4LI3X 2E5WA 4L3OA 3TMYA 3KTDA 4P3NA 4BQSA 4GBJA 1VHLA 4L0MA 3C3MA 3TTSA 4MVJE 1AJEA 2XVXA 4HVTA 1OZGA 5AVRA 4XOUA 3IUJA 5D85A 3LO5A 4AJ4A 4GRAA 2AK3A 1CR4A 1DJLA 2FMIA 2GPAA 2ZITA 4NSNA 3HJCA 4N4AA 4MW9A 2ORVA 4YCBA 4EF6A 1U7DA 2O23A 4GSLA 4U5XA 3GT7A 3V48A 1SVUA 4IHJB 3M70A 3WKEA 4IRXA 3N53A 4OEHA 1AOXA 3MTQA 2HMUA 4W7HA 3QU2A 1YGYA 1L5HA 4ARUA 3EQ9A 4KO2S 3OI7A 4M9XA 3PTZA 3I9LA 3C6KA 4LJKA 4XA8A 2H2FA 2WLTA 4AY6A 2DKNA 1Q7CA 3AY0A 4PFJA 3W5DA 4K88A 5B6PA 5TPZD 2XQVA 4PQEA 2C31A 4D5EA 4Q93A 1GNQA 1KVRA 1XD9A 2QR2A 2ON6A 3ZS9A 4NMLA 4XD7A 5C31A 2QW0X 2J3HA 7REQA 2P35A 3CEJA 1R1DA 4L7QA 5E0KB 5U4QA 3SZLA 3DLHA 1CUYA 5KAPA 1IN7A 4C7OB 5DXFA 3WDMA 2FRVA 3L8FA 4DCUA 4FEEA 3LFHA 1H8EA 2EJUA 1JNYA 2QTZA 4P2GA 3U3OA 5KCZA 2NUPA 2ERXA 4B80A 3WGNA 2Z9CA 5K99A 1CUEA 5CCBA 2F3TA 2Q4RA 1GV1A 3IVRA 3Q8XB 4CM8A 1W19A 3JRWA 1U2ZA 5IWCA 3KOMA 4DJJA 1YWGO 4DC1A 4ZYUA 4ZU3A 4OQYA 2OXTA 3GPDG 3C6YA 4XB6B 2AUTA 3LX8A 2ODTX 2B4YA 4FMDF 3NHRA 2DETA 4GOXA 3AETA 4L5CA 4RVUA 2ERYA 1L5OA 1GR1A 1UH5A 2X41A 3I9KA 1RFLA 4X7MA 1ZN7A 3SC2B 3SICE 3O7MA 1A1VA 1EXWA 2VH1A 3DAPA 4FX5A 2GERA 3S2IA 1WB9A 1QH8B 3HVUA 4FHFA 4RQUA 1UK7A 3HNPA 3G2MA 1RYMA 3IOBA 1SM4A 1UT6A 4NYMR 2FR1A 3M33A 2GRUA 1TYZA 3LC0A 2AZTA 1ZOOA 1NBOA 3KQVA 4P22A 2IEAA 1PLJA 4KOAA 4X6UA 5LQUA 1FA9A 4QDTA 4B7XA 2R4UA 2G08A 2XUKA 4LG1A 4EUFA 2PUAA 4QODA 4XASA 3GUUA 3ZBUA 4ACAA 3FWPA 2V6MA 3AOEA 4WQMA 1GYPA 4Y6SA 5TRTA 4ZJPA 4KQHA 3OQHA 1LI5A 5A9SB 1PKEA 3ZBPA 3O4VA 1G2PA 3QMPA 4RQTA 4YAIA 5CLQA 3UPDA 4XZ3A 1M76A 2H1RA 5ALUA 4DREA 2D5BA 5DZSA 2H51A 4KX3A 3RF7A 1TTQB 4A82A 5C8DA 1OLSB 3P0RA 1K0FA 3FBGA 4J03A 1OFUA 1GNVA 4H17A 2IJGX 2ZBPA 4KPFC 3ZQ6A 1M67A 4LY9A 4FYWA 2ZPUA 1TW2A 3QQPA 2GEFA 4FE7A 1YQQA 1ORWA 1QHHB 4GPD1 4WECA 4R31A 