1A55A

Phosphate-binding protein mutant a197c
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
321
structure length
321
Chain Sequence
b'EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGTSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYCYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATE-BINDING PROTEIN
publication title Crystal structure of phosphate binding protein labeled with a coumarin fluorophore, a probe for inorganic phosphate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphotransferase
total genus 107
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 1998-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1a55A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1a55A02
2HZLA 1S9TA 2PX1A 3OMBA 1R9QA 4AB5A 1PB7A 3SDFA 3MJNA 1QJMA 2ABHA 4YKPA 1DMBA 3DP4A 3K02A 1Y3PA 3EHTA 3KSXA 4NF6A 4PFWA 3W9VA 3OO9A 4PE5B 4QSCA 1JNFA 4E0XA 3UN6A 3SEVA 1P1QA 3ZSFA 1N7XA 2VHAA 4IO6A 3ILTB 4I9DA 1LLSA 5H8FA 1NMUA 2F35A 5AA3A 2DE4A 2NWJA 4RPNA 2XD2A 3MAMA 4F39A 1IIWA 2GFEA 2ALUA 3MZBA 2AL5A 3JV9A 3H6VA 1P1WA 3MVWA 1LAFE 4F3SA 3TODA 1DOTA 3G3FA 4C1UA 3HO7A 1CE2A 2B3BA 5ITPA 4IO4A 5H8FB 5I59A 1DPEA 1N0TA 4POWA 1O7TA 3G3HA 1RKMA 1S50A 2QJEA 1DTGA 2G93A 4WKMA 4DLDA 4KCCA 2UVIA 1XVXA 4RJZA 1HSJA 3TELA 1XOCA 2RINA 3L6GA 2RCBA 1O63A 3HHFA 2QS1A 1ZIUA 5J1DA 1D9YA 1FW0A 4OQOA 2XXIA 1EZ9A 3WAEA 1XHYA 1LAGE 1PB8A 3C31A 2P0SA 4F31B 1B32A 4IO3A 2VP1A 1P1OA 2O84X 1LCTA 4UACA 2FYIA 4YMAA 5FHNA 3PPQA 1URSA 4BDLA 3CSBA 5F7VA 3VVEA 2IA4A 3EPEA 3E13X 1A54A 3RTFB 3FVKA 3LBSA 4ZEIA 4EUOA 2DYXA 4U23A 1A99A 4HW8A 4XKRA 3MP8A 4WEPA 4JB7A 5CI5A 3VFJA 1M5EA 1ELJA 3TQWA 3TTKA 4Q5TA 4JWXA 1JVXA 1AOVA 2QSXA 3IB0A 2XXXA 4IO2A 4QFOA 2UVHA 1ZBMA 2V3QA 3MPKA 3TCGA 3T96B 3H4ZA 4DXCA 2F6PA 1F9BA 1USYE 2AYSA 2DWAA 4NE4A 1AMFA 1MPCA 4NMYA 4I1DA 3PU5A 1EZOA 1LAHE 3TAJA 3KZGA 2I0CA 3DLNA 2OWSA 4LZ8A 2XXRA 3LUYA 4OVJA 1RYOA 2DVZA 4DDDA 4L17A 3HPIA 3OO6A 1POTA 5DYHA 4F3PA 1FQAA 2O7IA 2A5SA 2V25A 4U4SA 4C1TA 1FQCA 1YCJA 3ECRA 2Y7IA 3H3GA 2YPNA 1A55A 4U4XA 2UYEA 3MP6A 5KCJA 3Q25A 3CFXA 1MXYA 4E0WA 2Z23A 4OESA 2CMOA 3S4UA 3PUZE 4R6YA 2PT1A 1UQWA 2O7UA 3CVGA 3UK4A 5AA4B 4LVQA 3PPNA 2O1MA 2R6GE 4MLVA 1AIVA 4QFNA 3N5LA 4M4GA 1R6ZA 4BDQA 4IGTA 3SERA 3M8UA 1TT1A 3PUXE 1VSOA 4GRKA 5CMMA 3OO7A 4YB6A 3QYTA 4F3GA 3LSFB 2XXUA 4RK9A 4GL0A 1POY1 1KWHA 3FXUA 3RT6B 4AQ4A 2Q89A 4N13A 2F7AA 1MRPA 1FQEA 1DTZA 3QIMA 1MM6A 2I49A 1B1XA 1TFAA 3GZGA 4XTCQ 3CSGA 3MVXA 3ONMA 2DE2A 1B58A 2UYFA 4IB2A 1B3FA 1US4A 1QVSA 1UTBB 2DVCA 1EZPA 3MP1A 4EXKA 2PT2A 3KN3A 3EHSA 2P2AA 2RF1A 3IORA 4F2OA 3T93B 1XVYA 1H76A 2A5TB 3P7IA 5F1QA 3O6GA 4F1VA 1BKAA 4X48A 1EH3A 1SQYA 2O51A 1ZMGA 2RCAA 3T9XB 3VLVA 2O6AA 5K2YA 3K6WA 3H7MA 4ZE9A 2DS9A 1MQGA 2ZYKA 2PVUA 2REGA 4TQUQ 2FNCA 4OENA 4YB7A 1MXVA 1NL5A 3RTWB 5TU0A 1A8FA 3FXRA 4IGRA 4H8IA 3U1OA 5I2KA 3MC2A 3DP8A 5I84A 1PBPA 4NF5A 5CMBA 4OERA 3IB2A 4PETA 4ZE8A 3M3FA 4NEDA 3Q28A 3CFLA 1SI1A 3GXAA 1QW0A 3EF7A 2QPQA 5H8QA 4H65A 3M3LA 4JWOA 3IOUA 3RPWA 5I2KB 3CRBA 2P1SA 1RYXA 1ZTYA 3FVOA 2YLNA 4NF5B 1MDP1 2GHAA 1M5DA 2HZKA 3O6HA 1N84A 4YICA 5BUUA 4OYVA 4HCWA 4JDFA 5H8QB 1LB9A 4XXUA 1OLCA 1N3WA 4ZS9A 4G68C 4JSDA 3GLBA 5CMKA 3H03A 1WDNA 3AXFA 4JXIA 3K1MA 3IOWA 1N76A 3CIJA 5AE4A 2QS3A 4XKPA 4QFLA 4ZDMA 1JW1A 4NWDA 4GXAA 1N3XA 1SI0A 2ZNTA 4HS7A 3E9XA 1JEUA 3H6UA 2Z22A 2HXWA 3SKPA 1B51A 2XXYA 2D3IA 3S9NC 1MH4A 3HSTA 4GIZA 1SW1A 3E3KA 4GFRA 1ANFA 3C32A 4DXBA 5HBCA 4GWOA 4EQ9A 1UTHA 4LP2B 1FQBA 4ZZEA 2I48A 3S2VA 4ZECA 3IO6A 2E0SA 3A3CA 3FATA 4OFJA 1QKAA 4PFUA 1H44A 2RKMA 1MQJA 5ISUA 2DE3A 4G2ZA 1VFEA 5KZTA 3VLUA 3UIFA 5A5XA 1IUDA 1Q35A 2F97A 3Q29A 1A40A 1UTHB 4RNSA 3RGYA 3VXCA 3JZJA 4H6DA 5HM4B 3U72A 2HCAA 5JTYA 3K4UA 2F7BA 3QAXA 4R2FA 4G8MA 4DXUA 4NF6B 4I8CA 3C4MA 3C35A 4OZ9A 4M1VA 4C0RA 3VLWA 2HAVA 4YAHX 5JTYB 4EF1A 1B7ZA 3MPLA 4Z0IA 4H0WA 1Y20A 3B6WA 3OD7A 5DEXA 3T9UA 1SD3A 3LSLA 4H67A 5ICQA 3FIRA 2VOZA 2XXTA 2ZNUA 3TCHA 4H5GA 3V83A 4QSEA 2XXVA 2ZYMA 3VE1B 5I59B 3K01A 4QSDA 3O9PA 1FTKA 2OK2A 5FTIA 4KYDA 1MY0A 3FGSA 1ZU0A 2QS4A 3G3KA 1HSLA 3RY3A 4QFKA 2BJJX 1B46A 1JVYA 3L6HA 3G3GA 2DXRA 3BKIB 2ONRA 4ELPA 3R7XA 3IAZA 4BDMA 1IXCA 3ODBA 3O6IA 3PUVE 2Y84A 5L9OA 2UVJA 2X26A 3PPRA 1MS7A 2THIA 1ATGA 3T9HB 4PP0A 2FA7A 2H5YA 5JK4A 3V89B 1MXZA 3PD9A 5L9MA 3IO4A 2ONSA 4HCYA 3MZ9A 1DSNA 1GV8A 4POXA 4KCDA 4F22A 4JSOA 3RUMA 4DZ1A 2NUVA 3THIA 1JW4A 1GTKA 4LQ5A 2OJTA 1M5FA 3TMGA 5FTHA 1LFGA 5KDTA 4QHQA 1XT8A 3MUQA 2XXHA 4FAJA 3IOVA 3K6UA 3B6TA 1FTOA 4BDNA 1NNKA 4LA9A 1MPDA 3BBRA 4DCXA 1WVJA 3U93A 1H45A 2DOJA 4EF2A 3OEKA 4PFTA 2NXOA 4O3CA 1XC1A 3IX1A 3SEYA 2XXQA 3KJ7A 5KDTB 3O66A 3D4GA 3FASA 4R9FA 1H3DA 4PFYA 2F78A 1T0KA 1N7WA 3SEWA 1B1HA 4OETA 1MH3A 5M2VA 3PV0E 4FJPA 2M8CA 4G77A 4F29A 1A8EA 2XX7A 1LBBA 2X7QA 4AB6A 1J1NA 2REJA 4P0IA 2F5XA 1MQIA 4H5FA 3O28A 1GVCA 1N04A 2PBWA 5DT6A 3TDJA 1MDQA 4WEDA 4Z7EA 3N6UA 4IY6A 1YTVA 5KCJB 3ZKLA 4LZ7A 3Q27A 4NTLA 1Y9UA 4EDPA 2HEUA 2CZLA 3MW0A 2XX9A 4GL8A 1QKBA 4H8JA 4MF3A 4QRZA 5H8HA 4FE8A 2I4BA 1MXUA 1B0HA 3PPOA 4G8HA 5IKBA 4G68A 4DIGA 3HV1A 3T9VA 3KOSA 1OQHA 1MQHA 3OELA 4N6PA 1UIVA 3FV2A 3U94A 2ZNSA 5CMCA 4F1UA 3G7WA 1B7HA 5H8HB 3B7DA 3SEXA 3TFLA 3QK6A 2H98A 4ND9A 4Q8RA 4KR5A 3KG2A 3FUZA 4IO7A 1Y4TA 1NNPA 2I6EA 4U1ZA 3K1NA 4EQ7A 4U22A 4GLIA 1IZ1A 3EHUA 4RPOA 1I6AA 1IITA 4GQOA 2DWIA 1MY2A 1MXWA 1P1UA 4KYSA 1US5A 4QFPA 2OLBA 2H9BA 1II5A 3JYRA 1IXIA 4ELRA 3PMVA 2V3TA 1MPBA 4TOZA 2RC9A 1ZJLA 4NF8A 2V84A 4I62A 1NNFA 2AL4A 4BDRA 1JQFA 1B7UA 2H4IA 5CC2A 1B05A 4YKJA 3VDFA 2QMWA 2B65A 3CR9A 3O29A 1QUIA 1FQDA 4R2BA 4NF8B 2HFBA 4ESXA 4OFLA 4ZEBA 1OMPA 4NF4A 1SW5A 1NKXA 5I56A 1FQFA 3OEMA 4FEDA 3R6UA 3IJXB 4TLLB 2D5WA 1XS5A 2ZYNA 3KN8A 3WAFA 1I69A 2OZZA 3I6VA 3PPPA 5I57A 1LFIA 4O3BA 3G3JA 4LATA 2ONKE 1MXXA 1MY1A 2R9JA 4YU0A 5DTBA 1NNTA 1FTMA 1D9VA 4NF4B 3ZS6A 2G29A 5DVJA 4O3AA 4N07A 3C9HA 4F2QA 4KFQA 2X7PA 3TYHA 2QRYA 3SEUA 4F3BA 2Q8JA 1P1NA 3T66A 1ZKBA 3OENA 3PUYE 1CB6A 2ZXTA 1URGA 4GXSB 3E4RA 4XIGQ 3UORA 1DPPA 1SBPA 5LOMA 4HTGA 2Z8EA 2O69A 1HSEA 3I3VA 4U21A 1OQGA 2ESNA 3VVDA 3FJGA 4OTEA 5EHSA 2QMXA 5AA2A 1URDA 1LCFA 3TPAA 1MY3A 4JWYA 3O2AA 4KHZE 3FV1A 1VE4A 4MFIA 1OVBA 2V93A 1I6QA 2Q9TA 2H99A 2F6GA 4GD5A 4YKKA 1H43A 1PBQA 1B3LA 1D4NA 5AA2B 1BLFA 3K1PA 3FXQA 3S9LC 1TWYA 5ITOA 4F19A 2VD3A 1SYIA 4ZEFA 3MZ1A 4MLQA 2D21A 4ESWA 5A5XB 4GOTA 2HQ0A 3FJ7A 1GR2A 2I3WA 2I0BA 4P11A 5DVFA 3LC8A 1L5TA 3ZKKA 3FD3A 3KGCA 3M3KA 1B40A 1PEBA 4X1BA 1ZLQA 4ELOA 2Q88A 4FEBA 3QUJA 3LSWA 5H8NA 3PUWE 3DP6A 4ONYA 2I58A 2Q2AA 2DP8A 3TTMA 1AH5A 4UA8A 4BLAA 2I3VA 1B4HA 3O97A 1FTJA 1FTLA 1R1NA 3HN0A 5CBSA 3K6VA 2XXWA 4Q30B 1YAEA 4NWCA 4XKQA 5CM6A 4R75A 4BDOA 4P0GA 1BIYA 5H8NB 1VR5A 2QS2A 4YB5A 3MVYA 4XKNA 1LFHA 1NFTA 5DEXB 3TQLA 1Z7ME 1SW4A 3B6QA 4F1YA 2Q2CA 1B5JA 2GHBA 2DQVA 1QUKA 4FECA 3GBBA 1JEVA 3TTNA 4FATA 1PB9A 3TTLA 3PD8A 1Q1KA 2PYYA 1OVTA 2DXYA 3KOTA 4R74A 2LAOA 1B5HA 4RYAA 3GBAA 1TXFA 3CG1A 1M5BA 4OWDA 1MG1A 5B7DA 4KQPA 1USYH 1JW5A 4YKIA 3FJMA 3N94A 1LGBC 2KLFA 3MBPA 2OWTA 3S9MC 3FVGA 4MBPA 3TTRA 4U2RA 3KSJA 1M5CA 4JBZA 3C34A 1IQ7A 3FVNA 3RLFE 4KYEA 5CRYA 2GH9A 3QUFA 3SESA 2ANJA 4ELQA 5BWJA 1NH7A 4OMBA 3TEPA 1B0LA 3UP9A 2F34A 2F7CA 4ZEKA 1WODA 5ICTA 4IY5A 1B3GA 2V3UA 3IR1A 3RN8A 4RK2A 1P99A 4DCYA 4G8NA 4OEUA 1B4ZA 3HCQA 3TUSA 3IB1A 2QL3A 4FORA 3UGWA 5ELVA 5I58A 4GVOA 4GF8A 1MM7A 3OO8A 3U92A 5IAIA 2XX8A 3D4CA 1S7YA 1IXGA 3T22A 3Q26A 1A7LA 1MQDA 1PDAA 4OXVA 3I5OA 3PMXA 5AA4A 4U1OA 1B3EA 3IOTA 2IEEA 1Z7NE 3KJTA 5I58B 3LSXA 2VD2A 4YMBA 3C33A 3U8QA 5AA1A 3PGFA 2NVUB 2ZMBA 2OCUA 3A3UA 3UA8A 4ECFA 5H8SA 3K2DA 4Q0CA 3OSQA 1PC3A 4EQBA 1LBCA 4ZZAA 3BFTA 4K3FA 5DVIA 1SVXB 4EXLA 1LSTA 4RY1A 4TLMB 2HAUA 2F8DA 5CBRA 3DM0A 4DE8A 3VVFA 3W15C 3MVZA 3RT8A 4LUBA 4X1DA 5TPAA 1LAXA 3H06B 3K6XA 2OBGA 2XD3A 4KPTA 1D3KA 3CG3A 3SETA 1VFDA 4H1XA 2PMSA 4G68B 1MY4A 4QF9A 3HHGA 2W7YA 1UTBA 4LZ5A 5EHMA 1EU8A 3W9WA 5TPAB 3VV5A 4YZZA 5I2NA 3PMWA 1Y1ZA 3H6TA 1LB8A 5JEIA 2XHDA 2A5TA 2XXPA 1UIUA 4R6HA 4ISUA 3QSLA 2WKYA 1B9JA 2DWHA 5FHMA 2DWJA 1GGGA 1I6BA 5FHOA 5I2NB 4ZEDA 2NOOA 4LQ2A 2DSFA 3IJOB 1B6HA 1Y3NA 1AL3A 3OXNA 1BTJA 1B2HA 3TCFA 5L8DA 3CI8A 5K2XA 3C36A 4RXLA 4WXJA 2H25A 1SW2A 3USDA 3FZVA 3EQ1A 1O64A 1QUJA 2YJPA 2UVGA 3KBRA 4OFOA 3CFZA 2Z8DA 4R9GA 1IXHA 5B70A 1FCKA 2Y7PA 3OSRA 2B3FA 4F18A 3TKDA 4OEVA 5TP9A 1SDXA 2Y7RA 3MQ9A 1OIBA 3H6WA 3TZAA 1Y3QA 4X9TA 3N6TA 1NH8A 1IEJA 4R72A 2ZYOA 1BP5A 3OOAA 3RQTA 2Y7WA 3F11A 3K0VA 4IO5A 3KFMA 1Y1MA 4FIMA 5TP9B 3K00A 2I4CA 3G3IA 2UXAA 4RA1A 1R9LA 1TFDA 1QULA 2RC8A 4R6KA 5I56B 1YPNA 2AIXA 1SYHA 3LR1A 3N26A 2Z8FA 1B52A 4THIA 5I57B 3IL1B 1B3HA 2F36A 3A09A 3MWBA 3EN3A 1JETA 3IK6B 2Y7KA 3V8XB 2RC7A 5HPQA 4R73A 5EYFA 1B5IA 4PQJA 3ILUB 2R71A 2VGQA 3KEIA 2GRVA 3KN7A 3BFUA 4OHNA 4MH5A 5L9SA 3S9EA 2E1SA 4LONB 3V5AA 5AA2D 1OLAA 2O68A 4G4PA 1Y4CA 3QXMA 3DELB 3R26A 4KI0E 4KD5A 2O1LA 3RNNA 3VXBA
