1A55A

Phosphate-binding protein mutant a197c
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
321
structure length
321
Chain Sequence
EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGTSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYCYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of phosphate binding protein labeled with a coumarin fluorophore, a probe for inorganic phosphate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphotransferase
molecule keywords PHOSPHATE-BINDING PROTEIN
total genus 107
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 1998-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1a55A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1a55A02
2UVIA 3UIFA 1N0TA 5BUUA 3EN3A 3TTKA 1USYE 1HSEA 5KDTA 3T22A 3MZBA 3OELA 3C33A 3FZVA 3OO7A 1B32A 3H6WA 1FW0A 4OMBA 4JSDA 1B58A 3PPOA 4GL0A 2FNCA 2RINA 2Z8DA 3TCHA 2ONRA 4H5GA 2F78A 2G29A 1IUDA 4IY6A 3FV1A 4EQ9A 5BWJA 4IO7A 4OZ9A 4OXVA 4YKKA 1LAHE 3TUSA 3LSWA 2RC7A 4XKNA 3O9PA 4YKIA 4QSDA 3VVEA 2I49A 2ZNTA 3K00A 1MH4A 5DYHA 1ZKBA 5H8NA 1XC1A 3FXQA 3MJNA 5CMCA 3S4UA 1OLCA 4NF8B 2RF1A 2B3FA 4UACA 3ZS6A 5CMBA 1FQEA 3LBSA 3K02A 1Y4CA 2CZLA 2R71A 2Z8FA 3KN7A 3LC8A 1UTHB 4R2BA 2ZYKA 4XIGQ 3TYHA 2H99A 1DTGA 3MUQA 5I56A 2ANJA 3IAZA 3TTLA 4ESWA 1BP5A 3FV2A 5B70A 4KI0E 1D9YA 1IEJA 1N7WA 3MP6A 2DQVA 3EHSA 3OD7A 1B7ZA 3P7IA 2G93A 1J1NA 2OWTA 3B6TA 4ZS9A 3FJ7A 4G8HA 4I62A 5I2NB 1MDQA 3V8XB 5JTYB 4OFOA 1M5FA 2DE4A 3O29A 5KDTB 1R1NA 1RYOA 3N6UA 3W9VA 3VLVA 1WVJA 4NWCA 3M3FA 1M5CA 3MP1A 5KZTA 4OWDA 4RA1A 3O6GA 4JBZA 5JK4A 1LB9A 3FIRA 1RYXA 4Q0CA 1D4NA 3TTNA 3W9WA 2ESNA 4GF8A 4LUBA 4OFLA 3DLNA 4F1YA 5I58B 2YJPA 3MVXA 3I6VA 4GWOA 4P0GA 4U21A 4YAHX 2HZKA 1IIWA 3G7WA 4DE8A 1MQGA 3FASA 2B65A 3IB0A 4G77A 3U93A 4DXUA 1PC3A 4M1VA 4U4XA 2FA7A 3DELB 3RGYA 2I4CA 3LUYA 4K3FA 1HSJA 1MY3A 3BFTA 1FTKA 5EYFA 5L9MA 1I6AA 1H44A 1B6HA 4FE8A 4BDMA 1XS5A 3HCQA 5I57A 2XX7A 4POWA 4PFUA 3CVGA 1ZJLA 3H4ZA 3C32A 3K6VA 4LP2B 1NNTA 4QRZA 3IO4A 3LSFB 3TCFA 3VV5A 3H06B 2OJTA 1P1NA 1SBPA 2VGQA 4LA9A 1VR5A 2VD3A 3SKPA 4YMAA 3K2DA 5EHSA 3PMXA 4XKPA 2ZXTA 3OEKA 3O28A 2I3WA 2W7YA 1PDAA 5DVFA 3RN8A 1A55A 4PQJA 4DCYA 2Q89A 3JZJA 2IA4A 1UIUA 2DWIA 3IB1A 4EQBA 3IOWA 5L9SA 4P0IA 1IXGA 1D9VA 2F7CA 1UQWA 2XXRA 4KD5A 2NVUB 1B7HA 5ITOA 2Z23A 3O6IA 3FUZA 4XTCQ 2ALUA 3TPAA 3FXRA 3CSBA 5I56B 3U94A 1M5BA 1UTHA 1LGBC 4LQ2A 1PB9A 2DOJA 3A3CA 2XXYA 1GVCA 4KYEA 3USDA 5CC2A 4F18A 2IEEA 3PUYE 1URGA 4U22A 3T9UA 4F3PA 3SEXA 3O2AA 3KJ7A 3Q28A 5DVJA 1MPDA 1SW4A 2UYFA 5AA4A 4ZEDA 5L9OA 1XVXA 3PD8A 1EZ9A 2YLNA 4ELRA 2RC9A 1BTJA 3Q29A 4FATA 2YPNA 3R6UA 3M8UA 1LB8A 1O63A 4M4GA 4H0WA 3C31A 2F34A 1JETA 5L8DA 1SI0A 4I8CA 5I59B 3H6VA 1UIVA 1IXHA 2ZMBA 1EU8A 1OLAA 1B5IA 1DSNA 1SVXB 3KZGA 2AL5A 5CRYA 1B3EA 1A8EA 3RLFE 4RK2A 1LBCA 1LCFA 2A5TA 1YCJA 3T9XB 5HM4B 1ELJA 5ICQA 3G3FA 3O6HA 3A3UA 3CFLA 2KLFA 3CSGA 2X7PA 2I6EA 4MFIA 3T93B 4QFKA 3MZ1A 4OERA 4E0WA 3M3KA 3FXUA 3QSLA 2ZNSA 4U2RA 2OK2A 2QS1A 4EQ7A 1AOVA 4NMYA 3HV1A 4OENA 4R2FA 4KFQA 2V93A 2RCAA 4ZEFA 2GHAA 3FVGA 5H8HA 2XD3A 1LAXA 3HSTA 1VSOA 2DVCA 5AA1A 3MW0A 4G8NA 3PUZE 1B3FA 3OMBA 1SYIA 2F35A 1H76A 4MBPA 1RKMA 3KG2A 2DVZA 3SERA 3GZGA 1FQFA 2UXAA 2I48A 3O97A 4ZZEA 2DXRA 3VLUA 1A7LA 3HN0A 1DMBA 2NUVA 4GLIA 3TQWA 1B3LA 1EZPA 1LFHA 3CG1A 2REJA 3OSRA 1JVXA 1N3WA 1Y4TA 2QL3A 4PETA 1Q35A 4PFYA 3FVNA 3TFLA 3BFUA 4FAJA 4O3AA 3PPRA 2V3TA 2V84A 4WEPA 4F3SA 3VXBA 2F97A 3FGSA 4JSOA 3TMGA 5CBSA 4FEDA 4KHZE 1NMUA 4AQ4A 1BIYA 1SD3A 4GQOA 5DVIA 1P1WA 4O3CA 5H8SA 3Q25A 3WAEA 3KBRA 1P99A 1Q1KA 4H65A 2ONKE 5F1QA 3K6UA 3T9VA 3WAFA 2QS3A 2PMSA 3W15C 2F6GA 4N13A 1JVYA 1EH3A 3EF7A 1VFEA 1XHYA 4OEUA 1TWYA 2VOZA 5FTIA 4ZEIA 1M5EA 1QKBA 2HAUA 4NEDA 4QHQA 2XXTA 3B6QA 1PEBA 2DS9A 1JNFA 2H25A 3IO6A 1LSTA 5TU0A 1QUIA 4OTEA 1DTZA 4F2OA 1OQGA 4GIZA 2P1SA 3KN3A 1XVYA 3C36A 2XX8A 3H6TA 3PMVA 2DE2A 1JW4A 1B5JA 3RNNA 4IGTA 5KCJA 1OVBA 3G3HA 4RNSA 4GOTA 5B7DA 1PBQA 1N04A 2E1SA 3BKIB 3V89B 4FORA 3H6UA 2GH9A 4TLLB 2D3IA 3TELA 1MY4A 1O64A 1Y3PA 4EUOA 3VFJA 4POXA 5JTYA 4EF1A 4GVOA 1ATGA 1SDXA 3IORA 2XXWA 4O3BA 1GGGA 4P11A 4RYAA 1YAEA 1A99A 1ANFA 4NE4A 4TQUQ 3E9XA 1AH5A 1SW5A 2OLBA 3EHTA 5EHMA 2DWHA 4RPNA 4YZZA 3PPNA 2XXVA 3SEWA 1MQHA 2H98A 4ZE8A 4EDPA 4HTGA 3OO9A 1Y3NA 4EXKA 4YB7A 1N3XA 2ZYOA 2D5WA 4FJPA 2A5SA 4IB2A 4JB7A 1A40A 1TFDA 3A09A 4NF8A 5M2VA 4BDNA 1WDNA 1H43A 3E13X 3FATA 3I3VA 3IB2A 3MAMA 4JWYA 1MRPA 4LQ5A 3G3JA 4R74A 4MLVA 3IX1A 4X1DA 3QAXA 1Y20A 1OIBA 4LATA 3MC2A 5H8QA 3HPIA 1Y1ZA 2XD2A 3K1PA 4GRKA 3RT6B 1ZBMA 1L5TA 2DE3A 3MVZA 4C1TA 1NFTA 3PGFA 4QFLA 4NF6A 4QSCA 1A8FA 1URSA 3TAJA 2Y7PA 1B0HA 3IR1A 4R9GA 4Z7EA 1T0KA 4EF2A 5TPAA 4KYSA 1MXUA 4DDDA 5IAIA 2DSFA 2PT2A 1IZ1A 2V3UA 1UTBA 5ISUA 3QXMA 4DZ1A 5AA2B 4XXUA 3AXFA 1FTMA 4H8JA 3SEYA 4U1ZA 5IKBA 3H03A 3S2VA 1B3HA 1CB6A 2ABHA 2H4IA 3OOAA 4Q8RA 2O7IA 3V83A 2F8DA 4ELQA 5H8FA 4PFTA 4ELOA 3TQLA 4ZZAA 1ZMGA 1N7XA 3PU5A 4F1VA 1POTA 4DXCA 2I58A 4PE5B 1SI1A 3DP6A 4F29A 2X26A 4R6KA 3T66A 4G4PA 1PBPA 2Q2AA 1FTJA 2GHBA 1JEVA 1S7YA 2HQ0A 2XX9A 1B4ZA 3GLBA 3UORA 3GBBA 1D3KA 3FVKA 1FQDA 4ZE9A 4G68C 2F36A 1JW1A 3HO7A 4KYDA 4JWOA 4LONB 3BBRA 3VXCA 3PUXE 4X1BA 5TP9A 1NNFA 3RUMA 1QVSA 3TKDA 4DXBA 2F6PA 1NKXA 4F39A 3IJOB 5KCJB 4BDOA 5I2KA 4RJZA 2V25A 4IO3A 1B0LA 2DXYA 4I9DA 2REGA 4OETA 1DPEA 1MY1A 2AIXA 4RPOA 3UK4A 4OFJA 2QMXA 4IY5A 1M5DA 1MQJA 1MXVA 3QUFA 5F7VA 1Z7ME 3FJGA 3K0VA 4ZEKA 1POY1 3SDFA 3T9HB 4GFRA 4THIA 2WKYA 2VP1A 3MZ9A 4IO6A 1MH3A 1JW5A 1P1QA 2B3BA 5HPQA 4ZDMA 1MXYA 4LZ5A 1Z7NE 5FTHA 2UVJA 1MXZA 2ONSA 5I2KB 3C9HA 4KCCA 3S9LC 4BDLA 4ND9A 4OHNA 1QKAA 2I0BA 1MM6A 5LOMA 3Q27A 4H6DA 1FTLA 4BDQA 2O69A 4AB5A 3RQTA 1GR2A 2F7AA 2XHDA 3KSXA 4OVJA 1I6BA 2HAVA 4JDFA 2Q8JA 4BDRA 4R6HA 2XXHA 4F22A 4DLDA 4OEVA 2XXPA 2P0SA 3VVFA 2X7QA 4WKMA 2THIA 5ELVA 1EZOA 3G3GA 2CMOA 1TT1A 2PX1A 2DP8A 1IQ7A 3OEMA 5DEXA 1H45A 2ZYMA 5K2XA 3SESA 1XOCA 5H8FB 4F1UA 1SQYA 5A5XB 1I6QA 1ZU0A 2HXWA 2O1MA 1BKAA 1JQFA 1N76A 2QS4A 2ZYNA 3N26A 4G68A 3RTWB 1F9BA 3QIMA 4DIGA 3UN6A 2Y7IA 3N6TA 2A5TB 4NF5A 3OO8A 1SW1A 1UTBB 2DWAA 3D4GA 4G68B 4LVQA 1AIVA 2FYIA 3PUVE 3T96B 1B40A 3KJTA 1SYHA 3KFMA 4H5FA 2P2AA 4R73A 4HCYA 1B46A 1URDA 3IK6B 2QSXA 3IOUA 4N6PA 3TDJA 4I1DA 2HFBA 3EQ1A 3M3LA 4C0RA 5J1DA 4H8IA 4MF3A 2PT1A 2Y84A 4OESA 3MQ9A 1B51A 2DWJA 2PYYA 3G3IA 4U1OA 3ILTB 1MDP1 2Y7WA 3CG3A 5JEIA 3CFXA 3K01A 1GTKA 1VE4A 4QFOA 2UVHA 5FHNA 4C1UA 3LSXA 1BLFA 4AB6A 2F5XA 1IITA 1MM7A 1US5A 3U72A 1P1UA 3VLWA 4GXAA 1FQBA 5I84A 3S9EA 3FD3A 3F11A 2PBWA 4NF4B 5FHMA 4FIMA 4F2QA 1FQAA 3TZAA 1FCKA 2OBGA 3KN8A 5HBCA 3TTMA 4X9TA 1LCTA 4MLQA 2NOOA 4G2ZA 4R9FA 2R6GE 2R9JA 2O7UA 4LZ7A 1MPCA 1NNPA 1B05A 1Y9UA 3PD9A 3IOVA 5CBRA 2O51A 3C4MA 3LSLA 1FTOA 1US4A 2O6AA 5TP9B 1ZLQA 4XKQA 1YTVA 1MXWA 1P1OA 1YPNA 2ZNUA 1NH8A 3OENA 4GXSB 4PFWA 2NXOA 2RC8A 3Q26A 4Z0IA 1I69A 5DT6A 1XT8A 1WODA 3QUJA 4R72A 2OCUA 2QJEA 1OQHA 3IL1B 4OQOA 4NTLA 4QFNA 2I3VA 3D4CA 3C35A 1OVTA 4JXIA 1USYH 2GFEA 3ONMA 4KCDA 4R75A 5AA3A 5CM6A 1QUKA 5AE4A 3K1MA 3K6XA 3E4RA 4JWXA 3CIJA 5CMMA 1MY0A 2HEUA 2RCBA 4YB5A 1MPBA 5I58A 5CI5A 3IOTA 2O68A 3PPQA 4KPTA 3H7MA 3K4UA 3RTFB 3SEUA 1B52A 3PPPA 3ZKKA 1B1HA 4NF4A 3U92A 3DM0A 4NWDA 3KSJA 5TPAB 1QUJA 4IGRA 3IJXB 3UGWA 4F31B 3JV9A 3OO6A 4NF6B 4UA8A 5I2NA 1DOTA 3PUWE 4F3GA 3VDFA 2VHAA 1LAGE 3KGCA 3QK6A 1AL3A 4HS7A 1Y3QA 1LBBA 1NNKA 1R9LA 3H3GA 3TODA 1H3DA 2QMWA 1PB8A 5H8QB 1O7TA 3EPEA 3TTRA 3SETA 2Z22A 2M8CA 2PVUA 3HHGA 2O84X 2XXUA 2VD2A 1VFDA 3K6WA 3L6HA 4N07A 3K1NA 4G8MA 3ILUB 1B9JA 2LAOA 4Q30B 4EXLA 1FQCA 3TEPA 5H8NB 1MG1A 3S9MC 3VVDA 5CMKA 1MQIA 1MY2A 1TFAA 3G3KA 2O1LA 1B1XA 1N84A 3DP8A 3KOTA 3RT8A 4KQPA 2AYSA 1R9QA 4L17A 4ECFA 3B7DA 1SW2A 4ISUA 4RXLA 2HZLA 4PP0A 1LFIA 2Z8EA 4NF5B 2QPQA 2BJJX 2Y7KA 3MP8A 1DPPA 4H67A 4QF9A 2UVGA 4ONYA 2RKMA 3C34A 1MQDA 3R7XA 1GV8A 4U4SA 4YU0A 5AA2D 5I59A 2DYXA 4GD5A 5A5XA 4FEBA 3QYTA 3FJMA 1AMFA 4IO2A 3U1OA 1OMPA 5DEXB 1MS7A 3HHFA 4RK9A 4RY1A 4YICA 2Q88A 4YB6A 2H5YA 1R6ZA 1QULA 3LR1A 1B3GA 3O66A 5AA4B 1S50A 3I5OA 4XKRA 1IXIA 1II5A 2V3QA 4F3BA 3GBAA 4KR5A 4U23A 1S9TA 1CE2A 3E3KA 3MBPA 1JEUA 3SEVA 4HCWA 3TCGA 4ZECA 3CFZA 2AL4A 2OZZA 2QS2A 4LZ8A 3RY3A 3THIA 2Y7RA 2HCAA 4WEDA 2OWSA 3N5LA 3U8QA 3ZKLA 4HW8A 4IO4A 4DCXA 3ODBA 3RPWA 2I0CA 4ZEBA 1B4HA 3DP4A 2D21A 4MH5A 1QW0A 4GL8A 1LFGA 4FECA 1TXFA 3S9NC 4ELPA 2XXXA 1B5HA 3KEIA 4YKJA 4IO5A 2GRVA 3UA8A 1NL5A 4X48A 4TLMB 3UP9A 4F19A 3ECRA 2NWJA 5ICTA 3MPKA 1PB7A 3N94A 3V5AA 2Q2CA 2E0SA 1ZIUA 3MVYA 3VE1B 1ZTYA 4ESXA 4YMBA 1KWHA 1LLSA 3MVWA 1IXCA 1B2HA 3OSQA 5DTBA 2F7BA 3CR9A 4TOZA 5I57B 5H8HB 2XXIA 4WXJA 2QRYA 2H9BA 3B6WA 1NH7A 3JYRA 3KOSA 3PV0E 4QSEA 3GXAA 4Q5TA 5K2YA 2XXQA 3ZSFA 5ITPA 3OXNA 4R6YA 2UYEA 2I4BA 3EHUA 3FVOA 3MPLA 4YKPA 3L6GA 1MXXA 1QJMA 3CI8A 3R26A 3CRBA 3PMWA 1Y1MA 1A54A 1B7UA 1LAFE 4H1XA 4BLAA 4E0XA 3MWBA 1HSLA 4OYVA 2Q9TA 4QFPA 5FHOA 5AA2A
