1A55A

Phosphate-binding protein mutant a197c
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
321
structure length
321
Chain Sequence
EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGTSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYCYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATE-BINDING PROTEIN
publication title Crystal structure of phosphate binding protein labeled with a coumarin fluorophore, a probe for inorganic phosphate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphotransferase
total genus 107
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 1998-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1a55A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1a55A02
1NH8A 3KJTA 2I3VA 4HW8A 1MPBA 3K6XA 3FASA 3DP4A 5I59A 4FECA 2F8DA 5H8QA 5ITOA 3TTKA 4YKPA 3FV2A 2HZKA 1NNKA 4ELRA 3B7DA 2XXWA 4DIGA 1OLCA 3MQ9A 1SBPA 4R72A 1MPDA 3SETA 2H9BA 4ONYA 1A40A 1YCJA 2XX9A 2Z8FA 5L9SA 4OQOA 5KDTB 2Q2AA 4F29A 5ICTA 1SI0A 2DYXA 1NMUA 3K00A 2UYFA 2P1SA 4WKMA 4PP0A 4R2BA 4G8MA 3KN7A 2OWSA 3E13X 5CBSA 1MS7A 1B3FA 2ONRA 1Z7ME 2UVHA 1OQHA 4N6PA 4ELOA 3OELA 3I6VA 2ONKE 4TOZA 4GQOA 3TTMA 2RKMA 2VGQA 1MH3A 1PEBA 3FATA 1URDA 1MRPA 2O1LA 4NF4B 1MQDA 4IO7A 2H4IA 3CFLA 3CVGA 4IY6A 4ZEDA 3SERA 2NUVA 5H8FB 3HSTA 1P1UA 4IO6A 1MY2A 4RNSA 4OYVA 5K2XA 1SD3A 3TQWA 1USYE 3HHFA 2Q8JA 2RF1A 1IXHA 2O51A 4M4GA 1B4HA 1AIVA 4F22A 2I0CA 4OWDA 3KBRA 3ZKLA 1N3XA 4KCDA 3MZ1A 2UVGA 1ATGA 3JYRA 3RGYA 5I2KB 4M1VA 4OFLA 3V8XB 3U92A 2I48A 1A7LA 2M8CA 2O69A 3DP6A 1UIVA 3VDFA 3CFZA 1MXUA 1DTZA 1GR2A 2AL4A 1UTBA 5K2YA 1NNTA 2XXYA 5KZTA 3A3CA 4OESA 2O1MA 1BKAA 5H8HA 3VXBA 4YU0A 1AH5A 2XD2A 1P1NA 3U94A 3S9NC 2Q88A 4O3CA 3O97A 5CI5A 1LB9A 1RYXA 5I59B 3I5OA 3S9EA 2G29A 4KFQA 4ZEBA 1DMBA 4MBPA 1MXWA 1LBCA 4C1TA 3CR9A 1NNPA 2F7BA 3TDJA 4KCCA 3RLFE 3MPLA 1Y4TA 1F9BA 3IAZA 3K6WA 3A09A 4G4PA 3Q25A 1LLSA 2GFEA 1JVXA 4ZZEA 3KFMA 3TEPA 4NWCA 3E9XA 2PYYA 3SESA 3Q26A 4X1DA 5TU0A 1ELJA 4IO2A 3GZGA 2DS9A 1Q35A 5AE4A 4LZ8A 3S9MC 1GV8A 2DOJA 4ESWA 2XXQA 5EHSA 4EQBA 2F97A 1URSA 5AA4B 4YB7A 3PPRA 2YPNA 3O29A 4XKPA 1JETA 3UGWA 1B7HA 3LBSA 1XHYA 4DDDA 1Z7NE 3HN0A 2OK2A 4ZDMA 1FTLA 1R9QA 3BKIB 4IO5A 4BDMA 4YKIA 1IZ1A 4X48A 3TFLA 1MDQA 1B1HA 3VVDA 1PB9A 4I1DA 3SDFA 2QMXA 4NEDA 4P11A 4R9FA 1BIYA 3LUYA 3IOVA 4YKJA 1B46A 3TTNA 2V93A 5DVIA 2QMWA 4YICA 1MPCA 4U21A 3PGFA 1MXZA 4LA9A 3L6GA 5ELVA 4U23A 2B3FA 1AOVA 2ESNA 1NL5A 5IKBA 4F1UA 2XXRA 3TTRA 3ZSFA 1UTBB 2OZZA 4NE4A 2G93A 5L9MA 3IO4A 3DLNA 1R1NA 1ZJLA 4Z0IA 5KCJB 2HAUA 3U72A 1GGGA 4RYAA 2Y7WA 2DWIA 5H8HB 3E4RA 2FA7A 3SEUA 5JTYA 5BUUA 3S4UA 3P7IA 3RT8A 2HCAA 3FV1A 2DE3A 1UTHA 5BWJA 3RQTA 5LOMA 2GHBA 4RY1A 3C9HA 5H8NA 1LAHE 1IQ7A 5CMBA 3QUJA 5I58A 3IB1A 4LQ5A 1Y3QA 3MP6A 4YB5A 3TZAA 1B5HA 5AA3A 5FHOA 1SYIA 4R9GA 3H3GA 4GXAA 1JW5A 1QUKA 1XVXA 2CZLA 2THIA 2QL3A 2I6EA 1II5A 1T0KA 2OBGA 1BP5A 4MH5A 2D21A 1URGA 1DSNA 3ONMA 2H98A 3G3KA 2I58A 4FORA 2I49A 3T22A 4XXUA 1ZTYA 2ZNTA 3OD7A 4U4SA 3LR1A 4XKQA 3MZ9A 5JK4A 3BFUA 4HS7A 5HBCA 2OLBA 3O6HA 3TCFA 3VVFA 1NKXA 3U93A 3K1MA 4EQ7A 4UACA 3TQLA 3JV9A 4PFYA 3UK4A 1LAXA 1CE2A 1B0LA 3KSXA 3IO6A 3TCGA 3QSLA 5CRYA 3TKDA 3RPWA 2PX1A 3ZS6A 1MQHA 1N76A 3HO7A 2UXAA 3CSBA 4NMYA 1M5BA 1A99A 1M5EA 3FXUA 5HPQA 3K01A 2Q9TA 4KHZE 1FTOA 1ZLQA 1AMFA 3OSRA 4IO4A 5I57A 2XX7A 3R26A 1IXGA 1FQDA 1MH4A 1EZPA 3MVWA 4JDFA 5HM4B 1MY3A 2NVUB 3IK6B 2NXOA 2V25A 3T9HB 3G3HA 4H8IA 4FJPA 3DM0A 1M5DA 3DELB 4BDNA 4GWOA 1QKAA 5AA2A 1D4NA 1OQGA 3CG1A 1AL3A 3OO7A 1OLAA 3MPKA 4ZECA 1A54A 1MY4A 4AB5A 4N07A 3G3JA 3D4GA 4GD5A 5JTYB 3T9XB 4ND9A 1H45A 1VR5A 2V84A 1Y3PA 1MXXA 3C4MA 4GIZA 2P2AA 3FVKA 1QKBA 4I62A 4AB6A 2QSXA 4IB2A 4LATA 1UTHB 4ZS9A 1PB7A 3OXNA 4JWXA 3S9LC 3PPNA 1R9LA 1I6AA 4N13A 3FZVA 1LCTA 1QVSA 1TWYA 5H8NB 4MFIA 5I58B 2GRVA 1B4ZA 1S9TA 3UP9A 4YMAA 3PV0E 3IORA 3B6WA 4E0XA 3C32A 3PUWE 3HHGA 2RCBA 2PMSA 1B32A 2F7CA 1LCFA 3MVXA 3QAXA 4FATA 4JB7A 2REGA 1TFAA 4PFUA 5TP9A 5ITPA 1B05A 2PBWA 4G8NA 3W15C 4QFPA 3GXAA 3H06B 3G3GA 3FXRA 2ZYMA 4QSCA 1MG1A 1XOCA 5M2VA 1P99A 5DEXA 4PE5B 1HSLA 2AIXA 5AA2D 3A3UA 3QYTA 2F34A 1OVBA 4H67A 1JEVA 2DVZA 3S2VA 3PPPA 2V3QA 1D9YA 1B6HA 1Q1KA 3PUZE 1PBQA 3AXFA 2Z22A 1GTKA 2PT2A 4ISUA 3B6TA 4F3GA 1R6ZA 1N7WA 3HV1A 4ELPA 1QUIA 4WEDA 3VV5A 2A5SA 5CM6A 3ZKKA 4TLMB 3V5AA 4NF8A 1SDXA 4H1XA 1RYOA 2H5YA 3V89B 1QJMA 5FTIA 3O6IA 3QUFA 1N7XA 3QIMA 1USYH 3U8QA 2B3BA 5H8QB 3OEKA 4POWA 3THIA 2ZYOA 3T96B 1LGBC 3CG3A 4OMBA 3RUMA 1MY1A 2GH9A 3IOTA 1Y3NA 4ESXA 4MLQA 3C33A 1LSTA 1SW2A 1PB8A 4F39A 3VFJA 4L17A 3H7MA 4H65A 4ZEIA 4EXLA 3FJGA 3PPQA 3PUXE 3CIJA 2V3UA 1LFHA 1LFIA 1IEJA 1QUJA 3IX1A 1B3HA 3PMXA 1H43A 2FYIA 4YKKA 1US5A 1DTGA 1FQFA 4U2RA 4UA8A 2R6GE 5IAIA 1JW4A 1TFDA 2OCUA 1ZKBA 2YLNA 4FAJA 3I3VA 2DVCA 4U1OA 4Q8RA 3MBPA 2VD2A 3SEXA 2A5TA 2REJA 3UN6A 1UIUA 4G68A 3G3IA 4R6YA 1B51A 1LAFE 3KEIA 2VOZA 3H6WA 4LZ7A 1PBPA 4BDRA 1N3WA 3KN3A 4RK9A 3FVNA 1DOTA 1FQEA 4IO3A 2O6AA 2Q89A 2ZNUA 1NFTA 4RK2A 1EH3A 1POTA 1HSJA 2RC9A 4HCYA 3MW0A 3KOTA 1I6BA 4BLAA 4QFNA 2UYEA 1B0HA 5TP9B 3IJXB 2HFBA 1B7UA 2ALUA 3VVEA 4ECFA 1B1XA 1POY1 2QS3A 5DEXB 2RC7A 4U22A 2DP8A 3Q29A 4Q5TA 3LC8A 4F2OA 3PUVE 1IIWA 1J1NA 4F2QA 1I6QA 2HZLA 1A8FA 1L5TA 1MQGA 1HSEA 4R2FA 3T93B 3SKPA 1B58A 4LQ2A 4H6DA 3KSJA 1FTJA 4H5FA 2H99A 3IOWA 4NF8B 1BTJA 3FVOA 4NWDA 2RINA 4KPTA 3O28A 2D3IA 1VFEA 3K02A 4HTGA 2ZXTA 2CMOA 2Z8EA 4EF2A 1B3LA 4O3AA 3IL1B 3W9WA 2OJTA 3VE1B 1ZU0A 2XXXA 4IGRA 1FQBA 3G7WA 5TPAA 4JBZA 3VLUA 2OWTA 3CI8A 2UVJA 4QSDA 1O63A 4DCYA 3EHTA 4GXSB 4YAHX 2RC8A 3EPEA 2XHDA 3MP8A 1MQIA 2E0SA 4G8HA 2Y7PA 3ILTB 1BLFA 4LVQA 3CRBA 1YAEA 3RT6B 3BFTA 4F3PA 1MM7A 4RXLA 3DP8A 1M5FA 2AL5A 1WODA 3FD3A 4EUOA 2R9JA 2O7IA 2O68A 1B9JA 3V83A 5I56A 2A5TB 1LBBA 4G68B 2P0SA 1N84A 2DWJA 4WEPA 4WXJA 1B3GA 3H6VA 1YPNA 1M5CA 3IR1A 2F78A 1WDNA 3HPIA 1Y9UA 1H76A 3IOUA 1SYHA 1S7YA 4P0GA 1ZMGA 3WAEA 3FGSA 4JSOA 4QFLA 4I8CA 3T9VA 5CMCA 4XIGQ 1EU8A 3LSFB 4JSDA 3EHUA 1WVJA 3UORA 4HCWA 1D9VA 1TXFA 3FUZA 2XXTA 4NF5A 3ECRA 4KI0E 3OO8A 5EHMA 1O7TA 2Y7RA 2H25A 2W7YA 3FXQA 4KYEA 3ODBA 3EN3A 4LP2B 4BDQA 4GL0A 1O64A 4I9DA 3C31A 1XVYA 5FTHA 1ZIUA 2VP1A 3T9UA 5ISUA 1S50A 2XX8A 3VLVA 3N6TA 4LUBA 3MVZA 4BDOA 2F7AA 2I3WA 4DLDA 4YZZA 1DPEA 4QFKA 4F18A 3RY3A 4QHQA 1B5IA 5B70A 2HAVA 3OENA 3IJOB 3RTWB 3PU5A 1Y20A 3H6TA 3O2AA 4DXCA 2XXUA 4U1ZA 5CBRA 5DYHA 3Q27A 3RNNA 1FCKA 2ZYKA 3MUQA 1CB6A 1QULA 4E0WA 4IY5A 5L8DA 4DCXA 2DWHA 3C34A 2DQVA 4OFJA 4NF6A 1OMPA 3KN8A 1TT1A 4R74A 2XXPA 4RPNA 2ANJA 4GVOA 3EQ1A 1FTMA 2QPQA 1MXYA 2F35A 5TPAB 3MWBA 5AA4A 4GRKA 1H44A 2BJJX 3CSGA 2F36A 4GF8A 1SQYA 4XTCQ 2B65A 3WAFA 1Y1ZA 4XKRA 4H5GA 1UQWA 1Y1MA 4H8JA 4H0WA 3K0VA 3QK6A 4KYDA 4C1UA 2O84X 3UA8A 3GBBA 4ZE9A 1A8EA 3MAMA 4DXUA 3TMGA 3TELA 4ZE8A 2PVUA 4MLVA 4THIA 3H4ZA 1GVCA 4EQ9A 3TAJA 5I2NA 1B3EA 5I56B 4R75A 3OO6A 2X26A 2F5XA 1SVXB 1FW0A 4C0RA 3TPAA 5I84A 1IUDA 1D3KA 4POXA 5H8SA 1H3DA 1JNFA 4PETA 2PT1A 3TODA 3OMBA 5J1DA 3MP1A 2GHAA 2HXWA 2XXIA 3CFXA 3G3FA 4NF5B 1EZ9A 1SW1A 1B52A 4F31B 5CC2A 4AQ4A 4Q30B 3K2DA 2DXYA 1FTKA 5KCJA 5I57B 3LSXA 2ZNSA 4KD5A 2X7PA 2XD3A 2IEEA 4QFOA 2ABHA 2DXRA 2R71A 5A5XA 3TCHA 2RCAA 2X7QA 1B2HA 5F1QA 1JQFA 1VE4A 5CMMA 4JWOA 2Z23A 5AA2B 3TYHA 1IXIA 1US4A 2F6GA 1EZOA 3FJMA 4F19A 1ANFA 2E1SA 1P1WA 1B7ZA 1QW0A 3B6QA 4G77A 4LONB 4TQUQ 3C35A 2NWJA 2ONSA 4IGTA 3O9PA 4X1BA 4JWYA 3TUSA 1N04A 3OEMA 4EF1A 3K4UA 3KGCA 4NF6B 4R6HA 3PPOA 3IB2A 1FQAA 2UVIA 2XXHA 3KJ7A 3FVGA 5DTBA 4TLLB 5JEIA 5B7DA 4NTLA 5EYFA 4GLIA 1OVTA 2XXVA 4YB6A 4QRZA 2QRYA 4RA1A 2VHAA 4PFWA 2QS2A 3OO9A 3D4CA 2Y84A 4DXBA 1KWHA 2Z8DA 1B5JA 4GL8A 4XKNA 4G2ZA 1LAGE 4OZ9A 4OETA 4ZZAA 4F3SA 1VSOA 4KQPA 2I4CA 3U1OA 4PFTA 1JVYA 2QJEA 1NNFA 5ICQA 1ZBMA 1XS5A 1Y4CA 3JZJA 1FQCA 3QXMA 3OSQA 2YJPA 2DWAA 2HQ0A 3H6UA 5I2NB 4ELQA 1SI1A 3MZBA 1RKMA 1I69A 4F3BA 2WKYA 1SW5A 2VD3A 3E3KA 4P0IA 3GBAA 1P1QA 1PDAA 3SEVA 4ZEFA 3HCQA 3OOAA 4MF3A 2DE4A 5AA1A 2F6PA 3N6UA 5FHNA 5DVFA 3O6GA 4O3BA 4JXIA 3PD8A 2ZMBA 4DE8A 3USDA 2KLFA 4F1YA 3R6UA 1VFDA 4FEBA 4FIMA 4YMBA 2D5WA 5CMKA 4DZ1A 1IXCA 3L6HA 3Q28A 3EF7A 1B40A 3KZGA 4R73A 4U4XA 4KR5A 1A55A 3N94A 3H03A 2FNCA 5KDTA 3LSLA 4OEUA 1NH7A 2AYSA 4RJZA 4F1VA 3T66A 5DT6A 2I4BA 4GOTA 3MC2A 2Q2CA 3K6VA 1MDP1 1PC3A 3IB0A 2O7UA 2Y7IA 3KOSA 2QS4A 5A5XB 3MVYA 4OXVA 1MXVA 1XT8A 3N26A 4OERA 2Y7KA 3BBRA 3EHSA 4OEVA 4PQJA 5DVJA 3FJ7A 1SW4A 4BDLA 1DPPA 3M3FA 5F7VA 1LFGA 3O66A 1N0TA 4OFOA 3LSWA 4OTEA 4QSEA 1OIBA 3TTLA 4G68C 4NF4A 3PMVA 3M3LA 2DSFA 3KG2A 2V3TA 3VXCA 5H8FA 2I0BA 2LAOA 3UIFA 3F11A 2QS1A 1MM6A 3K1PA 1LB8A 4X9TA 3PMWA 3K6UA 3M8UA 2IA4A 4R6KA 4KYSA 4LZ5A 1JW1A 4OHNA 4GFRA 4Q0CA 4OENA 2ZYNA 3RTFB 3W9VA 3C36A 5I2KA 4EDPA 3ILUB 4FEDA 1P1OA 1IITA 4EXKA 1JEUA 3M3KA 3PD9A 1MQJA 4K3FA 3VLWA 3N5LA 4QF9A 4RPOA 3FIRA 3K1NA 4FE8A 5L9OA 4OVJA 5FHMA 3SEYA 3SEWA 3R7XA 1XC1A 3PUYE 1YTVA 3MJNA 3GLBA 2DE2A 4ZEKA 4Z7EA 2NOOA 1MY0A 2HEUA 3RN8A