4TZ6A 1B6RA 2XXAB 2QTBA 2WT4A 4V2UA 2BP7A 1V4NA 1DCKA 1MO3A 4IMJB 5D3QA 3ETLA 1XZDA 3KD3A 3TUJC 1NYRA 4DEYA 3IBGA 3B51X 3BL6A 2W8ZA 3DE1X 2FX3A 2CNKA 3I9MA 1O96B 5JAOA 2V0GA 1V1RA 2A30A 1DHRA 5JANA 3KPUA 3RHTA 3GZNA 1QLWA 3I92A 3L41A 1U3WA 1B4DA 1UKZA 2VWPA 3GLIA 3P2YA 1KDPA 1VI5A 2OHHA 4NJMA 4Q1FA 2W2LD 3BJIC 1WJGA 3H5IA 3OC6A 2FAXA 3FPGA 4OH1A 1R16A 5FO1A 3X0DA 4FKMA 3EVAA 3WMFA 3U4MA 3CKLA 1VJDA 4JLAA 4B7ZA 1U8TA 1C9MA 1IZYA 3RE1A 2AN1A 4OGGA 5K8IA 4BO1A 4HC4A 4EECA 2CL0X 4ZOCA 1J8MF 2CL5A 1NAIA 1EAYA 2COUA 3MUFA 3R20A 5DO9A 5IC5A 3CVWA 1OF1A 2O1EA 1MB3A 3T6KA 2VDLB 1PFVA 3UT6A 4C2UA 3WLPA 2PS3A 4JGBA 4Y2RA 4DMLA 4GZLA 1ISRA 1UBTS 1CJCA 2CNBA 4JJ6A 3UWMA 5LD2C 3FCSB 2VH2A 5IHXA 2YX1A 1JJIA 3SNHA 5JXJA 2GI4A 2XUIA 1FSZA 3FKSD 1XZMA 3E03A 2R00C 4OLJA 4P53A 1JSZA 2PHZA 3KKPA 5SY4A 3TX6A 5ALLA 2W6IA 4OMDA 2KB0A 1Y8ZA 4OJTA 2NO6A 4JSTA 3A1NA 1X1AA 3ZGNA 3VPGA 4D4MA 4F1KA 4ZKDA 2VP2A 3GFPA 1L5HB 2RD2A 1DIOB 1ZMXA 2JAOA 3JD2A 3KV1A 2VZLA 5AHKA 3WLTA 5C8VA 1U3FA 4NU6A 5DBFA 3GEPA 4F5ZA 4E5UA 2R1TB 3E1SA 4RNCA 4K0KB 2XAAA 3ENNA 4UVHA 3CUYA 1R4AA 1Q5PA 3ECSA 2I22A 4YCJA 2O2SA 3U40A 4Z1MD 2YL2A 4A1OA 5DNDA 3V8PA 3CLRC 4E3WA 3NBKA 3BX1A 4GFDA 1FTWA 4O8ZA 3AW9A 2ZRBA 3MOGA 4BYGA 4BX8A 3AGQA 1AO0A 2VR1A 3M6VA 3LAWA 4RY9A 4WK6A 5TARA 3U09A 5EIEA 2VUUA 2JGMA 5D1HA 4CTJA 4MVJG 2QUHA 4WXRA 3BJRA 2PRIA 5LYJB 1HDEA 1EWVA 2XJ9A 3HO8A 3W8RA 3L8HA 4LGVA 3SJCA 2BF4A 1MDBA 2J30A 4JEMA 3VM6A 4MR9B 1LUAA 1N2ZA 4LF9B 3B5EA 1FP6A 5AOVA 2VDUE 2VZEA 3HR7A 4RFVA 5L6MB 5DJ5A 1NN0A 3HXKA 4U9HS 1VLJA 3EZ2A 1KYTA 4QFDA 1PNRA 1E1CA 1OFTA 1ZC4A 4M36A 2GDZA 5KKCA 1SHLA 3KKKA 3PCRB 2ATIA 2FYTA 4O25A 4ENPA 1IJKA 3AUXA 1ZU5A 2XBUA 2CZQA 3STVA 1G20A 4TXLA 2HEGA 3SOZA 5HOQA 2JFYA 2CV0A 3BWDD 4ER5A 2JNWA 