chains in the Genus database with same CATH superfamily
3EN3A 3TTKA 1HSEA 3C33A 3OO7A 2FNCA 2G29A 1IUDA 4GWZA 1D9QA 3LSWA 5DYHA 1ZKBA 2VPNA 3S4UA 1FQEA 1Y4CA 1SPIA 3TYHA 5I56A 2ANJA 3TTLA 1BP5A 3MP6A 2CZIA 1J1NA 3B6TA 4G8HA 1M5FA 2DE4A 5KDTB 1YYZA 4NWCA 4OWDA 3FIRA 3TTNA 3I6VA 4YAHX 4U21A 1IIWA 5EQAA 2F3DA 3IB0A 2B65A 4DXUA 4MAGA 3DELB 2I4CA 3LUYA 1HSJA 1I6AA 1H44A 1B6HA 4FE8A 1XS5A 2ZZXA 3HCQA 3CVGA 1ZJLA 3H4ZA 3C32A 4LP2B 4QRZA 2OJTA 1SBPA 2VGQA 5EHSA 2ZXTA 4NG7A 3OEKA 2W7YA 1PDAA 1INPA 1A55A 1UIUA 1D9VA 2F7CA 2XXRA 4PF6A 3EKIA 1EYIA 3BIHA 5ITOA 2Z23A 1FJ6A 4XTCQ 5I56B 3CSBA 3U94A 1FTAA 1M5BA 2FIXA 2DOJA 2XXYA 1GVCA 4F18A 3PUYE 4F3PA 1MPDA 4KXPA 4GWSA 5AA4A 2FIEA 1XVXA 2YLNA 4N17A 2Q8MA 2PFZA 4I8CA 3H6VA 2ZMBA 1EU8A 1OLAA 1DSNA 2AL5A 3O6HA 2KLFA 3CSGA 2WYKA 4QFKA 4H45A 4U2RA 3FXUA 2OK2A 4EQ7A 4ZEFA 5FBPA 5A5LA 2XD3A 1VSOA 3MW0A 4G8NA 5ET5A 2DXRA 1A7LA 3HN0A 1Y4TA 3FBPA 3ISPA 4O3AA 2V84A 4WEPA 3VXBA 3FGSA 5CBSA 4KHZE 1NMUA 4AQ4A 3WAEA 3WAFA 5ET7A 2QS3A 2PMSA 3W15C 4OEUA 1EH3A 1TWYA 4ZEIA 4QHQA 1PEBA 2DS9A 1QUIA 4OTEA 2P1SA 3KN3A 3PMVA 1JW4A 1B5JA 1NV1A 4RNSA 4GOTA 4TLLB 2GH9A 3TELA 4EUOA 4EF1A 5EQ8A 1YAEA 1A99A 5EHMA 5ET8A 2DWHA 4RPNA 3SEWA 4HTGA 4P1EA 2ZYOA 4NF8A 1A40A 3A09A 4BDNA 1XI6A 3IX1A 3QAXA 4HXVA 3HPIA 1Y1ZA 4QSCA 3PGFA 3TAJA 1A8FA 1URSA 3IR1A 1T0KA 2KQZA 1MXUA 4QBAA 1UTBA 4XXUA 3SEYA 4U1ZA 1B3HA 2H4IA 3CHGA 5H8FA 2WBDA 4ELOA 4MEVA 4DXCA 4NHBA 1FTJA 1VDWA 1RDXA 4MJOA 3T1BA 1D3KA 4G68C 3HO7A 4JWOA 4X1BA 4DXBA 2F6PA 3IJOB 1FBCA 4RJZA 1B0LA 2DXYA 1DPEA 4OFJA 4NF0A 1M5DA 1Z7ME 4ZEKA 1POY1 1MH3A 4ZDMA 1MXYA 4LZ5A 1Z7NE 5FTHA 5J16A 1MXZA 3S9LC 4KCCA 4ND9A 1K9ZA 2B4MA 3LV0A 1GR2A 2XHDA 4OVJA 2HAVA 4BDRA 4R6HA 5DW8A 2CMOA 3OEMA 5H8FB 4PAFA 1I6QA 2HXWA 1BKAA 1N76A 3QIMA 3N6TA 3E78A 1UTBB 2FYIA 3KJTA 1SYHA 1NUXA 4H5FA 4R73A 4HCYA 1B46A 1URDA 2QSXA 3IOUA 2Y84A 4N6DA 3ILTB 4X04A 2L5VA 4AB6A 1US5A 5I84A 3FD3A 4NF4B 3TZAA 1FCKA 4AS5A 4X9TA 1LCTA 4YMAA 2NOOA 4G2ZA 2R6GE 2O7UA 1Y9UA 2O51A 5TP9B 2O6AA 3OENA 1P1OA 2RC8A 1I69A 2QJEA 3IFAA 2GFEA 4R75A 1NV4A 2F3BA 1QUKA 5AE4A 1FPEA 3K6XA 1MY0A 3IOTA 3K4UA 3PPPA 4MIJA 4NF4A 2WYPA 5TPAB 1QUJA 4IGRA 3UGWA 4F31B 3JV9A 4NF6B 1LAGE 3KGCA 3QK6A 4ZECA 1Y3QA 1H3DA 3TTRA 2JJKA 5DT6A 3SESA 2VD2A 4EXLA 4G8MA 2LAOA 2OWZA 1MG1A 1MY2A 3G3KA 3DP8A 3NOHA 1FPIA 4PP0A 4H67A 3MP8A 4QF9A 2UVGA 1MQDA 4U4SA 4FEBA 1MS7A 2H5YA 1QULA 1G0HA 5AA4B 3GBAA 4KR5A 4U23A 1S9TA 2HCAA 4DCXA 3ODBA 1B4HA 4OVRA 1LFGA 2HXRA 3UA8A 4TLMB 5ICTA 3MPKA 1PB7A 2E0SA 3VE1B 4ESXA 1ZTYA 3CR9A 4OVTA 5H8HB 1NH7A 4QSEA 5ITPA 4Q5TA 2XXQA 4YKPA 3FVOA 2I4BA 3MPLA 4BDLA 5DTBA 3R26A 4BLAA 4H1XA 1A54A 2Q9TA 4QFPA 4NQ8A 1USYE 5KDTA 3T22A 3MZBA 3OELA 3H6WA 4JSDA 1B58A 2Z8DA 3TCHA 4H5GA 2F78A 3FV1A 4OXVA 2BJIA 3O9PA 4QSDA 1MH4A 5H8NA 5CMCA 1OLCA 4NF8B 2QVVA 4UACA 2R71A 2CZLA 2Z8FA 3KN7A 3U72A 2ZYKA 4JVIA 2H99A 3IAZA 4KI0E 1N7WA 3P7IA 4G61A 4ZS9A 2OWTA 1MDQA 1IMFA 3MP1A 1D4NA 5I58B 4LUBA 4OFLA 2P3VA 3DLNA 4GWOA 4P0GA 3G7WA 1MQGA 3FASA 2FA7A 1MY3A 1YZ0A 5EYFA 5I57A 2XX7A 1CNQA 3K6VA 3IO4A 3TCFA 4LA9A 2VD3A 4XKPA 2I3WA 2PFYA 4DCYA 2Q89A 2IA4A 3IB1A 5L9SA 3IOWA 4FBPA 3BIGA 4KD5A 2NVUB 3O6IA 3FUZA 2ALUA 3A3CA 5ET6A 4DI4B 1URGA 3T9UA 3KJ7A 5DVJA 4ZEDA 3PD8A 4ELRA 2RC9A 1BTJA 4O8MA 4X8RA 4M4GA 2CZKA 2F34A 1SI0A 2MKZA 5CRYA 3RLFE 1B3EA 1A8EA 1LCFA 2A5TA 1YCJA 5ICQA 1ELJA 3CFLA 3LUZA 3T0JA 4E0WA 2QS1A 2FBPA 4KFQA 2V93A 3PUZE 3OMBA 1SYIA 1RKMA 3KG2A 3GZGA 1FQFA 2I48A 3O97A 4ZZEA 4GLIA 1DMBA 4GWXA 1FPBA 2HPGA 1JVXA 2QL3A 1Q35A 4PFYA 3FVNA 3BFUA 2XWVA 2F97A 1NV7A 3B50A 3RPLA 1BIYA 1SD3A 4GQOA 5H8SA 3KBRA 4H65A 5KCJA 5T3JA 3UK4A 1QKBA 2XXTA 3B6QA 3IO6A 1LSTA 5TU0A 4NN3A 4F2OA 1XVYA 3C36A 4IGTA 3G3HA 1LBYA 3V89B 4FORA 3H6UA 1QGXA 3VFJA 4POXA 1IMAA 4P11A 3TUSA 4TQUQ 3EHTA 3IFCA 4F22A 4PFBA 2H98A 1FPLA 4YB7A 4FJPA 5M2VA 4R74A 1DCUA 1Y20A 1OIBA 5H8QA 4GRKA 2Q74A 2DE3A 4C1TA 4Z7EA 4KYSA 4DDDA 4P56A 1IZ1A 4PDDA 4O94A 3AXFA 2ABHA 3OOAA 4PFTA 4ZZAA 4N4UA 3DP6A 4F29A 2X26A 4R6KA 1PBPA 1FBPA 1JEVA 1S7YA 2HQ0A 2XX9A 3GLBA 1FQDA 4ZE9A 1JW1A 2DDKA 3VXCA 1NNFA 1QVSA 4BDOA 4IO3A 4RPOA 4XEQA 1MQJA 5F7VA 4GFRA 2VP1A 3MZ9A 1JW5A 2B3BA 2UVJA 5I2KB 1QKAA 3Q27A 1FTLA 2F7AA 1I6BA 2Q8JA 4DLDA 2WBBA 2X7QA 4WKMA 5ELVA 1TT1A 1IQ7A 1IMDA 2ZYMA 5K2XA 5A5XB 2ZYNA 2QS4A 4G68A 4N15A 1F9BA 4DIGA 3UN6A 2Y7IA 2OX3A 3OO8A 1SW1A 4LVQA 3D4GA 5IZZA 3T96B 1B40A 4PDHA 3KFMA 2P2AA 4GBWA 3EQ1A 3M3LA 4C0RA 4H8IA 3MQ9A 3G3IA 2Y7WA 4GWUA 4QFOA 3LSXA 1BLFA 1MM7A 1P1UA 3VLWA 1FQBA 2PBWA 3KN8A 4MLQA 4LZ7A 1B05A 3PD9A 3C4MA 3LSLA 1US4A 1YTVA 1MXWA 2ZNUA 4PFWA 1NH8A 2NXOA 3Q26A 3QUJA 4R72A 1OQHA 2GQ1A 4OQOA 4NTLA 3D4CA 3C35A 1USYH 4KCDA 5AA3A 4OVQA 4PBHA 4JWXA 3CIJA 1MPBA 5CI5A 3SEUA 1B52A 3KC0A 3KSJA 4PGPA 5I2NA 4UA8A 3VDFA 2VHAA 1LBVA 3TPAA 4HS7A 1DK4A 1LBBA 3H3GA 2QMWA 1PB8A 3SETA 2Z22A 4PFUA 3HHGA 2XXUA 3K6WA 2XWKA 1B9JA 2FVZA 5CMKA 1MQIA 4OVPA 4ECFA 3B7DA 1SW2A 4ISUA 4NF5B 2Y7KA 2BJJX 2XWOA 3C34A 4O7IA 5I59A 4GD5A 3FJMA 3U1OA 3HHFA 3B8BA 1R6ZA 1S50A 5IZ3A 4F3BA 4HCWA 2QS2A 2OZZA 4AB5A 4LZ8A 3RY3A 2WX9A 2I0CA 4ZEBA 1QW0A 3A29A 4GL8A 4FECA 1TXFA 3S9NC 4ELPA 1AWBA 3KEIA 2GRVA 1NL5A 4X48A 3D1RA 3UP9A 4F19A 4MCOA 3V5AA 1ZIUA 1DBZA 4IR8A 3MVWA 3OSQA 2QRYA 3PV0E 3KC1A 3OXNA 5EYGA 3EHUA 4Q8RA 3L6GA 1MXXA 3CRBA 1LEVA 1HSLA 4N81A 4OYVA 5AA2A 1N0TA 5BUUA 2KR0A 3FZVA 1NV5A 4OMBA 4GL0A 2RINA 4IY6A 1IMBA 4IO7A 2RC7A 4XKNA 3VVEA 2I49A 3MJNA 2RF1A 2B3FA 3ZS6A 1UTHB 4R2BA 1DTGA 1FBDA 3FV2A 1D9YA 1IEJA 3OD7A 2DQVA 1B7ZA 5I2NB 4OFOA 3O29A 3N6UA 3W9VA 5I7IA 4JVDA 1LB9A 3W9WA 1RYXA 3ROJA 4F1YA 3U93A 1PC3A 4U4XA 5ESYA 5L9MA 4BDMA 4POWA 1LBXA 3H06B 1Q9DA 1VR5A 1FPGA 3K2DA 3PMXA 4MNPA 3O28A 1EYKA 3RN8A 4PQJA 5LDZA 3JZJA 2DWIA 1FBGA 4EQBA 4PCDA 4P47A 1B7HA 1UTHA 4LQ2A 1PB9A 3USDA 2IEEA 4U22A 3SEXA 3KBZA 3Q28A 1SW4A 2UYFA 4P9KA 5L9OA 4FATA 3R6UA 3M8UA 1LB8A 5IM2A 4H0WA 1UIVA 1IXHA 3KZGA 4I40A 4RK2A 1LBCA 5HM4B 2X7PA 2I6EA 4MFIA 3T93B 4OERA 4HE2A 3M3KA 2ZNSA 4NMYA 4R2FA 3FVGA 2R8TA 3HSTA 2DVCA 5AA1A 1H76A 1NV0A 2DVZA 3SERA 3VLUA 1B3LA 4N6KA 2REJA 2ZZVA 3TFLA 3PPRA 2V3TA 4F3SA 4FEDA 5DVIA 4PFIA 1P1WA 1Q1KA 3K6UA 2F6GA 1XHYA 5FTIA 5IZ3B 2HAUA 1JNFA 1DTZA 1OQGA 3H6TA 3RNNA 1PBQA 1N04A 3BKIB 5JTYA 2B4LA 2CZHA 2XXWA 3RT6B 1GGGA 5FHMA 1ANFA 3E9XA 4NAPA 4MNIA 1SW5A 2OLBA 4YZZA 3PPNA 4EDPA 4ZE8A 3OO9A 4NGUA 2D5WA 2VT5A 4JB7A 4FAJA 3FATA 1H43A 3IB2A 3MAMA 4JWYA 1MRPA 4LATA 3MC2A 4LN5A 4R9GA 3HFUA 5IAIA 2DSFA 2PT2A 3QXMA 1FTMA 2Y5LA 4H46A 3H03A 3S2VA 2ZZWA 4MX6A 2O7IA 3V83A 2F8DA 2PCRA 3TQLA 1ZMGA 4F1VA 1SI1A 3T66A 3PTYA 3GYYA 3UORA 4LONB 4KYDA 3BBRA 3PUXE 3RUMA 5KCJB 4F39A 4GWWA 2V25A 4OETA 1MY1A 2AIXA 4JVCA 3U65A 4IY5A 1MXVA 3QUFA 3T9HB 4GX6A 4IO6A 1P1QA 4PC9A 1FJ9A 2I0BA 5LOMA 4BDQA 5EQ7A 2HHMA 3RQTA 4OEVA 2XXPA 2P0SA 2THIA 1EZOA 3G3GA 1FPJA 2DP8A 4GBVA 5DEXA 1XOCA 1SQYA 3RTWB 3N26A 3MYUA 3E79A 2A5TB 2DWAA 4G68B 1AIVA 1K9YA 1IMEA 1KA1A 3IK6B 3TDJA 2HFBA 4OESA 2DWJA 2PYYA 1MDP1 3CG3A 3CFXA 3K01A 4C1UA 2F5XA 4FIMA 3QMFA 3TTMA 4R9FA 2R9JA 2CEXA 3MSTA 4XKQA 1YPNA 4GXSB 2QVUA 1XT8A 1WODA 3IL1B 4QFNA 2VPOA 3ONMA 2RCBA 4YB5A 5I58A 2O68A 3PPQA 4KPTA 1KZ8A 1RDZA 4I3EA 1FBHA 1DOTA 3PUWE 2XWIA 1AL3A 3TODA 5I3SA 5H8QB 1O7TA 4PBQA 2M8CA 3L6HA 4N07A 3K1NA 3ILUB 4Q30B 1FQCA 5H8NB 1JP4A 3KOTA 4KQPA 2AYSA 1R9QA 4L17A 2HZLA 1LFIA 2Z8EA 2QPQA 1DPPA 5EYHA 3R7XA 1GV8A 1NUZA 3QYTA 1OMPA 5DEXB 4RK9A 1FBFA 3LR1A 1NV6A 2V3QA 4DI3D 3MBPA 1CE2A 3E3KA 1JEUA 3SEVA 4GWYA 3TCGA 3CFZA 3THIA 3ZKLA 2OWSA 3N5LA 1G0IA 1FPFA 3DP4A 4AS4A 2D21A 4MNCA 4N8YA 4YKJA 4HE1A 3N94A 3MVYA 3RYDA 1B2HA 2XXIA 4WXJA 2H9BA 3FXBA 3JYRA 4GX4A 5K2YA 3GXAA 4N91A 1QJMA 4O3BA 3PMWA 1LAFE 4E0XA 3MWBA 5FHOA 2UVIA 3UIFA 4P3LA 1B32A 1FW0A 2P3NA 3PPOA 5B70A 2ONRA 4EQ9A 5BWJA 4YKKA 4OZ9A 1LAHE 4YKIA 1FBEA 2ZNTA 3K00A 1XC1A 3FXQA 5CMBA 3LBSA 3K02A 