chains in the Genus database with same CATH superfamily
1BK4A 1NH8A 2MKZA 3KJTA 2I3VA 4HW8A 1MPBA 3K6XA 3FASA 3DP4A 5I59A 4FECA 2F8DA 5H8QA 2VPNA 4H45A 5ITOA 3TTKA 1IMFA 1IMCA 4YKPA 3FV2A 2CEXA 3B8BA 2HZKA 1NNKA 4ELRA 3B7DA 2XXWA 4DIGA 4LN5A 4P47A 1OLCA 1FJ9A 1NUXA 2CZIA 1JP4A 3MQ9A 1SBPA 4R72A 1MPDA 3SETA 2H9BA 4ONYA 3RPLA 1A40A 1YCJA 2XX9A 2Z8FA 5L9SA 4OQOA 1IMBA 5KDTB 2Q2AA 4F29A 5ICTA 1SI0A 2DYXA 1NMUA 3K00A 5IZ3B 4GWUA 2UYFA 2P1SA 4WKMA 4PP0A 4R2BA 4G8MA 5ET7A 4X8RA 3KN7A 2OWSA 3E13X 5CBSA 1MS7A 5ESYA 2KR0A 1IMDA 1B3FA 2ONRA 1Z7ME 1K9YA 2UVHA 1OQHA 4N6PA 4ELOA 2WX9A 3OELA 3I6VA 3EKIA 2ONKE 4TOZA 4GQOA 3TTMA 2RKMA 2VGQA 1MH3A 3LV0A 1PEBA 3FATA 1MRPA 1URDA 2O1LA 4NF4B 1MQDA 4IO7A 2H4IA 3CFLA 3CVGA 4IY6A 3SERA 4ZEDA 2NUVA 5H8FB 3HSTA 1P1UA 4IO6A 1MY2A 4RNSA 4OYVA 5K2XA 1SD3A 3TQWA 1USYE 3HHFA 2Q8JA 2RF1A 1IXHA 2O51A 4M4GA 1B4HA 1AIVA 2HPGA 4F22A 2I0CA 4OWDA 1FPIA 3KBRA 3ZKLA 1N3XA 4KCDA 3HFUA 3MZ1A 2UVGA 1ATGA 3JYRA 3RGYA 5I2KB 4M1VA 4OFLA 3FXBA 3V8XB 4MJOA 3U92A 2I48A 1A7LA 2M8CA 2O69A 3DP6A 4MMPA 1UIVA 3VDFA 3CFZA 1MXUA 1DTZA 1GR2A 1KA0A 2AL4A 1UTBA 5K2YA 1NNTA 5ET5A 3LUZA 2XXYA 2PCRA 5KZTA 3A3CA 4OESA 4GWWA 4NGUA 2O1MA 4MHFA 1BKAA 3QMFA 5H8HA 3VXBA 4YU0A 2VT5A 1AH5A 2XD2A 1P1NA 3U94A 3S9NC 2Q88A 4GWSA 4O3CA 3O97A 5CI5A 1LB9A 4FBPA 1RYXA 1NUYA 4GX3A 5I59B 3I5OA 3S9EA 4PDHA 2G29A 4KFQA 4ZEBA 1DMBA 4MBPA 1MXWA 1LBCA 4C1TA 3CR9A 1DCUA 1NNPA 2F7BA 3TDJA 4KCCA 3RLFE 3MPLA 1Y4TA 1F9BA 4N6DA 1LBWA 3IAZA 3K6WA 3A09A 4G4PA 3Q25A 4GBVA 1LLSA 2GFEA 1JVXA 4ZZEA 3KFMA 3TEPA 4NWCA 3E9XA 2PYYA 3SESA 3Q26A 4X1DA 4N6KA 5TU0A 1ELJA 4IO2A 3GZGA 2DS9A 1Q35A 5AE4A 4LZ8A 3S9MC 1GV8A 2DOJA 4ESWA 2XXQA 1FRPA 5EHSA 4EQBA 2F97A 1URSA 5AA4B 4YB7A 1KZ8A 3PPRA 2YPNA 3T0JA 3O29A 4XKPA 4PFBA 1JETA 3UGWA 1B7HA 3LBSA 1XHYA 4DDDA 4O94A 1Z7NE 3HN0A 2OK2A 4ZDMA 1FTLA 1R9QA 3BKIB 5EQAA 4IO5A 4BDMA 4GWXA 4YKIA 1IZ1A 4X48A 3TFLA 1MDQA 4MNPA 4AS4A 1B1HA 4NHBA 3VVDA 1PB9A 4I1DA 3SDFA 2QMXA 4NEDA 4P11A 4R9FA 1BIYA 3LUYA 3IOVA 4YKJA 1B46A 3TTNA 2V93A 5DVIA 2QMWA 4YICA 1MPCA 4PF8A 4U21A 2V4CA 3PGFA 1MXZA 4LA9A 1FPKA 4NX1A 3L6GA 5ELVA 4U23A 1Q9DA 2B3FA 1AOVA 2ESNA 1NL5A 5IKBA 3GYYA 4F1UA 2XXRA 3TTRA 3ZSFA 1UTBB 2OZZA 4NE4A 2G93A 5L9MA 3IO4A 3DLNA 1R1NA 4XFEA 1ZJLA 4Z0IA 5KCJB 2HAUA 4MAGA 3U72A 1GGGA 1YZ0A 4RYAA 2PFZA 2Y7WA 2DWIA 5H8HB 3E4RA 2FA7A 3SEUA 5JTYA 4PAIA 5BUUA 3S4UA 3P7IA 3RT8A 2HCAA 3FV1A 2DE3A 4NQ8A 1UTHA 5BWJA 3RQTA 5LOMA 2WYKA 2GHBA 4RY1A 3C9HA 5H8NA 1LAHE 1IQ7A 5CMBA 3QUJA 5I58A 3IB1A 4LQ5A 1Y3QA 3MP6A 4YB5A 3TZAA 1B5HA 5AA3A 5FHOA 1SYIA 2ZZXA 1XI6A 5EYHA 4R9GA 3H3GA 4GXAA 1JW5A 1QUKA 1XVXA 2CZLA 2THIA 1D9QA 2QL3A 2I6EA 1II5A 1NV7A 1NV5A 1T0KA 2OBGA 1BP5A 4MH5A 2D21A 1URGA 1DSNA 3ONMA 2H98A 3G3KA 2I58A 4FORA 2I49A 3T22A 2QVRA 4XXUA 1ZTYA 4MIJA 2ZNTA 3OD7A 1RDZA 4U4SA 3LR1A 4XKQA 3MZ9A 5JK4A 3BFUA 4HS7A 5EQ9A 5F24A 5HBCA 2OLBA 3O6HA 3TCFA 3VVFA 1NKXA 3U93A 3K1MA 4EQ7A 4UACA 3TQLA 3JV9A 4PFYA 3UK4A 1LAXA 1CE2A 1B0LA 3KSXA 3IO6A 2F3BA 3TCGA 3QSLA 5CRYA 3TKDA 3RPWA 2PX1A 3ZS6A 1MQHA 1N76A 3HO7A 2QFLA 2UXAA 3CSBA 4NMYA 2CZKA 1M5BA 1A99A 1M5EA 3FXUA 5HPQA 1EYKA 1INPA 3K01A 2Q9TA 2BJIA 2XA5A 4GWYA 4KHZE 2QVUA 1FTOA 1ZLQA 1AMFA 3OSRA 4IO4A 5I57A 2XX7A 3R26A 4HXVA 1IXGA 1FQDA 1MH4A 1EZPA 3MVWA 5LTCA 4JDFA 5HM4B 1MY3A 2NVUB 4PGPA 3IK6B 2NXOA 2V25A 3T9HB 3G3HA 4H8IA 4NN3A 2Q74A 4FJPA 1FBPA 3DM0A 1M5DA 3DELB 4BDNA 4GWOA 1QKAA 4QBAA 5AA2A 2HXRA 1D4NA 1OQGA 3CG1A 1AL3A 3OO7A 1OLAA 3MPKA 4ZECA 1A54A 5J16A 1MY4A 4PTKA 4AB5A 1KA1A 4N07A 3G3JA 3D4GA 4GD5A 5JTYB 3T9XB 1DK4A 4ND9A 1H45A 1VR5A 2V84A 1Y3PA 1MXXA 3C4MA 4GIZA 1FPDA 5IGAA 2P2AA 3FVKA 1QKBA 4I62A 4AB6A 1FPFA 2QSXA 4IB2A 4LATA 1UTHB 4ZS9A 1PB7A 3OXNA 4JWXA 3S9LC 3PPNA 1R9LA 1I6AA 4N13A 3FZVA 1LCTA 4OVPA 1QVSA 1TWYA 5H8NB 4MFIA 5I58B 3SZPA 2GRVA 1B4ZA 1S9TA 3UP9A 4YMAA 3PV0E 3IORA 3B6WA 4E0XA 3C32A 3PUWE 3HHGA 2RCBA 4QXDA 2PMSA 1B32A 2FIXA 2F7CA 1LCFA 3MVXA 3QAXA 5EYGA 4FATA 4DI3D 4JB7A 2REGA 3E79A 1TFAA 4PFUA 2Q8MA 4MEVA 5TP9A 5ITPA 1B05A 2PBWA 4P1LA 4G8NA 3W15C 4QFPA 3GXAA 3T1BA 3H06B 1QGXA 3G3GA 3FXRA 2ZYMA 2P3NA 4QSCA 1MG1A 1XOCA 5M2VA 1P99A 5DEXA 4PE5B 1HSLA 2AIXA 5AA2D 3A3UA 3QYTA 4HE0A 2F34A 4PFRA 1OVBA 4H67A 1JEVA 2DVZA 4OANA 2FBPA 3S2VA 3PPPA 2V3QA 1D9YA 1B6HA 1Q1KA 3PUZE 1PBQA 3AXFA 1FJ6A 2Y5KA 2Z22A 1GTKA 2PT2A 4ISUA 1G0HA 3B6TA 4F3GA 1R6ZA 1N7WA 3HV1A 1FBDA 4ELPA 4NG7A 1QUIA 4WEDA 3VV5A 1NV2A 2A5SA 5FBPA 1LBXA 5CM6A 3ZKKA 4TLMB 3V5AA 2XWOA 4NF8A 1SDXA 4H1XA 1RYOA 2H5YA 3V89B 5I3SA 1QJMA 5FTIA 3O6IA 3QUFA 1N7XA 3QIMA 1USYH 3U8QA 2B3BA 5H8QB 3OEKA 4POWA 3THIA 2ZYOA 2F3DA 3T96B 1LGBC 3CG3A 4OMBA 3RUMA 1MY1A 2GH9A 3IOTA 1Y3NA 5I5PA 4ESXA 4MLQA 3C33A 1LSTA 1SW2A 1PB8A 4F39A 3VFJA 4L17A 3H7MA 4H65A 3RPLB 4OVSA 4ZEIA 4KXPA 4EXLA 2XWIA 1SPIA 3FJGA 3PPQA 3PUXE 2VPOA 3CIJA 2V3UA 4P56A 1LFHA 1LFIA 1IEJA 1QUJA 1LBZA 3IX1A 1FPBA 1B3HA 3PMXA 1H43A 2FYIA 4YKKA 1US5A 1DTGA 1FPJA 1FQFA 4U2RA 4UA8A 2R6GE 5IAIA 1JW4A 1TFDA 2OCUA 1ZKBA 1EYJA 2YLNA 4FAJA 3I3VA 2DVCA 4U1OA 4Q8RA 3MBPA 2VD2A 3SEXA 2A5TA 2REJA 3UN6A 1K9ZA 1UIUA 4G68A 3G3IA 4R6YA 1B51A 4OVRA 1LAFE 3KEIA 2VOZA 3H6WA 4LZ7A 4PF6A 1PBPA 4BDRA 1N3WA 3KN3A 4RK9A 3FVNA 4N8YA 1DOTA 1FQEA 4IO3A 2O6AA 2ZNUA 2Q89A 1NFTA 4RK2A 3KC0A 1EH3A 1POTA 1HSJA 2RC9A 4MX6A 2WEFA 4HCYA 3MW0A 3KOTA 1I6BA 4BLAA 4QFNA 2UYEA 1B0HA 5TP9B 4UABA 3IJXB 2HFBA 1B7UA 2ALUA 3VVEA 4ECFA 1B1XA 1FBGA 1POY1 2QS3A 5DEXB 2RC7A 5IZ1A 4U22A 2DP8A 3Q29A 4Q5TA 3LC8A 4F2OA 3PUVE 1IIWA 1J1NA 4F2QA 1I6QA 2HZLA 1A8FA 3KBZA 4I3YA 1MQGA 1L5TA 2WBBA 1HSEA 4R2FA 1IMEA 3T93B 3SKPA 1B58A 4LQ2A 4H6DA 3KSJA 1FTJA 1LBVA 4X04A 4H5FA 2H99A 3IOWA 1YXIA 4NF8B 1BTJA 3FVOA 4GX4A 4NWDA 2RINA 4KPTA 1NV3A 3O28A 5ET8A 3ISPA 2D3IA 1VFEA 3K02A 4HTGA 3U65A 2ZXTA 2CMOA 2WYPA 2Z8EA 4EF2A 1B3LA 4O3AA 3IL1B 3W9WA 2OJTA 3VE1B 1ZU0A 2XXXA 4IGRA 1RDXA 1FQBA 5A5LA 3G7WA 5TPAA 4JBZA 3VLUA 2OWTA 3CI8A 2UVJA 4QSDA 1O63A 4DCYA 2P3VA 4P8BA 3EHTA 4GXSB 3E78A 1FBHA 2FIEA 4YAHX 2RC8A 3EPEA 2XHDA 3MP8A 1MQIA 2E0SA 4G8HA 2Y7PA 3ILTB 4LVQA 1BLFA 3CRBA 1YAEA 3RT6B 3BFTA 4F3PA 1MM7A 4RXLA 4PGNA 3DP8A 1M5FA 2AL5A 1FPEA 1WODA 3FD3A 4N15A 4EUOA 4HE2A 3RN8A 2R9JA 2O7IA 2O68A 3FBPA 1B9JA 3IFAA 3V83A 5I56A 4PAFA 2A5TB 1LBBA 5EQ7A 4G68B 2P0SA 1N84A 2DWJA 4WEPA 4WXJA 1B3GA 3H6VA 1FTAA 3CHGA 1YPNA 1M5CA 3IR1A 2F78A 1WDNA 3HPIA 4JVIA 1Y9UA 1H76A 3IOUA 1SYHA 1S7YA 4P0GA 1ZMGA 3WAEA 3FGSA 4JSOA 4QFLA 1NUZA 4I8CA 3T9VA 4GBWA 3B50A 5CMCA 4XIGQ 1EU8A 3LSFB 4JSDA 3EHUA 1WVJA 3UORA 4HCWA 1D9VA 1TXFA 3FUZA 2XXTA 4NF5A 3ECRA 4KI0E 3OO8A 5EHMA 5IM2A 1O7TA 2Y7RA 2QVVA 2H25A 5T3JA 2W7YA 3FXQA 4O7MA 2FHYA 4KYEA 4O8MA 3ODBA 4P3LA 3EN3A 2L5VA 4LP2B 4BDQA 4GL0A 1O64A 4PFIA 5IZZA 4I9DA 3C31A 1XVYA 5FTHA 1ZIUA 2VP1A 3T9UA 5ISUA 1S50A 2XX8A 3VLVA 3N6TA 4LUBA 3MVZA 4BDOA 2F7AA 3BIGA 2I3WA 4DLDA 4YZZA 1DPEA 4QFKA 4F18A 3RY3A 4QHQA 1B5IA 5B70A 2HAVA 3OENA 4O7IA 4G61A 3IJOB 4PBHA 3RTWB 3PU5A 5DW8A 4MNCA 1Y20A 3H6TA 3O2AA 1NV6A 4DXCA 2XXUA 4U1ZA 5CBRA 5DYHA 3Q27A 3RNNA 1FCKA 2ZYKA 3MUQA 4PCDA 1CB6A 1QULA 4E0WA 4IY5A 5L8DA 4DCXA 1IMAA 2DWHA 3C34A 2DQVA 4N81A 4OFJA 4NF6A 1OMPA 3KN8A 1TT1A 4R74A 2XXPA 2WBDA 4RPNA 2ANJA 4GVOA 3EQ1A 1FTMA 2QPQA 1MXYA 2F35A 4GWZA 5TPAB 3MWBA 5AA4A 4GRKA 1H44A 5ET6A 2BJJX 3CSGA 2F36A 5LDZA 4GF8A 1SQYA 4XTCQ 2B65A 3WAFA 1Y1ZA 4XKRA 4H5GA 1UQWA 1Y1MA 4H8JA 4H0WA 3K0VA 3QK6A 4KYDA 4C1UA 2O84X 1EYIA 1FSAA 3UA8A 4GX6A 3GBBA 4PDDA 4ZE9A 1A8EA 3MAMA 4DXUA 4H46A 3TMGA 3TELA 4ZE8A 2PVUA 4MLVA 4THIA 3H4ZA 1RDYA 1GVCA 4EQ9A 3TAJA 2DDKA 5I2NA 1B3EA 5I56B 1LBYA 4R75A 3OO6A 2X26A 4AS5A 2F5XA 1SVXB 1FW0A 3RYDA 4C0RA 3TPAA 5I84A 1IUDA 4MCOA 1D3KA 4POXA 5H8SA 1H3DA 1JNFA 4PETA 2PT1A 3TODA 3OMBA 5J1DA 3MP1A 2GHAA 2KQZA 2HXWA 2XXIA 3CFXA 2R8TA 3G3FA 3BIHA 4NF5B 1EZ9A 1SW1A 1B52A 1FBCA 4F31B 5CC2A 4AQ4A 4Q30B 4OVQA 