chains in the Genus database with same CATH superfamily
2HZLA 1S9TA 2PX1A 3OMBA 1R9QA 2XXKA 4AB5A 1PB7A 3SDFA 3MJNA 1QJMA 2ABHA 4YKPA 1DMBA 3DP4A 1LBXA 3K02A 1Y3PA 3EHTA 3KSXA 4NF6A 4PFWA 3W9VA 1CNQA 3OO9A 4PE5B 4QSCA 1JNFA 3UN6A 4E0XA 3SEVA 1P1QA 3ZSFA 1N7XA 2VHAA 4IO6A 3ILTB 1XI6A 4I9DA 1LLSA 1NUXA 5H8FA 1NMUA 2F35A 5AA3A 2DE4A 4OA4A 2NWJA 4RPNA 2XD2A 2PFYA 3MAMA 2QVRA 2DDKA 4F39A 1IIWA 2GFEA 2FIEA 2ALUA 3MZBA 2AL5A 2KQZA 3JV9A 3H6VA 1P1WA 3MVWA 1LAFE 4F3SA 3TODA 1DOTA 3G3FA 4C1UA 3HO7A 1CE2A 2B3BA 5ITPA 4IO4A 5H8FB 5I59A 1DPEA 1N0TA 4POWA 1O7TA 3G3HA 1RKMA 1S50A 3EKIA 2QJEA 1DTGA 2G93A 4WKMA 2KR0A 4HE2A 4DLDA 4KCCA 2UVIA 1XVXA 4RJZA 1FBFA 1HSJA 3TELA 1XOCA 2RINA 3L6GA 2RCBA 1O63A 3HHFA 2QS1A 2QFLA 1ZIUA 5J1DA 1D9YA 4PAFA 1FW0A 4OQOA 2XXIA 1EZ9A 3WAEA 1XHYA 1LAGE 1PB8A 4HE1A 3C31A 2P0SA 4F31B 1B32A 4IO3A 2VP1A 1P1OA 2O84X 1LCTA 4UACA 2ZZVA 2FYIA 4YMAA 5FHNA 3PPQA 1URSA 4BDLA 3CSBA 5F7VA 2XWVA 3VVEA 2IA4A 3EPEA 3CHGA 3E13X 4I3EA 1A54A 4PFBA 5IZ1A 3RTFB 3FVKA 3LBSA 4ZEIA 4EUOA 2DYXA 4U23A 1A99A 5ET6A 4HW8A 4XKRA 3MP8A 4WEPA 4JB7A 5CI5A 3VFJA 1M5EA 1ELJA 3TQWA 3TTKA 4Q5TA 4JWXA 1FTAA 3BIHA 1JVXA 3FBPA 1AOVA 1IMBA 2QSXA 3IB0A 2QVVA 4OVSA 2XXXA 4IO2A 1QGXA 4QFOA 2UVHA 1ZBMA 2V3QA 3MPKA 3TCGA 3T96B 3H4ZA 4DXCA 2F6PA 1F9BA 1USYE 2AYSA 1YZ0A 2DWAA 4NE4A 1AMFA 1MPCA 4NMYA 4I1DA 3PU5A 1EZOA 4OVTA 1LAHE 3TAJA 4NQ8A 3KZGA 4NGUA 2I0CA 3DLNA 4G61A 2OWSA 4LZ8A 2XXRA 3LUYA 4OVJA 1RYOA 2DVZA 4DDDA 4L17A 3HPIA 3OO6A 1POTA 5DYHA 4F3PA 1FQAA 4GX3A 2O7IA 4OVQA 2A5SA 2V25A 4U4SA 4C1TA 4I3YA 1FQCA 1YCJA 3ECRA 2Y7IA 3H3GA 2YPNA 4O7MA 1A55A 4U4XA 2UYEA 3MP6A 4N8YA 5KCJA 3Q25A 3CFXA 1MXYA 4E0WA 2Z23A 5I7IA 4OESA 2CMOA 3S4UA 5A5LA 3PUZE 4R6YA 2PT1A 1UQWA 2O7UA 3CVGA 3UK4A 5AA4B 4LVQA 3PPNA 2O1MA 2R6GE 4MLVA 1AIVA 4QFNA 2VT5A 3N5LA 4DI3D 4PF8A 4M4GA 4MNPA 1R6ZA 4IGTA 4BDQA 1K9YA 3SERA 3M8UA 1TT1A 3PUXE 3MYUA 1VSOA 4GRKA 5CMMA 5ET7A 3OO7A 4YB6A 3QYTA 3MSTA 4F3GA 3ROJA 3LSFB 4PFIA 2XXUA 5J16A 4RK9A 4GL0A 1POY1 1NV4A 1FRPA 2VPNA 4PF6A 1KWHA 3KBZA 3FXUA 3RT6B 4AQ4A 2Q89A 4N13A 2WBDA 2F7AA 1MRPA 1FQEA 1DTZA 3QIMA 1MM6A 1FPEA 2I49A 1B1XA 2OWZA 2Y5LA 1TFAA 4P1LA 3GZGA 4XTCQ 3CSGA 5EYGA 3MVXA 3ONMA 2DE2A 1B58A 2UYFA 4IB2A 1B3FA 1US4A 1QVSA 3NOHA 1UTBB 2DVCA 4N91A 1EZPA 3MP1A 4EXKA 2PT2A 3KN3A 3EHSA 3QMFA 1NV7A 2P2AA 2RF1A 1FPJA 3IORA 4F2OA 5ESYA 3T93B 1XVYA 1H76A 4PDHA 2A5TB 1K9ZA 3P7IA 5F1QA 3O6GA 4F1VA 1BKAA 1FPLA 4X48A 4N17A 1EH3A 1SQYA 2O51A 3FXBA 1ZMGA 2RCAA 3T9XB 2JJKA 3VLVA 2O6AA 5K2YA 3K6WA 4N8GA 3H7MA 4ZE9A 2DS9A 1MQGA 2ZYKA 2PVUA 2REGA 4I40A 4TQUQ 2HPGA 2FNCA 4OENA 4YB7A 1MXVA 1NL5A 3RTWB 5TU0A 1A8FA 3FXRA 1DCUA 4IGRA 4H8IA 2PCRA 3U1OA 5I2KA 3MC2A 2ZZWA 3DP8A 5I84A 1PBPA 4NF5A 1FBHA 5CMBA 4OERA 3IB2A 4PETA 1NV3A 4ZE8A 3M3FA 4NEDA 3Q28A 1EYKA 3CFLA 1SI1A 3GXAA 1QW0A 4N4UA 3EF7A 2QPQA 5H8QA 4H65A 3M3LA 4JWOA 3IOUA 4PE3A 3RPWA 2HXRA 4XF5A 5IM2A 5I2KB 3CRBA 2P1SA 1RYXA 1ZTYA 3FVOA 2YLNA 2QVUA 4NF5B 1MDP1 2GHAA 4P8BA 1M5DA 2HZKA 3O6HA 1N84A 4YICA 5BUUA 4OYVA 4HCWA 4P3LA 4JDFA 5H8QB 1LB9A 4XXUA 1OLCA 1N3WA 4ZS9A 4G68C 4JSDA 5EQ7A 3GLBA 5CMKA 3H03A 4PAKA 1WDNA 3AXFA 4JXIA 1JP4A 3K1MA 3IOWA 1N76A 3CIJA 5AE4A 2QS3A 4XKPA 4QFLA 4ZDMA 1JW1A 4NWDA 4GXAA 1N3XA 1SI0A 2ZNTA 4HS7A 2CEYA 3E9XA 1JEUA 5F24A 3H6UA 2Z22A 2HXWA 1NV0A 3SKPA 1B51A 2XXYA 2D3IA 1D9QA 3S9NC 1MH4A 3HSTA 1KA1A 4GIZA 1SW1A 3E3KA 4GFRA 1ANFA 3C32A 3KC0A 1YXIA 4DXBA 5HBCA 4GWOA 4AS5A 2WBBA 4EQ9A 1UTHA 4LP2B 1FQBA 4ZZEA 2I48A 3S2VA 4ZECA 2WYKA 3IO6A 2E0SA 3A3CA 3FATA 4OFJA 1QKAA 4PFUA 5I5PA 1H44A 2RKMA 1MQJA 5ISUA 1FPBA 2DE3A 4G2ZA 1VFEA 5KZTA 3VLUA 3HFUA 3B8BA 3UIFA 5A5XA 1IUDA 1Q35A 1FBPA 2F97A 3Q29A 1A40A 1UTHB 4RNSA 3RGYA 3VXCA 3JZJA 4H6DA 5HM4B 3U72A 2HCAA 5JTYA 3K4UA 2F7BA 3QAXA 4R2FA 4G8MA 4DXUA 1NUZA 4NF6B 4I8CA 3C4MA 3C35A 3E78A 4OZ9A 4M1VA 4C0RA 3VLWA 2HAVA 4YAHX 1LBYA 5JTYB 4EF1A 1B7ZA 3MPLA 4Z0IA 1RDYA 4H0WA 1Y20A 1BK4A 3B6WA 3OD7A 5DEXA 3RYDA 3T9UA 1SD3A 3LSLA 4PAIA 4H67A 5ICQA 3FIRA 2VOZA 2XXTA 2ZNUA 3TCHA 4H5GA 3V83A 4QSEA 2XXVA 2ZYMA 3VE1B 5I59B 3K01A 4NN3A 4QSDA 4MX6A 3T0JA 4X8RA 5T3JA 3O9PA 1FTKA 2OK2A 5FTIA 4KYDA 1MY0A 3FGSA 1ZU0A 2QS4A 3G3KA 1HSLA 3RY3A 4QFKA 2BJJX 1B46A 1JVYA 3L6HA 3G3GA 2DXRA 3BKIB 2ONRA 4ELPA 3R7XA 3IAZA 4BDMA 1IXCA 3ODBA 3O6IA 3PUVE 1DBZA 2FVZA 2Y84A 4PBQA 5L9OA 2UVJA 2X26A 3PPRA 1MS7A 2THIA 1ATGA 3T9HB 4PP0A 1RDXA 2FA7A 2H5YA 5JK4A 3V89B 1MXZA 3PD9A 4MAGA 5L9MA 3IO4A 2ONSA 4HCYA 2CEXA 3MZ9A 1DSNA 1GV8A 4POXA 4KCDA 4F22A 4JSOA 3RUMA 4DZ1A 2NUVA 3THIA 1NV1A 1JW4A 4PCDA 2FHYA 1GTKA 4LQ5A 2OJTA 1M5FA 2CZKA 3TMGA 5FTHA 1LFGA 5KDTA 4QHQA 1XT8A 3MUQA 2MKZA 3E79A 2XXHA 4FAJA 3IOVA 2V4CA 3K6UA 3B6TA 1NUYA 1FTOA 4BDNA 1NNKA 4LA9A 1MPDA 3BBRA 5ET8A 4DCXA 1WVJA 4MHFA 3U93A 1H45A 2DOJA 4EF2A 3OEKA 4PFTA 2NXOA 4NX1A 4O3CA 1XC1A 3IX1A 3SEYA 2XXQA 3KJ7A 5KDTB 1INPA 3O66A 4LN5A 3D4GA 2FBPA 4R9FA 3FASA 1H3DA 4PFYA 2F78A 1T0KA 1N7WA 3SEWA 1B1HA 4OETA 1MH3A 5M2VA 3PV0E 1KA0A 2P3VA 3BIGA 2M8CA 4FJPA 4G77A 4F29A 2OX3A 1A8EA 2XX7A 1LBBA 2X7QA 4AB6A 1J1NA 4PGNA 2REJA 3IFCA 4P0IA 2F5XA 1MQIA 4H5FA 3O28A 1GVCA 1N04A 2PBWA 5DT6A 3TDJA 1LBZA 4GWUA 1MDQA 4OVPA 2WEFA 4WEDA 4Z7EA 3N6UA 4IY6A 1YTVA 3B50A 4IR8A 3LV0A 5KCJB 3ZKLA 4LZ7A 3Q27A 4NTLA 1Y9UA 4O94A 4JVDA 4EDPA 2HEUA 2CZLA 3MW0A 4H46A 2XX9A 4GL8A 4OANA 1QKBA 4H8JA 4MF3A 4QRZA 5H8HA 4MIJA 4FE8A 2I4BA 1MXUA 1B0HA 3PPOA 4N81A 4G8HA 5IKBA 4G68A 4DIGA 3HV1A 3T9VA 3KOSA 1OQHA 1MQHA 3OELA 4N6PA 2Q74A 4NHBA 1UIVA 3FV2A 3U94A 2ZNSA 5CMCA 4F1UA 1FPKA 3G7WA 1B7HA 5H8HB 3B7DA 4FBPA 3SEXA 3TFLA 3QK6A 1IMDA 2H98A 4ND9A 4Q8RA 2XA5A 4KR5A 3KG2A 5I3SA 3FUZA 4IO7A 2VPOA 1Y4TA 1NNPA 2I6EA 2XWOA 4U1ZA 3K1NA 4EQ7A 2BJIA 4U22A 4GLIA 1IZ1A 3EHUA 4RPOA 1I6AA 1IITA 4GQOA 2DWIA 1MY2A 1MXWA 1P1UA 4KYSA 1US5A 1IMAA 3ISPA 4QFPA 3D1RA 2OLBA 2H9BA 1II5A 3JYRA 1IXIA 4ELRA 5IGAA 3PMVA 2V3TA 1FJ6A 1MPBA 4TOZA 2RC9A 1ZJLA 4NF8A 2V84A 4I62A 4MCOA 1NNFA 2AL4A 4XFEA 1KZ8A 5IZ3A 4BDRA 1JQFA 4QXDA 1B7UA 2H4IA 5CC2A 1B05A 4YKJA 3VDFA 4AS4A 2QMWA 2B65A 3CR9A 3O29A 1QUIA 1FQDA 4R2BA 4NF8B 1FPGA 2HFBA 4ESXA 4OFLA 2L5VA 4ZEBA 1OMPA 4NF4A 1SW5A 1NKXA 5I56A 1FQFA 3OEMA 4FEDA 3R6UA 3IJXB 4TLLB 2D5WA 1XS5A 1FPDA 2ZYNA 3KN8A 3WAFA 1NV2A 1I69A 2OZZA 3I6VA 3PPPA 5I57A 1LFIA 4O3BA 3G3JA 4LATA 2ONKE 1MXXA 1MY1A 4H45A 2R9JA 4YU0A 5DTBA 1NNTA 1FTMA 1D9VA 4NF4B 3ZS6A 1FBEA 2G29A 5DVJA 4O3AA 5IZZA 4N07A 3C9HA 2CZHA 4F2QA 4KFQA 1IMEA 2X7PA 2QRYA 3TYHA 4GWXA 3SEUA 4JVIA 4NAPA 4F3BA 2Q8JA 1P1NA 5DW8A 3T66A 1ZKBA 4P1EA 3OENA 3PUYE 1CB6A 2ZXTA 1URGA 4GXSB 3E4RA 4XIGQ 3UORA 1DPPA 1SBPA 5LOMA 4HTGA 2Z8EA 2O69A 1HSEA 3I3VA 4GWZA 4U21A 1OQGA 2ESNA 3VVDA 1DK4A 3FJGA 4OTEA 5EHSA 1FPIA 2QMXA 5AA2A 1URDA 1LCFA 3TPAA 1MY3A 5EQ9A 4JWYA 3O2AA 1LEVA 4KHZE 4MFIA 1VE4A 3FV1A 5FBPA 1OVBA 2V93A 3U65A 2Q8MA 1I6QA 2Q9TA 2H99A 2F6GA 4GD5A 4YKKA 1H43A 1PBQA 1B3LA 1D4NA 2XWKA 5AA2B 1BLFA 3K1PA 3FXQA 3S9LC 1TWYA 5ITOA 4F19A 2VD3A 1SYIA 4O7IA 4ZEFA 3MZ1A 4MLQA 4P47A 2D21A 1EYJA 4ESWA 5A5XB 4GOTA 2HQ0A 3FJ7A 1GR2A 2I3WA 4PBHA 4P9KA 2I0BA 4P11A 5DVFA 3LC8A 1L5TA 3ZKKA 1NUWA 3FD3A 3KGCA 3M3KA 1B40A 1PEBA 4X1BA 1ZLQA 4ELOA 2Q88A 4FEBA 5EYHA 3SZPA 3QUJA 3LSWA 3GYYA 5H8NA 1SPIA 3PUWE 3DP6A 4ONYA 2I58A 4GX4A 2Q2AA 2DP8A 3TTMA 1AH5A 4UA8A 4BLAA 2I3VA 1B4HA 3O97A 1FTJA 1FTLA 1R1NA 3HN0A 5CBSA 3K6VA 2XXWA 4Q30B 1YAEA 1IMFA 4NWCA 4XKQA 5CM6A 4R75A 4BDOA 4P0GA 1BIYA 5H8NB 1VR5A 2QS2A 4YB5A 3MVYA 4XKNA 1LFHA 1NFTA 5DEXB 4NG7A 3TQLA 1Z7ME 1SW4A 3B6QA 4F1YA 2Q2CA 1B5JA 2GHBA 2DQVA 1QUKA 4FECA 3GBBA 1JEVA 3TTNA 4FATA 1PB9A 3TTLA 3PD8A 1Q1KA 2PYYA 1OVTA 2DXYA 3KOTA 4R74A 1RDZA 2LAOA 1B5HA 4RYAA 3GBAA 2WX9A 1TXFA 3CG1A 1M5BA 4OWDA 1MG1A 2Y5KA 5B7DA 4KQPA 3RPLA 1USYH 1JW5A 4YKIA 1NV5A 1AWBA 3FJMA 3N94A 4GWSA 1LGBC 2KLFA 3MBPA 2OWTA 3S9MC 3FVGA 3T1BA 4MBPA 3TTRA 4JVCA 4U2RA 