3LC8A 4XIGQ 3MUQA 4ESWA 3EHSA 1NV3A 2G93A 3FJ7A 4I62A 1NI9A 3V8XB 5JTYB 1LBZA 1R1NA 1RYOA 3VLVA 1WVJA 3M3FA 1M5CA 5KZTA 4HE0A 4RA1A 3O6GA 4JBZA 5JK4A 4Q0CA 2ESNA 4GF8A 2YJPA 3MVXA 2HZKA 4DE8A 5IGAA 4G77A 4M1VA 3RGYA 4K3FA 3BFTA 1FTKA 1NNTA 3LSFB 3VV5A 1P1NA 3SKPA 5DVFA 1NV2A 4P0IA 1IXGA 1RDYA 1UQWA 2QVRA 3FXRA 1LGBC 4KYEA 5CC2A 3O2AA 1EZ9A 3Q29A 2YPNA 1O63A 4GX3A 3C31A 1JETA 5L8DA 5I59B 1B5IA 1SVXB 4QXDA 3G3FA 3A3UA 3MZ1A 2WEFA 4PE3A 3QSLA 2V4CA 1AOVA 3HV1A 4OENA 2RCAA 2GHAA 4NX1A 5H8HA 1LAXA 4PTKA 1B3FA 4MBPA 2F35A 2UXAA 1EZPA 1LBWA 2NUVA 3TQWA 1LFHA 3CG1A 2QFLA 3OSRA 1N3WA 4PETA 4JSOA 3TMGA 4O3CA 3Q25A 1P99A 5F1QA 2ONKE 3T9VA 4OANA 4N13A 1JVYA 3EF7A 4DZ1A 1VFEA 2VOZA 1M5EA 4NEDA 4MHFA 2H25A 4GIZA 2XX8A 2DE2A 1OVBA 5B7DA 2E1SA 2D3IA 1MY4A 1O64A 1Y3PA 4GVOA 1ATGA 1SDXA 3IORA 4NE4A 1AH5A 2XXVA 1MQHA 1Y3NA 4EXKA 1N3XA 4IB2A 4P8BA 2A5SA 1TFDA 1WDNA 3E13X 3I3VA 3T9XB 4LQ5A 1IMCA 3G3JA 4MLVA 4X1DA 3K1PA 2XD2A 1ZBMA 1L5TA 3MVZA 1NFTA 4QFLA 4NF6A 2Y7PA 1B0HA 4EF2A 5TPAA 4N8GA 5ISUA 2V3UA 5AA2B 4H8JA 5IKBA 1CB6A 4ELQA 4O7MA 1YXIA 1N7XA 3PU5A 1POTA 2I58A 4PE5B 4P1LA 2FHYA 4G4PA 2Q2AA 2GHBA 3SZPA 1B4ZA 3GBBA 3FVKA 2F36A 1NUYA 5TP9A 3TKDA 1NKXA 5I2KA 4RYAA 4I9DA 2REGA 2QMXA 4PGNA 3K0VA 3FJGA 3SDFA 4THIA 3TEPA 2WKYA 5HPQA 4XF5A 4OA4A 2ONSA 3C9HA 4OHNA 1MM6A 5EQ9A 4H6DA 2O69A 3KSXA 1BK4A 4JDFA 2XXHA 1FPKA 2PX1A 5IZ1A 1H45A 4F1UA 1ZU0A 2O1MA 1JQFA 4YMBA 1KA0A 4NF5A 1FPDA 3PUVE 4N6PA 4PFRA 4I1DA 4XFEA 5J1DA 4MF3A 2PT1A 1B51A 4U1OA 5JEIA 1GTKA 1VE4A 4PAKA 2UVHA 2CEYA 1IITA 4GXAA 3S9EA 3F11A 2XXKA 4F2QA 1FQAA 5HBCA 2OBGA 4PAIA 1MPCA 1NNPA 1NUWA 4OVSA 3IOVA 5CBRA 1FTOA 1ZLQA 3VVFA 4Z0IA 2OCUA 5I5PA 2I3VA 4PF8A 1OVTA 4JXIA 5CM6A 1EYJA 3K1MA 3E4RA 5CMMA 2HEUA 3RPLB 3RTFB 3H7MA 3ZKKA 1B1HA 3U92A 3DM0A 4NWDA 2XA5A 3IJXB 3OO6A 4F3GA 1NNKA 1R9LA 1FSAA 3EPEA 2PVUA 5F24A 2O84X 1VFDA 3S9MC 3VVDA 1TFAA 2O1LA 3RT8A 1B1XA 1N84A 4RXLA 1FRPA 4ONYA 2RKMA 4YU0A 5AA2D 2DYXA 5A5XA 4IO2A 1AMFA 4RY1A 4YICA 2Q88A 4YB6A 1B3GA 3O66A 5LTCA 3I5OA 4XKRA 1IXIA 1II5A 4I3YA 2AL4A 3U8QA 2Y7RA 4WEDA 4MMPA 4HW8A 4IO4A 3RPWA 4MH5A 2XXXA 1B5HA 4IO5A 2Y5KA 3ECRA 2NWJA 2Q2CA 4UABA 1KWHA 1LLSA 1IXCA 2F7BA 4TOZA 5I57B 3B6WA 3KOSA 3ZSFA 4R6YA 2UYEA 5FHNA 3CI8A 1Y1MA 1B7UA
chains in the Genus database with same CATH topology
2UVIA 3UIFA 1N0TA 5BUUA 3EN3A 3TTKA 1USYE 1HSEA 5KDTA 3T22A 3MZBA 3OELA 3C33A 3FZVA 3OO7A 1B32A 3H6WA 1FW0A 4OMBA 4JSDA 1B58A 3PPOA 4GL0A 2FNCA 2RINA 2Z8DA 3TCHA 2ONRA 4H5GA 2F78A 2G29A 1IUDA 4IY6A 3FV1A 4EQ9A 5BWJA 4IO7A 4OZ9A 4OXVA 4YKKA 1LAHE 3TUSA 3LSWA 2RC7A 4XKNA 3O9PA 4YKIA 4QSDA 3VVEA 2I49A 2ZNTA 3K00A 1MH4A 5DYHA 1ZKBA 5H8NA 1XC1A 3FXQA 3MJNA 5CMCA 3S4UA 1OLCA 4NF8B 2RF1A 2B3FA 4UACA 3ZS6A 5CMBA 1FQEA 3LBSA 3K02A 1Y4CA 2CZLA 2R71A 2Z8FA 3KN7A 3LC8A 1UTHB 4R2BA 2ZYKA 4XIGQ 3TYHA 2H99A 1DTGA 3MUQA 5I56A 2ANJA 3IAZA 3TTLA 4ESWA 1BP5A 3FV2A 5B70A 4KI0E 1D9YA 1IEJA 1N7WA 3MP6A 2DQVA 3EHSA 3OD7A 1B7ZA 3P7IA 2G93A 1J1NA 2OWTA 3B6TA 4ZS9A 3FJ7A 4G8HA 4I62A 5I2NB 1MDQA 3V8XB 5JTYB 4OFOA 1M5FA 2DE4A 3O29A 5KDTB 1R1NA 1RYOA 3N6UA 3W9VA 3VLVA 1WVJA 4NWCA 3M3FA 1M5CA 3MP1A 5KZTA 4OWDA 4RA1A 3O6GA 4JBZA 5JK4A 1LB9A 3FIRA 1RYXA 4Q0CA 1D4NA 3TTNA 3W9WA 2ESNA 4GF8A 4LUBA 4OFLA 3DLNA 4F1YA 5I58B 2YJPA 3MVXA 3I6VA 4GWOA 4P0GA 4U21A 4YAHX 2HZKA 1IIWA 3G7WA 4DE8A 1MQGA 3FASA 2B65A 3IB0A 4G77A 3U93A 4DXUA 1PC3A 4M1VA 4U4XA 2FA7A 3DELB 3RGYA 2I4CA 3LUYA 4K3FA 1HSJA 1MY3A 3BFTA 1FTKA 5EYFA 5L9MA 1I6AA 1H44A 1B6HA 4FE8A 4BDMA 1XS5A 3HCQA 5I57A 2XX7A 4POWA 4PFUA 3CVGA 1ZJLA 3H4ZA 3C32A 3K6VA 4LP2B 1NNTA 4QRZA 3IO4A 3LSFB 3TCFA 3VV5A 3H06B 2OJTA 1P1NA 1SBPA 2VGQA 4LA9A 1VR5A 2VD3A 3SKPA 4YMAA 3K2DA 5EHSA 3PMXA 4XKPA 2ZXTA 3OEKA 3O28A 2I3WA 2W7YA 1PDAA 5DVFA 3RN8A 1A55A 4PQJA 4DCYA 2Q89A 3JZJA 2IA4A 1UIUA 2DWIA 3IB1A 4EQBA 3IOWA 5L9SA 4P0IA 1IXGA 1D9VA 2F7CA 1UQWA 2XXRA 4KD5A 2NVUB 1B7HA 5ITOA 2Z23A 3O6IA 3FUZA 4XTCQ 2ALUA 3TPAA 3FXRA 3CSBA 5I56B 3U94A 1M5BA 1UTHA 1LGBC 4LQ2A 1PB9A 2DOJA 3A3CA 2XXYA 1GVCA 4KYEA 3USDA 5CC2A 4F18A 2IEEA 3PUYE 1URGA 4U22A 3T9UA 4F3PA 3SEXA 3O2AA 3KJ7A 3Q28A 5DVJA 1MPDA 1SW4A 2UYFA 5AA4A 4ZEDA 5L9OA 1XVXA 3PD8A 1EZ9A 2YLNA 4ELRA 2RC9A 1BTJA 3Q29A 4FATA 2YPNA 3R6UA 3M8UA 1LB8A 1O63A 4M4GA 4H0WA 3C31A 2F34A 1JETA 5L8DA 1SI0A 4I8CA 5I59B 3H6VA 1UIVA 1IXHA 2ZMBA 1EU8A 1OLAA 1B5IA 1DSNA 1SVXB 3KZGA 2AL5A 5CRYA 1B3EA 1A8EA 3RLFE 4RK2A 1LBCA 1LCFA 2A5TA 1YCJA 3T9XB 5HM4B 1ELJA 5ICQA 3G3FA 3O6HA 3A3UA 3CFLA 2KLFA 3CSGA 2X7PA 2I6EA 4MFIA 3T93B 4QFKA 3MZ1A 4OERA 4E0WA 3M3KA 3FXUA 3QSLA 2ZNSA 4U2RA 2OK2A 2QS1A 4EQ7A 1AOVA 4NMYA 3HV1A 4OENA 4R2FA 4KFQA 2V93A 2RCAA 4ZEFA 2GHAA 3FVGA 5H8HA 2XD3A 1LAXA 3HSTA 1VSOA 2DVCA 5AA1A 3MW0A 4G8NA 3PUZE 1B3FA 3OMBA 1SYIA 2F35A 1H76A 4MBPA 1RKMA 3KG2A 2DVZA 3SERA 3GZGA 1FQFA 2UXAA 2I48A 3O97A 4ZZEA 2DXRA 3VLUA 1A7LA 3HN0A 1DMBA 2NUVA 4GLIA 3TQWA 1B3LA 1EZPA 1LFHA 3CG1A 2REJA 3OSRA 1JVXA 1N3WA 1Y4TA 2QL3A 4PETA 1Q35A 4PFYA 3FVNA 3TFLA 3BFUA 4FAJA 4O3AA 3PPRA 2V3TA 2V84A 4WEPA 4F3SA 3VXBA 2F97A 3FGSA 4JSOA 3TMGA 5CBSA 4FEDA 4KHZE 1NMUA 4AQ4A 1BIYA 1SD3A 4GQOA 5DVIA 1P1WA 4O3CA 5H8SA 3Q25A 3WAEA 3KBRA 1P99A 1Q1KA 4H65A 2ONKE 5F1QA 3K6UA 3T9VA 3WAFA 2QS3A 2PMSA 3W15C 2F6GA 4N13A 1JVYA 1EH3A 3EF7A 1VFEA 1XHYA 4OEUA 1TWYA 2VOZA 5FTIA 4ZEIA 1M5EA 1QKBA 2HAUA 4NEDA 4QHQA 2XXTA 3B6QA 1PEBA 2DS9A 1JNFA 2H25A 3IO6A 1LSTA 5TU0A 1QUIA 4OTEA 1DTZA 4F2OA 1OQGA 4GIZA 2P1SA 3KN3A 1XVYA 3C36A 2XX8A 3H6TA 3PMVA 2DE2A 1JW4A 1B5JA 3RNNA 4IGTA 5KCJA 1OVBA 3G3HA 4RNSA 4GOTA 5B7DA 1PBQA 1N04A 2E1SA 3BKIB 3V89B 4FORA 3H6UA 2GH9A 4TLLB 2D3IA 3TELA 1MY4A 1O64A 1Y3PA 4EUOA 3VFJA 4POXA 5JTYA 4EF1A 4GVOA 1ATGA 1SDXA 3IORA 2XXWA 4O3BA 1GGGA 4P11A 4RYAA 1YAEA 1A99A 1ANFA 4NE4A 4TQUQ 3E9XA 1AH5A 1SW5A 2OLBA 3EHTA 5EHMA 2DWHA 4RPNA 4YZZA 3PPNA 2XXVA 3SEWA 1MQHA 2H98A 4ZE8A 4EDPA 4HTGA 3OO9A 1Y3NA 4EXKA 4YB7A 1N3XA 2ZYOA 2D5WA 4FJPA 2A5SA 4IB2A 4JB7A 1A40A 1TFDA 3A09A 4NF8A 5M2VA 4BDNA 1WDNA 1H43A 3E13X 3FATA 3I3VA 3IB2A 3MAMA 4JWYA 1MRPA 4LQ5A 3G3JA 4R74A 4MLVA 3IX1A 4X1DA 3QAXA 1Y20A 1OIBA 4LATA 3MC2A 5H8QA 3HPIA 1Y1ZA 2XD2A 3K1PA 4GRKA 3RT6B 1ZBMA 1L5TA 2DE3A 3MVZA 4C1TA 1NFTA 3PGFA 4QFLA 4NF6A 4QSCA 1A8FA 1URSA 3TAJA 2Y7PA 1B0HA 3IR1A 4R9GA 4Z7EA 1T0KA 4EF2A 5TPAA 4KYSA 1MXUA 4DDDA 5IAIA 2DSFA 2PT2A 1IZ1A 2V3UA 1UTBA 5ISUA 3QXMA 4DZ1A 5AA2B 4XXUA 3AXFA 1FTMA 4H8JA 3SEYA 4U1ZA 5IKBA 3H03A 3S2VA 1B3HA 1CB6A 2ABHA 2H4IA 3OOAA 4Q8RA 2O7IA 3V83A 2F8DA 4ELQA 5H8FA 4PFTA 4ELOA 3TQLA 4ZZAA 1ZMGA 1N7XA 3PU5A 4F1VA 1POTA 4DXCA 2I58A 4PE5B 1SI1A 3DP6A 4F29A 2X26A 4R6KA 3T66A 4G4PA 1PBPA 2Q2AA 1FTJA 2GHBA 1JEVA 1S7YA 2HQ0A 2XX9A 1B4ZA 3GLBA 3UORA 3GBBA 1D3KA 3FVKA 1FQDA 4ZE9A 4G68C 2F36A 1JW1A 3HO7A 4KYDA 4JWOA 4LONB 3BBRA 3VXCA 3PUXE 4X1BA 5TP9A 1NNFA 3RUMA 1QVSA 3TKDA 4DXBA 2F6PA 1NKXA 4F39A 3IJOB 5KCJB 4BDOA 5I2KA 4RJZA 2V25A 4IO3A 1B0LA 2DXYA 4I9DA 2REGA 4OETA 1DPEA 1MY1A 2AIXA 4RPOA 3UK4A 4OFJA 2QMXA 4IY5A 1M5DA 1MQJA 1MXVA 3QUFA 5F7VA 1Z7ME 3FJGA 3K0VA 4ZEKA 1POY1 3SDFA 3T9HB 4GFRA 4THIA 2WKYA 2VP1A 3MZ9A 4IO6A 1MH3A 1JW5A 1P1QA 2B3BA 5HPQA 4ZDMA 1MXYA 4LZ5A 1Z7NE 5FTHA 2UVJA 1MXZA 2ONSA 5I2KB 3C9HA 4KCCA 3S9LC 4BDLA 4ND9A 4OHNA 1QKAA 2I0BA 1MM6A 5LOMA 3Q27A 4H6DA 1FTLA 4BDQA 2O69A 4AB5A 3RQTA 1GR2A 2F7AA 2XHDA 3KSXA 4OVJA 1I6BA 2HAVA 4JDFA 2Q8JA 4BDRA 4R6HA 2XXHA 4F22A 4DLDA 4OEVA 2XXPA 2P0SA 3VVFA 2X7QA 4WKMA 2THIA 5ELVA 1EZOA 3G3GA 2CMOA 1TT1A 2PX1A 2DP8A 1IQ7A 3OEMA 5DEXA 1H45A 2ZYMA 5K2XA 3SESA 1XOCA 5H8FB 4F1UA 1SQYA 5A5XB 1I6QA 1ZU0A 2HXWA 2O1MA 1BKAA 1JQFA 1N76A 2QS4A 2ZYNA 3N26A 4G68A 3RTWB 1F9BA 3QIMA 4DIGA 3UN6A 2Y7IA 3N6TA 2A5TB 4NF5A 3OO8A 1SW1A 1UTBB 2DWAA 3D4GA 4G68B 4LVQA 1AIVA 2FYIA 3PUVE 3T96B 1B40A 3KJTA 1SYHA 3KFMA 4H5FA 2P2AA 4R73A 4HCYA 1B46A 1URDA 3IK6B 2QSXA 3IOUA 4N6PA 3TDJA 4I1DA 2HFBA 3EQ1A 3M3LA 4C0RA 5J1DA 4H8IA 4MF3A 2PT1A 2Y84A 4OESA 3MQ9A 1B51A 2DWJA 2PYYA 3G3IA 4U1OA 3ILTB 1MDP1 2Y7WA 3CG3A 5JEIA 3CFXA 3K01A 1GTKA 1VE4A 4QFOA 2UVHA 5FHNA 4C1UA 3LSXA 1BLFA 4AB6A 2F5XA 1IITA 1MM7A 1US5A 3U72A 1P1UA 3VLWA 4GXAA 1FQBA 5I84A 3S9EA 3FD3A 3F11A 2PBWA 4NF4B 5FHMA 4FIMA 4F2QA 1FQAA 3TZAA 1FCKA 2OBGA 3KN8A 5HBCA 3TTMA 4X9TA 1LCTA 4MLQA 2NOOA 4G2ZA 4R9FA 2R6GE 2R9JA 2O7UA 4LZ7A 1MPCA 1NNPA 1B05A 1Y9UA 3PD9A 3IOVA 5CBRA 2O51A 3C4MA 3LSLA 1FTOA 1US4A 2O6AA 5TP9B 1ZLQA 4XKQA 1YTVA 