3K2DA 2DXYA 1FTKA 5KCJA 5I57B 3LSXA 2ZNSA 1VDWA 4KD5A 2X7PA 2XD3A 2IEEA 4QFOA 2ABHA 2DXRA 2R71A 5A5XA 1FBFA 3TCHA 2RCAA 2X7QA 1B2HA 5F1QA 1JQFA 1VE4A 4PBQA 5CMMA 4JWOA 2Z23A 5AA2B 4N8GA 2ZZVA 3TYHA 1DBZA 1IXIA 1US4A 5I7IA 2F6GA 4JVCA 1EZOA 3FJMA 4XF5A 4F19A 1ANFA 4PE3A 2E1SA 3IFCA 1P1WA 1B7ZA 1QW0A 3B6QA 4G77A 4LONB 4TQUQ 3C35A 2NWJA 2ONSA 4IGTA 3O9PA 4X1BA 4JWYA 3TUSA 1N04A 1YYZA 2PFYA 3OEMA 4EF1A 4P1EA 3K4UA 4MNIA 3KGCA 4NF6B 4R6HA 3PPOA 3IB2A 1FQAA 2UVIA 2XXHA 3KJ7A 3FVGA 5DTBA 4TLLB 1FPLA 5JEIA 5B7DA 4NTLA 5EYFA 1NV0A 4GLIA 1OVTA 2XXVA 4YB6A 4QRZA 3MYUA 2QRYA 4RA1A 2VHAA 4PFWA 3A29A 2QS2A 3OO9A 3D4CA 2Y84A 4DXBA 1KWHA 1NUWA 2Z8DA 4PAKA 1B5JA 4GL8A 4XKNA 4G2ZA 2GQ1A 1LAGE 4OZ9A 4OETA 4ZZAA 4F3SA 1VSOA 4KQPA 2I4CA 3KC1A 2CZHA 3ROJA 3U1OA 4PFTA 1JVYA 2QJEA 1G0IA 1NNFA 5ICQA 1FBEA 1ZBMA 1XS5A 2B4MA 1Y4CA 3JZJA 1FQCA 3QXMA 3OSQA 2YJPA 2DWAA 2HQ0A 3H6UA 5I2NB 4ELQA 1SI1A 3MZBA 1RKMA 1I69A 4F3BA 2WKYA 1SW5A 2VD3A 3E3KA 4P0IA 3GBAA 1P1QA 1PDAA 3SEVA 1FPGA 4ZEFA 4HE1A 3HCQA 3OOAA 4MF3A 2DE4A 5AA1A 2F6PA 3N6UA 5FHNA 5DVFA 2ZZWA 3O6GA 2HHMA 4O3BA 4JXIA 3PD8A 2ZMBA 4DE8A 1AWBA 3USDA 2KLFA 4F1YA 4OA4A 2XXKA 4N4UA 3R6UA 1VFDA 4FEBA 4FIMA 5EQ8A 4PC9A 4YMBA 2Y5LA 2D5WA 5CMKA 4DZ1A 1IXCA 3L6HA 3Q28A 4I40A 3EF7A 1B40A 3KZGA 4R73A 4U4XA 1A55A 3N94A 3H03A 2FNCA 5KDTA 3LSLA 4OEUA 1NH7A 2AYSA 4RJZA 4F1VA 3T66A 5DT6A 2I4BA 4GOTA 3MC2A 2Q2CA 3K6VA 1MDP1 5IZ3A 1PC3A 3IB0A 2O7UA 4NAPA 4IR8A 2Y7IA 3KOSA 2QS4A 4OVTA 5A5XB 3MVYA 4OXVA 1MXVA 1XT8A 3N26A 2CEYA 4OERA 2Y7KA 3BBRA 1NV1A 2XWKA 3EHSA 2XWVA 4OEVA 4PQJA 5DVJA 3FJ7A 2OWZA 1SW4A 4P9KA 4BDLA 1DPPA 3M3FA 5F7VA 3PTYA 1LFGA 3O66A 1N0TA 4OFOA 3LSWA 4OTEA 3MSTA 4QSEA 1OIBA 1LEVA 3TTLA 4G68C 4NF4A 3PMVA 1CNQA 3M3LA 2DSFA 3KG2A 2V3TA 4N17A 3VXCA 5H8FA 4XEQA 2I0BA 2LAOA 4JVDA 3UIFA 3F11A 2QS1A 1NV4A 1MM6A 3NOHA 3K1PA 1LB8A 4X9TA 3PMWA 3K6UA 2B4LA 3M8UA 2IA4A 4R6KA 4KYSA 4LZ5A 1JW1A 4N91A 4OHNA 4GFRA 4Q0CA 4OENA 2ZYNA 3RTFB 3W9VA 3C36A 5I2KA 4EDPA 2FVZA 3ILUB 4DI4B 4FEDA 3D1RA 1P1OA 4NF0A 1IITA 4EXKA 1JEUA 3M3KA 4I3EA 3PD9A 1MQJA 4K3FA 3VLWA 3N5LA 2OX3A 4QF9A 4RPOA 3FIRA 3K1NA 4FE8A 5L9OA 4OVJA 5FHMA 3SEYA 3SEWA 3R7XA 1XC1A 2JJKA 3PUYE 1YTVA 3MJNA 3GLBA 2DE2A 4ZEKA 4Z7EA 2NOOA 1MY0A 2HEUA 1NI9A 4KR5A
chains in the Genus database with same CATH topology
1NH8A 3KJTA 2I3VA 4HW8A 1MPBA 3K6XA 3FASA 3DP4A 5I59A 4FECA 2F8DA 5H8QA 5ITOA 3TTKA 4YKPA 3FV2A 2HZKA 1NNKA 4ELRA 3B7DA 2XXWA 4DIGA 1OLCA 3MQ9A 1SBPA 4R72A 1MPDA 3SETA 2H9BA 4ONYA 1A40A 1YCJA 2XX9A 2Z8FA 5L9SA 4OQOA 5KDTB 2Q2AA 4F29A 5ICTA 1SI0A 2DYXA 1NMUA 3K00A 2UYFA 2P1SA 4WKMA 4PP0A 4R2BA 4G8MA 3KN7A 2OWSA 3E13X 5CBSA 1MS7A 1B3FA 2ONRA 1Z7ME 2UVHA 1OQHA 4N6PA 4ELOA 3OELA 3I6VA 2ONKE 4TOZA 4GQOA 3TTMA 2RKMA 2VGQA 1MH3A 1PEBA 3FATA 1URDA 1MRPA 2O1LA 4NF4B 1MQDA 4IO7A 2H4IA 3CFLA 3CVGA 4IY6A 4ZEDA 3SERA 2NUVA 5H8FB 3HSTA 1P1UA 4IO6A 1MY2A 4RNSA 4OYVA 5K2XA 1SD3A 3TQWA 1USYE 3HHFA 2Q8JA 2RF1A 1IXHA 2O51A 4M4GA 1B4HA 1AIVA 4F22A 2I0CA 4OWDA 3KBRA 3ZKLA 1N3XA 4KCDA 3MZ1A 2UVGA 1ATGA 3JYRA 3RGYA 5I2KB 4M1VA 4OFLA 3V8XB 3U92A 2I48A 1A7LA 2M8CA 2O69A 3DP6A 1UIVA 3VDFA 3CFZA 1MXUA 1DTZA 1GR2A 2AL4A 1UTBA 5K2YA 1NNTA 2XXYA 5KZTA 3A3CA 4OESA 2O1MA 1BKAA 5H8HA 3VXBA 4YU0A 1AH5A 2XD2A 1P1NA 3U94A 3S9NC 2Q88A 4O3CA 3O97A 5CI5A 1LB9A 1RYXA 5I59B 3I5OA 3S9EA 2G29A 4KFQA 4ZEBA 1DMBA 4MBPA 1MXWA 1LBCA 4C1TA 3CR9A 1NNPA 2F7BA 3TDJA 4KCCA 3RLFE 3MPLA 1Y4TA 1F9BA 3IAZA 3K6WA 3A09A 4G4PA 3Q25A 1LLSA 2GFEA 1JVXA 4ZZEA 3KFMA 3TEPA 4NWCA 3E9XA 2PYYA 3SESA 3Q26A 4X1DA 5TU0A 1ELJA 4IO2A 3GZGA 2DS9A 1Q35A 5AE4A 4LZ8A 3S9MC 1GV8A 2DOJA 4ESWA 2XXQA 5EHSA 4EQBA 2F97A 1URSA 5AA4B 4YB7A 3PPRA 2YPNA 3O29A 4XKPA 1JETA 3UGWA 1B7HA 3LBSA 1XHYA 4DDDA 1Z7NE 3HN0A 2OK2A 4ZDMA 1FTLA 1R9QA 3BKIB 4IO5A 4BDMA 4YKIA 1IZ1A 4X48A 3TFLA 1MDQA 1B1HA 3VVDA 1PB9A 4I1DA 3SDFA 2QMXA 4NEDA 4P11A 4R9FA 1BIYA 3LUYA 3IOVA 4YKJA 1B46A 3TTNA 2V93A 5DVIA 2QMWA 4YICA 1MPCA 4U21A 3PGFA 1MXZA 4LA9A 3L6GA 5ELVA 4U23A 2B3FA 1AOVA 2ESNA 1NL5A 5IKBA 4F1UA 2XXRA 3TTRA 3ZSFA 1UTBB 2OZZA 4NE4A 2G93A 5L9MA 3IO4A 3DLNA 1R1NA 1ZJLA 4Z0IA 5KCJB 2HAUA 3U72A 1GGGA 4RYAA 2Y7WA 2DWIA 5H8HB 3E4RA 2FA7A 3SEUA 5JTYA 5BUUA 3S4UA 3P7IA 3RT8A 2HCAA 3FV1A 2DE3A 1UTHA 5BWJA 3RQTA 5LOMA 2GHBA 4RY1A 3C9HA 5H8NA 1LAHE 1IQ7A 5CMBA 3QUJA 5I58A 3IB1A 4LQ5A 1Y3QA 3MP6A 4YB5A 3TZAA 1B5HA 5AA3A 5FHOA 1SYIA 4R9GA 3H3GA 4GXAA 1JW5A 1QUKA 1XVXA 2CZLA 2THIA 2QL3A 2I6EA 1II5A 1T0KA 2OBGA 1BP5A 4MH5A 2D21A 1URGA 1DSNA 3ONMA 2H98A 3G3KA 2I58A 4FORA 2I49A 3T22A 4XXUA 1ZTYA 2ZNTA 3OD7A 4U4SA 3LR1A 4XKQA 3MZ9A 5JK4A 3BFUA 4HS7A 5HBCA 2OLBA 3O6HA 3TCFA 3VVFA 1NKXA 3U93A 3K1MA 4EQ7A 4UACA 3TQLA 3JV9A 4PFYA 3UK4A 1LAXA 1CE2A 1B0LA 3KSXA 3IO6A 3TCGA 3QSLA 5CRYA 3TKDA 3RPWA 2PX1A 3ZS6A 1MQHA 1N76A 3HO7A 2UXAA 3CSBA 4NMYA 1M5BA 1A99A 1M5EA 3FXUA 5HPQA 3K01A 2Q9TA 4KHZE 1FTOA 1ZLQA 1AMFA 3OSRA 4IO4A 5I57A 2XX7A 3R26A 1IXGA 1FQDA 1MH4A 1EZPA 3MVWA 4JDFA 5HM4B 1MY3A 2NVUB 3IK6B 2NXOA 2V25A 3T9HB 3G3HA 4H8IA 4FJPA 3DM0A 1M5DA 3DELB 4BDNA 4GWOA 1QKAA 5AA2A 1D4NA 1OQGA 3CG1A 1AL3A 3OO7A 1OLAA 3MPKA 4ZECA 1A54A 1MY4A 4AB5A 4N07A 3G3JA 3D4GA 4GD5A 5JTYB 3T9XB 4ND9A 1H45A 1VR5A 2V84A 1Y3PA 1MXXA 3C4MA 4GIZA 2P2AA 3FVKA 1QKBA 4I62A 4AB6A 2QSXA 4IB2A 4LATA 1UTHB 4ZS9A 1PB7A 3OXNA 4JWXA 3S9LC 3PPNA 1R9LA 1I6AA 4N13A 3FZVA 1LCTA 1QVSA 1TWYA 5H8NB 4MFIA 5I58B 2GRVA 1B4ZA 1S9TA 3UP9A 4YMAA 3PV0E 3IORA 3B6WA 4E0XA 3C32A 3PUWE 3HHGA 2RCBA 2PMSA 1B32A 2F7CA 1LCFA 3MVXA 3QAXA 4FATA 4JB7A 2REGA 1TFAA 4PFUA 5TP9A 5ITPA 1B05A 2PBWA 4G8NA 3W15C 4QFPA 3GXAA 3H06B 3G3GA 3FXRA 2ZYMA 4QSCA 1MG1A 1XOCA 5M2VA 1P99A 5DEXA 4PE5B 1HSLA 2AIXA 5AA2D 3A3UA 3QYTA 2F34A 1OVBA 4H67A 1JEVA 2DVZA 3S2VA 3PPPA 2V3QA 1D9YA 1B6HA 1Q1KA 3PUZE 1PBQA 3AXFA 2Z22A 1GTKA 2PT2A 4ISUA 3B6TA 4F3GA 1R6ZA 1N7WA 3HV1A 4ELPA 1QUIA 4WEDA 3VV5A 2A5SA 5CM6A 3ZKKA 4TLMB 3V5AA 4NF8A 1SDXA 4H1XA 1RYOA 2H5YA 3V89B 1QJMA 5FTIA 3O6IA 3QUFA 1N7XA 3QIMA 1USYH 3U8QA 2B3BA 5H8QB 3OEKA 4POWA 3THIA 2ZYOA 3T96B 1LGBC 3CG3A 4OMBA 3RUMA 1MY1A 2GH9A 3IOTA 1Y3NA 4ESXA 4MLQA 3C33A 1LSTA 1SW2A 1PB8A 4F39A 3VFJA 4L17A 3H7MA 4H65A 4ZEIA 4EXLA 3FJGA 3PPQA 3PUXE 3CIJA 2V3UA 1LFHA 1LFIA 1IEJA 1QUJA 3IX1A 1B3HA 3PMXA 1H43A 2FYIA 4YKKA 1US5A 1DTGA 1FQFA 4U2RA 4UA8A 2R6GE 5IAIA 1JW4A 1TFDA 2OCUA 1ZKBA 2YLNA 4FAJA 3I3VA 2DVCA 4U1OA 4Q8RA 3MBPA 2VD2A 3SEXA 2A5TA 2REJA 3UN6A 1UIUA 4G68A 3G3IA 4R6YA 1B51A 1LAFE 3KEIA 2VOZA 3H6WA 4LZ7A 1PBPA 4BDRA 1N3WA 3KN3A 4RK9A 3FVNA 1DOTA 1FQEA 4IO3A 2O6AA 2Q89A 2ZNUA 1NFTA 4RK2A 1EH3A 1POTA 1HSJA 2RC9A 4HCYA 3MW0A 3KOTA 1I6BA 4BLAA 4QFNA 2UYEA 1B0HA 5TP9B 3IJXB 2HFBA 1B7UA 2ALUA 3VVEA 4ECFA 1B1XA 1POY1 2QS3A 5DEXB 2RC7A 4U22A 2DP8A 3Q29A 4Q5TA 3LC8A 4F2OA 3PUVE 1IIWA 1J1NA 4F2QA 1I6QA 2HZLA 1A8FA 1L5TA 1MQGA 1HSEA 4R2FA 3T93B 3SKPA 1B58A 4LQ2A 4H6DA 3KSJA 1FTJA 4H5FA 2H99A 3IOWA 4NF8B 1BTJA 3FVOA 4NWDA 2RINA 4KPTA 3O28A 2D3IA 1VFEA 3K02A 4HTGA 2ZXTA 2CMOA 2Z8EA 4EF2A 1B3LA 4O3AA 3IL1B 3W9WA 2OJTA 3VE1B 1ZU0A 2XXXA 4IGRA 1FQBA 3G7WA 5TPAA 4JBZA 3VLUA 2OWTA 3CI8A 2UVJA 4QSDA 1O63A 4DCYA 3EHTA 4GXSB 4YAHX 2RC8A 3EPEA 2XHDA 3MP8A 1MQIA 2E0SA 4G8HA 2Y7PA 3ILTB 1BLFA 4LVQA 3CRBA 1YAEA 3RT6B 3BFTA 4F3PA 1MM7A 4RXLA 3DP8A 1M5FA 2AL5A 1WODA 3FD3A 4EUOA 2R9JA 2O7IA 2O68A 1B9JA 3V83A 5I56A 2A5TB 1LBBA 4G68B 2P0SA 1N84A 2DWJA 4WEPA 4WXJA 1B3GA 3H6VA 1YPNA 1M5CA 3IR1A 2F78A 1WDNA 3HPIA 1Y9UA 1H76A 3IOUA 1SYHA 1S7YA 4P0GA 1ZMGA 3WAEA 3FGSA 4JSOA 4QFLA 4I8CA 3T9VA 5CMCA 4XIGQ 1EU8A 3LSFB 4JSDA 3EHUA 1WVJA 3UORA 4HCWA 1D9VA 1TXFA 3FUZA 2XXTA 4NF5A 3ECRA 4KI0E 3OO8A 5EHMA 1O7TA 2Y7RA 2H25A 2W7YA 3FXQA 4KYEA 3ODBA 3EN3A 4LP2B 4BDQA 4GL0A 1O64A 4I9DA 3C31A 1XVYA 5FTHA 1ZIUA 2VP1A 3T9UA 5ISUA 1S50A 2XX8A 3VLVA 3N6TA 4LUBA 3MVZA 4BDOA 2F7AA 2I3WA 4DLDA 4YZZA 1DPEA 4QFKA 4F18A 3RY3A 4QHQA 1B5IA 5B70A 2HAVA 3OENA 3IJOB 3RTWB 3PU5A 1Y20A 3H6TA 3O2AA 4DXCA 2XXUA 4U1ZA 5CBRA 5DYHA 3Q27A 3RNNA 1FCKA 2ZYKA 3MUQA 1CB6A 1QULA 4E0WA 4IY5A 5L8DA 4DCXA 2DWHA 3C34A 2DQVA 4OFJA 4NF6A 1OMPA 3KN8A 1TT1A 4R74A 2XXPA 4RPNA 2ANJA 4GVOA 3EQ1A 1FTMA 2QPQA 1MXYA 2F35A 5TPAB 3MWBA 5AA4A 4GRKA 1H44A 2BJJX 3CSGA 2F36A 4GF8A 1SQYA 4XTCQ 2B65A 3WAFA 1Y1ZA 4XKRA 4H5GA 1UQWA 1Y1MA 4H8JA 4H0WA 3K0VA 3QK6A 4KYDA 4C1UA 2O84X 3UA8A 3GBBA 4ZE9A 1A8EA 3MAMA 4DXUA 3TMGA 3TELA 4ZE8A 2PVUA 4MLVA 4THIA 