3KSJA 1M5CA 4JBZA 1IMCA 3C34A 1LBWA 1IQ7A 3FVNA 3RLFE 1Q9DA 4KYEA 5CRYA 3RPLB 2GH9A 3QUFA 3SESA 4O8MA 2ANJA 4ELQA 5BWJA 1NH7A 5EQAA 4OMBA 4MMPA 1YYZA 3TEPA 1B0LA 3UP9A 2F34A 2F7CA 4ZEKA 4NF0A 1WODA 5ICTA 4IY5A 1B3GA 2V3UA 3IR1A 3RN8A 4RK2A 1P99A 4HXVA 4DCYA 4G8NA 4OEUA 1B4ZA 3HCQA 3TUSA 4P56A 3IB1A 2QL3A 4FORA 2WYPA 4HE0A 3UGWA 5ELVA 4OVRA 5I58A 4GVOA 4GF8A 1MM7A 3OO8A 3U92A 5IAIA 2XX8A 3D4CA 1S7YA 1IXGA 3T22A 3Q26A 1A7LA 4PTKA 1MQDA 1PDAA 4OXVA 3I5OA 3PMXA 5EQ8A 5AA4A 4U1OA 1B3EA 3IOTA 4MJOA 2IEEA 1Z7NE 3KJTA 5I58B 3LSXA 2VD2A 2FIXA 4YMBA 5LDZA 3C33A 3U8QA 5AA1A 3PGFA 2NVUB 2HHMA 2ZMBA 4PFRA 2OCUA 3A3UA 3UA8A 4ECFA 4PDDA 5H8SA 3K2DA 4Q0CA 3OSQA 2F3DA 1PC3A 4EQBA 4DI4B 1FPFA 1LBCA 4N6KA 4ZZAA 3BFTA 4K3FA 5DVIA 1SVXB 4EXLA 1LSTA 4RY1A 4TLMB 2HAUA 2F8DA 5CBRA 3DM0A 4DE8A 4GWYA 3VVFA 3W15C 3MVZA 3RT8A 3A29A 4LUBA 4X1DA 5TPAA 1LAXA 2B4MA 3H06B 3K6XA 2OBGA 2XD3A 4KPTA 4GBWA 1D3KA 1EYIA 3CG3A 3SETA 4MEVA 1VFDA 4H1XA 2PMSA 4G68B 1MY4A 4QF9A 3HHGA 2W7YA 1UTBA 4LZ5A 4QBAA 5EHMA 1EU8A 3W9WA 4GWWA 5TPAB 4GBVA 3VV5A 4YZZA 5I2NA 4GX6A 3PMWA 1Y1ZA 1FBGA 3IFAA 3H6TA 1LB8A 5JEIA 2XHDA 2A5TA 2XXPA 5ET5A 1UIUA 4R6HA 4ISUA 3QSLA 2WKYA 1B9JA 2DWHA 5LTCA 5FHMA 4MNIA 2DWJA 1GGGA 1I6BA 5FHOA 5I2NB 4ZEDA 2NOOA 4LQ2A 1FBDA 2DSFA 3IJOB 1B6HA 1Y3NA 1AL3A 1FJ9A 3OXNA 1BTJA 1B2HA 3TCFA 5L8DA 3CI8A 2XWIA 5K2XA 3C36A 4RXLA 4WXJA 2H25A 1SW2A 3USDA 1NI9A 3FZVA 3EQ1A 4N6DA 1O64A 1QUJA 2YJPA 2UVGA 2ZZXA 3KBRA 4OFOA 3CFZA 2Z8DA 4R9GA 1IXHA 5B70A 1FCKA 2Y7PA 2GQ1A 3OSRA 2B3FA 4F18A 3TKDA 4OEVA 5TP9A 1SDXA 4UABA 2Y7RA 2F3BA 3MQ9A 1OIBA 3H6WA 2CZIA 3TZAA 1Y3QA 4X9TA 3N6TA 5IZ3B 2PFZA 1NH8A 4X04A 1IEJA 4MNCA 4R72A 2ZYOA 4PGPA 1G0HA 1BP5A 2B4LA 3OOAA 3RQTA 2Y7WA 3F11A 3K0VA 4IO5A 3KFMA 1Y1MA 1FBCA 4FIMA 5TP9B 3K00A 2I4CA 3KC1A 3G3IA 2UXAA 4RA1A 1R9LA 4XEQA 4PC9A 1TFDA 2R8TA 1QULA 2RC8A 1NV6A 4R6KA 5I56B 1YPNA 1LBVA 2AIXA 1SYHA 3LR1A 3N26A 1G0IA 2Z8FA 1B52A 4THIA 1VDWA 5I57B 3IL1B 1B3HA 2F36A 3A09A 3MWBA 3EN3A 1JETA 3LUZA 3IK6B 2Y7KA 3V8XB 3PTYA 4N15A 2RC7A 5HPQA 4R73A 5EYFA 1B5IA 4PQJA 3ILUB 2R71A 2VGQA 3KEIA 2GRVA 3KN7A 3BFUA 4OHNA 4MH5A 5L9SA 3S9EA 2E1SA 4LONB 3V5AA 5AA2D 1OLAA 2O68A 4G4PA 1Y4CA 3QXMA 3DELB 3R26A 2P3NA 4KI0E 4KD5A 2O1LA 4KXPA 3RNNA 1FSAA 3VXBA
chains in the Genus database with same CATH topology
2HZLA 1S9TA 2PX1A 3OMBA 1R9QA 4AB5A 1PB7A 3SDFA 3MJNA 1QJMA 2ABHA 4YKPA 1DMBA 3DP4A 3K02A 1Y3PA 3EHTA 3KSXA 4NF6A 4PFWA 3W9VA 3OO9A 4PE5B 4QSCA 1JNFA 4E0XA 3UN6A 3SEVA 1P1QA 3ZSFA 1N7XA 2VHAA 4IO6A 3ILTB 4I9DA 1LLSA 5H8FA 1NMUA 2F35A 5AA3A 2DE4A 2NWJA 4RPNA 2XD2A 3MAMA 4F39A 1IIWA 2GFEA 2ALUA 3MZBA 2AL5A 3JV9A 3H6VA 1P1WA 3MVWA 1LAFE 4F3SA 3TODA 1DOTA 3G3FA 4C1UA 3HO7A 1CE2A 2B3BA 5ITPA 4IO4A 5H8FB 5I59A 1DPEA 1N0TA 4POWA 1O7TA 3G3HA 1RKMA 1S50A 2QJEA 1DTGA 2G93A 4WKMA 4DLDA 4KCCA 2UVIA 1XVXA 4RJZA 1HSJA 3TELA 1XOCA 2RINA 3L6GA 2RCBA 1O63A 3HHFA 2QS1A 1ZIUA 5J1DA 1D9YA 1FW0A 4OQOA 2XXIA 1EZ9A 3WAEA 1XHYA 1LAGE 1PB8A 3C31A 2P0SA 4F31B 1B32A 4IO3A 2VP1A 1P1OA 2O84X 1LCTA 4UACA 2FYIA 4YMAA 5FHNA 3PPQA 1URSA 4BDLA 3CSBA 5F7VA 3VVEA 2IA4A 3EPEA 3E13X 1A54A 3RTFB 3FVKA 3LBSA 4ZEIA 4EUOA 2DYXA 4U23A 1A99A 4HW8A 4XKRA 3MP8A 4WEPA 4JB7A 5CI5A 3VFJA 1M5EA 1ELJA 3TQWA 3TTKA 4Q5TA 4JWXA 1JVXA 1AOVA 2QSXA 3IB0A 2XXXA 4IO2A 4QFOA 2UVHA 1ZBMA 2V3QA 3MPKA 3TCGA 3T96B 3H4ZA 4DXCA 2F6PA 1F9BA 1USYE 2AYSA 2DWAA 4NE4A 1AMFA 1MPCA 4NMYA 4I1DA 3PU5A 1EZOA 1LAHE 3TAJA 3KZGA 2I0CA 3DLNA 2OWSA 4LZ8A 2XXRA 3LUYA 4OVJA 1RYOA 2DVZA 4DDDA 4L17A 3HPIA 3OO6A 1POTA 5DYHA 4F3PA 1FQAA 2O7IA 2A5SA 2V25A 4U4SA 4C1TA 1FQCA 1YCJA 3ECRA 2Y7IA 3H3GA 2YPNA 1A55A 4U4XA 2UYEA 3MP6A 5KCJA 3Q25A 3CFXA 1MXYA 4E0WA 2Z23A 4OESA 2CMOA 3S4UA 3PUZE 4R6YA 2PT1A 1UQWA 2O7UA 3CVGA 3UK4A 5AA4B 4LVQA 3PPNA 2O1MA 2R6GE 4MLVA 1AIVA 4QFNA 3N5LA 4M4GA 1R6ZA 4BDQA 4IGTA 3SERA 3M8UA 1TT1A 3PUXE 1VSOA 4GRKA 5CMMA 3OO7A 4YB6A 3QYTA 4F3GA 3LSFB 2XXUA 4RK9A 4GL0A 1POY1 1KWHA 3FXUA 3RT6B 4AQ4A 2Q89A 4N13A 2F7AA 1MRPA 1FQEA 1DTZA 3QIMA 1MM6A 2I49A 1B1XA 1TFAA 3GZGA 4XTCQ 3CSGA 3MVXA 3ONMA 2DE2A 1B58A 2UYFA 4IB2A 1B3FA 1US4A 1QVSA 1UTBB 2DVCA 1EZPA 3MP1A 4EXKA 2PT2A 3KN3A 3EHSA 2P2AA 2RF1A 3IORA 4F2OA 3T93B 1XVYA 1H76A 2A5TB 3P7IA 5F1QA 3O6GA 4F1VA 1BKAA 4X48A 1EH3A 1SQYA 2O51A 1ZMGA 2RCAA 3T9XB 3VLVA 2O6AA 5K2YA 3K6WA 3H7MA 4ZE9A 2DS9A 1MQGA 2ZYKA 2PVUA 2REGA 4TQUQ 2FNCA 4OENA 4YB7A 1MXVA 1NL5A 3RTWB 5TU0A 1A8FA 3FXRA 4IGRA 4H8IA 3U1OA 5I2KA 3MC2A 3DP8A 5I84A 1PBPA 4NF5A 5CMBA 4OERA 3IB2A 4PETA 4ZE8A 3M3FA 4NEDA 3Q28A 3CFLA 1SI1A 3GXAA 1QW0A 3EF7A 2QPQA 5H8QA 4H65A 3M3LA 4JWOA 3IOUA 3RPWA 5I2KB 3CRBA 2P1SA 1RYXA 1ZTYA 3FVOA 2YLNA 4NF5B 1MDP1 2GHAA 1M5DA 2HZKA 3O6HA 1N84A 4YICA 5BUUA 4OYVA 4HCWA 4JDFA 5H8QB 1LB9A 4XXUA 1OLCA 1N3WA 4ZS9A 4G68C 4JSDA 3GLBA 5CMKA 3H03A 1WDNA 3AXFA 4JXIA 3K1MA 3IOWA 1N76A 3CIJA 5AE4A 2QS3A 4XKPA 4QFLA 4ZDMA 1JW1A 4NWDA 4GXAA 1N3XA 1SI0A 2ZNTA 4HS7A 3E9XA 1JEUA 3H6UA 2Z22A 2HXWA 3SKPA 1B51A 2XXYA 2D3IA 3S9NC 1MH4A 3HSTA 4GIZA 1SW1A 3E3KA 4GFRA 1ANFA 3C32A 4DXBA 5HBCA 4GWOA 4EQ9A 1UTHA 4LP2B 1FQBA 4ZZEA 2I48A 3S2VA 4ZECA 3IO6A 2E0SA 3A3CA 3FATA 4OFJA 1QKAA 4PFUA 1H44A 2RKMA 1MQJA 5ISUA 2DE3A 4G2ZA 1VFEA 5KZTA 3VLUA 3UIFA 5A5XA 1IUDA 1Q35A 2F97A 3Q29A 1A40A 1UTHB 4RNSA 3RGYA 3VXCA 3JZJA 4H6DA 5HM4B 3U72A 2HCAA 5JTYA 3K4UA 2F7BA 3QAXA 4R2FA 4G8MA 4DXUA 4NF6B 4I8CA 3C4MA 3C35A 4OZ9A 4M1VA 4C0RA 3VLWA 2HAVA 4YAHX 5JTYB 4EF1A 1B7ZA 3MPLA 4Z0IA 4H0WA 1Y20A 3B6WA 3OD7A 5DEXA 3T9UA 1SD3A 3LSLA 4H67A 5ICQA 3FIRA 2VOZA 2XXTA 2ZNUA 3TCHA 4H5GA 3V83A 4QSEA 2XXVA 2ZYMA 3VE1B 5I59B 3K01A 4QSDA 3O9PA 1FTKA 2OK2A 5FTIA 4KYDA 1MY0A 3FGSA 1ZU0A 2QS4A 3G3KA 1HSLA 3RY3A 4QFKA 2BJJX 1B46A 1JVYA 3L6HA 3G3GA 2DXRA 3BKIB 2ONRA 4ELPA 3R7XA 3IAZA 4BDMA 1IXCA 3ODBA 3O6IA 3PUVE 2Y84A 5L9OA 2UVJA 2X26A 3PPRA 1MS7A 2THIA 1ATGA 3T9HB 4PP0A 2FA7A 2H5YA 5JK4A 3V89B 1MXZA 3PD9A 5L9MA 3IO4A 2ONSA 4HCYA 3MZ9A 1DSNA 1GV8A 4POXA 4KCDA 4F22A 4JSOA 3RUMA 4DZ1A 2NUVA 3THIA 1JW4A 1GTKA 4LQ5A 2OJTA 1M5FA 3TMGA 5FTHA 1LFGA 5KDTA 4QHQA 1XT8A 3MUQA 2XXHA 4FAJA 3IOVA 3K6UA 3B6TA 1FTOA 4BDNA 1NNKA 4LA9A 1MPDA 3BBRA 4DCXA 1WVJA 3U93A 1H45A 2DOJA 4EF2A 3OEKA 4PFTA 2NXOA 4O3CA 1XC1A 3IX1A 3SEYA 2XXQA 3KJ7A 5KDTB 3O66A 3D4GA 3FASA 4R9FA 1H3DA 4PFYA 2F78A 1T0KA 1N7WA 3SEWA 1B1HA 4OETA 1MH3A 5M2VA 3PV0E 4FJPA 2M8CA 4G77A 4F29A 1A8EA 2XX7A 1LBBA 2X7QA 4AB6A 1J1NA 2REJA 4P0IA 2F5XA 1MQIA 4H5FA 3O28A 1GVCA 1N04A 2PBWA 5DT6A 3TDJA 1MDQA 4WEDA 4Z7EA 3N6UA 4IY6A 1YTVA 5KCJB 3ZKLA 4LZ7A 3Q27A 4NTLA 1Y9UA 4EDPA 2HEUA 2CZLA 3MW0A 2XX9A 4GL8A 1QKBA 4H8JA 4MF3A 4QRZA 5H8HA 4FE8A 2I4BA 1MXUA 1B0HA 3PPOA 4G8HA 5IKBA 4G68A 4DIGA 3HV1A 3T9VA 3KOSA 1OQHA 1MQHA 3OELA 4N6PA 1UIVA 3FV2A 3U94A 2ZNSA 5CMCA 4F1UA 3G7WA 1B7HA 5H8HB 3B7DA 3SEXA 3TFLA 3QK6A 2H98A 4ND9A 4Q8RA 4KR5A 3KG2A 3FUZA 4IO7A 1Y4TA 1NNPA 2I6EA 4U1ZA 3K1NA 4EQ7A 4U22A 4GLIA 1IZ1A 3EHUA 4RPOA 1I6AA 1IITA 4GQOA 2DWIA 1MY2A 1MXWA 1P1UA 4KYSA 1US5A 4QFPA 2OLBA 2H9BA 1II5A 3JYRA 1IXIA 4ELRA 3PMVA 2V3TA 1MPBA 4TOZA 2RC9A 1ZJLA 4NF8A 2V84A 4I62A 1NNFA 2AL4A 4BDRA 1JQFA 1B7UA 2H4IA 5CC2A 1B05A 4YKJA 3VDFA 2QMWA 2B65A 3CR9A 3O29A 1QUIA 1FQDA 4R2BA 4NF8B 2HFBA 4ESXA 4OFLA 4ZEBA 1OMPA 4NF4A 1SW5A 1NKXA 5I56A 1FQFA 3OEMA 4FEDA 3R6UA 3IJXB 4TLLB 2D5WA 1XS5A 2ZYNA 3KN8A 3WAFA 1I69A 2OZZA 3I6VA 3PPPA 5I57A 1LFIA 4O3BA 3G3JA 4LATA 2ONKE 1MXXA 1MY1A 2R9JA 4YU0A 5DTBA 1NNTA 1FTMA 1D9VA 4NF4B 3ZS6A 2G29A 5DVJA 4O3AA 4N07A 3C9HA 4F2QA 4KFQA 2X7PA 3TYHA 2QRYA 3SEUA 4F3BA 2Q8JA 1P1NA 3T66A 1ZKBA 3OENA 3PUYE 1CB6A 2ZXTA 1URGA 4GXSB 3E4RA 4XIGQ 3UORA 1DPPA 1SBPA 5LOMA 4HTGA 2Z8EA 2O69A 1HSEA 3I3VA 4U21A 1OQGA 2ESNA 3VVDA 3FJGA 4OTEA 5EHSA 2QMXA 5AA2A 1URDA 1LCFA 3TPAA 1MY3A 4JWYA 3O2AA 4KHZE 3FV1A 1VE4A 4MFIA 1OVBA 2V93A 1I6QA 2Q9TA 2H99A 2F6GA 4GD5A 4YKKA 1H43A 1PBQA 1B3LA 1D4NA 5AA2B 1BLFA 3K1PA 3FXQA 3S9LC 1TWYA 5ITOA 4F19A 2VD3A 1SYIA 4ZEFA 3MZ1A 4MLQA 2D21A 4ESWA 5A5XB 4GOTA 2HQ0A 3FJ7A 1GR2A 2I3WA 2I0BA 4P11A 5DVFA 3LC8A 1L5TA 3ZKKA 3FD3A 3KGCA 3M3KA 1B40A 1PEBA 4X1BA 1ZLQA 4ELOA 2Q88A 4FEBA 3QUJA 3LSWA 5H8NA 3PUWE 3DP6A 4ONYA 2I58A 2Q2AA 2DP8A 3TTMA 1AH5A 4UA8A 4BLAA 2I3VA 1B4HA 3O97A 1FTJA 1FTLA 1R1NA 3HN0A 5CBSA 3K6VA 2XXWA 4Q30B 1YAEA 4NWCA 4XKQA 5CM6A 4R75A 4BDOA 4P0GA 1BIYA 5H8NB 1VR5A 2QS2A 4YB5A 3MVYA 4XKNA 1LFHA 1NFTA 5DEXB 3TQLA 1Z7ME 1SW4A 