1PTKA 1K5DA 2GOYA 2XMGA 3ONFA 5DOVA 4CLXA 2AG5A 4BN5A 1U3TA 3ESRA 4IKPA 2HNAA 5DXAA 4WBNA 2CW5A 2PEZA 1X6VA 4BIMA 1KO5A 2BBTA 1PWYE 4L9RA 1SQ5A 3T9AA 1YA8A 2Y76A 4B84A 3TLGA 4DA0A 3STHA 1GOTA 1DP4A 4MJXA 2FZLA 3WY9A 1USUA 1SKYE 3BH6A 3H6HA 1TZCA 5ALSA 4CPDA 1TO6A 4JJ8A 1J6UA 5F2NA 4RFSB 4B45A 2AF3C 1AK9A 1ZI6A 2RGDA 1M1NA 3EVNA 2QB5A 3F96A 3PP8A 5JASA 3D5TA 4UHBA 2IOFA 3VU3A 3DHNA 4L50A 1NY5A 2C5AA 5FWNA 1X2BA 3EOBI 4N5MA 1YNSA 2QDXA 3LZ6A 3QYPA 1XMPA 2JVKA 5AW5A 5ICMA 3AIIA 5HGJA 1IFXA 3M4JA 5F78A 5IK2A 1YBMA 4XM1A 5EFOA 4HXFB 2ZE5A 5TB5A 5A0VA 2JDID 3AJRA 1PJ4A 2VHYA 5CA0A 4PN3A 1A04A 2V0NA 1CUXA 4RTRA 4MOWA 1HOXA 2HREA 1UPBA 2EZ8A 5DVZA 2R00A 1U1GA 2BEKA 2AFHA 1RIIA 4IIHA 1IBKB 4RZUA 4ZAXA 4AIRA 1KVQA 2A9PA 3Q11A 4TKVB 5BR1A 1G5FA 1KPIA 3LRXA 1Y81A 3U2QA 3T5PA 3ZY4A 4OHOA 2JCGA 3MQ4A 1K97A 3IJPA 3MFQA 4NX2A 1ZH8A 3E3AA 4WHMA 4QJBA 3GGSA 5KSYA 3JWJA 1NRXA 1TT5A 5LNK1 4IF4A 3EHEA 2ZWPA 3Q0EA 3DO5A 1VCHA 4HNSA 4H7DA 1JP7A 2RJ3A 3F6PA 3TL6A 4EGAA 4QZVA 1XDWA 4U2BA 4JWTA 3NW9A 3ZGXA 4PANA 2AXEA 4A5SA 1KNQA 2UDPA 1TO2E 2YWXA 2O48X 2P3SA 1PJCA 2A5GA 3WNZA 1H8HA 5T8KA 3TIXB 2ADFA 5DI3B 1PP4A 4OKNA 1E1LA 1E1QD 5FTLA 2M6LA 2AZMA 1KRWA 3PFKA 3BTUA 5EZ5A 4C6HA 4ZI7B 3FW1A 4INOA 3R7BA 2F6RA 3U7QA 5BMVF 4MMXB 4JC4A 3TBKA 4IIUA 4A8JB 1K0UA 3HBJA 4E0BA 2O5CA 2AUMA 3AESA 1V7CA 3BIWA 5COBA 1G16A 1VE7A 4EHLA 3AIMA 5BV1A 3EE6A 1Q7BA 1VPWA 1Z29A 1II9A 3JQAD 3SKVA 2JFQA 8ADHA 2IBTA 4R3WA 2OLJA 4ITRC 1NMZA 1LBHA 2FPRA 3PFHA 1A88A 1QFYA 1FNMA 2VCEA 3GC6A 1F2UB 3BK1A 1TRKA 3OM8A 3IYLW 3QF4A 4OQMA 4A36A 2HF2A 3RSOA 4A8TA 3L6RA 2I34A 3IMFA 2XCOA 3PJEA 2DQ4A 3R74A 2AN4A 1W85B 2NZVG 1I80A 1N4DA 1TM2A 3MMPA 4NZ9A 2Q6VA 4BBPA 1DEHA 3I9V6 1JDUA 4PLYA 2FSFA 2JLAA 4BO2A 3CB4A 3PWZA 1KFEB 2IS4A 4X3CA 2XIQA 3M49A 2GBPA 1SNYA 4XCVA 3DL7A 2TMKA 5B1YA 1Y7LA 1DXHA 1KRXA 4W1QA 4O4HF 1IB0A 1UBHS 2BMFA 2H4HA 4AY4A 2ZR9A 3AZQA 4JOCA 4N7RA 3HBLA 3I64A 3P19A 4B44A 4EJMA 5KOJA 1GA4A 2B8EA 1W59A 2IQIA 3DFZA 2R6JA 4ZVVA 3WLEA 5D6OA 4BECA 2R5WA 5T4HA 2P9BA 1XK7A 3C4VA 3SYTA 4ARBA 2XVAA 4TLCA 4JN6B 2X4IA 3LX6A 4XYMA 4EP1A 2XF8A 1VBKA 3PQ5A 2DAPA 2OV2A 2RBGA 1OA1A 4LN1A 1RABA 1Y4AE 2VDOB 3H5RA 2V54A 2A92A 2G3YA 1R6AA 5AQ1A 2IYQA 1ECBA 4QSHA 3I6BA 4TYNA 1SFRA 4K9RA 4J1TC 3TCKA 3H87A 2VHVA 5HOEA 1JR3D 2AK2A 3WL3A 4BE9A 5HF5A 5K6TA 2A1UB 4YRBA 4GLJA 3NKLA 1UMCA 4UCXA 1GLVA 5GGYA 1HFEL 1MAWA 1W0CA 1LWOA 2YJ6A 3E5NA 3I34X 3I01M 3QSYA 1LW6E 4TQ9A 4RYDA 4V03A 1YQXA 1GPMA 2CJXA 4DBLC 4DKXA 2O14A 5HG0A 1HOTA 1ZW1A 1DJQA 4C0JA 4D6PA 1IPFA 4XVCA 2Q9AA 2G28A 1AK1A 1NXWA 3R5FA 5KX5A 5JU6A 5CUQA 2I80A 5CFPA 3UK1A 1G3UA 5BPHA 2PKYX 1JX6A 4UFNA 3M4XA 2GA9A 4D4LA 2VPPA 3M6WA 4Q4HB 1E2MA 3AUTA 4DFDA 2XWBF 5JISA 4Y2SA 4D0LB 3G2HA 3T7KA 3K0FA 3RFXA 2QBYB 3EFOB 2ZJ3A 4IFBA 1XYYA 1YRHA 2ZQ5A 3LSYA 3LPCA 4NCKA 3LPMA 4IGIA 4L8FA 4YRZA 2V7GA 3FUCA 1E7SA 3IDQA 1OZ0A 4QEDA 1EDZA 3VSCA 2B34A 1NVGA 2J0VA 4HDNA 4YJFA 3AQIA 2OE2A 3PE3A 2FNAA 2JLQA 4TMTA 3RS2A 3SQWA 3K8QA 3IUNA 1NG1A 1LPSA 4G4GA 2DQZA 2EKDA 1IVSA 3BF7A 5AJYA 1KE1A 3F6BX 3BWXA 3RNLA 1WXEA 4JHXA 3TPCA 5GIOE 5HJ7A 2A2ZA 3R0QA 2IW1A 5I4CA 1PVVA 4R3NA 2VWHA 2AX4A 3FHCB 4TSKA 3ZD9A 1U2GA 1VRWA 4BS9A 3MWFA 3ND8A 4W82A 1PYGA 5CX4A 4AG3A 3WNVA 4R8SA 4D0NA 2PSHA 2AW5A 1ESZA 2WWHA 3FGZA 3ZV5A 3TW6A 4TV9A 4BQQA 3F5DA 4Z99A 5HK8A 1F4PA 4TKVA 3SJ7A 1KJJA 1UBEA 1IHDA 1KKUA 1AN9A 2OP0A 3PNMA 4FFWA 4K6OA 1P8JA 5JCOC 1D5WA 4BFWA 3LF2A 4ETIA 4W9NC 1N78A 3HKCB 2PVCA 1JR6A 3PRKE 4G97A 3A31A 1YCHA 2Q3JA 2ZTUA 3ZWVA 4Z9AA 4CV2A 1JHRA 4ZT3A 2QVCA 3M82A 4GPTA 2G88A 