3H4ZA 1GVCA 4EQ9A 3TAJA 5I2NA 1B3EA 5I56B 4R75A 3OO6A 2X26A 2F5XA 1SVXB 1FW0A 4C0RA 3TPAA 5I84A 1IUDA 1D3KA 4POXA 5H8SA 1H3DA 1JNFA 4PETA 2PT1A 3TODA 3OMBA 5J1DA 3MP1A 2GHAA 2HXWA 2XXIA 3CFXA 3G3FA 4NF5B 1EZ9A 1SW1A 1B52A 4F31B 5CC2A 4AQ4A 4Q30B 3K2DA 2DXYA 1FTKA 5KCJA 5I57B 3LSXA 2ZNSA 4KD5A 2X7PA 2XD3A 2IEEA 4QFOA 2ABHA 2DXRA 2R71A 5A5XA 3TCHA 2RCAA 2X7QA 1B2HA 5F1QA 1JQFA 1VE4A 5CMMA 4JWOA 2Z23A 5AA2B 3TYHA 1IXIA 1US4A 2F6GA 1EZOA 3FJMA 4F19A 1ANFA 2E1SA 1P1WA 1B7ZA 1QW0A 3B6QA 4G77A 4LONB 4TQUQ 3C35A 2NWJA 2ONSA 4IGTA 3O9PA 4X1BA 4JWYA 3TUSA 1N04A 3OEMA 4EF1A 3K4UA 3KGCA 4NF6B 4R6HA 3PPOA 3IB2A 1FQAA 2UVIA 2XXHA 3KJ7A 3FVGA 5DTBA 4TLLB 5JEIA 5B7DA 4NTLA 5EYFA 4GLIA 1OVTA 2XXVA 4YB6A 4QRZA 2QRYA 4RA1A 2VHAA 4PFWA 2QS2A 3OO9A 3D4CA 2Y84A 4DXBA 1KWHA 2Z8DA 1B5JA 4GL8A 4XKNA 4G2ZA 1LAGE 4OZ9A 4OETA 4ZZAA 4F3SA 1VSOA 4KQPA 2I4CA 3U1OA 4PFTA 1JVYA 2QJEA 1NNFA 5ICQA 1ZBMA 1XS5A 1Y4CA 3JZJA 1FQCA 3QXMA 3OSQA 2YJPA 2DWAA 2HQ0A 3H6UA 5I2NB 4ELQA 1SI1A 3MZBA 1RKMA 1I69A 4F3BA 2WKYA 1SW5A 2VD3A 3E3KA 4P0IA 3GBAA 1P1QA 1PDAA 3SEVA 4ZEFA 3HCQA 3OOAA 4MF3A 2DE4A 5AA1A 2F6PA 3N6UA 5FHNA 5DVFA 3O6GA 4O3BA 4JXIA 3PD8A 2ZMBA 4DE8A 3USDA 2KLFA 4F1YA 3R6UA 1VFDA 4FEBA 4FIMA 4YMBA 2D5WA 5CMKA 4DZ1A 1IXCA 3L6HA 3Q28A 3EF7A 1B40A 3KZGA 4R73A 4U4XA 4KR5A 1A55A 3N94A 3H03A 2FNCA 5KDTA 3LSLA 4OEUA 1NH7A 2AYSA 4RJZA 4F1VA 3T66A 5DT6A 2I4BA 4GOTA 3MC2A 2Q2CA 3K6VA 1MDP1 1PC3A 3IB0A 2O7UA 2Y7IA 3KOSA 2QS4A 5A5XB 3MVYA 4OXVA 1MXVA 1XT8A 3N26A 4OERA 2Y7KA 3BBRA 3EHSA 4OEVA 4PQJA 5DVJA 3FJ7A 1SW4A 4BDLA 1DPPA 3M3FA 5F7VA 1LFGA 3O66A 1N0TA 4OFOA 3LSWA 4OTEA 4QSEA 1OIBA 3TTLA 4G68C 4NF4A 3PMVA 3M3LA 2DSFA 3KG2A 2V3TA 3VXCA 5H8FA 2I0BA 2LAOA 3UIFA 3F11A 2QS1A 1MM6A 3K1PA 1LB8A 4X9TA 3PMWA 3K6UA 3M8UA 2IA4A 4R6KA 4KYSA 4LZ5A 1JW1A 4OHNA 4GFRA 4Q0CA 4OENA 2ZYNA 3RTFB 3W9VA 3C36A 5I2KA 4EDPA 3ILUB 4FEDA 1P1OA 1IITA 4EXKA 1JEUA 3M3KA 3PD9A 1MQJA 4K3FA 3VLWA 3N5LA 4QF9A 4RPOA 3FIRA 3K1NA 4FE8A 5L9OA 4OVJA 5FHMA 3SEYA 3SEWA 3R7XA 1XC1A 3PUYE 1YTVA 3MJNA 3GLBA 2DE2A 4ZEKA 4Z7EA 2NOOA 1MY0A 2HEUA 3RN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NH8 A;  3KJT A;  2I3V A;  4HW8 A;  1MPB A;  3K6X A;  3FAS A;  3DP4 A;  5I59 A;  4FEC A;  2F8D A;  5H8Q A;  5ITO A;  3TTK A;  4YKP A;  3FV2 A;  2HZK A;  1NNK A;  4ELR A;  3B7D A;  2XXW A;  4DIG A;  1OLC A;  3MQ9 A;  1SBP A;  4R72 A;  1MPD A;  3SET A;  2H9B A;  4ONY A;  1A40 A;  1YCJ A;  2XX9 A;  2Z8F A;  5L9S A;  4OQO A;  5KDT B;  2Q2A A;  4F29 A;  5ICT A;  1SI0 A;  2DYX A;  1NMU A;  3K00 A;  2UYF A;  2P1S A;  4WKM A;  4PP0 A;  4R2B A;  4G8M A;  3KN7 A;  2OWS A;  3E13 X;  5CBS A;  1MS7 A;  1B3F A;  2ONR A;  1Z7M E;  2UVH A;  1OQH A;  4N6P A;  4ELO A;  3OEL A;  3I6V A;  2ONK E;  4TOZ A;  4GQO A;  3TTM A;  2RKM A;  2VGQ A;  1MH3 A;  1PEB A;  3FAT A;  1URD A;  1MRP A;  2O1L A;  4NF4 B;  1MQD A;  4IO7 A;  2H4I A;  3CFL A;  3CVG A;  4IY6 A;  4ZED A;  3SER A;  2NUV A;  5H8F B;  3HST A;  1P1U A;  4IO6 A;  1MY2 A;  4RNS A;  4OYV A;  5K2X A;  1SD3 A;  3TQW A;  1USY E;  3HHF A;  2Q8J A;  2RF1 A;  1IXH A;  2O51 A;  4M4G A;  1B4H A;  1AIV A;  4F22 A;  2I0C A;  4OWD A;  3KBR A;  3ZKL A;  1N3X A;  4KCD A;  3MZ1 A;  2UVG A;  1ATG A;  3JYR A;  3RGY A;  5I2K B;  4M1V A;  4OFL A;  3V8X B;  3U92 A;  2I48 A;  1A7L A;  2M8C A;  2O69 A;  3DP6 A;  1UIV A;  3VDF A;  3CFZ A;  1MXU A;  1DTZ A;  1GR2 A;  2AL4 A;  1UTB A;  5K2Y A;  1NNT A;  2XXY A;  5KZT A;  3A3C A;  4OES A;  2O1M A;  1BKA A;  5H8H A;  3VXB A;  4YU0 A;  1AH5 A;  2XD2 A;  1P1N A;  3U94 A;  3S9N C;  2Q88 A;  4O3C A;  3O97 A;  5CI5 A;  1LB9 A;  1RYX A;  5I59 B;  3I5O A;  3S9E A;  2G29 A;  4KFQ A;  4ZEB A;  1DMB A;  4MBP A;  1MXW A;  1LBC A;  4C1T A;  3CR9 A;  1NNP A;  2F7B A;  3TDJ A;  4KCC A;  3RLF E;  3MPL A;  1Y4T A;  1F9B A;  3IAZ A;  3K6W A;  3A09 A;  4G4P A;  3Q25 A;  1LLS A;  2GFE A;  1JVX A;  4ZZE A;  3KFM A;  3TEP A;  4NWC A;  3E9X A;  2PYY A;  3SES A;  3Q26 A;  4X1D A;  5TU0 A;  1ELJ A;  4IO2 A;  3GZG A;  2DS9 A;  1Q35 A;  5AE4 A;  4LZ8 A;  3S9M C;  1GV8 A;  2DOJ A;  4ESW A;  2XXQ A;  5EHS A;  4EQB A;  2F97 A;  1URS A;  5AA4 B;  4YB7 A;  3PPR A;  2YPN A;  3O29 A;  4XKP A;  1JET A;  3UGW A;  1B7H A;  3LBS A;  1XHY A;  4DDD A;  1Z7N E;  3HN0 A;  2OK2 A;  4ZDM A;  1FTL A;  1R9Q A;  3BKI B;  4IO5 A;  4BDM A;  4YKI A;  1IZ1 A;  4X48 A;  3TFL A;  1MDQ A;  1B1H A;  3VVD A;  1PB9 A;  4I1D A;  3SDF A;  2QMX A;  4NED A;  4P11 A;  4R9F A;  1BIY A;  3LUY A;  3IOV A;  4YKJ A;  1B46 A;  3TTN A;  2V93 A;  5DVI A;  2QMW A;  4YIC A;  1MPC A;  4U21 A;  3PGF A;  1MXZ A;  4LA9 A;  3L6G A;  5ELV A;  4U23 A;  2B3F A;  1AOV A;  2ESN A;  1NL5 A;  5IKB A;  4F1U A;  2XXR A;  3TTR A;  3ZSF A;  1UTB B;  2OZZ A;  4NE4 A;  2G93 A;  5L9M A;  3IO4 A;  3DLN A;  1R1N A;  1ZJL A;  4Z0I A;  5KCJ B;  2HAU A;  3U72 A;  1GGG A;  4RYA A;  2Y7W A;  2DWI A;  5H8H B;  3E4R A;  2FA7 A;  3SEU A;  5JTY A;  5BUU A;  3S4U A;  3P7I A;  3RT8 A;  2HCA A;  3FV1 A;  2DE3 A;  1UTH A;  5BWJ A;  3RQT A;  5LOM A;  2GHB A;  4RY1 A;  3C9H A;  5H8N A;  1LAH E;  1IQ7 A;  5CMB A;  3QUJ A;  5I58 A;  3IB1 A;  4LQ5 A;  1Y3Q A;  3MP6 A;  4YB5 A;  3TZA A;  1B5H A;  5AA3 A;  5FHO A;  1SYI A;  4R9G A;  3H3G A;  4GXA A;  1JW5 A;  1QUK A;  1XVX A;  2CZL A;  2THI A;  2QL3 A;  2I6E A;  1II5 A;  1T0K A;  2OBG A;  1BP5 A;  4MH5 A;  2D21 A;  1URG A;  1DSN A;  3ONM A;  2H98 A;  3G3K A;  2I58 A;  4FOR A;  2I49 A;  3T22 A;  4XXU A;  1ZTY A;  2ZNT A;  3OD7 A;  4U4S A;  3LR1 A;  4XKQ A;  3MZ9 A;  5JK4 A;  3BFU A;  4HS7 A;  5HBC A;  2OLB A;  3O6H A;  3TCF A;  3VVF A;  1NKX A;  3U93 A;  3K1M A;  4EQ7 A;  4UAC A;  3TQL A;  3JV9 A;  4PFY A;  3UK4 A;  1LAX A;  1CE2 A;  1B0L A;  3KSX A;  3IO6 A;  3TCG A;  3QSL A;  5CRY A;  3TKD A;  3RPW A;  2PX1 A;  3ZS6 A;  1MQH A;  1N76 A;  3HO7 A;  2UXA A;  3CSB A;  4NMY A;  1M5B A;  1A99 A;  1M5E A;  3FXU A;  5HPQ A;  3K01 A;  2Q9T A;  4KHZ E;  1FTO A;  1ZLQ A;  1AMF A;  3OSR A;  4IO4 A;  5I57 A;  2XX7 A;  3R26 A;  1IXG A;  1FQD A;  1MH4 A;  1EZP A;  3MVW A;  4JDF A;  5HM4 B;  1MY3 A;  2NVU B;  3IK6 B;  2NXO A;  2V25 A;  3T9H B;  3G3H A;  4H8I A;  4FJP A;  3DM0 A;  1M5D A;  3DEL B;  4BDN A;  4GWO A;  1QKA A;  5AA2 A;  1D4N A;  1OQG A;  3CG1 A;  1AL3 A;  3OO7 A;  1OLA A;  3MPK A;  4ZEC A;  1A54 A;  1MY4 A;  4AB5 A;  4N07 A;  3G3J A;  3D4G A;  4GD5 A;  5JTY B;  3T9X B;  4ND9 A;  1H45 A;  1VR5 A;  2V84 A;  1Y3P A;  1MXX A;  3C4M A;  4GIZ A;  2P2A A;  3FVK A;  1QKB A;  4I62 A;  4AB6 A;  2QSX A;  4IB2 A;  4LAT A;  1UTH B;  4ZS9 A;  1PB7 A;  3OXN A;  4JWX A;  3S9L C;  3PPN A;  1R9L A;  1I6A A;  4N13 A;  3FZV A;  1LCT A;  1QVS A;  1TWY A;  5H8N B;  4MFI A;  5I58 B;  2GRV A;  1B4Z A;  1S9T A;  3UP9 A;  4YMA A;  3PV0 E;  3IOR A;  3B6W A;  4E0X A;  3C32 A;  3PUW E;  3HHG A;  2RCB A;  2PMS A;  1B32 A;  2F7C A;  1LCF A;  3MVX A;  3QAX A;  4FAT A;  4JB7 A;  2REG A;  1TFA A;  4PFU A;  5TP9 A;  5ITP A;  1B05 A;  2PBW A;  4G8N A;  3W15 C;  4QFP A;  3GXA A;  3H06 B;  3G3G A;  3FXR A;  2ZYM A;  4QSC A;  1MG1 A;  1XOC A;  5M2V A;  1P99 A;  5DEX A;  4PE5 B;  1HSL A;  2AIX A;  5AA2 D;  3A3U A;  3QYT A;  2F34 A;  1OVB A;  4H67 A;  1JEV A;  2DVZ A;  3S2V A;  3PPP A;  2V3Q A;  1D9Y A;  1B6H A;  1Q1K A;  3PUZ E;  1PBQ A;  3AXF A;  2Z22 A;  1GTK A;  2PT2 A;  4ISU A;  3B6T A;  4F3G A;  1R6Z A;  1N7W A;  3HV1 A;  4ELP A;  1QUI A;  4WED A;  3VV5 A;  2A5S A;  5CM6 A;  3ZKK A;  4TLM B;  3V5A A;  4NF8 A;  1SDX A;  4H1X A;  1RYO A;  2H5Y A;  3V89 B;  1QJM A;  5FTI A;  3O6I A;  3QUF A;  1N7X A;  3QIM A;  1USY H;  3U8Q A;  2B3B A;  5H8Q B;  3OEK A;  4POW A;  3THI A;  2ZYO A;  3T96 B;  1LGB C;  3CG3 A;  4OMB A;  3RUM A;  1MY1 A;  2GH9 A;  3IOT A;  1Y3N A;  4ESX A;  4MLQ A;  3C33 A;  1LST A;  1SW2 A;  1PB8 A;  4F39 A;  3VFJ A;  4L17 A;  3H7M A;  4H65 A;  4ZEI A;  4EXL A;  3FJG A;  3PPQ A;  3PUX E;  3CIJ A;  2V3U A;  1LFH A;  1LFI A;  1IEJ A;  1QUJ A;  3IX1 A;  1B3H A;  3PMX A;  1H43 A;  2FYI A;  4YKK A;  1US5 A;  1DTG A;  1FQF A;  4U2R A;  4UA8 A;  2R6G E;  5IAI A;  1JW4 A;  1TFD A;  2OCU A;  1ZKB A;  2YLN A;  4FAJ A;  3I3V A;  2DVC A;  4U1O A;  4Q8R A;  3MBP A;  2VD2 A;  3SEX A;  2A5T A;  2REJ A;  3UN6 A;  1UIU A;  4G68 A;  3G3I A;  4R6Y A;  1B51 A;  1LAF E;  3KEI A;  2VOZ A;  3H6W A;  4LZ7 