3B6QA 4F1YA 2Q2CA 1B5JA 2GHBA 2DQVA 1QUKA 4FECA 3GBBA 1JEVA 3TTNA 4FATA 1PB9A 3TTLA 3PD8A 1Q1KA 2PYYA 1OVTA 2DXYA 3KOTA 4R74A 2LAOA 1B5HA 4RYAA 3GBAA 1TXFA 3CG1A 1M5BA 4OWDA 1MG1A 5B7DA 4KQPA 1USYH 1JW5A 4YKIA 3FJMA 3N94A 1LGBC 2KLFA 3MBPA 2OWTA 3S9MC 3FVGA 4MBPA 3TTRA 4U2RA 3KSJA 1M5CA 4JBZA 3C34A 1IQ7A 3FVNA 3RLFE 4KYEA 5CRYA 2GH9A 3QUFA 3SESA 2ANJA 4ELQA 5BWJA 1NH7A 4OMBA 3TEPA 1B0LA 3UP9A 2F34A 2F7CA 4ZEKA 1WODA 5ICTA 4IY5A 1B3GA 2V3UA 3IR1A 3RN8A 4RK2A 1P99A 4DCYA 4G8NA 4OEUA 1B4ZA 3HCQA 3TUSA 3IB1A 2QL3A 4FORA 3UGWA 5ELVA 5I58A 4GVOA 4GF8A 1MM7A 3OO8A 3U92A 5IAIA 2XX8A 3D4CA 1S7YA 1IXGA 3T22A 3Q26A 1A7LA 1MQDA 1PDAA 4OXVA 3I5OA 3PMXA 5AA4A 4U1OA 1B3EA 3IOTA 2IEEA 1Z7NE 3KJTA 5I58B 3LSXA 2VD2A 4YMBA 3C33A 3U8QA 5AA1A 3PGFA 2NVUB 2ZMBA 2OCUA 3A3UA 3UA8A 4ECFA 5H8SA 3K2DA 4Q0CA 3OSQA 1PC3A 4EQBA 1LBCA 4ZZAA 3BFTA 4K3FA 5DVIA 1SVXB 4EXLA 1LSTA 4RY1A 4TLMB 2HAUA 2F8DA 5CBRA 3DM0A 4DE8A 3VVFA 3W15C 3MVZA 3RT8A 4LUBA 4X1DA 5TPAA 1LAXA 3H06B 3K6XA 2OBGA 2XD3A 4KPTA 1D3KA 3CG3A 3SETA 1VFDA 4H1XA 2PMSA 4G68B 1MY4A 4QF9A 3HHGA 2W7YA 1UTBA 4LZ5A 5EHMA 1EU8A 3W9WA 5TPAB 3VV5A 4YZZA 5I2NA 3PMWA 1Y1ZA 3H6TA 1LB8A 5JEIA 2XHDA 2A5TA 2XXPA 1UIUA 4R6HA 4ISUA 3QSLA 2WKYA 1B9JA 2DWHA 5FHMA 2DWJA 1GGGA 1I6BA 5FHOA 5I2NB 4ZEDA 2NOOA 4LQ2A 2DSFA 3IJOB 1B6HA 1Y3NA 1AL3A 3OXNA 1BTJA 1B2HA 3TCFA 5L8DA 3CI8A 5K2XA 3C36A 4RXLA 4WXJA 2H25A 1SW2A 3USDA 3FZVA 3EQ1A 1O64A 1QUJA 2YJPA 2UVGA 3KBRA 4OFOA 3CFZA 2Z8DA 4R9GA 1IXHA 5B70A 1FCKA 2Y7PA 3OSRA 2B3FA 4F18A 3TKDA 4OEVA 5TP9A 1SDXA 2Y7RA 3MQ9A 1OIBA 3H6WA 3TZAA 1Y3QA 4X9TA 3N6TA 1NH8A 1IEJA 4R72A 2ZYOA 1BP5A 3OOAA 3RQTA 2Y7WA 3F11A 3K0VA 4IO5A 3KFMA 1Y1MA 4FIMA 5TP9B 3K00A 2I4CA 3G3IA 2UXAA 4RA1A 1R9LA 1TFDA 1QULA 2RC8A 4R6KA 5I56B 1YPNA 2AIXA 1SYHA 3LR1A 3N26A 2Z8FA 1B52A 4THIA 5I57B 3IL1B 1B3HA 2F36A 3A09A 3MWBA 3EN3A 1JETA 3IK6B 2Y7KA 3V8XB 2RC7A 5HPQA 4R73A 5EYFA 1B5IA 4PQJA 3ILUB 2R71A 2VGQA 3KEIA 2GRVA 3KN7A 3BFUA 4OHNA 4MH5A 5L9SA 3S9EA 2E1SA 4LONB 3V5AA 5AA2D 1OLAA 2O68A 4G4PA 1Y4CA 3QXMA 3DELB 3R26A 4KI0E 4KD5A 2O1LA 3RNNA 3VXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HZL A;  1S9T A;  2PX1 A;  3OMB A;  1R9Q A;  4AB5 A;  1PB7 A;  3SDF A;  3MJN A;  1QJM A;  2ABH A;  4YKP A;  1DMB A;  3DP4 A;  3K02 A;  1Y3P A;  3EHT A;  3KSX A;  4NF6 A;  4PFW A;  3W9V A;  3OO9 A;  4PE5 B;  4QSC A;  1JNF A;  4E0X A;  3UN6 A;  3SEV A;  1P1Q A;  3ZSF A;  1N7X A;  2VHA A;  4IO6 A;  3ILT B;  4I9D A;  1LLS A;  5H8F A;  1NMU A;  2F35 A;  5AA3 A;  2DE4 A;  2NWJ A;  4RPN A;  2XD2 A;  3MAM A;  4F39 A;  1IIW A;  2GFE A;  2ALU A;  3MZB A;  2AL5 A;  3JV9 A;  3H6V A;  1P1W A;  3MVW A;  1LAF E;  4F3S A;  3TOD A;  1DOT A;  3G3F A;  4C1U A;  3HO7 A;  1CE2 A;  2B3B A;  5ITP A;  4IO4 A;  5H8F B;  5I59 A;  1DPE A;  1N0T A;  4POW A;  1O7T A;  3G3H A;  1RKM A;  1S50 A;  2QJE A;  1DTG A;  2G93 A;  4WKM A;  4DLD A;  4KCC A;  2UVI A;  1XVX A;  4RJZ A;  1HSJ A;  3TEL A;  1XOC A;  2RIN A;  3L6G A;  2RCB A;  1O63 A;  3HHF A;  2QS1 A;  1ZIU A;  5J1D A;  1D9Y A;  1FW0 A;  4OQO A;  2XXI A;  1EZ9 A;  3WAE A;  1XHY A;  1LAG E;  1PB8 A;  3C31 A;  2P0S A;  4F31 B;  1B32 A;  4IO3 A;  2VP1 A;  1P1O A;  2O84 X;  1LCT A;  4UAC A;  2FYI A;  4YMA A;  5FHN A;  3PPQ A;  1URS A;  4BDL A;  3CSB A;  5F7V A;  3VVE A;  2IA4 A;  3EPE A;  3E13 X;  1A54 A;  3RTF B;  3FVK A;  3LBS A;  4ZEI A;  4EUO A;  2DYX A;  4U23 A;  1A99 A;  4HW8 A;  4XKR A;  3MP8 A;  4WEP A;  4JB7 A;  5CI5 A;  3VFJ A;  1M5E A;  1ELJ A;  3TQW A;  3TTK A;  4Q5T A;  4JWX A;  1JVX A;  1AOV A;  2QSX A;  3IB0 A;  2XXX A;  4IO2 A;  4QFO A;  2UVH A;  1ZBM A;  2V3Q A;  3MPK A;  3TCG A;  3T96 B;  3H4Z A;  4DXC A;  2F6P A;  1F9B A;  1USY E;  2AYS A;  2DWA A;  4NE4 A;  1AMF A;  1MPC A;  4NMY A;  4I1D A;  3PU5 A;  1EZO A;  1LAH E;  3TAJ A;  3KZG A;  2I0C A;  3DLN A;  2OWS A;  4LZ8 A;  2XXR A;  3LUY A;  4OVJ A;  1RYO A;  2DVZ A;  4DDD A;  4L17 A;  3HPI A;  3OO6 A;  1POT A;  5DYH A;  4F3P A;  1FQA A;  2O7I A;  2A5S A;  2V25 A;  4U4S A;  4C1T A;  1FQC A;  1YCJ A;  3ECR A;  2Y7I A;  3H3G A;  2YPN A;  1A55 A;  4U4X A;  2UYE A;  3MP6 A;  5KCJ A;  3Q25 A;  3CFX A;  1MXY A;  4E0W A;  2Z23 A;  4OES A;  2CMO A;  3S4U A;  3PUZ E;  4R6Y A;  2PT1 A;  1UQW A;  2O7U A;  3CVG A;  3UK4 A;  5AA4 B;  4LVQ A;  3PPN A;  2O1M A;  2R6G E;  4MLV A;  1AIV A;  4QFN A;  3N5L A;  4M4G A;  1R6Z A;  4BDQ A;  4IGT A;  3SER A;  3M8U A;  1TT1 A;  3PUX E;  1VSO A;  4GRK A;  5CMM A;  3OO7 A;  4YB6 A;  3QYT A;  4F3G A;  3LSF B;  2XXU A;  4RK9 A;  4GL0 A;  1POY 1;  1KWH A;  3FXU A;  3RT6 B;  4AQ4 A;  2Q89 A;  4N13 A;  2F7A A;  1MRP A;  1FQE A;  1DTZ A;  3QIM A;  1MM6 A;  2I49 A;  1B1X A;  1TFA A;  3GZG A;  4XTC Q;  3CSG A;  3MVX A;  3ONM A;  2DE2 A;  1B58 A;  2UYF A;  4IB2 A;  1B3F A;  1US4 A;  1QVS A;  1UTB B;  2DVC A;  1EZP A;  3MP1 A;  4EXK A;  2PT2 A;  3KN3 A;  3EHS A;  2P2A A;  2RF1 A;  3IOR A;  4F2O A;  3T93 B;  1XVY A;  1H76 A;  2A5T B;  3P7I A;  5F1Q A;  3O6G A;  4F1V A;  1BKA A;  4X48 A;  1EH3 A;  1SQY A;  2O51 A;  1ZMG A;  2RCA A;  3T9X B;  3VLV A;  2O6A A;  5K2Y A;  3K6W A;  3H7M A;  4ZE9 A;  2DS9 A;  1MQG A;  2ZYK A;  2PVU A;  2REG A;  4TQU Q;  2FNC A;  4OEN A;  4YB7 A;  1MXV A;  1NL5 A;  3RTW B;  5TU0 A;  1A8F A;  3FXR A;  4IGR A;  4H8I A;  3U1O A;  5I2K A;  3MC2 A;  3DP8 A;  5I84 A;  1PBP A;  4NF5 A;  5CMB A;  4OER A;  3IB2 A;  4PET A;  4ZE8 A;  3M3F A;  4NED A;  3Q28 A;  3CFL A;  1SI1 A;  3GXA A;  1QW0 A;  3EF7 A;  2QPQ A;  5H8Q A;  4H65 A;  3M3L A;  4JWO A;  3IOU A;  3RPW A;  5I2K B;  3CRB A;  2P1S A;  1RYX A;  1ZTY A;  3FVO A;  2YLN A;  4NF5 B;  1MDP 1;  2GHA A;  1M5D A;  2HZK A;  3O6H A;  1N84 A;  4YIC A;  5BUU A;  4OYV A;  4HCW A;  4JDF A;  5H8Q B;  1LB9 A;  4XXU A;  1OLC A;  1N3W A;  4ZS9 A;  4G68 C;  4JSD A;  3GLB A;  5CMK A;  3H03 A;  1WDN A;  3AXF A;  4JXI A;  3K1M A;  3IOW A;  1N76 A;  3CIJ A;  5AE4 A;  2QS3 A;  4XKP A;  4QFL A;  4ZDM A;  1JW1 A;  4NWD A;  4GXA A;  1N3X A;  1SI0 A;  2ZNT A;  4HS7 A;  3E9X A;  1JEU A;  3H6U A;  2Z22 A;  2HXW A;  3SKP A;  1B51 A;  2XXY A;  2D3I A;  3S9N C;  1MH4 A;  3HST A;  4GIZ A;  1SW1 A;  3E3K A;  4GFR A;  1ANF A;  3C32 A;  4DXB A;  5HBC A;  4GWO A;  4EQ9 A;  1UTH A;  4LP2 B;  1FQB A;  4ZZE A;  2I48 A;  3S2V A;  4ZEC A;  3IO6 A;  2E0S A;  3A3C A;  3FAT A;  4OFJ A;  1QKA A;  4PFU A;  1H44 A;  2RKM A;  1MQJ A;  5ISU A;  2DE3 A;  4G2Z A;  1VFE A;  5KZT A;  3VLU A;  3UIF A;  5A5X A;  1IUD A;  1Q35 A;  2F97 A;  3Q29 A;  1A40 A;  1UTH B;  4RNS A;  3RGY A;  3VXC A;  3JZJ A;  4H6D A;  5HM4 B;  3U72 A;  2HCA A;  5JTY A;  3K4U A;  2F7B A;  3QAX A;  4R2F A;  4G8M A;  4DXU A;  4NF6 B;  4I8C A;  3C4M A;  3C35 A;  4OZ9 A;  4M1V A;  4C0R A;  3VLW A;  2HAV A;  4YAH X;  5JTY B;  4EF1 A;  1B7Z A;  3MPL A;  4Z0I A;  4H0W A;  1Y20 A;  3B6W A;  3OD7 A;  5DEX A;  3T9U A;  1SD3 A;  3LSL A;  4H67 A;  5ICQ A;  3FIR A;  2VOZ A;  2XXT A;  2ZNU A;  3TCH A;  4H5G A;  3V83 A;  4QSE A;  2XXV A;  2ZYM A;  3VE1 B;  5I59 B;  3K01 A;  4QSD A;  3O9P A;  1FTK A;  2OK2 A;  5FTI A;  4KYD A;  1MY0 A;  3FGS A;  1ZU0 A;  2QS4 A;  3G3K A;  1HSL A;  3RY3 A;  4QFK A;  2BJJ X;  1B46 A;  1JVY A;  3L6H A;  3G3G A;  2DXR A;  3BKI B;  2ONR A;  4ELP A;  3R7X A;  3IAZ A;  4BDM A;  1IXC A;  3ODB A;  3O6I A;  3PUV E;  2Y84 A;  5L9O A;  2UVJ A;  2X26 A;  3PPR A;  1MS7 A;  2THI A;  1ATG A;  3T9H B;  4PP0 A;  2FA7 A;  2H5Y A;  5JK4 A;  3V89 B;  1MXZ A;  3PD9 A;  5L9M A;  3IO4 A;  2ONS A;  4HCY A;  3MZ9 A;  1DSN A;  1GV8 A;  4POX A;  4KCD A;  4F22 A;  4JSO A;  3RUM A;  4DZ1 A;  2NUV A;  3THI A;  1JW4 A;  1GTK A;  4LQ5 A;  2OJT A;  1M5F A;  3TMG A;  5FTH A;  1LFG A;  5KDT A;  4QHQ A;  1XT8 A;  3MUQ A;  2XXH A;  4FAJ A;  3IOV A;  3K6U A;  3B6T A;  1FTO A;  4BDN A;  1NNK A;  4LA9 A;  1MPD A;  3BBR A;  4DCX A;  1WVJ A;  3U93 A;  1H45 A;  2DOJ A;  4EF2 A;  3OEK A;  4PFT A;  2NXO A;  4O3C A;  1XC1 A;  3IX1 A;  3SEY A;  2XXQ A;  3KJ7 A;  5KDT B;  3O66 A;  3D4G A;  3FAS A;  4R9F A;  1H3D A;  4PFY A;  2F78 A;  1T0K A;  1N7W A;  3SEW A;  1B1H A;  4OET A;  1MH3 A;  5M2V A;  3PV0 E;  4FJP A;  2M8C A;  4G77 A;  4F29 A;  1A8E A;  2XX7 A;  1LBB A;  2X7Q A;  4AB6 A;  1J1N A;  2REJ A;  4P0I A;  2F5X A;  1MQI A;  4H5F A;  3O28 A;  1GVC A;  1N04 A;  2PBW A;  5DT6 A;  3TDJ A;  1MDQ A;  4WED A;  4Z7E A;  3N6U A;  4IY6 A;  1YTV A;  5KCJ B;  3ZKL A;  4LZ7 A;  3Q27 A;  4NTL A;  1Y9U A;  4EDP A;  2HEU A;  2CZL A;  3MW0 A;  2XX9 A;  4GL8 A;  1QKB A;  4H8J A;  4MF3 A;  4QRZ A;  5H8H A;  4FE8 A;  2I4B A;  1MXU A;  1B0H A;  3PPO A;  4G8H A;  5IKB A;  4G68 A;  4DIG A;  3HV1 A;  3T9V A;  3KOS A;  1OQH A;  1MQH A;  3OEL A;  4N6P A;  1UIV A;  3FV2 A;  3U94 A;  2ZNS A;  5CMC A;  4F1U A;  3G7W A;  1B7H A;  5H8H B;  3B7D A;  3SEX A;  3TFL A;  3QK6 A;  2H98 A;  4ND9 A;  4Q8R A;  4KR5 A;  3KG2 A;  3FUZ A;  4IO7 A;  1Y4T A;  1NNP A;  2I6E A;  4U1Z A;  3K1N A;  4EQ7 A;  4U22 A;  4GLI A;  1IZ1 A;  3EHU A;  4RPO A;  1I6A A;  1IIT A;  4GQO A;  2DWI A;  1MY2 A;  1MXW A;  1P1U A;  4KYS A;  1US5 A;  4QFP A;  2OLB A;  2H9B A;  1II5 A;  3JYR A;  1IXI A;  4ELR A;  3PMV A;  2V3T A;  1MPB A;  4TOZ A;  2RC9 A;  1ZJL A;  4NF8 A;  2V84 A;  4I62 A;  1NNF A;  2AL4 A;  4BDR A;  1JQF A;  1B7U A;  2H4I A;  5CC2 A;  1B05 A;  4YKJ A;  3VDF A;  2QMW A;  2B65 A;  3CR9 A;  3O29 A;  1QUI A;  1FQD A;  4R2B A;  4NF8 B;  2HFB A;  4ESX A;  4OFL A;  4ZEB A;  1OMP A;  4NF4 A;  1SW5 A;  1NKX A;  5I56 A;  1FQF A;  3OEM A;  4FED A;  3R6U A;  3IJX B;  4TLL B;  2D5W A;  1XS5 A;  2ZYN A;  3KN8 A;  3WAF A;  1I69 A;  2OZZ A;  3I6V A;  3PPP A;  5I57 A;  1LFI A;  4O3B A;  3G3J A;  4LAT A;  2ONK E;  1MXX A;  1MY1 A;  2R9J A;  4YU0 A;  5DTB A;  1NNT A;  1FTM A;  1D9V A;  4NF4 B;  3ZS6 A;  2G29 A;  5DVJ A;  4O3A A;  4N07 A;  3C9H A;  4F2Q A;  4KFQ A;  2X7P A;  3TYH A;  2QRY A;  3SEU A;  4F3B A;  2Q8J A;  1P1N A;  3T66 A;  1ZKB A;  3OEN A;  3PUY E;  1CB6 A;  2ZXT A;  1URG A;  4GXS B;  3E4R A;  4XIG Q;  3UOR A;  1DPP A;  1SBP A;  5LOM A;  4HTG A;  2Z8E A;  2O69 A;  1HSE A;  3I3V A;  4U21 A;  1OQG A;  2ESN A;  3VVD A;  3FJG A;  4OTE A;  5EHS A;  2QMX A;  5AA2 A;  1URD A;  1LCF A;  3TPA A;  1MY3 A;  4JWY A;  3O2A A;  4KHZ E;  3FV1 A;  1VE4 A;  4MFI A;  1OVB A;  2V93 A;  1I6Q A;  2Q9T A;  2H99 A;  2F6G A;  4GD5 A;  4YKK A;  1H43 A;  1PBQ A;  1B3L A;  1D4N A;  5AA2 B;  1BLF A;  3K1P A;  3FXQ A;  3S9L C;  1TWY A;  5ITO A;  4F19 A;  2VD3 A;  1SYI A;  4ZEF A;  3MZ1 A;  4MLQ A;  2D21 A;  4ESW A;  5A5X B;  4GOT A;  2HQ0 A;  3FJ7 A;  1GR2 A;  2I3W A;  2I0B A;  4P11 A;  5DVF A;  3LC8 A;  1L5T A;  3ZKK A;  3FD3 A;  3KGC A;  3M3K A;  1B40 A;  1PEB A;  4X1B A;  1ZLQ A;  4ELO A;  2Q88 A;  4FEB A;  3QUJ A;  3LSW A;  5H8N A;  3PUW E;  3DP6 A;  4ONY A;  2I58 A;  2Q2A A;  2DP8 A;  3TTM A;  1AH5 A;  4UA8 A;  4BLA A;  2I3V A;  1B4H A;  3O97 A;  1FTJ A;  1FTL A;  1R1N A;  3HN0 A;  5CBS A;  3K6V A;  2XXW A;  4Q30 B;  1YAE A;  4NWC A;  4XKQ A;  5CM6 A;  4R75 A;  4BDO A;  4P0G A;  1BIY A;  5H8N B;  1VR5 A;  2QS2 A;  4YB5 A;  3MVY A;  4XKN A;  1LFH A;  1NFT A;  5DEX B;  3TQL A;  1Z7M E;  1SW4 A;  3B6Q A;  4F1Y A;  2Q2C A;  1B5J A;  2GHB A;  2DQV A;  1QUK A;  4FEC A;  3GBB A;  1JEV A;  3TTN A;  4FAT A;  1PB9 A;  3TTL A;  3PD8 A;  1Q1K A;  2PYY A;  1OVT A;  2DXY A;  3KOT A;  4R74 A;  2LAO A;  1B5H A;  4RYA A;  3GBA A;  1TXF A;  3CG1 A;  1M5B A;  4OWD A;  1MG1 A;  5B7D A;  4KQP A;  1USY H;  1JW5 A;  4YKI A;  3FJM A;  3N94 A;  1LGB C;  2KLF A;  3MBP A;  2OWT A;  3S9M C;  3FVG A;  4MBP A;  3TTR A;  4U2R A;  3KSJ A;  1M5C A;  4JBZ A;  3C34 A;  1IQ7 A;  3FVN A;  3RLF E;  4KYE A;  5CRY A;  2GH9 A;  3QUF A;  3SES A;  2ANJ A;  4ELQ A;  5BWJ A;  1NH7 A;  4OMB A;  3TEP A;  1B0L A;  3UP9 A;  2F34 A;  2F7C A;  4ZEK A;  1WOD A;  5ICT A;  4IY5 A;  1B3G A;  2V3U A;  3IR1 A;  3RN8 A;  4RK2 A;  1P99 A;  4DCY A;  4G8N A;  4OEU A;  1B4Z A;  3HCQ A;  3TUS A;  3IB1 A;  2QL3 A;  4FOR A;  3UGW A;  5ELV A;  5I58 A;  4GVO A;  4GF8 A;  1MM7 A;  3OO8 A;  3U92 A;  5IAI A;  2XX8 A;  3D4C A;  1S7Y A;  1IXG A;  3T22 A;  3Q26 A;  1A7L A;  1MQD A;  1PDA A;  4OXV A;  3I5O A;  3PMX A;  5AA4 A;  4U1O A;  1B3E A;  3IOT A;  2IEE A;  1Z7N E;  3KJT A;  5I58 B;  3LSX A;  2VD2 A;  4YMB A;  3C33 A;  3U8Q A;  5AA1 A;  3PGF A;  2NVU B;  2ZMB A;  2OCU A;  3A3U A;  3UA8 A;  4ECF A;  5H8S A;  3K2D A;  4Q0C A;  3OSQ A;  1PC3 A;  4EQB A;  1LBC A;  4ZZA A;  3BFT A;  4K3F A;  5DVI A;  1SVX B;  4EXL A;  1LST A;  4RY1 A;  4TLM B;  2HAU A;  2F8D A;  5CBR A;  3DM0 A;  4DE8 A;  3VVF A;  3W15 C;  3MVZ A;  3RT8 A;  4LUB A;  4X1D A;  5TPA A;  1LAX A;  3H06 B;  3K6X A;  2OBG A;  2XD3 A;  4KPT A;  1D3K A;  3CG3 A;  3SET A;  1VFD A;  4H1X A;  2PMS A;  4G68 B;  1MY4 A;  4QF9 A;  3HHG A;  2W7Y A;  1UTB A;  4LZ5 A;  5EHM A;  1EU8 A;  3W9W A;  5TPA B;  3VV5 A;  4YZZ A;  5I2N A;  3PMW A;  1Y1Z A;  3H6T A;  1LB8 A;  5JEI A;  2XHD A;  2A5T A;  2XXP A;  1UIU A;  4R6H A;  4ISU A;  3QSL A;  2WKY A;  1B9J A;  2DWH A;  5FHM A;  2DWJ A;  1GGG A;  1I6B A;  5FHO A;  5I2N B;  4ZED A;  2NOO A;  4LQ2 A;  2DSF A;  3IJO B;  1B6H A;  1Y3N A;  1AL3 A;  3OXN A;  1BTJ A;  1B2H A;  3TCF A;  5L8D A;  3CI8 A;  5K2X A;  3C36 A;  4RXL A;  4WXJ A;  2H25 A;  1SW2 A;  3USD A;  3FZV A;  3EQ1 A;  1O64 A;  1QUJ A;  2YJP A;  2UVG A;  3KBR A;  4OFO A;  3CFZ A;  2Z8D A;  4R9G A;  1IXH A;  5B70 A;  1FCK A;  2Y7P A;  3OSR A;  2B3F A;  4F18 A;  3TKD A;  4OEV A;  5TP9 A;  1SDX A;  2Y7R A;  3MQ9 A;  1OIB A;  3H6W A;  3TZA A;  1Y3Q A;  4X9T A;  3N6T A;  1NH8 A;  1IEJ A;  4R72 A;  2ZYO A;  1BP5 A;  3OOA A;  3RQT A;  2Y7W A;  3F11 A;  3K0V A;  4IO5 A;  3KFM A;  1Y1M A;  4FIM A;  5TP9 B;  3K00 A;  2I4C A;  3G3I A;  2UXA A;  4RA1 A;  1R9L A;  1TFD A;  1QUL A;  2RC8 A;  4R6K A;  5I56 B;  1YPN A;  2AIX A;  1SYH A;  3LR1 A;  3N26 A;  2Z8F A;  1B52 A;  4THI A;  5I57 B;  3IL1 B;  1B3H A;  2F36 A;  3A09 A;  3MWB A;  3EN3 A;  1JET A;  3IK6 B;  2Y7K A;  3V8X B;  2RC7 A;  5HPQ A;  4R73 A;  5EYF A;  1B5I A;  4PQJ A;  3ILU B;  2R71 A;  2VGQ A;  3KEI A;  2GRV A;  3KN7 A;  3BFU A;  4OHN A;  4MH5 A;  5L9S A;  3S9E A;  2E1S A;  4LON B;  3V5A A;  5AA2 D;  1OLA A;  2O68 A;  4G4P A;  1Y4C A;  3QXM A;  3DEL B;  3R26 A;  4KI0 E;  4KD5 A;  2O1L A;  3RNN A;  3VXB A; 
#chains in the Genus database with same CATH topology
 2HZL A;  1S9T A;  2PX1 A;  3OMB A;  1R9Q A;  2XXK A;  4AB5 A;  1PB7 A;  3SDF A;  3MJN A;  1QJM A;  2ABH A;  4YKP A;  1DMB A;  3DP4 A;  1LBX A;  3K02 A;  1Y3P A;  3EHT A;  3KSX A;  4NF6 A;  4PFW A;  3W9V A;  1CNQ A;  3OO9 A;  4PE5 B;  4QSC A;  1JNF A;  3UN6 A;  4E0X A;  3SEV A;  1P1Q A;  3ZSF A;  1N7X A;  2VHA A;  4IO6 A;  3ILT B;  1XI6 A;  4I9D A;  1LLS A;  1NUX A;  5H8F A;  1NMU A;  2F35 A;  5AA3 A;  2DE4 A;  4OA4 A;  2NWJ A;  4RPN A;  2XD2 A;  2PFY A;  3MAM A;  2QVR A;  2DDK A;  4F39 A;  1IIW A;  2GFE A;  2FIE A;  2ALU A;  3MZB A;  2AL5 A;  2KQZ A;  3JV9 A;  3H6V A;  1P1W A;  3MVW A;  1LAF E;  4F3S A;  3TOD A;  1DOT A;  3G3F A;  4C1U A;  3HO7 A;  1CE2 A;  2B3B A;  5ITP A;  4IO4 A;  5H8F B;  5I59 A;  1DPE A;  1N0T A;  4POW A;  1O7T A;  3G3H A;  1RKM A;  1S50 A;  3EKI A;  2QJE A;  1DTG A;  2G93 A;  4WKM A;  2KR0 A;  4HE2 A;  4DLD A;  4KCC A;  2UVI A;  1XVX A;  4RJZ A;  1FBF A;  1HSJ A;  3TEL A;  1XOC A;  2RIN A;  3L6G A;  2RCB A;  1O63 A;  3HHF A;  2QS1 A;  2QFL A;  1ZIU A;  5J1D A;  1D9Y A;  4PAF A;  1FW0 A;  4OQO A;  2XXI A;  1EZ9 A;  3WAE A;  1XHY A;  1LAG E;  1PB8 A;  4HE1 A;  3C31 A;  2P0S A;  4F31 B;  1B32 A;  4IO3 A;  2VP1 A;  1P1O A;  2O84 X;  1LCT A;  4UAC A;  2ZZV A;  2FYI A;  4YMA A;  5FHN A;  3PPQ A;  1URS A;  4BDL A;  3CSB A;  5F7V A;  2XWV A;  3VVE A;  2IA4 A;  3EPE A;  3CHG A;  3E13 X;  4I3E A;  1A54 A;  4PFB A;  5IZ1 A;  3RTF B;  3FVK A;  3LBS A;  4ZEI A;  4EUO A;  2DYX A;  4U23 A;  1A99 A;  5ET6 A;  4HW8 A;  4XKR A;  3MP8 A;  4WEP A;  4JB7 A;  5CI5 A;  3VFJ A;  1M5E A;  1ELJ A;  3TQW A;  3TTK A;  4Q5T A;  4JWX A;  1FTA A;  3BIH A;  1JVX A;  3FBP A;  1AOV A;  1IMB A;  2QSX A;  3IB0 A;  2QVV A;  4OVS A;  2XXX A;  4IO2 A;  1QGX A;  4QFO A;  2UVH A;  1ZBM A;  2V3Q A;  3MPK A;  3TCG A;  3T96 B;  3H4Z A;  4DXC A;  2F6P A;  1F9B A;  1USY E;  2AYS A;  1YZ0 A;  2DWA A;  4NE4 A;  1AMF A;  1MPC A;  4NMY A;  4I1D A;  3PU5 A;  1EZO A;  4OVT A;  1LAH E;  3TAJ A;  4NQ8 A;  3KZG A;  4NGU A;  2I0C A;  3DLN A;  4G61 A;  2OWS A;  4LZ8 A;  2XXR A;  3LUY A;  4OVJ A;  1RYO A;  2DVZ A;  4DDD A;  4L17 A;  3HPI A;  3OO6 A;  1POT A;  5DYH A;  4F3P A;  1FQA A;  4GX3 A;  2O7I A;  4OVQ A;  2A5S A;  2V25 A;  4U4S A;  4C1T A;  4I3Y A;  1FQC A;  1YCJ A;  