1MXWA 1P1OA 1YPNA 2ZNUA 1NH8A 3OENA 4GXSB 4PFWA 2NXOA 2RC8A 3Q26A 4Z0IA 1I69A 5DT6A 1XT8A 1WODA 3QUJA 4R72A 2OCUA 2QJEA 1OQHA 3IL1B 4OQOA 4NTLA 4QFNA 2I3VA 3D4CA 3C35A 1OVTA 4JXIA 1USYH 2GFEA 3ONMA 4KCDA 4R75A 5AA3A 5CM6A 1QUKA 5AE4A 3K1MA 3K6XA 3E4RA 4JWXA 3CIJA 5CMMA 1MY0A 2HEUA 2RCBA 4YB5A 1MPBA 5I58A 5CI5A 3IOTA 2O68A 3PPQA 4KPTA 3H7MA 3K4UA 3RTFB 3SEUA 1B52A 3PPPA 3ZKKA 1B1HA 4NF4A 3U92A 3DM0A 4NWDA 3KSJA 5TPAB 1QUJA 4IGRA 3IJXB 3UGWA 4F31B 3JV9A 3OO6A 4NF6B 4UA8A 5I2NA 1DOTA 3PUWE 4F3GA 3VDFA 2VHAA 1LAGE 3KGCA 3QK6A 1AL3A 4HS7A 1Y3QA 1LBBA 1NNKA 1R9LA 3H3GA 3TODA 1H3DA 2QMWA 1PB8A 5H8QB 1O7TA 3EPEA 3TTRA 3SETA 2Z22A 2M8CA 2PVUA 3HHGA 2O84X 2XXUA 2VD2A 1VFDA 3K6WA 3L6HA 4N07A 3K1NA 4G8MA 3ILUB 1B9JA 2LAOA 4Q30B 4EXLA 1FQCA 3TEPA 5H8NB 1MG1A 3S9MC 3VVDA 5CMKA 1MQIA 1MY2A 1TFAA 3G3KA 2O1LA 1B1XA 1N84A 3DP8A 3KOTA 3RT8A 4KQPA 2AYSA 1R9QA 4L17A 4ECFA 3B7DA 1SW2A 4ISUA 4RXLA 2HZLA 4PP0A 1LFIA 2Z8EA 4NF5B 2QPQA 2BJJX 2Y7KA 3MP8A 1DPPA 4H67A 4QF9A 2UVGA 4ONYA 2RKMA 3C34A 1MQDA 3R7XA 1GV8A 4U4SA 4YU0A 5AA2D 5I59A 2DYXA 4GD5A 5A5XA 4FEBA 3QYTA 3FJMA 1AMFA 4IO2A 3U1OA 1OMPA 5DEXB 1MS7A 3HHFA 4RK9A 4RY1A 4YICA 2Q88A 4YB6A 2H5YA 1R6ZA 1QULA 3LR1A 1B3GA 3O66A 5AA4B 1S50A 3I5OA 4XKRA 1IXIA 1II5A 2V3QA 4F3BA 3GBAA 4KR5A 4U23A 1S9TA 1CE2A 3E3KA 3MBPA 1JEUA 3SEVA 4HCWA 3TCGA 4ZECA 3CFZA 2AL4A 2OZZA 2QS2A 4LZ8A 3RY3A 3THIA 2Y7RA 2HCAA 4WEDA 2OWSA 3N5LA 3U8QA 3ZKLA 4HW8A 4IO4A 4DCXA 3ODBA 3RPWA 2I0CA 4ZEBA 1B4HA 3DP4A 2D21A 4MH5A 1QW0A 4GL8A 1LFGA 4FECA 1TXFA 3S9NC 4ELPA 2XXXA 1B5HA 3KEIA 4YKJA 4IO5A 2GRVA 3UA8A 1NL5A 4X48A 4TLMB 3UP9A 4F19A 3ECRA 2NWJA 5ICTA 3MPKA 1PB7A 3N94A 3V5AA 2Q2CA 2E0SA 1ZIUA 3MVYA 3VE1B 1ZTYA 4ESXA 4YMBA 1KWHA 1LLSA 3MVWA 1IXCA 1B2HA 3OSQA 5DTBA 2F7BA 3CR9A 4TOZA 5I57B 5H8HB 2XXIA 4WXJA 2QRYA 2H9BA 3B6WA 1NH7A 3JYRA 3KOSA 3PV0E 4QSEA 3GXAA 4Q5TA 5K2YA 2XXQA 3ZSFA 5ITPA 3OXNA 4R6YA 2UYEA 2I4BA 3EHUA 3FVOA 3MPLA 4YKPA 3L6GA 1MXXA 1QJMA 3CI8A 3R26A 3CRBA 3PMWA 1Y1MA 1A54A 1B7UA 1LAFE 4H1XA 4BLAA 4E0XA 3MWBA 1HSLA 4OYVA 2Q9TA 4QFPA 5FHOA 5AA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UVI A;  3UIF A;  1N0T A;  5BUU A;  3EN3 A;  3TTK A;  1USY E;  1HSE A;  5KDT A;  3T22 A;  3MZB A;  3OEL A;  3C33 A;  3FZV A;  3OO7 A;  1B32 A;  3H6W A;  1FW0 A;  4OMB A;  4JSD A;  1B58 A;  3PPO A;  4GL0 A;  2FNC A;  2RIN A;  2Z8D A;  3TCH A;  2ONR A;  4H5G A;  2F78 A;  2G29 A;  1IUD A;  4IY6 A;  3FV1 A;  4EQ9 A;  5BWJ A;  4IO7 A;  4OZ9 A;  4OXV A;  4YKK A;  1LAH E;  3TUS A;  3LSW A;  2RC7 A;  4XKN A;  3O9P A;  4YKI A;  4QSD A;  3VVE A;  2I49 A;  2ZNT A;  3K00 A;  1MH4 A;  5DYH A;  1ZKB A;  5H8N A;  1XC1 A;  3FXQ A;  3MJN A;  5CMC A;  3S4U A;  1OLC A;  4NF8 B;  2RF1 A;  2B3F A;  4UAC A;  3ZS6 A;  5CMB A;  1FQE A;  3LBS A;  3K02 A;  1Y4C A;  2CZL A;  2R71 A;  2Z8F A;  3KN7 A;  3LC8 A;  1UTH B;  4R2B A;  2ZYK A;  4XIG Q;  3TYH A;  2H99 A;  1DTG A;  3MUQ A;  5I56 A;  2ANJ A;  3IAZ A;  3TTL A;  4ESW A;  1BP5 A;  3FV2 A;  5B70 A;  4KI0 E;  1D9Y A;  1IEJ A;  1N7W A;  3MP6 A;  2DQV A;  3EHS A;  3OD7 A;  1B7Z A;  3P7I A;  2G93 A;  1J1N A;  2OWT A;  3B6T A;  4ZS9 A;  3FJ7 A;  4G8H A;  4I62 A;  5I2N B;  1MDQ A;  3V8X B;  5JTY B;  4OFO A;  1M5F A;  2DE4 A;  3O29 A;  5KDT B;  1R1N A;  1RYO A;  3N6U A;  3W9V A;  3VLV A;  1WVJ A;  4NWC A;  3M3F A;  1M5C A;  3MP1 A;  5KZT A;  4OWD A;  4RA1 A;  3O6G A;  4JBZ A;  5JK4 A;  1LB9 A;  3FIR A;  1RYX A;  4Q0C A;  1D4N A;  3TTN A;  3W9W A;  2ESN A;  4GF8 A;  4LUB A;  4OFL A;  3DLN A;  4F1Y A;  5I58 B;  2YJP A;  3MVX A;  3I6V A;  4GWO A;  4P0G A;  4U21 A;  4YAH X;  2HZK A;  1IIW A;  3G7W A;  4DE8 A;  1MQG A;  3FAS A;  2B65 A;  3IB0 A;  4G77 A;  3U93 A;  4DXU A;  1PC3 A;  4M1V A;  4U4X A;  2FA7 A;  3DEL B;  3RGY A;  2I4C A;  3LUY A;  4K3F A;  1HSJ A;  1MY3 A;  3BFT A;  1FTK A;  5EYF A;  5L9M A;  1I6A A;  1H44 A;  1B6H A;  4FE8 A;  4BDM A;  1XS5 A;  3HCQ A;  5I57 A;  2XX7 A;  4POW A;  4PFU A;  3CVG A;  1ZJL A;  3H4Z A;  3C32 A;  3K6V A;  4LP2 B;  1NNT A;  4QRZ A;  3IO4 A;  3LSF B;  3TCF A;  3VV5 A;  3H06 B;  2OJT A;  1P1N A;  1SBP A;  2VGQ A;  4LA9 A;  1VR5 A;  2VD3 A;  3SKP A;  4YMA A;  3K2D A;  5EHS A;  3PMX A;  4XKP A;  2ZXT A;  3OEK A;  3O28 A;  2I3W A;  2W7Y A;  1PDA A;  5DVF A;  3RN8 A;  1A55 A;  4PQJ A;  4DCY A;  2Q89 A;  3JZJ A;  2IA4 A;  1UIU A;  2DWI A;  3IB1 A;  4EQB A;  3IOW A;  5L9S A;  4P0I A;  1IXG A;  1D9V A;  2F7C A;  1UQW A;  2XXR A;  4KD5 A;  2NVU B;  1B7H A;  5ITO A;  2Z23 A;  3O6I A;  3FUZ A;  4XTC Q;  2ALU A;  3TPA A;  3FXR A;  3CSB A;  5I56 B;  3U94 A;  1M5B A;  1UTH A;  1LGB C;  4LQ2 A;  1PB9 A;  2DOJ A;  3A3C A;  2XXY A;  1GVC A;  4KYE A;  3USD A;  5CC2 A;  4F18 A;  2IEE A;  3PUY E;  1URG A;  4U22 A;  3T9U A;  4F3P A;  3SEX A;  3O2A A;  3KJ7 A;  3Q28 A;  5DVJ A;  1MPD A;  1SW4 A;  2UYF A;  5AA4 A;  4ZED A;  5L9O A;  1XVX A;  3PD8 A;  1EZ9 A;  2YLN A;  4ELR A;  2RC9 A;  1BTJ A;  3Q29 A;  4FAT A;  2YPN A;  3R6U A;  3M8U A;  1LB8 A;  1O63 A;  4M4G A;  4H0W A;  3C31 A;  2F34 A;  1JET A;  5L8D A;  1SI0 A;  4I8C A;  5I59 B;  3H6V A;  1UIV A;  1IXH A;  2ZMB A;  1EU8 A;  1OLA A;  1B5I A;  1DSN A;  1SVX B;  3KZG A;  2AL5 A;  5CRY A;  1B3E A;  1A8E A;  3RLF E;  4RK2 A;  1LBC A;  1LCF A;  2A5T A;  1YCJ A;  3T9X B;  5HM4 B;  1ELJ A;  5ICQ A;  3G3F A;  3O6H A;  3A3U A;  3CFL A;  2KLF A;  3CSG A;  2X7P A;  2I6E A;  4MFI A;  3T93 B;  4QFK A;  3MZ1 A;  4OER A;  4E0W A;  3M3K A;  3FXU A;  3QSL A;  2ZNS A;  4U2R A;  2OK2 A;  2QS1 A;  4EQ7 A;  1AOV A;  4NMY A;  3HV1 A;  4OEN A;  4R2F A;  4KFQ A;  2V93 A;  2RCA A;  4ZEF A;  2GHA A;  3FVG A;  5H8H A;  2XD3 A;  1LAX A;  3HST A;  1VSO A;  2DVC A;  5AA1 A;  3MW0 A;  4G8N A;  3PUZ E;  1B3F A;  3OMB A;  1SYI A;  2F35 A;  1H76 A;  4MBP A;  1RKM A;  3KG2 A;  2DVZ A;  3SER A;  3GZG A;  1FQF A;  2UXA A;  2I48 A;  3O97 A;  4ZZE A;  2DXR A;  3VLU A;  1A7L A;  3HN0 A;  1DMB A;  2NUV A;  4GLI A;  3TQW A;  1B3L A;  1EZP A;  1LFH A;  3CG1 A;  2REJ A;  3OSR A;  1JVX A;  1N3W A;  1Y4T A;  2QL3 A;  4PET A;  1Q35 A;  4PFY A;  3FVN A;  3TFL A;  3BFU A;  4FAJ A;  4O3A A;  3PPR A;  2V3T A;  2V84 A;  4WEP A;  4F3S A;  3VXB A;  2F97 A;  3FGS A;  4JSO A;  3TMG A;  5CBS A;  4FED A;  4KHZ E;  1NMU A;  4AQ4 A;  1BIY A;  1SD3 A;  4GQO A;  5DVI A;  1P1W A;  4O3C A;  5H8S A;  3Q25 A;  3WAE A;  3KBR A;  1P99 A;  1Q1K A;  4H65 A;  2ONK E;  5F1Q A;  3K6U A;  3T9V A;  3WAF A;  2QS3 A;  2PMS A;  3W15 C;  2F6G A;  4N13 A;  1JVY A;  1EH3 A;  3EF7 A;  1VFE A;  1XHY A;  4OEU A;  1TWY A;  2VOZ A;  5FTI A;  4ZEI A;  1M5E A;  1QKB A;  2HAU A;  4NED A;  4QHQ A;  2XXT A;  3B6Q A;  1PEB A;  2DS9 A;  1JNF A;  2H25 A;  3IO6 A;  1LST A;  5TU0 A;  1QUI A;  4OTE A;  1DTZ A;  4F2O A;  1OQG A;  4GIZ A;  2P1S A;  3KN3 A;  1XVY A;  3C36 A;  2XX8 A;  3H6T A;  3PMV A;  2DE2 A;  1JW4 A;  1B5J A;  3RNN A;  4IGT A;  5KCJ A;  1OVB A;  3G3H A;  4RNS A;  4GOT A;  5B7D A;  1PBQ A;  1N04 A;  2E1S A;  3BKI B;  3V89 B;  4FOR A;  3H6U A;  2GH9 A;  4TLL B;  2D3I A;  3TEL A;  1MY4 A;  1O64 A;  1Y3P A;  4EUO A;  3VFJ A;  4POX A;  5JTY A;  4EF1 A;  4GVO A;  1ATG A;  1SDX A;  3IOR A;  2XXW A;  4O3B A;  1GGG A;  4P11 A;  4RYA A;  1YAE A;  1A99 A;  1ANF A;  4NE4 A;  4TQU Q;  3E9X A;  1AH5 A;  1SW5 A;  2OLB A;  3EHT A;  5EHM A;  2DWH A;  4RPN A;  4YZZ A;  3PPN A;  2XXV A;  3SEW A;  1MQH A;  2H98 A;  4ZE8 A;  4EDP A;  4HTG A;  3OO9 A;  1Y3N A;  4EXK A;  4YB7 A;  1N3X A;  2ZYO A;  2D5W A;  4FJP A;  2A5S A;  4IB2 A;  4JB7 A;  1A40 A;  1TFD A;  3A09 A;  4NF8 A;  5M2V A;  4BDN A;  1WDN A;  1H43 A;  3E13 X;  3FAT A;  3I3V A;  3IB2 A;  3MAM A;  4JWY A;  1MRP A;  4LQ5 A;  3G3J A;  4R74 A;  4MLV A;  3IX1 A;  4X1D A;  3QAX A;  1Y20 A;  1OIB A;  4LAT A;  3MC2 A;  5H8Q A;  3HPI A;  1Y1Z A;  2XD2 A;  3K1P A;  4GRK A;  3RT6 B;  1ZBM A;  1L5T A;  2DE3 A;  3MVZ A;  4C1T A;  1NFT A;  3PGF A;  4QFL A;  4NF6 A;  4QSC A;  1A8F A;  1URS A;  3TAJ A;  2Y7P A;  1B0H A;  3IR1 A;  4R9G A;  4Z7E A;  1T0K A;  4EF2 A;  5TPA A;  4KYS A;  1MXU A;  4DDD A;  5IAI A;  2DSF A;  2PT2 A;  1IZ1 A;  2V3U A;  1UTB A;  5ISU A;  3QXM A;  4DZ1 A;  5AA2 B;  4XXU A;  3AXF A;  1FTM A;  4H8J A;  3SEY A;  4U1Z A;  5IKB A;  3H03 A;  3S2V A;  1B3H A;  1CB6 A;  2ABH A;  2H4I A;  3OOA A;  4Q8R A;  2O7I A;  