A;  1PBP A;  4BDR A;  1N3W A;  3KN3 A;  4RK9 A;  3FVN A;  1DOT A;  1FQE A;  4IO3 A;  2O6A A;  2Q89 A;  2ZNU A;  1NFT A;  4RK2 A;  1EH3 A;  1POT A;  1HSJ A;  2RC9 A;  4HCY A;  3MW0 A;  3KOT A;  1I6B A;  4BLA A;  4QFN A;  2UYE A;  1B0H A;  5TP9 B;  3IJX B;  2HFB A;  1B7U A;  2ALU A;  3VVE A;  4ECF A;  1B1X A;  1POY 1;  2QS3 A;  5DEX B;  2RC7 A;  4U22 A;  2DP8 A;  3Q29 A;  4Q5T A;  3LC8 A;  4F2O A;  3PUV E;  1IIW A;  1J1N A;  4F2Q A;  1I6Q A;  2HZL A;  1A8F A;  1L5T A;  1MQG A;  1HSE A;  4R2F A;  3T93 B;  3SKP A;  1B58 A;  4LQ2 A;  4H6D A;  3KSJ A;  1FTJ A;  4H5F A;  2H99 A;  3IOW A;  4NF8 B;  1BTJ A;  3FVO A;  4NWD A;  2RIN A;  4KPT A;  3O28 A;  2D3I A;  1VFE A;  3K02 A;  4HTG A;  2ZXT A;  2CMO A;  2Z8E A;  4EF2 A;  1B3L A;  4O3A A;  3IL1 B;  3W9W A;  2OJT A;  3VE1 B;  1ZU0 A;  2XXX A;  4IGR A;  1FQB A;  3G7W A;  5TPA A;  4JBZ A;  3VLU A;  2OWT A;  3CI8 A;  2UVJ A;  4QSD A;  1O63 A;  4DCY A;  3EHT A;  4GXS B;  4YAH X;  2RC8 A;  3EPE A;  2XHD A;  3MP8 A;  1MQI A;  2E0S A;  4G8H A;  2Y7P A;  3ILT B;  1BLF A;  4LVQ A;  3CRB A;  1YAE A;  3RT6 B;  3BFT A;  4F3P A;  1MM7 A;  4RXL A;  3DP8 A;  1M5F A;  2AL5 A;  1WOD A;  3FD3 A;  4EUO A;  2R9J A;  2O7I A;  2O68 A;  1B9J A;  3V83 A;  5I56 A;  2A5T B;  1LBB A;  4G68 B;  2P0S A;  1N84 A;  2DWJ A;  4WEP A;  4WXJ A;  1B3G A;  3H6V A;  1YPN A;  1M5C A;  3IR1 A;  2F78 A;  1WDN A;  3HPI A;  1Y9U A;  1H76 A;  3IOU A;  1SYH A;  1S7Y A;  4P0G A;  1ZMG A;  3WAE A;  3FGS A;  4JSO A;  4QFL A;  4I8C A;  3T9V A;  5CMC A;  4XIG Q;  1EU8 A;  3LSF B;  4JSD A;  3EHU A;  1WVJ A;  3UOR A;  4HCW A;  1D9V A;  1TXF A;  3FUZ A;  2XXT A;  4NF5 A;  3ECR A;  4KI0 E;  3OO8 A;  5EHM A;  1O7T A;  2Y7R A;  2H25 A;  2W7Y A;  3FXQ A;  4KYE A;  3ODB A;  3EN3 A;  4LP2 B;  4BDQ A;  4GL0 A;  1O64 A;  4I9D A;  3C31 A;  1XVY A;  5FTH A;  1ZIU A;  2VP1 A;  3T9U A;  5ISU A;  1S50 A;  2XX8 A;  3VLV A;  3N6T A;  4LUB A;  3MVZ A;  4BDO A;  2F7A A;  2I3W A;  4DLD A;  4YZZ A;  1DPE A;  4QFK A;  4F18 A;  3RY3 A;  4QHQ A;  1B5I A;  5B70 A;  2HAV A;  3OEN A;  3IJO B;  3RTW B;  3PU5 A;  1Y20 A;  3H6T A;  3O2A A;  4DXC A;  2XXU A;  4U1Z A;  5CBR A;  5DYH A;  3Q27 A;  3RNN A;  1FCK A;  2ZYK A;  3MUQ A;  1CB6 A;  1QUL A;  4E0W A;  4IY5 A;  5L8D A;  4DCX A;  2DWH A;  3C34 A;  2DQV A;  4OFJ A;  4NF6 A;  1OMP A;  3KN8 A;  1TT1 A;  4R74 A;  2XXP A;  4RPN A;  2ANJ A;  4GVO A;  3EQ1 A;  1FTM A;  2QPQ A;  1MXY A;  2F35 A;  5TPA B;  3MWB A;  5AA4 A;  4GRK A;  1H44 A;  2BJJ X;  3CSG A;  2F36 A;  4GF8 A;  1SQY A;  4XTC Q;  2B65 A;  3WAF A;  1Y1Z A;  4XKR A;  4H5G A;  1UQW A;  1Y1M A;  4H8J A;  4H0W A;  3K0V A;  3QK6 A;  4KYD A;  4C1U A;  2O84 X;  3UA8 A;  3GBB A;  4ZE9 A;  1A8E A;  3MAM A;  4DXU A;  3TMG A;  3TEL A;  4ZE8 A;  2PVU A;  4MLV A;  4THI A;  3H4Z A;  1GVC A;  4EQ9 A;  3TAJ A;  5I2N A;  1B3E A;  5I56 B;  4R75 A;  3OO6 A;  2X26 A;  2F5X A;  1SVX B;  1FW0 A;  4C0R A;  3TPA A;  5I84 A;  1IUD A;  1D3K A;  4POX A;  5H8S A;  1H3D A;  1JNF A;  4PET A;  2PT1 A;  3TOD A;  3OMB A;  5J1D A;  3MP1 A;  2GHA A;  2HXW A;  2XXI A;  3CFX A;  3G3F A;  4NF5 B;  1EZ9 A;  1SW1 A;  1B52 A;  4F31 B;  5CC2 A;  4AQ4 A;  4Q30 B;  3K2D A;  2DXY A;  1FTK A;  5KCJ A;  5I57 B;  3LSX A;  2ZNS A;  4KD5 A;  2X7P A;  2XD3 A;  2IEE A;  4QFO A;  2ABH A;  2DXR A;  2R71 A;  5A5X A;  3TCH A;  2RCA A;  2X7Q A;  1B2H A;  5F1Q A;  1JQF A;  1VE4 A;  5CMM A;  4JWO A;  2Z23 A;  5AA2 B;  3TYH A;  1IXI A;  1US4 A;  2F6G A;  1EZO A;  3FJM A;  4F19 A;  1ANF A;  2E1S A;  1P1W A;  1B7Z A;  1QW0 A;  3B6Q A;  4G77 A;  4LON B;  4TQU Q;  3C35 A;  2NWJ A;  2ONS A;  4IGT A;  3O9P A;  4X1B A;  4JWY A;  3TUS A;  1N04 A;  3OEM A;  4EF1 A;  3K4U A;  3KGC A;  4NF6 B;  4R6H A;  3PPO A;  3IB2 A;  1FQA A;  2UVI A;  2XXH A;  3KJ7 A;  3FVG A;  5DTB A;  4TLL B;  5JEI A;  5B7D A;  4NTL A;  5EYF A;  4GLI A;  1OVT A;  2XXV A;  4YB6 A;  4QRZ A;  2QRY A;  4RA1 A;  2VHA A;  4PFW A;  2QS2 A;  3OO9 A;  3D4C A;  2Y84 A;  4DXB A;  1KWH A;  2Z8D A;  1B5J A;  4GL8 A;  4XKN A;  4G2Z A;  1LAG E;  4OZ9 A;  4OET A;  4ZZA A;  4F3S A;  1VSO A;  4KQP A;  2I4C A;  3U1O A;  4PFT A;  1JVY A;  2QJE A;  1NNF A;  5ICQ A;  1ZBM A;  1XS5 A;  1Y4C A;  3JZJ A;  1FQC A;  3QXM A;  3OSQ A;  2YJP A;  2DWA A;  2HQ0 A;  3H6U A;  5I2N B;  4ELQ A;  1SI1 A;  3MZB A;  1RKM A;  1I69 A;  4F3B A;  2WKY A;  1SW5 A;  2VD3 A;  3E3K A;  4P0I A;  3GBA A;  1P1Q A;  1PDA A;  3SEV A;  4ZEF A;  3HCQ A;  3OOA A;  4MF3 A;  2DE4 A;  5AA1 A;  2F6P A;  3N6U A;  5FHN A;  5DVF A;  3O6G A;  4O3B A;  4JXI A;  3PD8 A;  2ZMB A;  4DE8 A;  3USD A;  2KLF A;  4F1Y A;  3R6U A;  1VFD A;  4FEB A;  4FIM A;  4YMB A;  2D5W A;  5CMK A;  4DZ1 A;  1IXC A;  3L6H A;  3Q28 A;  3EF7 A;  1B40 A;  3KZG A;  4R73 A;  4U4X A;  4KR5 A;  1A55 A;  3N94 A;  3H03 A;  2FNC A;  5KDT A;  3LSL A;  4OEU A;  1NH7 A;  2AYS A;  4RJZ A;  4F1V A;  3T66 A;  5DT6 A;  2I4B A;  4GOT A;  3MC2 A;  2Q2C A;  3K6V A;  1MDP 1;  1PC3 A;  3IB0 A;  2O7U A;  2Y7I A;  3KOS A;  2QS4 A;  5A5X B;  3MVY A;  4OXV A;  1MXV A;  1XT8 A;  3N26 A;  4OER A;  2Y7K A;  3BBR A;  3EHS A;  4OEV A;  4PQJ A;  5DVJ A;  3FJ7 A;  1SW4 A;  4BDL A;  1DPP A;  3M3F A;  5F7V A;  1LFG A;  3O66 A;  1N0T A;  4OFO A;  3LSW A;  4OTE A;  4QSE A;  1OIB A;  3TTL A;  4G68 C;  4NF4 A;  3PMV A;  3M3L A;  2DSF A;  3KG2 A;  2V3T A;  3VXC A;  5H8F A;  2I0B A;  2LAO A;  3UIF A;  3F11 A;  2QS1 A;  1MM6 A;  3K1P A;  1LB8 A;  4X9T A;  3PMW A;  3K6U A;  3M8U A;  2IA4 A;  4R6K A;  4KYS A;  4LZ5 A;  1JW1 A;  4OHN A;  4GFR A;  4Q0C A;  4OEN A;  2ZYN A;  3RTF B;  3W9V A;  3C36 A;  5I2K A;  4EDP A;  3ILU B;  4FED A;  1P1O A;  1IIT A;  4EXK A;  1JEU A;  3M3K A;  3PD9 A;  1MQJ A;  4K3F A;  3VLW A;  3N5L A;  4QF9 A;  4RPO A;  3FIR A;  3K1N A;  4FE8 A;  5L9O A;  4OVJ A;  5FHM A;  3SEY A;  3SEW A;  3R7X A;  1XC1 A;  3PUY E;  1YTV A;  3MJN A;  3GLB A;  2DE2 A;  4ZEK A;  4Z7E A;  2NOO A;  1MY0 A;  2HEU A;  3RN8 A; 
#chains in the Genus database with same CATH topology
 1BK4 A;  1NH8 A;  2MKZ A;  3KJT A;  2I3V A;  4HW8 A;  1MPB A;  3K6X A;  3FAS A;  3DP4 A;  5I59 A;  4FEC A;  2F8D A;  5H8Q A;  2VPN A;  4H45 A;  5ITO A;  3TTK A;  1IMF A;  1IMC A;  4YKP A;  3FV2 A;  2CEX A;  3B8B A;  2HZK A;  1NNK A;  4ELR A;  3B7D A;  2XXW A;  4DIG A;  4LN5 A;  4P47 A;  1OLC A;  1FJ9 A;  1NUX A;  2CZI A;  1JP4 A;  3MQ9 A;  1SBP A;  4R72 A;  1MPD A;  3SET A;  2H9B A;  4ONY A;  3RPL A;  1A40 A;  1YCJ A;  2XX9 A;  2Z8F A;  5L9S A;  4OQO A;  1IMB A;  5KDT B;  2Q2A A;  4F29 A;  5ICT A;  1SI0 A;  2DYX A;  1NMU A;  3K00 A;  5IZ3 B;  4GWU A;  2UYF A;  2P1S A;  4WKM A;  4PP0 A;  4R2B A;  4G8M A;  5ET7 A;  4X8R A;  3KN7 A;  2OWS A;  3E13 X;  5CBS A;  1MS7 A;  5ESY A;  2KR0 A;  1IMD A;  1B3F A;  2ONR A;  1Z7M E;  1K9Y A;  2UVH A;  1OQH A;  4N6P A;  4ELO A;  2WX9 A;  3OEL A;  3I6V A;  3EKI A;  2ONK E;  4TOZ A;  4GQO A;  3TTM A;  2RKM A;  2VGQ A;  1MH3 A;  3LV0 A;  1PEB A;  3FAT A;  1MRP A;  1URD A;  2O1L A;  4NF4 B;  1MQD A;  4IO7 A;  2H4I A;  3CFL A;  3CVG A;  4IY6 A;  3SER A;  4ZED A;  2NUV A;  5H8F B;  3HST A;  1P1U A;  4IO6 A;  1MY2 A;  4RNS A;  4OYV A;  5K2X A;  1SD3 A;  3TQW A;  1USY E;  3HHF A;  2Q8J A;  2RF1 A;  1IXH A;  2O51 A;  4M4G A;  1B4H A;  1AIV A;  2HPG A;  4F22 A;  2I0C A;  4OWD A;  1FPI A;  3KBR A;  3ZKL A;  1N3X A;  4KCD A;  3HFU A;  3MZ1 A;  2UVG A;  1ATG A;  3JYR A;  3RGY A;  5I2K B;  4M1V A;  4OFL A;  3FXB A;  3V8X B;  4MJO A;  3U92 A;  2I48 A;  1A7L A;  2M8C A;  2O69 A;  3DP6 A;  4MMP A;  1UIV A;  3VDF A;  3CFZ A;  1MXU A;  1DTZ A;  1GR2 A;  1KA0 A;  2AL4 A;  1UTB A;  5K2Y A;  1NNT A;  5ET5 A;  3LUZ A;  2XXY A;  2PCR A;  5KZT A;  3A3C A;  4OES A;  4GWW A;  4NGU A;  2O1M A;  4MHF A;  1BKA A;  3QMF A;  5H8H A;  3VXB A;  4YU0 A;  2VT5 A;  1AH5 A;  2XD2 A;  1P1N A;  3U94 A;  3S9N C;  2Q88 A;  4GWS A;  4O3C A;  3O97 A;  5CI5 A;  1LB9 A;  4FBP A;  1RYX A;  1NUY A;  4GX3 A;  5I59 B;  3I5O A;  3S9E A;  4PDH A;  2G29 A;  4KFQ A;  4ZEB A;  1DMB A;  4MBP A;  1MXW A;  1LBC A;  4C1T A;  3CR9 A;  1DCU A;  1NNP A;  2F7B A;  3TDJ A;  4KCC A;  3RLF E;  3MPL A;  1Y4T A;  1F9B A;  4N6D A;  1LBW A;  3IAZ A;  3K6W A;  3A09 A;  4G4P A;  3Q25 A;  4GBV A;  1LLS A;  2GFE A;  1JVX A;  4ZZE A;  3KFM A;  3TEP A;  4NWC A;  3E9X A;  2PYY A;  