1ID1A 1KO7A 1QDUA 1WSBA 1RQXA 2W22A 2Q5CA 2CCGA 5I9LA 3GIDA 5F1YA 1EX1A 1L7AA 1UOEA 3PHHA 4CF5A 4EENA 3WSWA 5A4AA 5LLDA 4J2TA 3L7BA 3SBOA 1RRVA 2ZFUA 3AX6A 4P5DA 4DUPA 1PTJC 3L84A 1Y3FE 1DDOA 2IEIA 3W2FA 4HXEB 2HLNA 4AMUA 3ZLUA 4AN0A 2XWJI 1PDOA 1ID8A 1FB5A 1PT5A 1AGYA 1CUZA 3F98A 5A2QA 1NLFA 2BE7A 1JDPA 4Q01A 3W7VA 1BWSA 4FWBA 3ZH9B 4QWWA 1W9HA 2Q7DA 3OE7D 5IDVA 4G9EA 4I50A 3LQQA 3CR7A 1J21A 3BZBA 2VNKA 3FVRA 4RK7A 4B87A 1R8XA 3PXBA 4NE9A 4I3FA 1F2TA 4G0PA 1OAOC 3OZDA 1XEAA 2ZUBA 4G8JA 1WZUA 3G2PA 4LV5B 1Z4LA 1JEJA 5ALKA 1U3UA 4P0PB 1EJ0A 4ZO6A 5JNTA 1G8GA 1RC1A 2YYSA 1OXKB 2P0AA 3AR3A 4H3VA 2IS6A 2RHHA 4AECA 2FDRA 1GZ7A 2KX7A 4L8GA 2H16A 5AHXA 4HVCA 3QA3E 4I1RA 2DP4E 1KHTA 2NUBA 4Q02A 3ZI4A 2AQIA 4HAWA 1G19A 1TTTA 3C14C 3H3FA 2J3LA 2C2MA 5C18A 1XQXA 3QIAA 4QU0A 5JWHA 3TB4A 3V6MA 4CNQA 3TWOA 2ZEJA 2ISSD 2YXBA 2C2KA 2A0KA 3ELUA 4YBZA 4TWZA 2I29A 4B7UA 1UK6A 3THOA 4D9GA 5FV4A 2Q62A 3WJ1A 1QLHA 2PUEA 3K8YA 5L7WA 5A4MS 2R8OA 4FD3A 3ORYA 4LPSA 1FRFS 1HQYE 1YZTA 1G66A 4J0JA 2JFHA 5IMSA 4HN9A 4PPFA 1EB9A 3B3GA 1RAFA 2I87A 1KTVA 2PA0A 4D5GA 4PQYA 2FQXA 4DHEA 3W5IA 1P4SA 1BG6A 2LRHA 2YNMA 2FJUA 2PZKA 3DE4X 4R2KA 2NUPB 4ZOLB 3DBLA 5FHQA 5HZKA 4GKBA 4NR0A 1DJNA 4LWOA 2AKEA 1IN4A 5A0FA 2BDUA 1CCWA 2RONA 3OQOA 1ZSNA 4GMKA 4Q21A 1T35A 4QVKA 4QATA 2H0QA 1KPGA 4D9NA 3JZAA 3OM9A 1KQ3A 3AI7A 2AC4A 3LC2O 4OHBA 2WIBA 1VLHA 4OK3A 3IGFA 3DGEC 3WGOA 4FJ1A 3WLAA 1YU9A 3B6IA 1Q95A 4HEQA 5HM6A 1KSHA 2ZXFA 2FWIA 3DONA 3EGVA 3GPIA 3JSAA 4UVDA 4YGXB 2JW5A 5EEGA 5ELXA 2QUJA 1IZ7A 4YV0A 4C3UA 2XPCA 1XU4A 2FZGA 3IKMB 3IO5A 4F2WA 2AT1A 4LSGA 4D6XA 1HYEA 3QOWA 5IT0A 1DCMA 2JPDA 4QOJA 1GFWA 4NMWA 3E4DA 1ZD8A 3IV7A 3KJNA 4HPJB 1MOQA 4YP9A 2KE5A 5KVVA 2G0TA 2Y4NA 5C46F 2A9FA 3V9AA 5IYZB 3IXQA 1E3EA