3ECR A;  2Y7I A;  3H3G A;  2YPN A;  4O7M A;  1A55 A;  4U4X A;  2UYE A;  3MP6 A;  4N8Y A;  5KCJ A;  3Q25 A;  3CFX A;  1MXY A;  4E0W A;  2Z23 A;  5I7I A;  4OES A;  2CMO A;  3S4U A;  5A5L A;  3PUZ E;  4R6Y A;  2PT1 A;  1UQW A;  2O7U A;  3CVG A;  3UK4 A;  5AA4 B;  4LVQ A;  3PPN A;  2O1M A;  2R6G E;  4MLV A;  1AIV A;  4QFN A;  2VT5 A;  3N5L A;  4DI3 D;  4PF8 A;  4M4G A;  4MNP A;  1R6Z A;  4IGT A;  4BDQ A;  1K9Y A;  3SER A;  3M8U A;  1TT1 A;  3PUX E;  3MYU A;  1VSO A;  4GRK A;  5CMM A;  5ET7 A;  3OO7 A;  4YB6 A;  3QYT A;  3MST A;  4F3G A;  3ROJ A;  3LSF B;  4PFI A;  2XXU A;  5J16 A;  4RK9 A;  4GL0 A;  1POY 1;  1NV4 A;  1FRP A;  2VPN A;  4PF6 A;  1KWH A;  3KBZ A;  3FXU A;  3RT6 B;  4AQ4 A;  2Q89 A;  4N13 A;  2WBD A;  2F7A A;  1MRP A;  1FQE A;  1DTZ A;  3QIM A;  1MM6 A;  1FPE A;  2I49 A;  1B1X A;  2OWZ A;  2Y5L A;  1TFA A;  4P1L A;  3GZG A;  4XTC Q;  3CSG A;  5EYG A;  3MVX A;  3ONM A;  2DE2 A;  1B58 A;  2UYF A;  4IB2 A;  1B3F A;  1US4 A;  1QVS A;  3NOH A;  1UTB B;  2DVC A;  4N91 A;  1EZP A;  3MP1 A;  4EXK A;  2PT2 A;  3KN3 A;  3EHS A;  3QMF A;  1NV7 A;  2P2A A;  2RF1 A;  1FPJ A;  3IOR A;  4F2O A;  5ESY A;  3T93 B;  1XVY A;  1H76 A;  4PDH A;  2A5T B;  1K9Z A;  3P7I A;  5F1Q A;  3O6G A;  4F1V A;  1BKA A;  1FPL A;  4X48 A;  4N17 A;  1EH3 A;  1SQY A;  2O51 A;  3FXB A;  1ZMG A;  2RCA A;  3T9X B;  2JJK A;  3VLV A;  2O6A A;  5K2Y A;  3K6W A;  4N8G A;  3H7M A;  4ZE9 A;  2DS9 A;  1MQG A;  2ZYK A;  2PVU A;  2REG A;  4I40 A;  4TQU Q;  2HPG A;  2FNC A;  4OEN A;  4YB7 A;  1MXV A;  1NL5 A;  3RTW B;  5TU0 A;  1A8F A;  3FXR A;  1DCU A;  4IGR A;  4H8I A;  2PCR A;  3U1O A;  5I2K A;  3MC2 A;  2ZZW A;  3DP8 A;  5I84 A;  1PBP A;  4NF5 A;  1FBH A;  5CMB A;  4OER A;  3IB2 A;  4PET A;  1NV3 A;  4ZE8 A;  3M3F A;  4NED A;  3Q28 A;  1EYK A;  3CFL A;  1SI1 A;  3GXA A;  1QW0 A;  4N4U A;  3EF7 A;  2QPQ A;  5H8Q A;  4H65 A;  3M3L A;  4JWO A;  3IOU A;  4PE3 A;  3RPW A;  2HXR A;  4XF5 A;  5IM2 A;  5I2K B;  3CRB A;  2P1S A;  1RYX A;  1ZTY A;  3FVO A;  2YLN A;  2QVU A;  4NF5 B;  1MDP 1;  2GHA A;  4P8B A;  1M5D A;  2HZK A;  3O6H A;  1N84 A;  4YIC A;  5BUU A;  4OYV A;  4HCW A;  4P3L A;  4JDF A;  5H8Q B;  1LB9 A;  4XXU A;  1OLC A;  1N3W A;  4ZS9 A;  4G68 C;  4JSD A;  5EQ7 A;  3GLB A;  5CMK A;  3H03 A;  4PAK A;  1WDN A;  3AXF A;  4JXI A;  1JP4 A;  3K1M A;  3IOW A;  1N76 A;  3CIJ A;  5AE4 A;  2QS3 A;  4XKP A;  4QFL A;  4ZDM A;  1JW1 A;  4NWD A;  4GXA A;  1N3X A;  1SI0 A;  2ZNT A;  4HS7 A;  2CEY A;  3E9X A;  1JEU A;  5F24 A;  3H6U A;  2Z22 A;  2HXW A;  1NV0 A;  3SKP A;  1B51 A;  2XXY A;  2D3I A;  1D9Q A;  3S9N C;  1MH4 A;  3HST A;  1KA1 A;  4GIZ A;  1SW1 A;  3E3K A;  4GFR A;  1ANF A;  3C32 A;  3KC0 A;  1YXI A;  4DXB A;  5HBC A;  4GWO A;  4AS5 A;  2WBB A;  4EQ9 A;  1UTH A;  4LP2 B;  1FQB A;  4ZZE A;  2I48 A;  3S2V A;  4ZEC A;  2WYK A;  3IO6 A;  2E0S A;  3A3C A;  3FAT A;  4OFJ A;  1QKA A;  4PFU A;  5I5P A;  1H44 A;  2RKM A;  1MQJ A;  5ISU A;  1FPB A;  2DE3 A;  4G2Z A;  1VFE A;  5KZT A;  3VLU A;  3HFU A;  3B8B A;  3UIF A;  5A5X A;  1IUD A;  1Q35 A;  1FBP A;  2F97 A;  3Q29 A;  1A40 A;  1UTH B;  4RNS A;  3RGY A;  3VXC A;  3JZJ A;  4H6D A;  5HM4 B;  3U72 A;  2HCA A;  5JTY A;  3K4U A;  2F7B A;  3QAX A;  4R2F A;  4G8M A;  4DXU A;  1NUZ A;  4NF6 B;  4I8C A;  3C4M A;  3C35 A;  3E78 A;  4OZ9 A;  4M1V A;  4C0R A;  3VLW A;  2HAV A;  4YAH X;  1LBY A;  5JTY B;  4EF1 A;  1B7Z A;  3MPL A;  4Z0I A;  1RDY A;  4H0W A;  1Y20 A;  1BK4 A;  3B6W A;  3OD7 A;  5DEX A;  3RYD A;  3T9U A;  1SD3 A;  3LSL A;  4PAI A;  4H67 A;  5ICQ A;  3FIR A;  2VOZ A;  2XXT A;  2ZNU A;  3TCH A;  4H5G A;  3V83 A;  4QSE A;  2XXV A;  2ZYM A;  3VE1 B;  5I59 B;  3K01 A;  4NN3 A;  4QSD A;  4MX6 A;  3T0J A;  4X8R A;  5T3J A;  3O9P A;  1FTK A;  2OK2 A;  5FTI A;  4KYD A;  1MY0 A;  3FGS A;  1ZU0 A;  2QS4 A;  3G3K A;  1HSL A;  3RY3 A;  4QFK A;  2BJJ X;  1B46 A;  1JVY A;  3L6H A;  3G3G A;  2DXR A;  3BKI B;  2ONR A;  4ELP A;  3R7X A;  3IAZ A;  4BDM A;  1IXC A;  3ODB A;  3O6I A;  3PUV E;  1DBZ A;  2FVZ A;  2Y84 A;  4PBQ A;  5L9O A;  2UVJ A;  2X26 A;  3PPR A;  1MS7 A;  2THI A;  1ATG A;  3T9H B;  4PP0 A;  1RDX A;  2FA7 A;  2H5Y A;  5JK4 A;  3V89 B;  1MXZ A;  3PD9 A;  4MAG A;  5L9M A;  3IO4 A;  2ONS A;  4HCY A;  2CEX A;  3MZ9 A;  1DSN A;  1GV8 A;  4POX A;  4KCD A;  4F22 A;  4JSO A;  3RUM A;  4DZ1 A;  2NUV A;  3THI A;  1NV1 A;  1JW4 A;  4PCD A;  2FHY A;  1GTK A;  4LQ5 A;  2OJT A;  1M5F A;  2CZK A;  3TMG A;  5FTH A;  1LFG A;  5KDT A;  4QHQ A;  1XT8 A;  3MUQ A;  2MKZ A;  3E79 A;  2XXH A;  4FAJ A;  3IOV A;  2V4C A;  3K6U A;  3B6T A;  1NUY A;  1FTO A;  4BDN A;  1NNK A;  4LA9 A;  1MPD A;  3BBR A;  5ET8 A;  4DCX A;  1WVJ A;  4MHF A;  3U93 A;  1H45 A;  2DOJ A;  4EF2 A;  3OEK A;  4PFT A;  2NXO A;  4NX1 A;  4O3C A;  1XC1 A;  3IX1 A;  3SEY A;  2XXQ A;  3KJ7 A;  5KDT B;  1INP A;  3O66 A;  4LN5 A;  3D4G A;  2FBP A;  4R9F A;  3FAS A;  1H3D A;  4PFY A;  2F78 A;  1T0K A;  1N7W A;  3SEW A;  1B1H A;  4OET A;  1MH3 A;  5M2V A;  3PV0 E;  1KA0 A;  2P3V A;  3BIG A;  2M8C A;  4FJP A;  4G77 A;  4F29 A;  2OX3 A;  1A8E A;  2XX7 A;  1LBB A;  2X7Q A;  4AB6 A;  1J1N A;  4PGN A;  2REJ A;  3IFC A;  4P0I A;  2F5X A;  1MQI A;  4H5F A;  3O28 A;  1GVC A;  1N04 A;  2PBW A;  5DT6 A;  3TDJ A;  1LBZ A;  4GWU A;  1MDQ A;  4OVP A;  2WEF A;  4WED A;  4Z7E A;  3N6U A;  4IY6 A;  1YTV A;  3B50 A;  4IR8 A;  3LV0 A;  5KCJ B;  3ZKL A;  4LZ7 A;  3Q27 A;  4NTL A;  1Y9U A;  4O94 A;  4JVD A;  4EDP A;  2HEU A;  2CZL A;  3MW0 A;  4H46 A;  2XX9 A;  4GL8 A;  4OAN A;  1QKB A;  4H8J A;  4MF3 A;  4QRZ A;  5H8H A;  4MIJ A;  4FE8 A;  2I4B A;  1MXU A;  1B0H A;  3PPO A;  4N81 A;  4G8H A;  5IKB A;  4G68 A;  4DIG A;  3HV1 A;  3T9V A;  3KOS A;  1OQH A;  1MQH A;  3OEL A;  4N6P A;  2Q74 A;  4NHB A;  1UIV A;  3FV2 A;  3U94 A;  2ZNS A;  5CMC A;  4F1U A;  1FPK A;  3G7W A;  1B7H A;  5H8H B;  3B7D A;  4FBP A;  3SEX A;  3TFL A;  3QK6 A;  1IMD A;  2H98 A;  4ND9 A;  4Q8R A;  2XA5 A;  4KR5 A;  3KG2 A;  5I3S A;  3FUZ A;  4IO7 A;  2VPO A;  1Y4T A;  1NNP A;  2I6E A;  2XWO A;  4U1Z A;  3K1N A;  4EQ7 A;  2BJI A;  4U22 A;  4GLI A;  1IZ1 A;  3EHU A;  4RPO A;  1I6A A;  1IIT A;  4GQO A;  2DWI A;  1MY2 A;  1MXW A;  1P1U A;  4KYS A;  1US5 A;  1IMA A;  3ISP A;  4QFP A;  3D1R A;  2OLB A;  2H9B A;  1II5 A;  3JYR A;  1IXI A;  4ELR A;  5IGA A;  3PMV A;  2V3T A;  1FJ6 A;  1MPB A;  4TOZ A;  2RC9 A;  1ZJL A;  4NF8 A;  2V84 A;  4I62 A;  4MCO A;  1NNF A;  2AL4 A;  4XFE A;  1KZ8 A;  5IZ3 A;  4BDR A;  1JQF A;  4QXD A;  1B7U A;  2H4I A;  5CC2 A;  1B05 A;  4YKJ A;  3VDF A;  4AS4 A;  2QMW A;  2B65 A;  3CR9 A;  3O29 A;  1QUI A;  1FQD A;  4R2B A;  4NF8 B;  1FPG A;  2HFB A;  4ESX A;  4OFL A;  2L5V A;  4ZEB A;  1OMP A;  4NF4 A;  1SW5 A;  1NKX A;  5I56 A;  1FQF A;  3OEM A;  4FED A;  3R6U A;  3IJX B;  4TLL B;  2D5W A;  1XS5 A;  1FPD A;  2ZYN A;  3KN8 A;  3WAF A;  1NV2 A;  1I69 A;  2OZZ A;  3I6V A;  3PPP A;  5I57 A;  1LFI A;  4O3B A;  3G3J A;  4LAT A;  2ONK E;  1MXX A;  1MY1 A;  4H45 A;  2R9J A;  4YU0 A;  5DTB A;  1NNT A;  1FTM A;  1D9V A;  4NF4 B;  3ZS6 A;  1FBE A;  2G29 A;  5DVJ A;  4O3A A;  5IZZ A;  4N07 A;  3C9H A;  2CZH A;  4F2Q A;  4KFQ A;  1IME A;  2X7P A;  2QRY A;  3TYH A;  4GWX A;  3SEU A;  4JVI A;  4NAP A;  4F3B A;  2Q8J A;  1P1N A;  5DW8 A;  3T66 A;  1ZKB A;  4P1E A;  3OEN A;  3PUY E;  1CB6 A;  2ZXT A;  1URG A;  4GXS B;  3E4R A;  4XIG Q;  3UOR A;  1DPP A;  1SBP A;  5LOM A;  4HTG A;  2Z8E A;  2O69 A;  1HSE A;  3I3V A;  4GWZ A;  4U21 A;  1OQG A;  2ESN A;  3VVD A;  1DK4 A;  3FJG A;  4OTE A;  5EHS A;  1FPI A;  2QMX A;  5AA2 A;  1URD A;  1LCF A;  3TPA A;  1MY3 A;  5EQ9 A;  4JWY A;  3O2A A;  1LEV A;  4KHZ E;  4MFI A;  1VE4 A;  3FV1 A;  5FBP A;  1OVB A;  2V93 A;  3U65 A;  2Q8M A;  1I6Q A;  2Q9T A;  2H99 A;  2F6G A;  4GD5 A;  4YKK A;  1H43 A;  1PBQ A;  1B3L A;  1D4N A;  2XWK A;  5AA2 B;  1BLF A;  3K1P A;  3FXQ A;  3S9L C;  1TWY A;  5ITO A;  4F19 A;  2VD3 A;  1SYI A;  4O7I A;  4ZEF A;  3MZ1 A;  4MLQ A;  4P47 A;  2D21 A;  1EYJ A;  4ESW A;  5A5X B;  4GOT A;  2HQ0 A;  3FJ7 A;  1GR2 A;  2I3W A;  4PBH A;  4P9K A;  2I0B A;  4P11 A;  5DVF A;  3LC8 A;  1L5T A;  3ZKK A;  1NUW A;  3FD3 A;  3KGC A;  3M3K A;  1B40 A;  1PEB A;  4X1B A;  1ZLQ A;  4ELO A;  2Q88 A;  4FEB A;  5EYH A;  3SZP A;  