3SES A;  3Q26 A;  4X1D A;  4N6K A;  5TU0 A;  1ELJ A;  4IO2 A;  3GZG A;  2DS9 A;  1Q35 A;  5AE4 A;  4LZ8 A;  3S9M C;  1GV8 A;  2DOJ A;  4ESW A;  2XXQ A;  1FRP A;  5EHS A;  4EQB A;  2F97 A;  1URS A;  5AA4 B;  4YB7 A;  1KZ8 A;  3PPR A;  2YPN A;  3T0J A;  3O29 A;  4XKP A;  4PFB A;  1JET A;  3UGW A;  1B7H A;  3LBS A;  1XHY A;  4DDD A;  4O94 A;  1Z7N E;  3HN0 A;  2OK2 A;  4ZDM A;  1FTL A;  1R9Q A;  3BKI B;  5EQA A;  4IO5 A;  4BDM A;  4GWX A;  4YKI A;  1IZ1 A;  4X48 A;  3TFL A;  1MDQ A;  4MNP A;  4AS4 A;  1B1H A;  4NHB A;  3VVD A;  1PB9 A;  4I1D A;  3SDF A;  2QMX A;  4NED A;  4P11 A;  4R9F A;  1BIY A;  3LUY A;  3IOV A;  4YKJ A;  1B46 A;  3TTN A;  2V93 A;  5DVI A;  2QMW A;  4YIC A;  1MPC A;  4PF8 A;  4U21 A;  2V4C A;  3PGF A;  1MXZ A;  4LA9 A;  1FPK A;  4NX1 A;  3L6G A;  5ELV A;  4U23 A;  1Q9D A;  2B3F A;  1AOV A;  2ESN A;  1NL5 A;  5IKB A;  3GYY A;  4F1U A;  2XXR A;  3TTR A;  3ZSF A;  1UTB B;  2OZZ A;  4NE4 A;  2G93 A;  5L9M A;  3IO4 A;  3DLN A;  1R1N A;  4XFE A;  1ZJL A;  4Z0I A;  5KCJ B;  2HAU A;  4MAG A;  3U72 A;  1GGG A;  1YZ0 A;  4RYA A;  2PFZ A;  2Y7W A;  2DWI A;  5H8H B;  3E4R A;  2FA7 A;  3SEU A;  5JTY A;  4PAI A;  5BUU A;  3S4U A;  3P7I A;  3RT8 A;  2HCA A;  3FV1 A;  2DE3 A;  4NQ8 A;  1UTH A;  5BWJ A;  3RQT A;  5LOM A;  2WYK A;  2GHB A;  4RY1 A;  3C9H A;  5H8N A;  1LAH E;  1IQ7 A;  5CMB A;  3QUJ A;  5I58 A;  3IB1 A;  4LQ5 A;  1Y3Q A;  3MP6 A;  4YB5 A;  3TZA A;  1B5H A;  5AA3 A;  5FHO A;  1SYI A;  2ZZX A;  1XI6 A;  5EYH A;  4R9G A;  3H3G A;  4GXA A;  1JW5 A;  1QUK A;  1XVX A;  2CZL A;  2THI A;  1D9Q A;  2QL3 A;  2I6E A;  1II5 A;  1NV7 A;  1NV5 A;  1T0K A;  2OBG A;  1BP5 A;  4MH5 A;  2D21 A;  1URG A;  1DSN A;  3ONM A;  2H98 A;  3G3K A;  2I58 A;  4FOR A;  2I49 A;  3T22 A;  2QVR A;  4XXU A;  1ZTY A;  4MIJ A;  2ZNT A;  3OD7 A;  1RDZ A;  4U4S A;  3LR1 A;  4XKQ A;  3MZ9 A;  5JK4 A;  3BFU A;  4HS7 A;  5EQ9 A;  5F24 A;  5HBC A;  2OLB A;  3O6H A;  3TCF A;  3VVF A;  1NKX A;  3U93 A;  3K1M A;  4EQ7 A;  4UAC A;  3TQL A;  3JV9 A;  4PFY A;  3UK4 A;  1LAX A;  1CE2 A;  1B0L A;  3KSX A;  3IO6 A;  2F3B A;  3TCG A;  3QSL A;  5CRY A;  3TKD A;  3RPW A;  2PX1 A;  3ZS6 A;  1MQH A;  1N76 A;  3HO7 A;  2QFL A;  2UXA A;  3CSB A;  4NMY A;  2CZK A;  1M5B A;  1A99 A;  1M5E A;  3FXU A;  5HPQ A;  1EYK A;  1INP A;  3K01 A;  2Q9T A;  2BJI A;  2XA5 A;  4GWY A;  4KHZ E;  2QVU A;  1FTO A;  1ZLQ A;  1AMF A;  3OSR A;  4IO4 A;  5I57 A;  2XX7 A;  3R26 A;  4HXV A;  1IXG A;  1FQD A;  1MH4 A;  1EZP A;  3MVW A;  5LTC A;  4JDF A;  5HM4 B;  1MY3 A;  2NVU B;  4PGP A;  3IK6 B;  2NXO A;  2V25 A;  3T9H B;  3G3H A;  4H8I A;  4NN3 A;  2Q74 A;  4FJP A;  1FBP A;  3DM0 A;  1M5D A;  3DEL B;  4BDN A;  4GWO A;  1QKA A;  4QBA A;  5AA2 A;  2HXR A;  1D4N A;  1OQG A;  3CG1 A;  1AL3 A;  3OO7 A;  1OLA A;  3MPK A;  4ZEC A;  1A54 A;  5J16 A;  1MY4 A;  4PTK A;  4AB5 A;  1KA1 A;  4N07 A;  3G3J A;  3D4G A;  4GD5 A;  5JTY B;  3T9X B;  1DK4 A;  4ND9 A;  1H45 A;  1VR5 A;  2V84 A;  1Y3P A;  1MXX A;  3C4M A;  4GIZ A;  1FPD A;  5IGA A;  2P2A A;  3FVK A;  1QKB A;  4I62 A;  4AB6 A;  1FPF A;  2QSX A;  4IB2 A;  4LAT A;  1UTH B;  4ZS9 A;  1PB7 A;  3OXN A;  4JWX A;  3S9L C;  3PPN A;  1R9L A;  1I6A A;  4N13 A;  3FZV A;  1LCT A;  4OVP A;  1QVS A;  1TWY A;  5H8N B;  4MFI A;  5I58 B;  3SZP A;  2GRV A;  1B4Z A;  1S9T A;  3UP9 A;  4YMA A;  3PV0 E;  3IOR A;  3B6W A;  4E0X A;  3C32 A;  3PUW E;  3HHG A;  2RCB A;  4QXD A;  2PMS A;  1B32 A;  2FIX A;  2F7C A;  1LCF A;  3MVX A;  3QAX A;  5EYG A;  4FAT A;  4DI3 D;  4JB7 A;  2REG A;  3E79 A;  1TFA A;  4PFU A;  2Q8M A;  4MEV A;  5TP9 A;  5ITP A;  1B05 A;  2PBW A;  4P1L A;  4G8N A;  3W15 C;  4QFP A;  3GXA A;  3T1B A;  3H06 B;  1QGX A;  3G3G A;  3FXR A;  2ZYM A;  2P3N A;  4QSC A;  1MG1 A;  1XOC A;  5M2V A;  1P99 A;  5DEX A;  4PE5 B;  1HSL A;  2AIX A;  5AA2 D;  3A3U A;  3QYT A;  4HE0 A;  2F34 A;  4PFR A;  1OVB A;  4H67 A;  1JEV A;  2DVZ A;  4OAN A;  2FBP A;  3S2V A;  3PPP A;  2V3Q A;  1D9Y A;  1B6H A;  1Q1K A;  3PUZ E;  1PBQ A;  3AXF A;  1FJ6 A;  2Y5K A;  2Z22 A;  1GTK A;  2PT2 A;  4ISU A;  1G0H A;  3B6T A;  4F3G A;  1R6Z A;  1N7W A;  3HV1 A;  1FBD A;  4ELP A;  4NG7 A;  1QUI A;  4WED A;  3VV5 A;  1NV2 A;  2A5S A;  5FBP A;  1LBX A;  5CM6 A;  3ZKK A;  4TLM B;  3V5A A;  2XWO A;  4NF8 A;  1SDX A;  4H1X A;  1RYO A;  2H5Y A;  3V89 B;  5I3S A;  1QJM A;  5FTI A;  3O6I A;  3QUF A;  1N7X A;  3QIM A;  1USY H;  3U8Q A;  2B3B A;  5H8Q B;  3OEK A;  4POW A;  3THI A;  2ZYO A;  2F3D A;  3T96 B;  1LGB C;  3CG3 A;  4OMB A;  3RUM A;  1MY1 A;  2GH9 A;  3IOT A;  1Y3N A;  5I5P A;  4ESX A;  4MLQ A;  3C33 A;  1LST A;  1SW2 A;  1PB8 A;  4F39 A;  3VFJ A;  4L17 A;  3H7M A;  4H65 A;  3RPL B;  4OVS A;  4ZEI A;  4KXP A;  4EXL A;  2XWI A;  1SPI A;  3FJG A;  3PPQ A;  3PUX E;  2VPO A;  3CIJ A;  2V3U A;  4P56 A;  1LFH A;  1LFI A;  1IEJ A;  1QUJ A;  1LBZ A;  3IX1 A;  1FPB A;  1B3H A;  3PMX A;  1H43 A;  2FYI A;  4YKK A;  1US5 A;  1DTG A;  1FPJ A;  1FQF A;  4U2R A;  4UA8 A;  2R6G E;  5IAI A;  1JW4 A;  1TFD A;  2OCU A;  1ZKB A;  1EYJ A;  2YLN A;  4FAJ A;  3I3V A;  2DVC A;  4U1O A;  4Q8R A;  3MBP A;  2VD2 A;  3SEX A;  2A5T A;  2REJ A;  3UN6 A;  1K9Z A;  1UIU A;  4G68 A;  3G3I A;  4R6Y A;  1B51 A;  4OVR A;  1LAF E;  3KEI A;  2VOZ A;  3H6W A;  4LZ7 A;  4PF6 A;  1PBP A;  4BDR A;  1N3W A;  3KN3 A;  4RK9 A;  3FVN A;  4N8Y A;  1DOT A;  1FQE A;  4IO3 A;  2O6A A;  2ZNU A;  2Q89 A;  1NFT A;  4RK2 A;  3KC0 A;  1EH3 A;  1POT A;  1HSJ A;  2RC9 A;  4MX6 A;  2WEF A;  4HCY A;  3MW0 A;  3KOT A;  1I6B A;  4BLA A;  4QFN A;  2UYE A;  1B0H A;  5TP9 B;  4UAB A;  3IJX B;  2HFB A;  1B7U A;  2ALU A;  3VVE A;  4ECF A;  1B1X A;  1FBG A;  1POY 1;  2QS3 A;  5DEX B;  2RC7 A;  5IZ1 A;  4U22 A;  2DP8 A;  3Q29 A;  4Q5T A;  3LC8 A;  4F2O A;  3PUV E;  1IIW A;  1J1N A;  4F2Q A;  1I6Q A;  2HZL A;  1A8F A;  3KBZ A;  4I3Y A;  1MQG A;  1L5T A;  2WBB A;  1HSE A;  4R2F A;  1IME A;  3T93 B;  3SKP A;  1B58 A;  4LQ2 A;  4H6D A;  3KSJ A;  1FTJ A;  1LBV A;  4X04 A;  4H5F A;  2H99 A;  3IOW A;  1YXI A;  4NF8 B;  1BTJ A;  3FVO A;  4GX4 A;  4NWD A;  2RIN A;  4KPT A;  1NV3 A;  3O28 A;  5ET8 A;  3ISP A;  2D3I A;  1VFE A;  3K02 A;  4HTG A;  3U65 A;  2ZXT A;  2CMO A;  2WYP A;  2Z8E A;  4EF2 A;  1B3L A;  4O3A A;  3IL1 B;  3W9W A;  2OJT A;  3VE1 B;  1ZU0 A;  2XXX A;  4IGR A;  1RDX A;  1FQB A;  5A5L A;  3G7W A;  5TPA A;  4JBZ A;  3VLU A;  2OWT A;  3CI8 A;  2UVJ A;  4QSD A;  1O63 A;  4DCY A;  2P3V A;  4P8B A;  3EHT A;  4GXS B;  3E78 A;  1FBH A;  2FIE A;  4YAH X;  2RC8 A;  3EPE A;  2XHD A;  3MP8 A;  1MQI A;  2E0S A;  4G8H A;  2Y7P A;  3ILT B;  4LVQ A;  1BLF A;  3CRB A;  1YAE A;  3RT6 B;  3BFT A;  4F3P A;  1MM7 A;  4RXL A;  4PGN A;  3DP8 A;  1M5F A;  2AL5 A;  1FPE A;  1WOD A;  3FD3 A;  4N15 A;  4EUO A;  4HE2 A;  3RN8 A;  2R9J A;  2O7I A;  2O68 A;  3FBP A;  1B9J A;  3IFA A;  3V83 A;  5I56 A;  4PAF A;  2A5T B;  1LBB A;  5EQ7 A;  4G68 B;  2P0S A;  1N84 A;  2DWJ A;  4WEP A;  4WXJ A;  1B3G A;  3H6V A;  1FTA A;  3CHG A;  1YPN A;  1M5C A;  3IR1 A;  2F78 A;  1WDN A;  3HPI A;  4JVI A;  1Y9U A;  1H76 A;  3IOU A;  1SYH A;  1S7Y A;  4P0G A;  1ZMG A;  3WAE A;  3FGS A;  4JSO A;  4QFL A;  1NUZ A;  4I8C A;  3T9V A;  4GBW A;  3B50 A;  5CMC A;  4XIG Q;  1EU8 A;  3LSF B;  4JSD A;  3EHU A;  1WVJ A;  3UOR A;  4HCW A;  1D9V A;  1TXF A;  3FUZ A;  2XXT A;  4NF5 A;  3ECR A;  4KI0 E;  3OO8 A;  5EHM A;  5IM2 A;  1O7T A;  2Y7R A;  2QVV A;  2H25 A;  5T3J A;  2W7Y A;  3FXQ A;  4O7M A;  2FHY A;  4KYE A;  4O8M A;  3ODB A;  4P3L A;  3EN3 A;  2L5V A;  4LP2 B;  4BDQ A;  4GL0 A;  1O64 A;  4PFI A;  5IZZ A;  4I9D A;  3C31 A;  1XVY A;  5FTH A;  1ZIU A;  2VP1 A;  3T9U A;  5ISU A;  1S50 A;  2XX8 A;  3VLV A;  3N6T A;  4LUB A;  3MVZ A;  4BDO A;  2F7A A;  3BIG A;  2I3W A;  4DLD A;  4YZZ A;  1DPE A;  4QFK A;  4F18 A;  3RY3 A;  4QHQ A;  1B5I A;  5B70 A;  2HAV A;  3OEN A;  4O7I A;  4G61 A;  3IJO B;  4PBH A;  3RTW B;  3PU5 A;  5DW8 A;  4MNC A;  1Y20 A;  3H6T A;  3O2A A;  1NV6 A;  4DXC A;  2XXU A;  4U1Z A;  5CBR A;  5DYH A;  3Q27 A;  3RNN A;  1FCK A;  2ZYK A;  3MUQ A;  4PCD A;  1CB6 A;  1QUL A;  4E0W A;  4IY5 A;  5L8D A;  4DCX A;  1IMA A;  2DWH A;  3C34 A;  2DQV A;  4N81 A;  4OFJ A;  4NF6 A;  1OMP A;  3KN8 A;  1TT1 A;  4R74 A;  2XXP A;  2WBD A;  4RPN A;  