3V83 A;  2F8D A;  4ELQ A;  5H8F A;  4PFT A;  4ELO A;  3TQL A;  4ZZA A;  1ZMG A;  1N7X A;  3PU5 A;  4F1V A;  1POT A;  4DXC A;  2I58 A;  4PE5 B;  1SI1 A;  3DP6 A;  4F29 A;  2X26 A;  4R6K A;  3T66 A;  4G4P A;  1PBP A;  2Q2A A;  1FTJ A;  2GHB A;  1JEV A;  1S7Y A;  2HQ0 A;  2XX9 A;  1B4Z A;  3GLB A;  3UOR A;  3GBB A;  1D3K A;  3FVK A;  1FQD A;  4ZE9 A;  4G68 C;  2F36 A;  1JW1 A;  3HO7 A;  4KYD A;  4JWO A;  4LON B;  3BBR A;  3VXC A;  3PUX E;  4X1B A;  5TP9 A;  1NNF A;  3RUM A;  1QVS A;  3TKD A;  4DXB A;  2F6P A;  1NKX A;  4F39 A;  3IJO B;  5KCJ B;  4BDO A;  5I2K A;  4RJZ A;  2V25 A;  4IO3 A;  1B0L A;  2DXY A;  4I9D A;  2REG A;  4OET A;  1DPE A;  1MY1 A;  2AIX A;  4RPO A;  3UK4 A;  4OFJ A;  2QMX A;  4IY5 A;  1M5D A;  1MQJ A;  1MXV A;  3QUF A;  5F7V A;  1Z7M E;  3FJG A;  3K0V A;  4ZEK A;  1POY 1;  3SDF A;  3T9H B;  4GFR A;  4THI A;  2WKY A;  2VP1 A;  3MZ9 A;  4IO6 A;  1MH3 A;  1JW5 A;  1P1Q A;  2B3B A;  5HPQ A;  4ZDM A;  1MXY A;  4LZ5 A;  1Z7N E;  5FTH A;  2UVJ A;  1MXZ A;  2ONS A;  5I2K B;  3C9H A;  4KCC A;  3S9L C;  4BDL A;  4ND9 A;  4OHN A;  1QKA A;  2I0B A;  1MM6 A;  5LOM A;  3Q27 A;  4H6D A;  1FTL A;  4BDQ A;  2O69 A;  4AB5 A;  3RQT A;  1GR2 A;  2F7A A;  2XHD A;  3KSX A;  4OVJ A;  1I6B A;  2HAV A;  4JDF A;  2Q8J A;  4BDR A;  4R6H A;  2XXH A;  4F22 A;  4DLD A;  4OEV A;  2XXP A;  2P0S A;  3VVF A;  2X7Q A;  4WKM A;  2THI A;  5ELV A;  1EZO A;  3G3G A;  2CMO A;  1TT1 A;  2PX1 A;  2DP8 A;  1IQ7 A;  3OEM A;  5DEX A;  1H45 A;  2ZYM A;  5K2X A;  3SES A;  1XOC A;  5H8F B;  4F1U A;  1SQY A;  5A5X B;  1I6Q A;  1ZU0 A;  2HXW A;  2O1M A;  1BKA A;  1JQF A;  1N76 A;  2QS4 A;  2ZYN A;  3N26 A;  4G68 A;  3RTW B;  1F9B A;  3QIM A;  4DIG A;  3UN6 A;  2Y7I A;  3N6T A;  2A5T B;  4NF5 A;  3OO8 A;  1SW1 A;  1UTB B;  2DWA A;  3D4G A;  4G68 B;  4LVQ A;  1AIV A;  2FYI A;  3PUV E;  3T96 B;  1B40 A;  3KJT A;  1SYH A;  3KFM A;  4H5F A;  2P2A A;  4R73 A;  4HCY A;  1B46 A;  1URD A;  3IK6 B;  2QSX A;  3IOU A;  4N6P A;  3TDJ A;  4I1D A;  2HFB A;  3EQ1 A;  3M3L A;  4C0R A;  5J1D A;  4H8I A;  4MF3 A;  2PT1 A;  2Y84 A;  4OES A;  3MQ9 A;  1B51 A;  2DWJ A;  2PYY A;  3G3I A;  4U1O A;  3ILT B;  1MDP 1;  2Y7W A;  3CG3 A;  5JEI A;  3CFX A;  3K01 A;  1GTK A;  1VE4 A;  4QFO A;  2UVH A;  5FHN A;  4C1U A;  3LSX A;  1BLF A;  4AB6 A;  2F5X A;  1IIT A;  1MM7 A;  1US5 A;  3U72 A;  1P1U A;  3VLW A;  4GXA A;  1FQB A;  5I84 A;  3S9E A;  3FD3 A;  3F11 A;  2PBW A;  4NF4 B;  5FHM A;  4FIM A;  4F2Q A;  1FQA A;  3TZA A;  1FCK A;  2OBG A;  3KN8 A;  5HBC A;  3TTM A;  4X9T A;  1LCT A;  4MLQ A;  2NOO A;  4G2Z A;  4R9F A;  2R6G E;  2R9J A;  2O7U A;  4LZ7 A;  1MPC A;  1NNP A;  1B05 A;  1Y9U A;  3PD9 A;  3IOV A;  5CBR A;  2O51 A;  3C4M A;  3LSL A;  1FTO A;  1US4 A;  2O6A A;  5TP9 B;  1ZLQ A;  4XKQ A;  1YTV A;  1MXW A;  1P1O A;  1YPN A;  2ZNU A;  1NH8 A;  3OEN A;  4GXS B;  4PFW A;  2NXO A;  2RC8 A;  3Q26 A;  4Z0I A;  1I69 A;  5DT6 A;  1XT8 A;  1WOD A;  3QUJ A;  4R72 A;  2OCU A;  2QJE A;  1OQH A;  3IL1 B;  4OQO A;  4NTL A;  4QFN A;  2I3V A;  3D4C A;  3C35 A;  1OVT A;  4JXI A;  1USY H;  2GFE A;  3ONM A;  4KCD A;  4R75 A;  5AA3 A;  5CM6 A;  1QUK A;  5AE4 A;  3K1M A;  3K6X A;  3E4R A;  4JWX A;  3CIJ A;  5CMM A;  1MY0 A;  2HEU A;  2RCB A;  4YB5 A;  1MPB A;  5I58 A;  5CI5 A;  3IOT A;  2O68 A;  3PPQ A;  4KPT A;  3H7M A;  3K4U A;  3RTF B;  3SEU A;  1B52 A;  3PPP A;  3ZKK A;  1B1H A;  4NF4 A;  3U92 A;  3DM0 A;  4NWD A;  3KSJ A;  5TPA B;  1QUJ A;  4IGR A;  3IJX B;  3UGW A;  4F31 B;  3JV9 A;  3OO6 A;  4NF6 B;  4UA8 A;  5I2N A;  1DOT A;  3PUW E;  4F3G A;  3VDF A;  2VHA A;  1LAG E;  3KGC A;  3QK6 A;  1AL3 A;  4HS7 A;  1Y3Q A;  1LBB A;  1NNK A;  1R9L A;  3H3G A;  3TOD A;  1H3D A;  2QMW A;  1PB8 A;  5H8Q B;  1O7T A;  3EPE A;  3TTR A;  3SET A;  2Z22 A;  2M8C A;  2PVU A;  3HHG A;  2O84 X;  2XXU A;  2VD2 A;  1VFD A;  3K6W A;  3L6H A;  4N07 A;  3K1N A;  4G8M A;  3ILU B;  1B9J A;  2LAO A;  4Q30 B;  4EXL A;  1FQC A;  3TEP A;  5H8N B;  1MG1 A;  3S9M C;  3VVD A;  5CMK A;  1MQI A;  1MY2 A;  1TFA A;  3G3K A;  2O1L A;  1B1X A;  1N84 A;  3DP8 A;  3KOT A;  3RT8 A;  4KQP A;  2AYS A;  1R9Q A;  4L17 A;  4ECF A;  3B7D A;  1SW2 A;  4ISU A;  4RXL A;  2HZL A;  4PP0 A;  1LFI A;  2Z8E A;  4NF5 B;  2QPQ A;  2BJJ X;  2Y7K A;  3MP8 A;  1DPP A;  4H67 A;  4QF9 A;  2UVG A;  4ONY A;  2RKM A;  3C34 A;  1MQD A;  3R7X A;  1GV8 A;  4U4S A;  4YU0 A;  5AA2 D;  5I59 A;  2DYX A;  4GD5 A;  5A5X A;  4FEB A;  3QYT A;  3FJM A;  1AMF A;  4IO2 A;  3U1O A;  1OMP A;  5DEX B;  1MS7 A;  3HHF A;  4RK9 A;  4RY1 A;  4YIC A;  2Q88 A;  4YB6 A;  2H5Y A;  1R6Z A;  1QUL A;  3LR1 A;  1B3G A;  3O66 A;  5AA4 B;  1S50 A;  3I5O A;  4XKR A;  1IXI A;  1II5 A;  2V3Q A;  4F3B A;  3GBA A;  4KR5 A;  4U23 A;  1S9T A;  1CE2 A;  3E3K A;  3MBP A;  1JEU A;  3SEV A;  4HCW A;  3TCG A;  4ZEC A;  3CFZ A;  2AL4 A;  2OZZ A;  2QS2 A;  4LZ8 A;  3RY3 A;  3THI A;  2Y7R A;  2HCA A;  4WED A;  2OWS A;  3N5L A;  3U8Q A;  3ZKL A;  4HW8 A;  4IO4 A;  4DCX A;  3ODB A;  3RPW A;  2I0C A;  4ZEB A;  1B4H A;  3DP4 A;  2D21 A;  4MH5 A;  1QW0 A;  4GL8 A;  1LFG A;  4FEC A;  1TXF A;  3S9N C;  4ELP A;  2XXX A;  1B5H A;  3KEI A;  4YKJ A;  4IO5 A;  2GRV A;  3UA8 A;  1NL5 A;  4X48 A;  4TLM B;  3UP9 A;  4F19 A;  3ECR A;  2NWJ A;  5ICT A;  3MPK A;  1PB7 A;  3N94 A;  3V5A A;  2Q2C A;  2E0S A;  1ZIU A;  3MVY A;  3VE1 B;  1ZTY A;  4ESX A;  4YMB A;  1KWH A;  1LLS A;  3MVW A;  1IXC A;  1B2H A;  3OSQ A;  5DTB A;  2F7B A;  3CR9 A;  4TOZ A;  5I57 B;  5H8H B;  2XXI A;  4WXJ A;  2QRY A;  2H9B A;  3B6W A;  1NH7 A;  3JYR A;  3KOS A;  3PV0 E;  4QSE A;  3GXA A;  4Q5T A;  5K2Y A;  2XXQ A;  3ZSF A;  5ITP A;  3OXN A;  4R6Y A;  2UYE A;  2I4B A;  3EHU A;  3FVO A;  3MPL A;  4YKP A;  3L6G A;  1MXX A;  1QJM A;  3CI8 A;  3R26 A;  3CRB A;  3PMW A;  1Y1M A;  1A54 A;  1B7U A;  1LAF E;  4H1X A;  4BLA A;  4E0X A;  3MWB A;  1HSL A;  4OYV A;  2Q9T A;  4QFP A;  5FHO A;  5AA2 A; 
#chains in the Genus database with same CATH topology
 3EN3 A;  3TTK A;  1HSE A;  3C33 A;  3OO7 A;  2FNC A;  2G29 A;  1IUD A;  4GWZ A;  1D9Q A;  3LSW A;  5DYH A;  1ZKB A;  2VPN A;  3S4U A;  1FQE A;  1Y4C A;  1SPI A;  3TYH A;  5I56 A;  2ANJ A;  3TTL A;  1BP5 A;  3MP6 A;  2CZI A;  1J1N A;  3B6T A;  4G8H A;  1M5F A;  2DE4 A;  5KDT B;  1YYZ A;  4NWC A;  4OWD A;  3FIR A;  3TTN A;  3I6V A;  4YAH X;  4U21 A;  1IIW A;  5EQA A;  2F3D A;  3IB0 A;  2B65 A;  4DXU A;  4MAG A;  3DEL B;  2I4C A;  3LUY A;  1HSJ A;  1I6A A;  1H44 A;  1B6H A;  4FE8 A;  1XS5 A;  2ZZX A;  3HCQ A;  3CVG A;  1ZJL A;  3H4Z A;  3C32 A;  4LP2 B;  4QRZ A;  2OJT A;  1SBP A;  2VGQ A;  5EHS A;  2ZXT A;  4NG7 A;  3OEK A;  2W7Y A;  1PDA A;  1INP A;  1A55 A;  1UIU A;  1D9V A;  2F7C A;  2XXR A;  4PF6 A;  3EKI A;  1EYI A;  3BIH A;  5ITO A;  2Z23 A;  1FJ6 A;  4XTC Q;  5I56 B;  3CSB A;  3U94 A;  1FTA A;  1M5B A;  2FIX A;  2DOJ A;  2XXY A;  1GVC A;  4F18 A;  3PUY E;  4F3P A;  1MPD A;  4KXP A;  4GWS A;  5AA4 A;  2FIE A;  1XVX A;  2YLN A;  4N17 A;  2Q8M A;  2PFZ A;  4I8C A;  3H6V A;  2ZMB A;  1EU8 A;  1OLA A;  1DSN A;  2AL5 A;  3O6H A;  2KLF A;  3CSG A;  2WYK A;  4QFK A;  4H45 A;  4U2R A;  3FXU A;  2OK2 A;  4EQ7 A;  4ZEF A;  5FBP A;  5A5L A;  2XD3 A;  1VSO A;  3MW0 A;  4G8N A;  5ET5 A;  2DXR A;  1A7L A;  3HN0 A;  1Y4T A;  3FBP A;  3ISP A;  4O3A A;  2V84 A;  4WEP A;  3VXB A;  3FGS A;  5CBS A;  4KHZ E;  1NMU A;  4AQ4 A;  3WAE A;  3WAF A;  5ET7 A;  2QS3 A;  2PMS A;  3W15 C;  4OEU A;  1EH3 A;  1TWY A;  4ZEI A;  4QHQ A;  1PEB A;  2DS9 A;  1QUI A;  4OTE A;  2P1S A;  3KN3 A;  3PMV A;  1JW4 A;  1B5J A;  1NV1 A;  4RNS A;  4GOT A;  4TLL B;  2GH9 A;  3TEL A;  4EUO A;  4EF1 A;  5EQ8 A;  1YAE A;  1A99 A;  5EHM A;  5ET8 A;  2DWH A;  4RPN A;  3SEW A;  4HTG A;  4P1E A;  2ZYO A;  4NF8 A;  1A40 A;  3A09 A;  4BDN A;  1XI6 A;  3IX1 A;  3QAX A;  4HXV A;  3HPI A;  1Y1Z A;  4QSC A;  3PGF A;  3TAJ A;  1A8F A;  1URS A;  3IR1 A;  1T0K A;  2KQZ A;  1MXU A;  4QBA A;  1UTB A;  4XXU A;  3SEY A;  4U1Z A;  1B3H A;  2H4I A;  3CHG A;  5H8F A;  2WBD A;  4ELO A;  4MEV A;  4DXC A;  4NHB A;  1FTJ A;  1VDW A;  1RDX A;  4MJO A;  3T1B A;  1D3K A;  4G68 C;  3HO7 A;  4JWO A;  4X1B A;  4DXB A;  2F6P A;  3IJO B;  1FBC A;  4RJZ A;  1B0L A;  2DXY A;  1DPE A;  4OFJ A;  4NF0 A;  1M5D A;  1Z7M E;  4ZEK