3QUJ A;  3LSW A;  3GYY A;  5H8N A;  1SPI A;  3PUW E;  3DP6 A;  4ONY A;  2I58 A;  4GX4 A;  2Q2A A;  2DP8 A;  3TTM A;  1AH5 A;  4UA8 A;  4BLA A;  2I3V A;  1B4H A;  3O97 A;  1FTJ A;  1FTL A;  1R1N A;  3HN0 A;  5CBS A;  3K6V A;  2XXW A;  4Q30 B;  1YAE A;  1IMF A;  4NWC A;  4XKQ A;  5CM6 A;  4R75 A;  4BDO A;  4P0G A;  1BIY A;  5H8N B;  1VR5 A;  2QS2 A;  4YB5 A;  3MVY A;  4XKN A;  1LFH A;  1NFT A;  5DEX B;  4NG7 A;  3TQL A;  1Z7M E;  1SW4 A;  3B6Q A;  4F1Y A;  2Q2C A;  1B5J A;  2GHB A;  2DQV A;  1QUK A;  4FEC A;  3GBB A;  1JEV A;  3TTN A;  4FAT A;  1PB9 A;  3TTL A;  3PD8 A;  1Q1K A;  2PYY A;  1OVT A;  2DXY A;  3KOT A;  4R74 A;  1RDZ A;  2LAO A;  1B5H A;  4RYA A;  3GBA A;  2WX9 A;  1TXF A;  3CG1 A;  1M5B A;  4OWD A;  1MG1 A;  2Y5K A;  5B7D A;  4KQP A;  3RPL A;  1USY H;  1JW5 A;  4YKI A;  1NV5 A;  1AWB A;  3FJM A;  3N94 A;  4GWS A;  1LGB C;  2KLF A;  3MBP A;  2OWT A;  3S9M C;  3FVG A;  3T1B A;  4MBP A;  3TTR A;  4JVC A;  4U2R A;  3KSJ A;  1M5C A;  4JBZ A;  1IMC A;  3C34 A;  1LBW A;  1IQ7 A;  3FVN A;  3RLF E;  1Q9D A;  4KYE A;  5CRY A;  3RPL B;  2GH9 A;  3QUF A;  3SES A;  4O8M A;  2ANJ A;  4ELQ A;  5BWJ A;  1NH7 A;  5EQA A;  4OMB A;  4MMP A;  1YYZ A;  3TEP A;  1B0L A;  3UP9 A;  2F34 A;  2F7C A;  4ZEK A;  4NF0 A;  1WOD A;  5ICT A;  4IY5 A;  1B3G A;  2V3U A;  3IR1 A;  3RN8 A;  4RK2 A;  1P99 A;  4HXV A;  4DCY A;  4G8N A;  4OEU A;  1B4Z A;  3HCQ A;  3TUS A;  4P56 A;  3IB1 A;  2QL3 A;  4FOR A;  2WYP A;  4HE0 A;  3UGW A;  5ELV A;  4OVR A;  5I58 A;  4GVO A;  4GF8 A;  1MM7 A;  3OO8 A;  3U92 A;  5IAI A;  2XX8 A;  3D4C A;  1S7Y A;  1IXG A;  3T22 A;  3Q26 A;  1A7L A;  4PTK A;  1MQD A;  1PDA A;  4OXV A;  3I5O A;  3PMX A;  5EQ8 A;  5AA4 A;  4U1O A;  1B3E A;  3IOT A;  4MJO A;  2IEE A;  1Z7N E;  3KJT A;  5I58 B;  3LSX A;  2VD2 A;  2FIX A;  4YMB A;  5LDZ A;  3C33 A;  3U8Q A;  5AA1 A;  3PGF A;  2NVU B;  2HHM A;  2ZMB A;  4PFR A;  2OCU A;  3A3U A;  3UA8 A;  4ECF A;  4PDD A;  5H8S A;  3K2D A;  4Q0C A;  3OSQ A;  2F3D A;  1PC3 A;  4EQB A;  4DI4 B;  1FPF A;  1LBC A;  4N6K A;  4ZZA A;  3BFT A;  4K3F A;  5DVI A;  1SVX B;  4EXL A;  1LST A;  4RY1 A;  4TLM B;  2HAU A;  2F8D A;  5CBR A;  3DM0 A;  4DE8 A;  4GWY A;  3VVF A;  3W15 C;  3MVZ A;  3RT8 A;  3A29 A;  4LUB A;  4X1D A;  5TPA A;  1LAX A;  2B4M A;  3H06 B;  3K6X A;  2OBG A;  2XD3 A;  4KPT A;  4GBW A;  1D3K A;  1EYI A;  3CG3 A;  3SET A;  4MEV A;  1VFD A;  4H1X A;  2PMS A;  4G68 B;  1MY4 A;  4QF9 A;  3HHG A;  2W7Y A;  1UTB A;  4LZ5 A;  4QBA A;  5EHM A;  1EU8 A;  3W9W A;  4GWW A;  5TPA B;  4GBV A;  3VV5 A;  4YZZ A;  5I2N A;  4GX6 A;  3PMW A;  1Y1Z A;  1FBG A;  3IFA A;  3H6T A;  1LB8 A;  5JEI A;  2XHD A;  2A5T A;  2XXP A;  5ET5 A;  1UIU A;  4R6H A;  4ISU A;  3QSL A;  2WKY A;  1B9J A;  2DWH A;  5LTC A;  5FHM A;  4MNI A;  2DWJ A;  1GGG A;  1I6B A;  5FHO A;  5I2N B;  4ZED A;  2NOO A;  4LQ2 A;  1FBD A;  2DSF A;  3IJO B;  1B6H A;  1Y3N A;  1AL3 A;  1FJ9 A;  3OXN A;  1BTJ A;  1B2H A;  3TCF A;  5L8D A;  3CI8 A;  2XWI A;  5K2X A;  3C36 A;  4RXL A;  4WXJ A;  2H25 A;  1SW2 A;  3USD A;  1NI9 A;  3FZV A;  3EQ1 A;  4N6D A;  1O64 A;  1QUJ A;  2YJP A;  2UVG A;  2ZZX A;  3KBR A;  4OFO A;  3CFZ A;  2Z8D A;  4R9G A;  1IXH A;  5B70 A;  1FCK A;  2Y7P A;  2GQ1 A;  3OSR A;  2B3F A;  4F18 A;  3TKD A;  4OEV A;  5TP9 A;  1SDX A;  4UAB A;  2Y7R A;  2F3B A;  3MQ9 A;  1OIB A;  3H6W A;  2CZI A;  3TZA A;  1Y3Q A;  4X9T A;  3N6T A;  5IZ3 B;  2PFZ A;  1NH8 A;  4X04 A;  1IEJ A;  4MNC A;  4R72 A;  2ZYO A;  4PGP A;  1G0H A;  1BP5 A;  2B4L A;  3OOA A;  3RQT A;  2Y7W A;  3F11 A;  3K0V A;  4IO5 A;  3KFM A;  1Y1M A;  1FBC A;  4FIM A;  5TP9 B;  3K00 A;  2I4C A;  3KC1 A;  3G3I A;  2UXA A;  4RA1 A;  1R9L A;  4XEQ A;  4PC9 A;  1TFD A;  2R8T A;  1QUL A;  2RC8 A;  1NV6 A;  4R6K A;  5I56 B;  1YPN A;  1LBV A;  2AIX A;  1SYH A;  3LR1 A;  3N26 A;  1G0I A;  2Z8F A;  1B52 A;  4THI A;  1VDW A;  5I57 B;  3IL1 B;  1B3H A;  2F36 A;  3A09 A;  3MWB A;  3EN3 A;  1JET A;  3LUZ A;  3IK6 B;  2Y7K A;  3V8X B;  3PTY A;  4N15 A;  2RC7 A;  5HPQ A;  4R73 A;  5EYF A;  1B5I A;  4PQJ A;  3ILU B;  2R71 A;  2VGQ A;  3KEI A;  2GRV A;  3KN7 A;  3BFU A;  4OHN A;  4MH5 A;  5L9S A;  3S9E A;  2E1S A;  4LON B;  3V5A A;  5AA2 D;  1OLA A;  2O68 A;  4G4P A;  1Y4C A;  3QXM A;  3DEL B;  3R26 A;  2P3N A;  4KI0 E;  4KD5 A;  2O1L A;  4KXP A;  3RNN A;  1FSA A;  3VXB A; 
#chains in the Genus database with same CATH homology
 2HZL A;  1S9T A;  2PX1 A;  3OMB A;  1R9Q A;  4AB5 A;  1PB7 A;  3SDF A;  3MJN A;  1QJM A;  2ABH A;  4YKP A;  1DMB A;  3DP4 A;  3K02 A;  1Y3P A;  3EHT A;  3KSX A;  4NF6 A;  4PFW A;  3W9V A;  3OO9 A;  4PE5 B;  4QSC A;  1JNF A;  4E0X A;  3UN6 A;  3SEV A;  1P1Q A;  3ZSF A;  1N7X A;  2VHA A;  4IO6 A;  3ILT B;  4I9D A;  1LLS A;  5H8F A;  1NMU A;  2F35 A;  5AA3 A;  2DE4 A;  2NWJ A;  4RPN A;  2XD2 A;  3MAM A;  4F39 A;  1IIW A;  2GFE A;  2ALU A;  3MZB A;  2AL5 A;  3JV9 A;  3H6V A;  1P1W A;  3MVW A;  1LAF E;  4F3S A;  3TOD A;  1DOT A;  3G3F A;  4C1U A;  3HO7 A;  1CE2 A;  2B3B A;  5ITP A;  4IO4 A;  5H8F B;  5I59 A;  1DPE A;  1N0T A;  4POW A;  1O7T A;  3G3H A;  1RKM A;  1S50 A;  2QJE A;  1DTG A;  2G93 A;  4WKM A;  4DLD A;  4KCC A;  2UVI A;  1XVX A;  4RJZ A;  1HSJ A;  3TEL A;  1XOC A;  2RIN A;  3L6G A;  2RCB A;  1O63 A;  3HHF A;  2QS1 A;  1ZIU A;  5J1D A;  1D9Y A;  1FW0 A;  4OQO A;  2XXI A;  1EZ9 A;  3WAE A;  1XHY A;  1LAG E;  1PB8 A;  3C31 A;  2P0S A;  4F31 B;  1B32 A;  4IO3 A;  2VP1 A;  1P1O A;  2O84 X;  1LCT A;  4UAC A;  2FYI A;  4YMA A;  5FHN A;  3PPQ A;  1URS A;  4BDL A;  3CSB A;  5F7V A;  3VVE A;  2IA4 A;  3EPE A;  3E13 X;  1A54 A;  3RTF B;  3FVK A;  3LBS A;  4ZEI A;  4EUO A;  2DYX A;  4U23 A;  1A99 A;  4HW8 A;  4XKR A;  3MP8 A;  4WEP A;  4JB7 A;  5CI5 A;  3VFJ A;  1M5E A;  1ELJ A;  3TQW A;  3TTK A;  4Q5T A;  4JWX A;  1JVX A;  1AOV A;  2QSX A;  3IB0 A;  2XXX A;  4IO2 A;  4QFO A;  2UVH A;  1ZBM A;  2V3Q A;  3MPK A;  3TCG A;  3T96 B;  3H4Z A;  4DXC A;  2F6P A;  1F9B A;  1USY E;  2AYS A;  2DWA A;  4NE4 A;  1AMF A;  1MPC A;  4NMY A;  4I1D A;  3PU5 A;  1EZO A;  1LAH E;  3TAJ A;  3KZG A;  2I0C A;  3DLN A;  2OWS A;  4LZ8 A;  2XXR A;  3LUY A;  4OVJ A;  1RYO A;  2DVZ A;  4DDD A;  4L17 A;  3HPI A;  3OO6 A;  1POT A;  5DYH A;  4F3P A;  1FQA A;  2O7I A;  2A5S A;  2V25 A;  4U4S A;  4C1T A;  1FQC A;  1YCJ A;  3ECR A;  2Y7I A;  3H3G A;  2YPN A;  1A55 A;  4U4X A;  2UYE A;  3MP6 A;  5KCJ A;  3Q25 A;  3CFX A;  1MXY A;  4E0W A;  2Z23 A;  4OES A;  2CMO A;  3S4U A;  3PUZ E;  4R6Y A;  2PT1 A;  1UQW A;  2O7U A;  3CVG A;  3UK4 A;  5AA4 B;  4LVQ A;  3PPN A;  2O1M A;  2R6G E;  4MLV A;  1AIV A;  4QFN A;  3N5L A;  4M4G A;  1R6Z A;  4BDQ A;  4IGT A;  3SER A;  3M8U A;  1TT1 A;  3PUX E;  1VSO A;  4GRK A;  5CMM A;  3OO7 A;  4YB6 A;  3QYT A;  4F3G A;  3LSF B;  2XXU A;  4RK9 A;  4GL0 A;  1POY 1;  1KWH A;  3FXU A;  3RT6 B;  4AQ4 A;  2Q89 A;  4N13 A;  2F7A A;  1MRP A;  1FQE A;  1DTZ A;  3QIM A;  1MM6 A;  2I49 A;  1B1X A;  1TFA A;  3GZG A;  4XTC Q;  3CSG A;  3MVX A;  3ONM A;  2DE2 A;  1B58 A;  2UYF A;  4IB2 A;  1B3F A;  1US4 A;  1QVS A;  1UTB B;  2DVC A;  1EZP A;  3MP1 A;  4EXK A;  2PT2 A;  3KN3 A;  3EHS A;  2P2A A;  2RF1 A;  3IOR A;  4F2O A;  3T93 B;  1XVY A;  1H76 A;  2A5T B;  3P7I A;  5F1Q A;  3O6G A;  4F1V A;  1BKA A;  4X48 A;  1EH3 A;  1SQY A;  2O51 A;  1ZMG A;  2RCA A;  3T9X B;  3VLV A;  2O6A A;  5K2Y A;  3K6W A;  3H7M A;  4ZE9 A;  2DS9 A;  1MQG A;  2ZYK A;  2PVU A;  2REG A;  4TQU Q;  2FNC A;  4OEN A;  4YB7 A;  1MXV A;  1NL5 A;  3RTW B;  5TU0 A;  1A8F A;  3FXR A;  4IGR A;  4H8I A;  3U1O A;  5I2K A;  3MC2 A;  3DP8 A;  5I84 A;  1PBP A;  4NF5 A;  5CMB A;  4OER A;  3IB2 A;  4PET A;  4ZE8 A;  3M3F A;  4NED A;  3Q28 A;  3CFL A;  1SI1 A;  3GXA A;  1QW0 A;  3EF7 A;  2QPQ A;  5H8Q A;  4H65 A;  3M3L A;  4JWO A;  3IOU A;  3RPW A;  5I2K B;  3CRB A;  2P1S A;  1RYX A;  1ZTY A;  3FVO A;  2YLN A;  4NF5 B;  1MDP 1;  2GHA A;  1M5D A;  2HZK A;  3O6H A;  1N84 A;  4YIC A;  5BUU A;  4OYV A;  4HCW A;  4JDF A;  5H8Q B;  1LB9 A;  4XXU A;  1OLC A;  1N3W A;  4ZS9 A;  4G68 C;  4JSD A;  3GLB A;  5CMK A;  3H03 A;  1WDN A;  3AXF A;  4JXI A;  3K1M A;  3IOW A;  1N76 A;  3CIJ A;  5AE4 A;  2QS3 A;  4XKP A;  4QFL A;  4ZDM A;  1JW1 A;  4NWD A;  4GXA A;  1N3X A;  1SI0 A;  2ZNT A;  4HS7 