2ANJ A;  4GVO A;  3EQ1 A;  1FTM A;  2QPQ A;  1MXY A;  2F35 A;  4GWZ A;  5TPA B;  3MWB A;  5AA4 A;  4GRK A;  1H44 A;  5ET6 A;  2BJJ X;  3CSG A;  2F36 A;  5LDZ A;  4GF8 A;  1SQY A;  4XTC Q;  2B65 A;  3WAF A;  1Y1Z A;  4XKR A;  4H5G A;  1UQW A;  1Y1M A;  4H8J A;  4H0W A;  3K0V A;  3QK6 A;  4KYD A;  4C1U A;  2O84 X;  1EYI A;  1FSA A;  3UA8 A;  4GX6 A;  3GBB A;  4PDD A;  4ZE9 A;  1A8E A;  3MAM A;  4DXU A;  4H46 A;  3TMG A;  3TEL A;  4ZE8 A;  2PVU A;  4MLV A;  4THI A;  3H4Z A;  1RDY A;  1GVC A;  4EQ9 A;  3TAJ A;  2DDK A;  5I2N A;  1B3E A;  5I56 B;  1LBY A;  4R75 A;  3OO6 A;  2X26 A;  4AS5 A;  2F5X A;  1SVX B;  1FW0 A;  3RYD A;  4C0R A;  3TPA A;  5I84 A;  1IUD A;  4MCO A;  1D3K A;  4POX A;  5H8S A;  1H3D A;  1JNF A;  4PET A;  2PT1 A;  3TOD A;  3OMB A;  5J1D A;  3MP1 A;  2GHA A;  2KQZ A;  2HXW A;  2XXI A;  3CFX A;  2R8T A;  3G3F A;  3BIH A;  4NF5 B;  1EZ9 A;  1SW1 A;  1B52 A;  1FBC A;  4F31 B;  5CC2 A;  4AQ4 A;  4Q30 B;  4OVQ A;  3K2D A;  2DXY A;  1FTK A;  5KCJ A;  5I57 B;  3LSX A;  2ZNS A;  1VDW A;  4KD5 A;  2X7P A;  2XD3 A;  2IEE A;  4QFO A;  2ABH A;  2DXR A;  2R71 A;  5A5X A;  1FBF A;  3TCH A;  2RCA A;  2X7Q A;  1B2H A;  5F1Q A;  1JQF A;  1VE4 A;  4PBQ A;  5CMM A;  4JWO A;  2Z23 A;  5AA2 B;  4N8G A;  2ZZV A;  3TYH A;  1DBZ A;  1IXI A;  1US4 A;  5I7I A;  2F6G A;  4JVC A;  1EZO A;  3FJM A;  4XF5 A;  4F19 A;  1ANF A;  4PE3 A;  2E1S A;  3IFC A;  1P1W A;  1B7Z A;  1QW0 A;  3B6Q A;  4G77 A;  4LON B;  4TQU Q;  3C35 A;  2NWJ A;  2ONS A;  4IGT A;  3O9P A;  4X1B A;  4JWY A;  3TUS A;  1N04 A;  1YYZ A;  2PFY A;  3OEM A;  4EF1 A;  4P1E A;  3K4U A;  4MNI A;  3KGC A;  4NF6 B;  4R6H A;  3PPO A;  3IB2 A;  1FQA A;  2UVI A;  2XXH A;  3KJ7 A;  3FVG A;  5DTB A;  4TLL B;  1FPL A;  5JEI A;  5B7D A;  4NTL A;  5EYF A;  1NV0 A;  4GLI A;  1OVT A;  2XXV A;  4YB6 A;  4QRZ A;  3MYU A;  2QRY A;  4RA1 A;  2VHA A;  4PFW A;  3A29 A;  2QS2 A;  3OO9 A;  3D4C A;  2Y84 A;  4DXB A;  1KWH A;  1NUW A;  2Z8D A;  4PAK A;  1B5J A;  4GL8 A;  4XKN A;  4G2Z A;  2GQ1 A;  1LAG E;  4OZ9 A;  4OET A;  4ZZA A;  4F3S A;  1VSO A;  4KQP A;  2I4C A;  3KC1 A;  2CZH A;  3ROJ A;  3U1O A;  4PFT A;  1JVY A;  2QJE A;  1G0I A;  1NNF A;  5ICQ A;  1FBE A;  1ZBM A;  1XS5 A;  2B4M A;  1Y4C A;  3JZJ A;  1FQC A;  3QXM A;  3OSQ A;  2YJP A;  2DWA A;  2HQ0 A;  3H6U A;  5I2N B;  4ELQ A;  1SI1 A;  3MZB A;  1RKM A;  1I69 A;  4F3B A;  2WKY A;  1SW5 A;  2VD3 A;  3E3K A;  4P0I A;  3GBA A;  1P1Q A;  1PDA A;  3SEV A;  1FPG A;  4ZEF A;  4HE1 A;  3HCQ A;  3OOA A;  4MF3 A;  2DE4 A;  5AA1 A;  2F6P A;  3N6U A;  5FHN A;  5DVF A;  2ZZW A;  3O6G A;  2HHM A;  4O3B A;  4JXI A;  3PD8 A;  2ZMB A;  4DE8 A;  1AWB A;  3USD A;  2KLF A;  4F1Y A;  4OA4 A;  2XXK A;  4N4U A;  3R6U A;  1VFD A;  4FEB A;  4FIM A;  5EQ8 A;  4PC9 A;  4YMB A;  2Y5L A;  2D5W A;  5CMK A;  4DZ1 A;  1IXC A;  3L6H A;  3Q28 A;  4I40 A;  3EF7 A;  1B40 A;  3KZG A;  4R73 A;  4U4X A;  1A55 A;  3N94 A;  3H03 A;  2FNC A;  5KDT A;  3LSL A;  4OEU A;  1NH7 A;  2AYS A;  4RJZ A;  4F1V A;  3T66 A;  5DT6 A;  2I4B A;  4GOT A;  3MC2 A;  2Q2C A;  3K6V A;  1MDP 1;  5IZ3 A;  1PC3 A;  3IB0 A;  2O7U A;  4NAP A;  4IR8 A;  2Y7I A;  3KOS A;  2QS4 A;  4OVT A;  5A5X B;  3MVY A;  4OXV A;  1MXV A;  1XT8 A;  3N26 A;  2CEY A;  4OER A;  2Y7K A;  3BBR A;  1NV1 A;  2XWK A;  3EHS A;  2XWV A;  4OEV A;  4PQJ A;  5DVJ A;  3FJ7 A;  2OWZ A;  1SW4 A;  4P9K A;  4BDL A;  1DPP A;  3M3F A;  5F7V A;  3PTY A;  1LFG A;  3O66 A;  1N0T A;  4OFO A;  3LSW A;  4OTE A;  3MST A;  4QSE A;  1OIB A;  1LEV A;  3TTL A;  4G68 C;  4NF4 A;  3PMV A;  1CNQ A;  3M3L A;  2DSF A;  3KG2 A;  2V3T A;  4N17 A;  3VXC A;  5H8F A;  4XEQ A;  2I0B A;  2LAO A;  4JVD A;  3UIF A;  3F11 A;  2QS1 A;  1NV4 A;  1MM6 A;  3NOH A;  3K1P A;  1LB8 A;  4X9T A;  3PMW A;  3K6U A;  2B4L A;  3M8U A;  2IA4 A;  4R6K A;  4KYS A;  4LZ5 A;  1JW1 A;  4N91 A;  4OHN A;  4GFR A;  4Q0C A;  4OEN A;  2ZYN A;  3RTF B;  3W9V A;  3C36 A;  5I2K A;  4EDP A;  2FVZ A;  3ILU B;  4DI4 B;  4FED A;  3D1R A;  1P1O A;  4NF0 A;  1IIT A;  4EXK A;  1JEU A;  3M3K A;  4I3E A;  3PD9 A;  1MQJ A;  4K3F A;  3VLW A;  3N5L A;  2OX3 A;  4QF9 A;  4RPO A;  3FIR A;  3K1N A;  4FE8 A;  5L9O A;  4OVJ A;  5FHM A;  3SEY A;  3SEW A;  3R7X A;  1XC1 A;  2JJK A;  3PUY E;  1YTV A;  3MJN A;  3GLB A;  2DE2 A;  4ZEK A;  4Z7E A;  2NOO A;  1MY0 A;  2HEU A;  1NI9 A;  4KR5 A; 
#chains in the Genus database with same CATH homology
 1NH8 A;  3KJT A;  2I3V A;  4HW8 A;  1MPB A;  3K6X A;  3FAS A;  3DP4 A;  5I59 A;  4FEC A;  2F8D A;  5H8Q A;  5ITO A;  3TTK A;  4YKP A;  3FV2 A;  2HZK A;  1NNK A;  4ELR A;  3B7D A;  2XXW A;  4DIG A;  1OLC A;  3MQ9 A;  1SBP A;  4R72 A;  1MPD A;  3SET A;  2H9B A;  4ONY A;  1A40 A;  1YCJ A;  2XX9 A;  2Z8F A;  5L9S A;  4OQO A;  5KDT B;  2Q2A A;  4F29 A;  5ICT A;  1SI0 A;  2DYX A;  1NMU A;  3K00 A;  2UYF A;  2P1S A;  4WKM A;  4PP0 A;  4R2B A;  4G8M A;  3KN7 A;  2OWS A;  3E13 X;  5CBS A;  1MS7 A;  1B3F A;  2ONR A;  1Z7M E;  2UVH A;  1OQH A;  4N6P A;  4ELO A;  3OEL A;  3I6V A;  2ONK E;  4TOZ A;  4GQO A;  3TTM A;  2RKM A;  2VGQ A;  1MH3 A;  1PEB A;  3FAT A;  1URD A;  1MRP A;  2O1L A;  4NF4 B;  1MQD A;  4IO7 A;  2H4I A;  3CFL A;  3CVG A;  4IY6 A;  4ZED A;  3SER A;  2NUV A;  5H8F B;  3HST A;  1P1U A;  4IO6 A;  1MY2 A;  4RNS A;  4OYV A;  5K2X A;  1SD3 A;  3TQW A;  1USY E;  3HHF A;  2Q8J A;  2RF1 A;  1IXH A;  2O51 A;  4M4G A;  1B4H A;  1AIV A;  4F22 A;  2I0C A;  4OWD A;  3KBR A;  3ZKL A;  1N3X A;  4KCD A;  3MZ1 A;  2UVG A;  1ATG A;  3JYR A;  3RGY A;  5I2K B;  4M1V A;  4OFL A;  3V8X B;  3U92 A;  2I48 A;  1A7L A;  2M8C A;  2O69 A;  3DP6 A;  1UIV A;  3VDF A;  3CFZ A;  1MXU A;  1DTZ A;  1GR2 A;  2AL4 A;  1UTB A;  5K2Y A;  1NNT A;  2XXY A;  5KZT A;  3A3C A;  4OES A;  2O1M A;  1BKA A;  5H8H A;  3VXB A;  4YU0 A;  1AH5 A;  2XD2 A;  1P1N A;  3U94 A;  3S9N C;  2Q88 A;  4O3C A;  3O97 A;  5CI5 A;  1LB9 A;  1RYX A;  5I59 B;  3I5O A;  3S9E A;  2G29 A;  4KFQ A;  4ZEB A;  1DMB A;  4MBP A;  1MXW A;  1LBC A;  4C1T A;  3CR9 A;  1NNP A;  2F7B A;  3TDJ A;  4KCC A;  3RLF E;  3MPL A;  1Y4T A;  1F9B A;  3IAZ A;  3K6W A;  3A09 A;  4G4P A;  3Q25 A;  1LLS A;  2GFE A;  1JVX A;  4ZZE A;  3KFM A;  3TEP A;  4NWC A;  3E9X A;  2PYY A;  3SES A;  3Q26 A;  4X1D A;  5TU0 A;  1ELJ A;  4IO2 A;  3GZG A;  2DS9 A;  1Q35 A;  5AE4 A;  4LZ8 A;  3S9M C;  1GV8 A;  2DOJ A;  4ESW A;  2XXQ A;  5EHS A;  4EQB A;  2F97 A;  1URS A;  5AA4 B;  4YB7 A;  3PPR A;  2YPN A;  3O29 A;  4XKP A;  1JET A;  3UGW A;  1B7H A;  3LBS A;  1XHY A;  4DDD A;  1Z7N E;  3HN0 A;  2OK2 A;  4ZDM A;  1FTL A;  1R9Q A;  3BKI B;  4IO5 A;  4BDM A;  4YKI A;  1IZ1 A;  4X48 A;  3TFL A;  1MDQ A;  1B1H A;  3VVD A;  1PB9 A;  4I1D A;  3SDF A;  2QMX A;  4NED A;  4P11 A;  4R9F A;  1BIY A;  3LUY A;  3IOV A;  4YKJ A;  1B46 A;  3TTN A;  2V93 A;  5DVI A;  2QMW A;  4YIC A;  1MPC A;  4U21 A;  3PGF A;  1MXZ A;  4LA9 A;  3L6G A;  5ELV A;  4U23 A;  2B3F A;  1AOV A;  2ESN A;  1NL5 A;  5IKB A;  4F1U A;  2XXR A;  3TTR A;  3ZSF A;  1UTB B;  2OZZ A;  4NE4 A;  2G93 A;  5L9M A;  3IO4 A;  3DLN A;  1R1N A;  1ZJL A;  4Z0I A;  5KCJ B;  2HAU A;  3U72 A;  1GGG A;  4RYA A;  2Y7W A;  2DWI A;  5H8H B;  3E4R A;  2FA7 A;  3SEU A;  5JTY A;  5BUU A;  3S4U A;  3P7I A;  3RT8 A;  2HCA A;  3FV1 A;  2DE3 A;  1UTH A;  5BWJ A;  3RQT A;  5LOM A;  2GHB A;  4RY1 A;  3C9H A;  5H8N A;  1LAH E;  1IQ7 A;  5CMB A;  3QUJ A;  5I58 A;  3IB1 A;  4LQ5 A;  1Y3Q A;  3MP6 A;  4YB5 A;  3TZA A;  1B5H A;  5AA3 A;  5FHO A;  1SYI A;  4R9G A;  3H3G A;  4GXA A;  1JW5 A;  1QUK A;  1XVX A;  2CZL A;  2THI A;  2QL3 A;  2I6E A;  1II5 A;  1T0K A;  2OBG A;  1BP5 A;  4MH5 A;  2D21 A;  1URG A;  1DSN A;  3ONM A;  2H98 A;  3G3K A;  2I58 A;  4FOR A;  2I49 A;  3T22 A;  4XXU A;  1ZTY A;  2ZNT A;  3OD7 A;  4U4S A;  3LR1 A;  4XKQ A;  3MZ9 A;  5JK4 A;  3BFU A;  4HS7 A;  5HBC A;  2OLB A;  3O6H A;  3TCF A;  3VVF A;  1NKX A;  3U93 A;  3K1M A;  4EQ7 A;  4UAC A;  3TQL A;  3JV9 A;  4PFY A;  3UK4 A;  1LAX A;  1CE2 A;  1B0L A;  3KSX A;  3IO6 A;  3TCG A;  3QSL A;  5CRY A;  3TKD A;  3RPW A;  2PX1 A;  3ZS6 A;  1MQH A;  1N76 A;  3HO7 A;  2UXA A;  3CSB A;  4NMY A;  1M5B A;  1A99 A;  1M5E A;  3FXU A;  5HPQ A;  3K01 A;  2Q9T A;  4KHZ E;  1FTO A;  1ZLQ A;  1AMF A;  3OSR A;  4IO4 A;  5I57 A;  2XX7 A;  3R26 