A;  1POY 1;  1MH3 A;  4ZDM A;  1MXY A;  4LZ5 A;  1Z7N E;  5FTH A;  5J16 A;  1MXZ A;  3S9L C;  4KCC A;  4ND9 A;  1K9Z A;  2B4M A;  3LV0 A;  1GR2 A;  2XHD A;  4OVJ A;  2HAV A;  4BDR A;  4R6H A;  5DW8 A;  2CMO A;  3OEM A;  5H8F B;  4PAF A;  1I6Q A;  2HXW A;  1BKA A;  1N76 A;  3QIM A;  3N6T A;  3E78 A;  1UTB B;  2FYI A;  3KJT A;  1SYH A;  1NUX A;  4H5F A;  4R73 A;  4HCY A;  1B46 A;  1URD A;  2QSX A;  3IOU A;  2Y84 A;  4N6D A;  3ILT B;  4X04 A;  2L5V A;  4AB6 A;  1US5 A;  5I84 A;  3FD3 A;  4NF4 B;  3TZA A;  1FCK A;  4AS5 A;  4X9T A;  1LCT A;  4YMA A;  2NOO A;  4G2Z A;  2R6G E;  2O7U A;  1Y9U A;  2O51 A;  5TP9 B;  2O6A A;  3OEN A;  1P1O A;  2RC8 A;  1I69 A;  2QJE A;  3IFA A;  2GFE A;  4R75 A;  1NV4 A;  2F3B A;  1QUK A;  5AE4 A;  1FPE A;  3K6X A;  1MY0 A;  3IOT A;  3K4U A;  3PPP A;  4MIJ A;  4NF4 A;  2WYP A;  5TPA B;  1QUJ A;  4IGR A;  3UGW A;  4F31 B;  3JV9 A;  4NF6 B;  1LAG E;  3KGC A;  3QK6 A;  4ZEC A;  1Y3Q A;  1H3D A;  3TTR A;  2JJK A;  5DT6 A;  3SES A;  2VD2 A;  4EXL A;  4G8M A;  2LAO A;  2OWZ A;  1MG1 A;  1MY2 A;  3G3K A;  3DP8 A;  3NOH A;  1FPI A;  4PP0 A;  4H67 A;  3MP8 A;  4QF9 A;  2UVG A;  1MQD A;  4U4S A;  4FEB A;  1MS7 A;  2H5Y A;  1QUL A;  1G0H A;  5AA4 B;  3GBA A;  4KR5 A;  4U23 A;  1S9T A;  2HCA A;  4DCX A;  3ODB A;  1B4H A;  4OVR A;  1LFG A;  2HXR A;  3UA8 A;  4TLM B;  5ICT A;  3MPK A;  1PB7 A;  2E0S A;  3VE1 B;  4ESX A;  1ZTY A;  3CR9 A;  4OVT A;  5H8H B;  1NH7 A;  4QSE A;  5ITP A;  4Q5T A;  2XXQ A;  4YKP A;  3FVO A;  2I4B A;  3MPL A;  4BDL A;  5DTB A;  3R26 A;  4BLA A;  4H1X A;  1A54 A;  2Q9T A;  4QFP A;  4NQ8 A;  1USY E;  5KDT A;  3T22 A;  3MZB A;  3OEL A;  3H6W A;  4JSD A;  1B58 A;  2Z8D A;  3TCH A;  4H5G A;  2F78 A;  3FV1 A;  4OXV A;  2BJI A;  3O9P A;  4QSD A;  1MH4 A;  5H8N A;  5CMC A;  1OLC A;  4NF8 B;  2QVV A;  4UAC A;  2R71 A;  2CZL A;  2Z8F A;  3KN7 A;  3U72 A;  2ZYK A;  4JVI A;  2H99 A;  3IAZ A;  4KI0 E;  1N7W A;  3P7I A;  4G61 A;  4ZS9 A;  2OWT A;  1MDQ A;  1IMF A;  3MP1 A;  1D4N A;  5I58 B;  4LUB A;  4OFL A;  2P3V A;  3DLN A;  4GWO A;  4P0G A;  3G7W A;  1MQG A;  3FAS A;  2FA7 A;  1MY3 A;  1YZ0 A;  5EYF A;  5I57 A;  2XX7 A;  1CNQ A;  3K6V A;  3IO4 A;  3TCF A;  4LA9 A;  2VD3 A;  4XKP A;  2I3W A;  2PFY A;  4DCY A;  2Q89 A;  2IA4 A;  3IB1 A;  5L9S A;  3IOW A;  4FBP A;  3BIG A;  4KD5 A;  2NVU B;  3O6I A;  3FUZ A;  2ALU A;  3A3C A;  5ET6 A;  4DI4 B;  1URG A;  3T9U A;  3KJ7 A;  5DVJ A;  4ZED A;  3PD8 A;  4ELR A;  2RC9 A;  1BTJ A;  4O8M A;  4X8R A;  4M4G A;  2CZK A;  2F34 A;  1SI0 A;  2MKZ A;  5CRY A;  3RLF E;  1B3E A;  1A8E A;  1LCF A;  2A5T A;  1YCJ A;  5ICQ A;  1ELJ A;  3CFL A;  3LUZ A;  3T0J A;  4E0W A;  2QS1 A;  2FBP A;  4KFQ A;  2V93 A;  3PUZ E;  3OMB A;  1SYI A;  1RKM A;  3KG2 A;  3GZG A;  1FQF A;  2I48 A;  3O97 A;  4ZZE A;  4GLI A;  1DMB A;  4GWX A;  1FPB A;  2HPG A;  1JVX A;  2QL3 A;  1Q35 A;  4PFY A;  3FVN A;  3BFU A;  2XWV A;  2F97 A;  1NV7 A;  3B50 A;  3RPL A;  1BIY A;  1SD3 A;  4GQO A;  5H8S A;  3KBR A;  4H65 A;  5KCJ A;  5T3J A;  3UK4 A;  1QKB A;  2XXT A;  3B6Q A;  3IO6 A;  1LST A;  5TU0 A;  4NN3 A;  4F2O A;  1XVY A;  3C36 A;  4IGT A;  3G3H A;  1LBY A;  3V89 B;  4FOR A;  3H6U A;  1QGX A;  3VFJ A;  4POX A;  1IMA A;  4P11 A;  3TUS A;  4TQU Q;  3EHT A;  3IFC A;  4F22 A;  4PFB A;  2H98 A;  1FPL A;  4YB7 A;  4FJP A;  5M2V A;  4R74 A;  1DCU A;  1Y20 A;  1OIB A;  5H8Q A;  4GRK A;  2Q74 A;  2DE3 A;  4C1T A;  4Z7E A;  4KYS A;  4DDD A;  4P56 A;  1IZ1 A;  4PDD A;  4O94 A;  3AXF A;  2ABH A;  3OOA A;  4PFT A;  4ZZA A;  4N4U A;  3DP6 A;  4F29 A;  2X26 A;  4R6K A;  1PBP A;  1FBP A;  1JEV A;  1S7Y A;  2HQ0 A;  2XX9 A;  3GLB A;  1FQD A;  4ZE9 A;  1JW1 A;  2DDK A;  3VXC A;  1NNF A;  1QVS A;  4BDO A;  4IO3 A;  4RPO A;  4XEQ A;  1MQJ A;  5F7V A;  4GFR A;  2VP1 A;  3MZ9 A;  1JW5 A;  2B3B A;  2UVJ A;  5I2K B;  1QKA A;  3Q27 A;  1FTL A;  2F7A A;  1I6B A;  2Q8J A;  4DLD A;  2WBB A;  2X7Q A;  4WKM A;  5ELV A;  1TT1 A;  1IQ7 A;  1IMD A;  2ZYM A;  5K2X A;  5A5X B;  2ZYN A;  2QS4 A;  4G68 A;  4N15 A;  1F9B A;  4DIG A;  3UN6 A;  2Y7I A;  2OX3 A;  3OO8 A;  1SW1 A;  4LVQ A;  3D4G A;  5IZZ A;  3T96 B;  1B40 A;  4PDH A;  3KFM A;  2P2A A;  4GBW A;  3EQ1 A;  3M3L A;  4C0R A;  4H8I A;  3MQ9 A;  3G3I A;  2Y7W A;  4GWU A;  4QFO A;  3LSX A;  1BLF A;  1MM7 A;  1P1U A;  3VLW A;  1FQB A;  2PBW A;  3KN8 A;  4MLQ A;  4LZ7 A;  1B05 A;  3PD9 A;  3C4M A;  3LSL A;  1US4 A;  1YTV A;  1MXW A;  2ZNU A;  4PFW A;  1NH8 A;  2NXO A;  3Q26 A;  3QUJ A;  4R72 A;  1OQH A;  2GQ1 A;  4OQO A;  4NTL A;  3D4C A;  3C35 A;  1USY H;  4KCD A;  5AA3 A;  4OVQ A;  4PBH A;  4JWX A;  3CIJ A;  1MPB A;  5CI5 A;  3SEU A;  1B52 A;  3KC0 A;  3KSJ A;  4PGP A;  5I2N A;  4UA8 A;  3VDF A;  2VHA A;  1LBV A;  3TPA A;  4HS7 A;  1DK4 A;  1LBB A;  3H3G A;  2QMW A;  1PB8 A;  3SET A;  2Z22 A;  4PFU A;  3HHG A;  2XXU A;  3K6W A;  2XWK A;  1B9J A;  2FVZ A;  5CMK A;  1MQI A;  4OVP A;  4ECF A;  3B7D A;  1SW2 A;  4ISU A;  4NF5 B;  2Y7K A;  2BJJ X;  2XWO A;  3C34 A;  4O7I A;  5I59 A;  4GD5 A;  3FJM A;  3U1O A;  3HHF A;  3B8B A;  1R6Z A;  1S50 A;  5IZ3 A;  4F3B A;  4HCW A;  2QS2 A;  2OZZ A;  4AB5 A;  4LZ8 A;  3RY3 A;  2WX9 A;  2I0C A;  4ZEB A;  1QW0 A;  3A29 A;  4GL8 A;  4FEC A;  1TXF A;  3S9N C;  4ELP A;  1AWB A;  3KEI A;  2GRV A;  1NL5 A;  4X48 A;  3D1R A;  3UP9 A;  4F19 A;  4MCO A;  3V5A A;  1ZIU A;  1DBZ A;  4IR8 A;  3MVW A;  3OSQ A;  2QRY A;  3PV0 E;  3KC1 A;  3OXN A;  5EYG A;  3EHU A;  4Q8R A;  3L6G A;  1MXX A;  3CRB A;  1LEV A;  1HSL A;  4N81 A;  4OYV A;  5AA2 A;  1N0T A;  5BUU A;  2KR0 A;  3FZV A;  1NV5 A;  4OMB A;  4GL0 A;  2RIN A;  4IY6 A;  1IMB A;  4IO7 A;  2RC7 A;  4XKN A;  3VVE A;  2I49 A;  3MJN A;  2RF1 A;  2B3F A;  3ZS6 A;  1UTH B;  4R2B A;  1DTG A;  1FBD A;  3FV2 A;  1D9Y A;  1IEJ A;  3OD7 A;  2DQV A;  1B7Z A;  5I2N B;  4OFO A;  3O29 A;  3N6U A;  3W9V A;  5I7I A;  4JVD A;  1LB9 A;  3W9W A;  1RYX A;  3ROJ A;  4F1Y A;  3U93 A;  1PC3 A;  4U4X A;  5ESY A;  5L9M A;  4BDM A;  4POW A;  1LBX A;  3H06 B;  1Q9D A;  1VR5 A;  1FPG A;  3K2D A;  3PMX A;  4MNP A;  3O28 A;  1EYK A;  3RN8 A;  4PQJ A;  5LDZ A;  3JZJ A;  2DWI A;  1FBG A;  4EQB A;  4PCD A;  4P47 A;  1B7H A;  1UTH A;  4LQ2 A;  1PB9 A;  3USD A;  2IEE A;  4U22 A;  3SEX A;  3KBZ A;  3Q28 A;  1SW4 A;  2UYF A;  4P9K A;  5L9O A;  4FAT A;  3R6U A;  3M8U A;  1LB8 A;  5IM2 A;  4H0W A;  1UIV A;  1IXH A;  3KZG A;  4I40 A;  4RK2 A;  1LBC A;  5HM4 B;  2X7P A;  2I6E A;  4MFI A;  3T93 B;  4OER A;  4HE2 A;  3M3K A;  2ZNS A;  4NMY A;  4R2F A;  3FVG A;  2R8T A;  3HST A;  2DVC A;  5AA1 A;  1H76 A;  1NV0 A;  2DVZ A;  3SER A;  3VLU A;  1B3L A;  4N6K A;  2REJ A;  2ZZV A;  3TFL A;  3PPR A;  2V3T A;  4F3S A;  4FED A;  5DVI A;  4PFI A;  1P1W A;  1Q1K A;  3K6U A;  2F6G A;  1XHY A;  5FTI A;  5IZ3 B;  2HAU A;  1JNF A;  1DTZ A;  1OQG A;  3H6T A;  3RNN A;  1PBQ A;  1N04 A;  3BKI B;  5JTY A;  2B4L A;  2CZH A;  2XXW A;  3RT6 B;  1GGG A;  5FHM A;  1ANF A;  3E9X A;  4NAP A;  4MNI A;  1SW5 A;  2OLB A;  4YZZ A;  3PPN A;  4EDP A;  4ZE8 A;  3OO9 A;  4NGU A;  2D5W A;  2VT5 A;  4JB7 A;  4FAJ A;  3FAT A;  1H43 A;  3IB2 A;  3MAM A;  4JWY A;  1MRP A;  4LAT A;  3MC2 A;  4LN5 A;  4R9G A;  3HFU A;  5IAI A;  2DSF A;  2PT2 A;  3QXM A;  1FTM A;  2Y5L A;  4H46 A;  3H03 A;  3S2V A;  2ZZW A;  4MX6 A;  2O7I A;  3V83 A;  2F8D A;  2PCR A;  3TQL A;  1ZMG A;  4F1V A;  1SI1 A;  3T66 A;  3PTY A;  3GYY A;  3UOR A;  4LON B;  4KYD A;  3BBR A;  3PUX E;  3RUM A;  5KCJ B;  4F39 A;  4GWW A;  2V25 A;  4OET A;  1MY1 A;  2AIX A;  4JVC A;  3U65 A;  4IY5 A;  1MXV A;  3QUF A;  3T9H B;  4GX6 A;  4IO6 A;  1P1Q A;  4PC9 A;  1FJ9 A;  2I0B A;  5LOM A;  4BDQ A;  5EQ7 A;  2HHM A;  3RQT A;  4OEV A;  2XXP A;  2P0S A;  2THI A;  1EZO A;  3G3G A;  1FPJ A;  2DP8 A;  4GBV A;  5DEX A;  1XOC A;  1SQY A;  3RTW B;  3N26 A;  3MYU A;  3E79 A;  2A5T B;  2DWA A;  4G68 B;  1AIV A;  1K9Y A;  1IME A;  1KA1 A;  3IK6 B;  3TDJ A;  2HFB A;  4OES A;  2DWJ A;  2PYY A;  1MDP 1;  3CG3 A;  3CFX A;  3K01 A;  4C1U A;  2F5X A;  4FIM A;  3QMF A;  3TTM A;  4R9F A;  2R9J A;  2CEX A;  3MST A;  4XKQ A;  1YPN A;  4GXS B;  2QVU A;  1XT8 A;  1WOD A;  3IL1 B;  4QFN A;  2VPO A;  3ONM A;  2RCB A;  4YB5 A;  5I58 A;  2O68 A;  3PPQ A;  4KPT A;  1KZ8 A;  1RDZ A;  4I3E A;  1FBH A;  1DOT