A;  3E9X A;  1JEU A;  3H6U A;  2Z22 A;  2HXW A;  3SKP A;  1B51 A;  2XXY A;  2D3I A;  3S9N C;  1MH4 A;  3HST A;  4GIZ A;  1SW1 A;  3E3K A;  4GFR A;  1ANF A;  3C32 A;  4DXB A;  5HBC A;  4GWO A;  4EQ9 A;  1UTH A;  4LP2 B;  1FQB A;  4ZZE A;  2I48 A;  3S2V A;  4ZEC A;  3IO6 A;  2E0S A;  3A3C A;  3FAT A;  4OFJ A;  1QKA A;  4PFU A;  1H44 A;  2RKM A;  1MQJ A;  5ISU A;  2DE3 A;  4G2Z A;  1VFE A;  5KZT A;  3VLU A;  3UIF A;  5A5X A;  1IUD A;  1Q35 A;  2F97 A;  3Q29 A;  1A40 A;  1UTH B;  4RNS A;  3RGY A;  3VXC A;  3JZJ A;  4H6D A;  5HM4 B;  3U72 A;  2HCA A;  5JTY A;  3K4U A;  2F7B A;  3QAX A;  4R2F A;  4G8M A;  4DXU A;  4NF6 B;  4I8C A;  3C4M A;  3C35 A;  4OZ9 A;  4M1V A;  4C0R A;  3VLW A;  2HAV A;  4YAH X;  5JTY B;  4EF1 A;  1B7Z A;  3MPL A;  4Z0I A;  4H0W A;  1Y20 A;  3B6W A;  3OD7 A;  5DEX A;  3T9U A;  1SD3 A;  3LSL A;  4H67 A;  5ICQ A;  3FIR A;  2VOZ A;  2XXT A;  2ZNU A;  3TCH A;  4H5G A;  3V83 A;  4QSE A;  2XXV A;  2ZYM A;  3VE1 B;  5I59 B;  3K01 A;  4QSD A;  3O9P A;  1FTK A;  2OK2 A;  5FTI A;  4KYD A;  1MY0 A;  3FGS A;  1ZU0 A;  2QS4 A;  3G3K A;  1HSL A;  3RY3 A;  4QFK A;  2BJJ X;  1B46 A;  1JVY A;  3L6H A;  3G3G A;  2DXR A;  3BKI B;  2ONR A;  4ELP A;  3R7X A;  3IAZ A;  4BDM A;  1IXC A;  3ODB A;  3O6I A;  3PUV E;  2Y84 A;  5L9O A;  2UVJ A;  2X26 A;  3PPR A;  1MS7 A;  2THI A;  1ATG A;  3T9H B;  4PP0 A;  2FA7 A;  2H5Y A;  5JK4 A;  3V89 B;  1MXZ A;  3PD9 A;  5L9M A;  3IO4 A;  2ONS A;  4HCY A;  3MZ9 A;  1DSN A;  1GV8 A;  4POX A;  4KCD A;  4F22 A;  4JSO A;  3RUM A;  4DZ1 A;  2NUV A;  3THI A;  1JW4 A;  1GTK A;  4LQ5 A;  2OJT A;  1M5F A;  3TMG A;  5FTH A;  1LFG A;  5KDT A;  4QHQ A;  1XT8 A;  3MUQ A;  2XXH A;  4FAJ A;  3IOV A;  3K6U A;  3B6T A;  1FTO A;  4BDN A;  1NNK A;  4LA9 A;  1MPD A;  3BBR A;  4DCX A;  1WVJ A;  3U93 A;  1H45 A;  2DOJ A;  4EF2 A;  3OEK A;  4PFT A;  2NXO A;  4O3C A;  1XC1 A;  3IX1 A;  3SEY A;  2XXQ A;  3KJ7 A;  5KDT B;  3O66 A;  3D4G A;  3FAS A;  4R9F A;  1H3D A;  4PFY A;  2F78 A;  1T0K A;  1N7W A;  3SEW A;  1B1H A;  4OET A;  1MH3 A;  5M2V A;  3PV0 E;  4FJP A;  2M8C A;  4G77 A;  4F29 A;  1A8E A;  2XX7 A;  1LBB A;  2X7Q A;  4AB6 A;  1J1N A;  2REJ A;  4P0I A;  2F5X A;  1MQI A;  4H5F A;  3O28 A;  1GVC A;  1N04 A;  2PBW A;  5DT6 A;  3TDJ A;  1MDQ A;  4WED A;  4Z7E A;  3N6U A;  4IY6 A;  1YTV A;  5KCJ B;  3ZKL A;  4LZ7 A;  3Q27 A;  4NTL A;  1Y9U A;  4EDP A;  2HEU A;  2CZL A;  3MW0 A;  2XX9 A;  4GL8 A;  1QKB A;  4H8J A;  4MF3 A;  4QRZ A;  5H8H A;  4FE8 A;  2I4B A;  1MXU A;  1B0H A;  3PPO A;  4G8H A;  5IKB A;  4G68 A;  4DIG A;  3HV1 A;  3T9V A;  3KOS A;  1OQH A;  1MQH A;  3OEL A;  4N6P A;  1UIV A;  3FV2 A;  3U94 A;  2ZNS A;  5CMC A;  4F1U A;  3G7W A;  1B7H A;  5H8H B;  3B7D A;  3SEX A;  3TFL A;  3QK6 A;  2H98 A;  4ND9 A;  4Q8R A;  4KR5 A;  3KG2 A;  3FUZ A;  4IO7 A;  1Y4T A;  1NNP A;  2I6E A;  4U1Z A;  3K1N A;  4EQ7 A;  4U22 A;  4GLI A;  1IZ1 A;  3EHU A;  4RPO A;  1I6A A;  1IIT A;  4GQO A;  2DWI A;  1MY2 A;  1MXW A;  1P1U A;  4KYS A;  1US5 A;  4QFP A;  2OLB A;  2H9B A;  1II5 A;  3JYR A;  1IXI A;  4ELR A;  3PMV A;  2V3T A;  1MPB A;  4TOZ A;  2RC9 A;  1ZJL A;  4NF8 A;  2V84 A;  4I62 A;  1NNF A;  2AL4 A;  4BDR A;  1JQF A;  1B7U A;  2H4I A;  5CC2 A;  1B05 A;  4YKJ A;  3VDF A;  2QMW A;  2B65 A;  3CR9 A;  3O29 A;  1QUI A;  1FQD A;  4R2B A;  4NF8 B;  2HFB A;  4ESX A;  4OFL A;  4ZEB A;  1OMP A;  4NF4 A;  1SW5 A;  1NKX A;  5I56 A;  1FQF A;  3OEM A;  4FED A;  3R6U A;  3IJX B;  4TLL B;  2D5W A;  1XS5 A;  2ZYN A;  3KN8 A;  3WAF A;  1I69 A;  2OZZ A;  3I6V A;  3PPP A;  5I57 A;  1LFI A;  4O3B A;  3G3J A;  4LAT A;  2ONK E;  1MXX A;  1MY1 A;  2R9J A;  4YU0 A;  5DTB A;  1NNT A;  1FTM A;  1D9V A;  4NF4 B;  3ZS6 A;  2G29 A;  5DVJ A;  4O3A A;  4N07 A;  3C9H A;  4F2Q A;  4KFQ A;  2X7P A;  3TYH A;  2QRY A;  3SEU A;  4F3B A;  2Q8J A;  1P1N A;  3T66 A;  1ZKB A;  3OEN A;  3PUY E;  1CB6 A;  2ZXT A;  1URG A;  4GXS B;  3E4R A;  4XIG Q;  3UOR A;  1DPP A;  1SBP A;  5LOM A;  4HTG A;  2Z8E A;  2O69 A;  1HSE A;  3I3V A;  4U21 A;  1OQG A;  2ESN A;  3VVD A;  3FJG A;  4OTE A;  5EHS A;  2QMX A;  5AA2 A;  1URD A;  1LCF A;  3TPA A;  1MY3 A;  4JWY A;  3O2A A;  4KHZ E;  3FV1 A;  1VE4 A;  4MFI A;  1OVB A;  2V93 A;  1I6Q A;  2Q9T A;  2H99 A;  2F6G A;  4GD5 A;  4YKK A;  1H43 A;  1PBQ A;  1B3L A;  1D4N A;  5AA2 B;  1BLF A;  3K1P A;  3FXQ A;  3S9L C;  1TWY A;  5ITO A;  4F19 A;  2VD3 A;  1SYI A;  4ZEF A;  3MZ1 A;  4MLQ A;  2D21 A;  4ESW A;  5A5X B;  4GOT A;  2HQ0 A;  3FJ7 A;  1GR2 A;  2I3W A;  2I0B A;  4P11 A;  5DVF A;  3LC8 A;  1L5T A;  3ZKK A;  3FD3 A;  3KGC A;  3M3K A;  1B40 A;  1PEB A;  4X1B A;  1ZLQ A;  4ELO A;  2Q88 A;  4FEB A;  3QUJ A;  3LSW A;  5H8N A;  3PUW E;  3DP6 A;  4ONY A;  2I58 A;  2Q2A A;  2DP8 A;  3TTM A;  1AH5 A;  4UA8 A;  4BLA A;  2I3V A;  1B4H A;  3O97 A;  1FTJ A;  1FTL A;  1R1N A;  3HN0 A;  5CBS A;  3K6V A;  2XXW A;  4Q30 B;  1YAE A;  4NWC A;  4XKQ A;  5CM6 A;  4R75 A;  4BDO A;  4P0G A;  1BIY A;  5H8N B;  1VR5 A;  2QS2 A;  4YB5 A;  3MVY A;  4XKN A;  1LFH A;  1NFT A;  5DEX B;  3TQL A;  1Z7M E;  1SW4 A;  3B6Q A;  4F1Y A;  2Q2C A;  1B5J A;  2GHB A;  2DQV A;  1QUK A;  4FEC A;  3GBB A;  1JEV A;  3TTN A;  4FAT A;  1PB9 A;  3TTL A;  3PD8 A;  1Q1K A;  2PYY A;  1OVT A;  2DXY A;  3KOT A;  4R74 A;  2LAO A;  1B5H A;  4RYA A;  3GBA A;  1TXF A;  3CG1 A;  1M5B A;  4OWD A;  1MG1 A;  5B7D A;  4KQP A;  1USY H;  1JW5 A;  4YKI A;  3FJM A;  3N94 A;  1LGB C;  2KLF A;  3MBP A;  2OWT A;  3S9M C;  3FVG A;  4MBP A;  3TTR A;  4U2R A;  3KSJ A;  1M5C A;  4JBZ A;  3C34 A;  1IQ7 A;  3FVN A;  3RLF E;  4KYE A;  5CRY A;  2GH9 A;  3QUF A;  3SES A;  2ANJ A;  4ELQ A;  5BWJ A;  1NH7 A;  4OMB A;  3TEP A;  1B0L A;  3UP9 A;  2F34 A;  2F7C A;  4ZEK A;  1WOD A;  5ICT A;  4IY5 A;  1B3G A;  2V3U A;  3IR1 A;  3RN8 A;  4RK2 A;  1P99 A;  4DCY A;  4G8N A;  4OEU A;  1B4Z A;  3HCQ A;  3TUS A;  3IB1 A;  2QL3 A;  4FOR A;  3UGW A;  5ELV A;  5I58 A;  4GVO A;  4GF8 A;  1MM7 A;  3OO8 A;  3U92 A;  5IAI A;  2XX8 A;  3D4C A;  1S7Y A;  1IXG A;  3T22 A;  3Q26 A;  1A7L A;  1MQD A;  1PDA A;  4OXV A;  3I5O A;  3PMX A;  5AA4 A;  4U1O A;  1B3E A;  3IOT A;  2IEE A;  1Z7N E;  3KJT A;  5I58 B;  3LSX A;  2VD2 A;  4YMB A;  3C33 A;  3U8Q A;  5AA1 A;  3PGF A;  2NVU B;  2ZMB A;  2OCU A;  3A3U A;  3UA8 A;  4ECF A;  5H8S A;  3K2D A;  4Q0C A;  3OSQ A;  1PC3 A;  4EQB A;  1LBC A;  4ZZA A;  3BFT A;  4K3F A;  5DVI A;  1SVX B;  4EXL A;  1LST A;  4RY1 A;  4TLM B;  2HAU A;  2F8D A;  5CBR A;  3DM0 A;  4DE8 A;  3VVF A;  3W15 C;  3MVZ A;  3RT8 A;  4LUB A;  4X1D A;  5TPA A;  1LAX A;  3H06 B;  3K6X A;  2OBG A;  2XD3 A;  4KPT A;  1D3K A;  3CG3 A;  3SET A;  1VFD A;  4H1X A;  2PMS A;  4G68 B;  1MY4 A;  4QF9 A;  3HHG A;  2W7Y A;  1UTB A;  4LZ5 A;  5EHM A;  1EU8 A;  3W9W A;  5TPA B;  3VV5 A;  4YZZ A;  5I2N A;  3PMW A;  1Y1Z A;  3H6T A;  1LB8 A;  5JEI A;  2XHD A;  2A5T A;  2XXP A;  1UIU A;  4R6H A;  4ISU A;  3QSL A;  2WKY A;  1B9J A;  2DWH A;  5FHM A;  2DWJ A;  1GGG A;  1I6B A;  5FHO A;  5I2N B;  4ZED A;  2NOO A;  4LQ2 A;  2DSF A;  3IJO B;  1B6H A;  1Y3N A;  1AL3 A;  3OXN A;  1BTJ A;  1B2H A;  3TCF A;  5L8D A;  3CI8 A;  5K2X A;  3C36 A;  4RXL A;  4WXJ A;  2H25 A;  1SW2 A;  3USD A;  3FZV A;  3EQ1 A;  1O64 A;  1QUJ A;  2YJP A;  2UVG A;  3KBR A;  4OFO A;  3CFZ A;  2Z8D A;  4R9G A;  1IXH A;  5B70 A;  1FCK A;  2Y7P A;  3OSR A;  2B3F A;  4F18 A;  3TKD A;  4OEV A;  5TP9 A;  1SDX A;  2Y7R A;  3MQ9 A;  1OIB A;  3H6W A;  3TZA A;  1Y3Q A;  4X9T A;  3N6T A;  1NH8 A;  1IEJ A;  4R72 A;  2ZYO A;  1BP5 A;  3OOA A;  3RQT A;  2Y7W A;  3F11 A;  3K0V A;  4IO5 A;  3KFM A;  1Y1M A;  4FIM A;  5TP9 B;  3K00 A;  2I4C A;  3G3I A;  2UXA A;  4RA1 A;  1R9L A;  1TFD A;  1QUL A;  2RC8 A;  4R6K A;  5I56 B;  1YPN A;  2AIX A;  1SYH A;  3LR1 A;  3N26 A;  2Z8F A;  1B52 A;  4THI A;  5I57 B;  3IL1 B;  1B3H A;  2F36 A;  3A09 A;  3MWB A;  3EN3 A;  1JET A;  3IK6 B;  2Y7K A;  3V8X B;  2RC7 A;  5HPQ A;  4R73 A;  5EYF A;  1B5I A;  4PQJ A;  3ILU B;  2R71 A;  2VGQ A;  3KEI A;  2GRV A;  3KN7 A;  3BFU A;  4OHN A;  4MH5 A;  5L9S A;  3S9E A;  2E1S A;  4LON B;  3V5A A;  5AA2 D;  1OLA A;  2O68 A;  4G4P A;  1Y4C A;  3QXM A;  3DEL B;  3R26 A;  4KI0 E;  4KD5 A;  2O1L A;  3RNN A;  3VXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...