A;  1IXG A;  1FQD A;  1MH4 A;  1EZP A;  3MVW A;  4JDF A;  5HM4 B;  1MY3 A;  2NVU B;  3IK6 B;  2NXO A;  2V25 A;  3T9H B;  3G3H A;  4H8I A;  4FJP A;  3DM0 A;  1M5D A;  3DEL B;  4BDN A;  4GWO A;  1QKA A;  5AA2 A;  1D4N A;  1OQG A;  3CG1 A;  1AL3 A;  3OO7 A;  1OLA A;  3MPK A;  4ZEC A;  1A54 A;  1MY4 A;  4AB5 A;  4N07 A;  3G3J A;  3D4G A;  4GD5 A;  5JTY B;  3T9X B;  4ND9 A;  1H45 A;  1VR5 A;  2V84 A;  1Y3P A;  1MXX A;  3C4M A;  4GIZ A;  2P2A A;  3FVK A;  1QKB A;  4I62 A;  4AB6 A;  2QSX A;  4IB2 A;  4LAT A;  1UTH B;  4ZS9 A;  1PB7 A;  3OXN A;  4JWX A;  3S9L C;  3PPN A;  1R9L A;  1I6A A;  4N13 A;  3FZV A;  1LCT A;  1QVS A;  1TWY A;  5H8N B;  4MFI A;  5I58 B;  2GRV A;  1B4Z A;  1S9T A;  3UP9 A;  4YMA A;  3PV0 E;  3IOR A;  3B6W A;  4E0X A;  3C32 A;  3PUW E;  3HHG A;  2RCB A;  2PMS A;  1B32 A;  2F7C A;  1LCF A;  3MVX A;  3QAX A;  4FAT A;  4JB7 A;  2REG A;  1TFA A;  4PFU A;  5TP9 A;  5ITP A;  1B05 A;  2PBW A;  4G8N A;  3W15 C;  4QFP A;  3GXA A;  3H06 B;  3G3G A;  3FXR A;  2ZYM A;  4QSC A;  1MG1 A;  1XOC A;  5M2V A;  1P99 A;  5DEX A;  4PE5 B;  1HSL A;  2AIX A;  5AA2 D;  3A3U A;  3QYT A;  2F34 A;  1OVB A;  4H67 A;  1JEV A;  2DVZ A;  3S2V A;  3PPP A;  2V3Q A;  1D9Y A;  1B6H A;  1Q1K A;  3PUZ E;  1PBQ A;  3AXF A;  2Z22 A;  1GTK A;  2PT2 A;  4ISU A;  3B6T A;  4F3G A;  1R6Z A;  1N7W A;  3HV1 A;  4ELP A;  1QUI A;  4WED A;  3VV5 A;  2A5S A;  5CM6 A;  3ZKK A;  4TLM B;  3V5A A;  4NF8 A;  1SDX A;  4H1X A;  1RYO A;  2H5Y A;  3V89 B;  1QJM A;  5FTI A;  3O6I A;  3QUF A;  1N7X A;  3QIM A;  1USY H;  3U8Q A;  2B3B A;  5H8Q B;  3OEK A;  4POW A;  3THI A;  2ZYO A;  3T96 B;  1LGB C;  3CG3 A;  4OMB A;  3RUM A;  1MY1 A;  2GH9 A;  3IOT A;  1Y3N A;  4ESX A;  4MLQ A;  3C33 A;  1LST A;  1SW2 A;  1PB8 A;  4F39 A;  3VFJ A;  4L17 A;  3H7M A;  4H65 A;  4ZEI A;  4EXL A;  3FJG A;  3PPQ A;  3PUX E;  3CIJ A;  2V3U A;  1LFH A;  1LFI A;  1IEJ A;  1QUJ A;  3IX1 A;  1B3H A;  3PMX A;  1H43 A;  2FYI A;  4YKK A;  1US5 A;  1DTG A;  1FQF A;  4U2R A;  4UA8 A;  2R6G E;  5IAI A;  1JW4 A;  1TFD A;  2OCU A;  1ZKB A;  2YLN A;  4FAJ A;  3I3V A;  2DVC A;  4U1O A;  4Q8R A;  3MBP A;  2VD2 A;  3SEX A;  2A5T A;  2REJ A;  3UN6 A;  1UIU A;  4G68 A;  3G3I A;  4R6Y A;  1B51 A;  1LAF E;  3KEI A;  2VOZ A;  3H6W A;  4LZ7 A;  1PBP A;  4BDR A;  1N3W A;  3KN3 A;  4RK9 A;  3FVN A;  1DOT A;  1FQE A;  4IO3 A;  2O6A A;  2Q89 A;  2ZNU A;  1NFT A;  4RK2 A;  1EH3 A;  1POT A;  1HSJ A;  2RC9 A;  4HCY A;  3MW0 A;  3KOT A;  1I6B A;  4BLA A;  4QFN A;  2UYE A;  1B0H A;  5TP9 B;  3IJX B;  2HFB A;  1B7U A;  2ALU A;  3VVE A;  4ECF A;  1B1X A;  1POY 1;  2QS3 A;  5DEX B;  2RC7 A;  4U22 A;  2DP8 A;  3Q29 A;  4Q5T A;  3LC8 A;  4F2O A;  3PUV E;  1IIW A;  1J1N A;  4F2Q A;  1I6Q A;  2HZL A;  1A8F A;  1L5T A;  1MQG A;  1HSE A;  4R2F A;  3T93 B;  3SKP A;  1B58 A;  4LQ2 A;  4H6D A;  3KSJ A;  1FTJ A;  4H5F A;  2H99 A;  3IOW A;  4NF8 B;  1BTJ A;  3FVO A;  4NWD A;  2RIN A;  4KPT A;  3O28 A;  2D3I A;  1VFE A;  3K02 A;  4HTG A;  2ZXT A;  2CMO A;  2Z8E A;  4EF2 A;  1B3L A;  4O3A A;  3IL1 B;  3W9W A;  2OJT A;  3VE1 B;  1ZU0 A;  2XXX A;  4IGR A;  1FQB A;  3G7W A;  5TPA A;  4JBZ A;  3VLU A;  2OWT A;  3CI8 A;  2UVJ A;  4QSD A;  1O63 A;  4DCY A;  3EHT A;  4GXS B;  4YAH X;  2RC8 A;  3EPE A;  2XHD A;  3MP8 A;  1MQI A;  2E0S A;  4G8H A;  2Y7P A;  3ILT B;  1BLF A;  4LVQ A;  3CRB A;  1YAE A;  3RT6 B;  3BFT A;  4F3P A;  1MM7 A;  4RXL A;  3DP8 A;  1M5F A;  2AL5 A;  1WOD A;  3FD3 A;  4EUO A;  2R9J A;  2O7I A;  2O68 A;  1B9J A;  3V83 A;  5I56 A;  2A5T B;  1LBB A;  4G68 B;  2P0S A;  1N84 A;  2DWJ A;  4WEP A;  4WXJ A;  1B3G A;  3H6V A;  1YPN A;  1M5C A;  3IR1 A;  2F78 A;  1WDN A;  3HPI A;  1Y9U A;  1H76 A;  3IOU A;  1SYH A;  1S7Y A;  4P0G A;  1ZMG A;  3WAE A;  3FGS A;  4JSO A;  4QFL A;  4I8C A;  3T9V A;  5CMC A;  4XIG Q;  1EU8 A;  3LSF B;  4JSD A;  3EHU A;  1WVJ A;  3UOR A;  4HCW A;  1D9V A;  1TXF A;  3FUZ A;  2XXT A;  4NF5 A;  3ECR A;  4KI0 E;  3OO8 A;  5EHM A;  1O7T A;  2Y7R A;  2H25 A;  2W7Y A;  3FXQ A;  4KYE A;  3ODB A;  3EN3 A;  4LP2 B;  4BDQ A;  4GL0 A;  1O64 A;  4I9D A;  3C31 A;  1XVY A;  5FTH A;  1ZIU A;  2VP1 A;  3T9U A;  5ISU A;  1S50 A;  2XX8 A;  3VLV A;  3N6T A;  4LUB A;  3MVZ A;  4BDO A;  2F7A A;  2I3W A;  4DLD A;  4YZZ A;  1DPE A;  4QFK A;  4F18 A;  3RY3 A;  4QHQ A;  1B5I A;  5B70 A;  2HAV A;  3OEN A;  3IJO B;  3RTW B;  3PU5 A;  1Y20 A;  3H6T A;  3O2A A;  4DXC A;  2XXU A;  4U1Z A;  5CBR A;  5DYH A;  3Q27 A;  3RNN A;  1FCK A;  2ZYK A;  3MUQ A;  1CB6 A;  1QUL A;  4E0W A;  4IY5 A;  5L8D A;  4DCX A;  2DWH A;  3C34 A;  2DQV A;  4OFJ A;  4NF6 A;  1OMP A;  3KN8 A;  1TT1 A;  4R74 A;  2XXP A;  4RPN A;  2ANJ A;  4GVO A;  3EQ1 A;  1FTM A;  2QPQ A;  1MXY A;  2F35 A;  5TPA B;  3MWB A;  5AA4 A;  4GRK A;  1H44 A;  2BJJ X;  3CSG A;  2F36 A;  4GF8 A;  1SQY A;  4XTC Q;  2B65 A;  3WAF A;  1Y1Z A;  4XKR A;  4H5G A;  1UQW A;  1Y1M A;  4H8J A;  4H0W A;  3K0V A;  3QK6 A;  4KYD A;  4C1U A;  2O84 X;  3UA8 A;  3GBB A;  4ZE9 A;  1A8E A;  3MAM A;  4DXU A;  3TMG A;  3TEL A;  4ZE8 A;  2PVU A;  4MLV A;  4THI A;  3H4Z A;  1GVC A;  4EQ9 A;  3TAJ A;  5I2N A;  1B3E A;  5I56 B;  4R75 A;  3OO6 A;  2X26 A;  2F5X A;  1SVX B;  1FW0 A;  4C0R A;  3TPA A;  5I84 A;  1IUD A;  1D3K A;  4POX A;  5H8S A;  1H3D A;  1JNF A;  4PET A;  2PT1 A;  3TOD A;  3OMB A;  5J1D A;  3MP1 A;  2GHA A;  2HXW A;  2XXI A;  3CFX A;  3G3F A;  4NF5 B;  1EZ9 A;  1SW1 A;  1B52 A;  4F31 B;  5CC2 A;  4AQ4 A;  4Q30 B;  3K2D A;  2DXY A;  1FTK A;  5KCJ A;  5I57 B;  3LSX A;  2ZNS A;  4KD5 A;  2X7P A;  2XD3 A;  2IEE A;  4QFO A;  2ABH A;  2DXR A;  2R71 A;  5A5X A;  3TCH A;  2RCA A;  2X7Q A;  1B2H A;  5F1Q A;  1JQF A;  1VE4 A;  5CMM A;  4JWO A;  2Z23 A;  5AA2 B;  3TYH A;  1IXI A;  1US4 A;  2F6G A;  1EZO A;  3FJM A;  4F19 A;  1ANF A;  2E1S A;  1P1W A;  1B7Z A;  1QW0 A;  3B6Q A;  4G77 A;  4LON B;  4TQU Q;  3C35 A;  2NWJ A;  2ONS A;  4IGT A;  3O9P A;  4X1B A;  4JWY A;  3TUS A;  1N04 A;  3OEM A;  4EF1 A;  3K4U A;  3KGC A;  4NF6 B;  4R6H A;  3PPO A;  3IB2 A;  1FQA A;  2UVI A;  2XXH A;  3KJ7 A;  3FVG A;  5DTB A;  4TLL B;  5JEI A;  5B7D A;  4NTL A;  5EYF A;  4GLI A;  1OVT A;  2XXV A;  4YB6 A;  4QRZ A;  2QRY A;  4RA1 A;  2VHA A;  4PFW A;  2QS2 A;  3OO9 A;  3D4C A;  2Y84 A;  4DXB A;  1KWH A;  2Z8D A;  1B5J A;  4GL8 A;  4XKN A;  4G2Z A;  1LAG E;  4OZ9 A;  4OET A;  4ZZA A;  4F3S A;  1VSO A;  4KQP A;  2I4C A;  3U1O A;  4PFT A;  1JVY A;  2QJE A;  1NNF A;  5ICQ A;  1ZBM A;  1XS5 A;  1Y4C A;  3JZJ A;  1FQC A;  3QXM A;  3OSQ A;  2YJP A;  2DWA A;  2HQ0 A;  3H6U A;  5I2N B;  4ELQ A;  1SI1 A;  3MZB A;  1RKM A;  1I69 A;  4F3B A;  2WKY A;  1SW5 A;  2VD3 A;  3E3K A;  4P0I A;  3GBA A;  1P1Q A;  1PDA A;  3SEV A;  4ZEF A;  3HCQ A;  3OOA A;  4MF3 A;  2DE4 A;  5AA1 A;  2F6P A;  3N6U A;  5FHN A;  5DVF A;  3O6G A;  4O3B A;  4JXI A;  3PD8 A;  2ZMB A;  4DE8 A;  3USD A;  2KLF A;  4F1Y A;  3R6U A;  1VFD A;  4FEB A;  4FIM A;  4YMB A;  2D5W A;  5CMK A;  4DZ1 A;  1IXC A;  3L6H A;  3Q28 A;  3EF7 A;  1B40 A;  3KZG A;  4R73 A;  4U4X A;  4KR5 A;  1A55 A;  3N94 A;  3H03 A;  2FNC A;  5KDT A;  3LSL A;  4OEU A;  1NH7 A;  2AYS A;  4RJZ A;  4F1V A;  3T66 A;  5DT6 A;  2I4B A;  4GOT A;  3MC2 A;  2Q2C A;  3K6V A;  1MDP 1;  1PC3 A;  3IB0 A;  2O7U A;  2Y7I A;  3KOS A;  2QS4 A;  5A5X B;  3MVY A;  4OXV A;  1MXV A;  1XT8 A;  3N26 A;  4OER A;  2Y7K A;  3BBR A;  3EHS A;  4OEV A;  4PQJ A;  5DVJ A;  3FJ7 A;  1SW4 A;  4BDL A;  1DPP A;  3M3F A;  5F7V A;  1LFG A;  3O66 A;  1N0T A;  4OFO A;  3LSW A;  4OTE A;  4QSE A;  1OIB A;  3TTL A;  4G68 C;  4NF4 A;  3PMV A;  3M3L A;  2DSF A;  3KG2 A;  2V3T A;  3VXC A;  5H8F A;  2I0B A;  2LAO A;  3UIF A;  3F11 A;  2QS1 A;  1MM6 A;  3K1P A;  1LB8 A;  4X9T A;  3PMW A;  3K6U A;  3M8U A;  2IA4 A;  4R6K A;  4KYS A;  4LZ5 A;  1JW1 A;  4OHN A;  4GFR A;  4Q0C A;  4OEN A;  2ZYN A;  3RTF B;  3W9V A;  3C36 A;  5I2K A;  4EDP A;  3ILU B;  4FED A;  1P1O A;  1IIT A;  4EXK A;  1JEU A;  3M3K A;  3PD9 A;  1MQJ A;  4K3F A;  3VLW A;  3N5L A;  4QF9 A;  4RPO A;  3FIR A;  3K1N A;  4FE8 A;  5L9O A;  4OVJ A;  5FHM A;  3SEY A;  3SEW A;  3R7X A;  1XC1 A;  3PUY E;  1YTV A;  3MJN A;  3GLB A;  2DE2 A;  4ZEK A;  4Z7E A;  2NOO A;  1MY0 A;  2HEU A;  3RN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...