A;  3PUW E;  2XWI A;  1AL3 A;  3TOD A;  5I3S A;  5H8Q B;  1O7T A;  4PBQ A;  2M8C A;  3L6H A;  4N07 A;  3K1N A;  3ILU B;  4Q30 B;  1FQC A;  5H8N B;  1JP4 A;  3KOT A;  4KQP A;  2AYS A;  1R9Q A;  4L17 A;  2HZL A;  1LFI A;  2Z8E A;  2QPQ A;  1DPP A;  5EYH A;  3R7X A;  1GV8 A;  1NUZ A;  3QYT A;  1OMP A;  5DEX B;  4RK9 A;  1FBF A;  3LR1 A;  1NV6 A;  2V3Q A;  4DI3 D;  3MBP A;  1CE2 A;  3E3K A;  1JEU A;  3SEV A;  4GWY A;  3TCG A;  3CFZ A;  3THI A;  3ZKL A;  2OWS A;  3N5L A;  1G0I A;  1FPF A;  3DP4 A;  4AS4 A;  2D21 A;  4MNC A;  4N8Y A;  4YKJ A;  4HE1 A;  3N94 A;  3MVY A;  3RYD A;  1B2H A;  2XXI A;  4WXJ A;  2H9B A;  3FXB A;  3JYR A;  4GX4 A;  5K2Y A;  3GXA A;  4N91 A;  1QJM A;  4O3B A;  3PMW A;  1LAF E;  4E0X A;  3MWB A;  5FHO A;  2UVI A;  3UIF A;  4P3L A;  1B32 A;  1FW0 A;  2P3N A;  3PPO A;  5B70 A;  2ONR A;  4EQ9 A;  5BWJ A;  4YKK A;  4OZ9 A;  1LAH E;  4YKI A;  1FBE A;  2ZNT A;  3K00 A;  1XC1 A;  3FXQ A;  5CMB A;  3LBS A;  3K02 A;  3LC8 A;  4XIG Q;  3MUQ A;  4ESW A;  3EHS A;  1NV3 A;  2G93 A;  3FJ7 A;  4I62 A;  1NI9 A;  3V8X B;  5JTY B;  1LBZ A;  1R1N A;  1RYO A;  3VLV A;  1WVJ A;  3M3F A;  1M5C A;  5KZT A;  4HE0 A;  4RA1 A;  3O6G A;  4JBZ A;  5JK4 A;  4Q0C A;  2ESN A;  4GF8 A;  2YJP A;  3MVX A;  2HZK A;  4DE8 A;  5IGA A;  4G77 A;  4M1V A;  3RGY A;  4K3F A;  3BFT A;  1FTK A;  1NNT A;  3LSF B;  3VV5 A;  1P1N A;  3SKP A;  5DVF A;  1NV2 A;  4P0I A;  1IXG A;  1RDY A;  1UQW A;  2QVR A;  3FXR A;  1LGB C;  4KYE A;  5CC2 A;  3O2A A;  1EZ9 A;  3Q29 A;  2YPN A;  1O63 A;  4GX3 A;  3C31 A;  1JET A;  5L8D A;  5I59 B;  1B5I A;  1SVX B;  4QXD A;  3G3F A;  3A3U A;  3MZ1 A;  2WEF A;  4PE3 A;  3QSL A;  2V4C A;  1AOV A;  3HV1 A;  4OEN A;  2RCA A;  2GHA A;  4NX1 A;  5H8H A;  1LAX A;  4PTK A;  1B3F A;  4MBP A;  2F35 A;  2UXA A;  1EZP A;  1LBW A;  2NUV A;  3TQW A;  1LFH A;  3CG1 A;  2QFL A;  3OSR A;  1N3W A;  4PET A;  4JSO A;  3TMG A;  4O3C A;  3Q25 A;  1P99 A;  5F1Q A;  2ONK E;  3T9V A;  4OAN A;  4N13 A;  1JVY A;  3EF7 A;  4DZ1 A;  1VFE A;  2VOZ A;  1M5E A;  4NED A;  4MHF A;  2H25 A;  4GIZ A;  2XX8 A;  2DE2 A;  1OVB A;  5B7D A;  2E1S A;  2D3I A;  1MY4 A;  1O64 A;  1Y3P A;  4GVO A;  1ATG A;  1SDX A;  3IOR A;  4NE4 A;  1AH5 A;  2XXV A;  1MQH A;  1Y3N A;  4EXK A;  1N3X A;  4IB2 A;  4P8B A;  2A5S A;  1TFD A;  1WDN A;  3E13 X;  3I3V A;  3T9X B;  4LQ5 A;  1IMC A;  3G3J A;  4MLV A;  4X1D A;  3K1P A;  2XD2 A;  1ZBM A;  1L5T A;  3MVZ A;  1NFT A;  4QFL A;  4NF6 A;  2Y7P A;  1B0H A;  4EF2 A;  5TPA A;  4N8G A;  5ISU A;  2V3U A;  5AA2 B;  4H8J A;  5IKB A;  1CB6 A;  4ELQ A;  4O7M A;  1YXI A;  1N7X A;  3PU5 A;  1POT A;  2I58 A;  4PE5 B;  4P1L A;  2FHY A;  4G4P A;  2Q2A A;  2GHB A;  3SZP A;  1B4Z A;  3GBB A;  3FVK A;  2F36 A;  1NUY A;  5TP9 A;  3TKD A;  1NKX A;  5I2K A;  4RYA A;  4I9D A;  2REG A;  2QMX A;  4PGN A;  3K0V A;  3FJG A;  3SDF A;  4THI A;  3TEP A;  2WKY A;  5HPQ A;  4XF5 A;  4OA4 A;  2ONS A;  3C9H A;  4OHN A;  1MM6 A;  5EQ9 A;  4H6D A;  2O69 A;  3KSX A;  1BK4 A;  4JDF A;  2XXH A;  1FPK A;  2PX1 A;  5IZ1 A;  1H45 A;  4F1U A;  1ZU0 A;  2O1M A;  1JQF A;  4YMB A;  1KA0 A;  4NF5 A;  1FPD A;  3PUV E;  4N6P A;  4PFR A;  4I1D A;  4XFE A;  5J1D A;  4MF3 A;  2PT1 A;  1B51 A;  4U1O A;  5JEI A;  1GTK A;  1VE4 A;  4PAK A;  2UVH A;  2CEY A;  1IIT A;  4GXA A;  3S9E A;  3F11 A;  2XXK A;  4F2Q A;  1FQA A;  5HBC A;  2OBG A;  4PAI A;  1MPC A;  1NNP A;  1NUW A;  4OVS A;  3IOV A;  5CBR A;  1FTO A;  1ZLQ A;  3VVF A;  4Z0I A;  2OCU A;  5I5P A;  2I3V A;  4PF8 A;  1OVT A;  4JXI A;  5CM6 A;  1EYJ A;  3K1M A;  3E4R A;  5CMM A;  2HEU A;  3RPL B;  3RTF B;  3H7M A;  3ZKK A;  1B1H A;  3U92 A;  3DM0 A;  4NWD A;  2XA5 A;  3IJX B;  3OO6 A;  4F3G A;  1NNK A;  1R9L A;  1FSA A;  3EPE A;  2PVU A;  5F24 A;  2O84 X;  1VFD A;  3S9M C;  3VVD A;  1TFA A;  2O1L A;  3RT8 A;  1B1X A;  1N84 A;  4RXL A;  1FRP A;  4ONY A;  2RKM A;  4YU0 A;  5AA2 D;  2DYX A;  5A5X A;  4IO2 A;  1AMF A;  4RY1 A;  4YIC A;  2Q88 A;  4YB6 A;  1B3G A;  3O66 A;  5LTC A;  3I5O A;  4XKR A;  1IXI A;  1II5 A;  4I3Y A;  2AL4 A;  3U8Q A;  2Y7R A;  4WED A;  4MMP A;  4HW8 A;  4IO4 A;  3RPW A;  4MH5 A;  2XXX A;  1B5H A;  4IO5 A;  2Y5K A;  3ECR A;  2NWJ A;  2Q2C A;  4UAB A;  1KWH A;  1LLS A;  1IXC A;  2F7B A;  4TOZ A;  5I57 B;  3B6W A;  3KOS A;  3ZSF A;  4R6Y A;  2UYE A;  5FHN A;  3CI8 A;  1Y1M A;  1B7U A; 
#chains in the Genus database with same CATH homology
 2UVI A;  3UIF A;  1N0T A;  5BUU A;  3EN3 A;  3TTK A;  1USY E;  1HSE A;  5KDT A;  3T22 A;  3MZB A;  3OEL A;  3C33 A;  3FZV A;  3OO7 A;  1B32 A;  3H6W A;  1FW0 A;  4OMB A;  4JSD A;  1B58 A;  3PPO A;  4GL0 A;  2FNC A;  2RIN A;  2Z8D A;  3TCH A;  2ONR A;  4H5G A;  2F78 A;  2G29 A;  1IUD A;  4IY6 A;  3FV1 A;  4EQ9 A;  5BWJ A;  4IO7 A;  4OZ9 A;  4OXV A;  4YKK A;  1LAH E;  3TUS A;  3LSW A;  2RC7 A;  4XKN A;  3O9P A;  4YKI A;  4QSD A;  3VVE A;  2I49 A;  2ZNT A;  3K00 A;  1MH4 A;  5DYH A;  1ZKB A;  5H8N A;  1XC1 A;  3FXQ A;  3MJN A;  5CMC A;  3S4U A;  1OLC A;  4NF8 B;  2RF1 A;  2B3F A;  4UAC A;  3ZS6 A;  5CMB A;  1FQE A;  3LBS A;  3K02 A;  1Y4C A;  2CZL A;  2R71 A;  2Z8F A;  3KN7 A;  3LC8 A;  1UTH B;  4R2B A;  2ZYK A;  4XIG Q;  3TYH A;  2H99 A;  1DTG A;  3MUQ A;  5I56 A;  2ANJ A;  3IAZ A;  3TTL A;  4ESW A;  1BP5 A;  3FV2 A;  5B70 A;  4KI0 E;  1D9Y A;  1IEJ A;  1N7W A;  3MP6 A;  2DQV A;  3EHS A;  3OD7 A;  1B7Z A;  3P7I A;  2G93 A;  1J1N A;  2OWT A;  3B6T A;  4ZS9 A;  3FJ7 A;  4G8H A;  4I62 A;  5I2N B;  1MDQ A;  3V8X B;  5JTY B;  4OFO A;  1M5F A;  2DE4 A;  3O29 A;  5KDT B;  1R1N A;  1RYO A;  3N6U A;  3W9V A;  3VLV A;  1WVJ A;  4NWC A;  3M3F A;  1M5C A;  3MP1 A;  5KZT A;  4OWD A;  4RA1 A;  3O6G A;  4JBZ A;  5JK4 A;  1LB9 A;  3FIR A;  1RYX A;  4Q0C A;  1D4N A;  3TTN A;  3W9W A;  2ESN A;  4GF8 A;  4LUB A;  4OFL A;  3DLN A;  4F1Y A;  5I58 B;  2YJP A;  3MVX A;  3I6V A;  4GWO A;  4P0G A;  4U21 A;  4YAH X;  2HZK A;  1IIW A;  3G7W A;  4DE8 A;  1MQG A;  3FAS A;  2B65 A;  3IB0 A;  4G77 A;  3U93 A;  4DXU A;  1PC3 A;  4M1V A;  4U4X A;  2FA7 A;  3DEL B;  3RGY A;  2I4C A;  3LUY A;  4K3F A;  1HSJ A;  1MY3 A;  3BFT A;  1FTK A;  5EYF A;  5L9M A;  1I6A A;  1H44 A;  1B6H A;  4FE8 A;  4BDM A;  1XS5 A;  3HCQ A;  5I57 A;  2XX7 A;  4POW A;  4PFU A;  3CVG A;  1ZJL A;  3H4Z A;  3C32 A;  3K6V A;  4LP2 B;  1NNT A;  4QRZ A;  3IO4 A;  3LSF B;  3TCF A;  3VV5 A;  3H06 B;  2OJT A;  1P1N A;  1SBP A;  2VGQ A;  4LA9 A;  1VR5 A;  2VD3 A;  3SKP A;  4YMA A;  3K2D A;  5EHS A;  3PMX A;  4XKP A;  2ZXT A;  3OEK A;  3O28 A;  2I3W A;  2W7Y A;  1PDA A;  5DVF A;  3RN8 A;  1A55 A;  4PQJ A;  4DCY A;  2Q89 A;  3JZJ A;  2IA4 A;  1UIU A;  2DWI A;  3IB1 A;  4EQB A;  3IOW A;  5L9S A;  4P0I A;  1IXG A;  1D9V A;  2F7C A;  1UQW A;  2XXR A;  4KD5 A;  2NVU B;  1B7H A;  5ITO A;  2Z23 A;  3O6I A;  3FUZ A;  4XTC Q;  2ALU A;  3TPA A;  3FXR A;  3CSB A;  5I56 B;  3U94 A;  1M5B A;  1UTH A;  1LGB C;  4LQ2 A;  1PB9 A;  2DOJ A;  3A3C A;  2XXY A;  1GVC A;  4KYE A;  3USD A;  5CC2 A;  4F18 A;  2IEE A;  3PUY E;  1URG A;  4U22 A;  3T9U A;  4F3P A;  3SEX A;  3O2A A;  3KJ7 A;  3Q28 A;  5DVJ A;  1MPD A;  1SW4 A;  2UYF A;  5AA4 A;  4ZED A;  5L9O A;  1XVX A;  3PD8 A;  1EZ9 A;  2YLN A;  4ELR A;  2RC9 A;  1BTJ A;  3Q29 A;  4FAT A;  2YPN A;  3R6U A;  3M8U A;  1LB8 A;  1O63 A;  4M4G A;  4H0W A;  3C31 A;  2F34 A;  1JET A;  5L8D A;  1SI0 A;  4I8C A;  5I59 B;  3H6V A;  1UIV A;  1IXH A;  2ZMB A;  1EU8 A;  1OLA A;  1B5I A;  1DSN A;  1SVX B;  3KZG A;  2AL5 A;  5CRY A;  1B3E A;  1A8E A;  3RLF E;  4RK2 A;  1LBC A;  1LCF A;  2A5T A;  1YCJ A;  3T9X B;  5HM4 B;  1ELJ A;  5ICQ A;  3G3F A;  3O6H A;  3A3U A;  3CFL A;  2KLF A;  3CSG A;  2X7P A;  2I6E A;  4MFI A;  3T93 B;  4QFK A;  3MZ1 A;  4OER A;  4E0W A;  3M3K A;  3FXU A;  3QSL A;  2ZNS A;  4U2R A;  2OK2 A;  2QS1 A;  4EQ7 A;  1AOV A;  4NMY A;  3HV1 A;  4OEN A;  4R2F A;  4KFQ A;  2V93 A;  2RCA A;  4ZEF A;  2GHA A;  3FVG A;  5H8H A;  2XD3 A;  1LAX A;  3HST A;  1VSO A;  2DVC A;  5AA1 A;  3MW0 A;  4G8N A;  3PUZ E;  1B3F A;  3OMB A;  1SYI A;  2F35 A;  1H76 A;  4MBP A;  1RKM A;  3KG2 A;  2DVZ A;  3SER A;  3GZG A;  1FQF A;  2UXA A;  2I48 A;  3O97 A;  4ZZE A;  2DXR A;  3VLU A;  1A7L A;  3HN0 A;  1DMB A;  2NUV A;  4GLI A;  3TQW A;  1B3L A;  1EZP A;  1LFH A;  3CG1 A;  2REJ A;  3OSR A;  1JVX A;  1N3W A;  1Y4T A;  2QL3 A;  4PET A;  1Q35 A;  4PFY A;  3FVN A;  3TFL A;  3BFU A;  4FAJ A;  4O3A A;  3PPR A;  2V3T A;  2V84 A;  4WEP A;  4F3S A;  3VXB A;  2F97 A;  3FGS A;  4JSO A;  3TMG A;  5CBS A;  4FED A;  4KHZ E;  1NMU A;  4AQ4 A;  1BIY A;  1SD3 A;  4GQO A;  5DVI A;  1P1W A;  4O3C A;  5H8S A;  3Q25 A;  3WAE A;  3KBR A;  1P99 A;  1Q1K A;  4H65 A;  2ONK E;  5F1Q A;  3K6U A;  3T9V A;  3WAF A;  2QS3 A;  2PMS A;  3W15 C;  2F6G A;  4N13 A;  1JVY A;  1EH3 A;  3EF7 A;  1VFE A;  1XHY A;  4OEU A;  1TWY A;  2VOZ A;  5FTI A;  4ZEI A;  1M5E A;  1QKB A;  2HAU A;  4NED A;  4QHQ A;  2XXT A;  3B6Q A;  1PEB A;  2DS9 A;  1JNF A;  2H25 A;  3IO6 A;  1LST A;  5TU0 A;  1QUI A;  4OTE A;  1DTZ A;  4F2O A;  1OQG A;  4GIZ A;  2P1S A;  3KN3 A;  1XVY A;  3C36 A;  2XX8 A;  3H6T A;  3PMV A;  2DE2 A;  1JW4 A;  1B5J A;  3RNN A;  4IGT A;  5KCJ A;  1OVB A;  3G3H A;  4RNS A;  4GOT A;  5B7D A;  1PBQ A;  1N04 A;  2E1S A;  3BKI B;  3V89 B;  4FOR A;  3H6U A;  2GH9 A;  4TLL B;  2D3I A;  3TEL A;  1MY4 A;  1O64 A;  1Y3P A;  4EUO A;  3VFJ A;  4POX A;  5JTY A;  4EF1 A;  4GVO A;  1ATG A;  1SDX A;  3IOR A;  2XXW A;  4O3B A;  1GGG A;  4P11 A;  4RYA A;  1YAE A;  1A99 A;  1ANF A;  4NE4 A;  4TQU Q;  3E9X A;  1AH5 A;  1SW5 A;  2OLB A;  3EHT A;  5EHM A;  2DWH A;  4RPN A;  4YZZ A;  3PPN A;  2XXV A;  3SEW A;  1MQH A;  2H98 A;  4ZE8 A;  4EDP A;  4HTG A;  3OO9 A;  1Y3N A;  4EXK A;  4YB7 A;  1N3X A;  2ZYO A;  2D5W A;  4FJP A;  2A5S A;  4IB2 A;  4JB7 A;  1A40 A;  1TFD A;  3A09 A;  4NF8 A;  5M2V A;  4BDN A;  1WDN A;  1H43 A;  3E13 X;  3FAT A;  3I3V A;  3IB2 A;  3MAM A;  4JWY A;  1MRP A;  4LQ5 A;  3G3J A;  4R74 A;  4MLV A;  3IX1 A;  4X1D A;  3QAX A;  1Y20 A;  1OIB A;  4LAT A;  3MC2 A;  5H8Q A;  3HPI A;  1Y1Z A;  2XD2 A;  3K1P A;  4GRK A;  3RT6 B;  1ZBM A;  1L5T A;  2DE3 A;  3MVZ A;  4C1T A;  1NFT A;  3PGF A;  4QFL A;  4NF6 A;  4QSC A;  1A8F A;  1URS A;  3TAJ A;  2Y7P A;  1B0H A;  3IR1 A;  4R9G A;  4Z7E A;  1T0K A;  4EF2 A;  5TPA A;  4KYS A;  1MXU A;  4DDD A;  5IAI A;  2DSF A;  2PT2 A;  1IZ1 A;  2V3U A;  1UTB A;  5ISU A;  3QXM A;  4DZ1 A;  5AA2 B;  4XXU A;  3AXF A;  1FTM A;  4H8J A;  3SEY A;  4U1Z A;  5IKB A;  3H03 A;  3S2V A;  1B3H A;  1CB6 A;  2ABH A;  2H4I A;  3OOA A;  4Q8R A;  2O7I A;  3V83 A;  2F8D A;  4ELQ A;  5H8F A;  4PFT A;  4ELO A;  3TQL A;  4ZZA A;  1ZMG A;  1N7X A;  3PU5 A;  4F1V A;  1POT A;  4DXC A;  2I58 A;  4PE5 B;  1SI1 A;  3DP6 A;  4F29 A;  2X26 A;  4R6K A;  3T66 A;  4G4P A;  1PBP A;  2Q2A A;  1FTJ A;  2GHB A;  1JEV A;  1S7Y A;  2HQ0 A;  2XX9 A;  1B4Z A;  3GLB A;  3UOR A;  3GBB A;  1D3K A;  3FVK A;  1FQD A;  4ZE9 A;  4G68 C;  2F36 A;  1JW1 A;  3HO7 A;  4KYD A;  4JWO A;  4LON B;  3BBR A;  3VXC A;  3PUX E;  4X1B A;  5TP9 A;  1NNF A;  3RUM A;  1QVS A;  3TKD A;  4DXB A;  2F6P A;  1NKX A;  4F39 A;  3IJO B;  5KCJ B;  4BDO A;  5I2K A;  4RJZ A;  2V25 A;  4IO3 A;  1B0L A;  2DXY A;  4I9D A;  2REG A;  4OET A;  1DPE A;  1MY1 A;  2AIX A;  4RPO A;  3UK4 A;  4OFJ A;  2QMX A;  4IY5 A;  1M5D A;  1MQJ A;  1MXV A;  3QUF A;  5F7V A;  1Z7M E;  3FJG A;  3K0V A;  4ZEK A;  1POY 1;  3SDF A;  3T9H B;  4GFR A;  4THI A;  2WKY A;  2VP1 A;  3MZ9 A;  4IO6 A;  1MH3 A;  1JW5 A;  1P1Q A;  2B3B A;  5HPQ A;  4ZDM A;  1MXY A;  4LZ5 A;  1Z7N E;  5FTH A;  2UVJ A;  1MXZ A;  2ONS A;  5I2K B;  3C9H A;  4KCC A;  3S9L C;  4BDL A;  4ND9 A;  4OHN A;  1QKA A;  2I0B A;  1MM6 A;  5LOM A;  3Q27 A;  4H6D A;  1FTL A;  4BDQ A;  2O69 A;  4AB5 A;  3RQT A;  1GR2 A;  2F7A A;  2XHD A;  3KSX A;  4OVJ A;  1I6B A;  2HAV A;  4JDF A;  2Q8J A;  4BDR A;  4R6H A;  2XXH A;  4F22 A;  4DLD A;  4OEV A;  2XXP A;  2P0S A;  3VVF A;  2X7Q A;  4WKM A;  2THI A;  5ELV A;  1EZO A;  3G3G A;  2CMO A;  1TT1 A;  2PX1 A;  2DP8 A;  1IQ7 A;  3OEM A;  5DEX A;  1H45 A;  2ZYM A;  5K2X A;  3SES A;  1XOC A;  5H8F B;  4F1U A;  1SQY A;  5A5X B;  1I6Q A;  1ZU0 A;  2HXW A;  2O1M A;  1BKA A;  1JQF A;  1N76 A;  2QS4 A;  2ZYN A;  3N26 A;  4G68 A;  3RTW B;  1F9B A;  3QIM A;  4DIG A;  3UN6 A;  2Y7I A;  3N6T A;  2A5T B;  4NF5 A;  3OO8 A;  1SW1 A;  1UTB B;  2DWA A;  3D4G A;  4G68 B;  4LVQ A;  1AIV A;  2FYI A;  3PUV E;  3T96 B;  1B40 A;  3KJT A;  1SYH A;  3KFM A;  4H5F A;  2P2A A;  4R73 A;  4HCY A;  1B46 A;  1URD A;  3IK6 B;  2QSX A;  3IOU A;  4N6P A;  3TDJ A;  4I1D A;  2HFB A;  3EQ1 A;  3M3L A;  4C0R A;  5J1D A;  4H8I A;  4MF3 A;  2PT1 A;  2Y84 A;  4OES A;  3MQ9 A;  1B51 A;  2DWJ A;  2PYY A;  3G3I A;  4U1O A;  3ILT B;  1MDP 1;  2Y7W A;  3CG3 A;  5JEI A;  3CFX A;  3K01 A;  1GTK A;  1VE4 A;  4QFO A;  2UVH A;  5FHN A;  4C1U A;  3LSX A;  1BLF A;  4AB6 A;  2F5X A;  1IIT A;  1MM7 A;  1US5 A;  3U72 A;  1P1U A;  3VLW A;  4GXA A;  1FQB A;  5I84 A;  3S9E A;  3FD3 A;  3F11 A;  2PBW A;  4NF4 B;  5FHM A;  4FIM A;  4F2Q A;  1FQA A;  3TZA A;  1FCK A;  2OBG A;  3KN8 A;  5HBC A;  3TTM A;  4X9T A;  1LCT A;  4MLQ A;  2NOO A;  4G2Z A;  4R9F A;  2R6G E;  2R9J A;  2O7U A;  4LZ7 A;  1MPC A;  1NNP A;  1B05 A;  1Y9U A;  3PD9 A;  3IOV A;  5CBR A;  2O51 A;  3C4M A;  3LSL A;  1FTO A;  1US4 A;  2O6A A;  5TP9 B;  1ZLQ A;  4XKQ A;  1YTV A;  1MXW A;  1P1O A;  1YPN A;  2ZNU A;  1NH8 A;  3OEN A;  4GXS B;  4PFW A;  2NXO A;  2RC8 A;  3Q26 A;  4Z0I A;  1I69 A;  5DT6 A;  1XT8 A;  1WOD A;  3QUJ A;  4R72 A;  2OCU A;  2QJE A;  1OQH A;  3IL1 B;  4OQO A;  4NTL A;  4QFN A;  2I3V A;  3D4C A;  3C35 A;  1OVT A;  4JXI A;  1USY H;  2GFE A;  3ONM A;  4KCD A;  4R75 A;  5AA3 A;  5CM6 A;  1QUK A;  5AE4 A;  3K1M A;  3K6X A;  3E4R A;  4JWX A;  3CIJ A;  5CMM A;  1MY0 A;  2HEU A;  2RCB A;  4YB5 A;  1MPB A;  5I58 A;  5CI5 A;  3IOT A;  2O68 A;  3PPQ A;  4KPT A;  3H7M A;  3K4U A;  3RTF B;  3SEU A;  1B52 A;  3PPP A;  3ZKK A;  1B1H A;  4NF4 A;  3U92 A;  3DM0 A;  4NWD A;  3KSJ A;  5TPA B;  1QUJ A;  4IGR A;  3IJX B;  3UGW A;  4F31 B;  3JV9 A;  3OO6 A;  4NF6 B;  4UA8 A;  5I2N A;  1DOT A;  3PUW E;  4F3G A;  3VDF A;  2VHA A;  1LAG E;  3KGC A;  3QK6 A;  1AL3 A;  4HS7 A;  1Y3Q A;  1LBB A;  1NNK A;  1R9L A;  3H3G A;  3TOD A;  1H3D A;  2QMW A;  1PB8 A;  5H8Q B;  1O7T A;  3EPE A;  3TTR A;  3SET A;  2Z22 A;  2M8C A;  2PVU A;  3HHG A;  2O84 X;  2XXU A;  2VD2 A;  1VFD A;  3K6W A;  3L6H A;  4N07 A;  3K1N A;  4G8M A;  3ILU B;  1B9J A;  2LAO A;  4Q30 B;  4EXL A;  1FQC A;  3TEP A;  5H8N B;  1MG1 A;  3S9M C;  3VVD A;  5CMK A;  1MQI A;  1MY2 A;  1TFA A;  3G3K A;  2O1L A;  1B1X A;  1N84 A;  3DP8 A;  3KOT A;  3RT8 A;  4KQP A;  2AYS A;  1R9Q A;  4L17 A;  4ECF A;  3B7D A;  1SW2 A;  4ISU A;  4RXL A;  2HZL A;  4PP0 A;  1LFI A;  2Z8E A;  4NF5 B;  2QPQ A;  2BJJ X;  2Y7K A;  3MP8 A;  1DPP A;  4H67 A;  4QF9 A;  2UVG A;  4ONY A;  2RKM A;  3C34 A;  1MQD A;  3R7X A;  1GV8 A;  4U4S A;  4YU0 A;  5AA2 D;  5I59 A;  2DYX A;  4GD5 A;  5A5X A;  4FEB A;  3QYT A;  3FJM A;  1AMF A;  4IO2 A;  3U1O A;  1OMP A;  5DEX B;  1MS7 A;  3HHF A;  4RK9 A;  4RY1 A;  4YIC A;  2Q88 A;  4YB6 A;  2H5Y A;  1R6Z A;  1QUL A;  3LR1 A;  1B3G A;  3O66 A;  5AA4 B;  1S50 A;  3I5O A;  4XKR A;  1IXI A;  1II5 A;  2V3Q A;  4F3B A;  3GBA A;  4KR5 A;  4U23 A;  1S9T A;  1CE2 A;  3E3K A;  3MBP A;  1JEU A;  3SEV A;  4HCW A;  3TCG A;  4ZEC A;  3CFZ A;  2AL4 A;  2OZZ A;  2QS2 A;  4LZ8 A;  3RY3 A;  3THI A;  2Y7R A;  2HCA A;  4WED A;  2OWS A;  3N5L A;  3U8Q A;  3ZKL A;  4HW8 A;  4IO4 A;  4DCX A;  3ODB A;  3RPW A;  2I0C A;  4ZEB A;  1B4H A;  3DP4 A;  2D21 A;  4MH5 A;  1QW0 A;  4GL8 A;  1LFG A;  4FEC A;  1TXF A;  3S9N C;  4ELP A;  2XXX A;  1B5H A;  3KEI A;  4YKJ A;  4IO5 A;  2GRV A;  3UA8 A;  1NL5 A;  4X48 A;  4TLM B;  3UP9 A;  4F19 A;  3ECR A;  2NWJ A;  5ICT A;  3MPK A;  1PB7 A;  3N94 A;  3V5A A;  2Q2C A;  2E0S A;  1ZIU A;  3MVY A;  3VE1 B;  1ZTY A;  4ESX A;  4YMB A;  1KWH A;  1LLS A;  3MVW A;  1IXC A;  1B2H A;  3OSQ A;  5DTB A;  2F7B A;  3CR9 A;  4TOZ A;  5I57 B;  5H8H B;  2XXI A;  4WXJ A;  2QRY A;  2H9B A;  3B6W A;  1NH7 A;  3JYR A;  3KOS A;  3PV0 E;  4QSE A;  3GXA A;  4Q5T A;  5K2Y A;  2XXQ A;  3ZSF A;  5ITP A;  3OXN A;  4R6Y A;  2UYE A;  2I4B A;  3EHU A;  3FVO A;  3MPL A;  4YKP A;  3L6G A;  1MXX A;  1QJM A;  3CI8 A;  3R26 A;  3CRB A;  3PMW A;  1Y1M A;  1A54 A;  1B7U A;  1LAF E;  4H1X A;  4BLA A;  4E0X A;  3MWB A;  1HSL A;  4OYV A;  2Q9T A;  4QFP A;  5FHO A;  5AA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...