1A5VA

Asv integrase core domain with hiv-1 integrase inhibitor y3 and mn cation
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Structure of the catalytic domain of avian sarcoma virus integrase with a bound HIV-1 integrase-targeted inhibitor.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
molecule tags Hydrolase
total genus 51
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1a5vA00
1SKWA 4DTJA 2FBXA 4DFMA 1U47A 2HHTA 1WSEA 3RMAA 1IH7A 3ZSWA 3O3GA 5J2PA 3NF7A 3M8PA 1RT2A 3K5OA 4CJKA 2G8KA 1NK4A 1LAVA 1HYZA 1QSSA 3OVNA 1KVCA 4KTZA 1TL3A 3OYJA 3QEPA 4B9SA 3ALYA 3LWLA 1YTAA 2OPPA 1X9WA 1TK0A 1D8YA 4CJ4A 4E7IA 4BDZA 4N47A 2OPQA 1HNVA 4OKEA 2HHXA 4O44A 3PY8A 2YNFA 1RBSA 1IG9A 4OGCA 2GUIA 3AO2A 4CGIA 3LDSA 3LP0A 4OVLA 4JLHA 4B9MA 3KD1E 3P83D 2LSNA 1HYSA 3V9XA 2VWKA 4CHPA 4CF2A 4DSEA 3AO4A 1KSPA 3VQ9A 4AHTA 4CJQA 5FRNA 3NF8A 1DTQA 5JS2A 4JS4A 3VQBA 2E6LA 4FK0A 3OYNA 3E01A 4CECA 3VQ4A 4ICLA 2D0BA 1J53A 1VSJA 2O4GA 3C94A 3P1GA 3O4NA 3T1AA 4CJTA 1KRPA 1CXQA 3SPYA 3V1OA 1J9AA 1YVUA 4CIFA 4F3TA 3O4QA 3VQDA 1IKYA 1REVA 4CEOA 3RMDA 3SPZA 3F73A 2A1SA 1K6YA 4FJ7A 4J2AA 4FJMA 2HVHA 1S9EA 4FLVA 1CXUA 1VSDA 2GV9A 3OY9A 4AHSA 3OYMA 3OS1A 4ID1A 3OYAA 3KLHA 4DTSA 4B9UA 4C8OA 5DK5A 5HRSA 1ASVA 1VK0A 3T19A 1B92A 3LPUA 1BIUA 3JYTA 3SUQA 1QSYA 3DLHA 1SL0A 4DTNA 2RPIA 2B5JA 2FBVA 3WNFA 3OYLA 3CM5A 3U3GA 3NF9A 4PY5A 4IFYA 4NYNA 1U48A 4CF1A 1F21A 1QHTA 3QEWA 4RG8A 3TAPA 4J2EA 4CJRA 2YHBA 4O0JA 1JLBA 1RT1A 5SZTA 4DF8A 2OYQA 2XY7A 3L3UA 4OPJA 3ZSOA 2XO7A 3L3VA 5HLFA 5FRMA 2OPRA 3SQ0A 1C1BA 1KVBA 4Z4GA 4FJ9A 4ELUA 1ASUA 4KRFA 4GW6A 3K5NA 1S1UA 1IKWA 1HRHA 4RW7A 4CFDA 3RRHA 1SKSA 4AHCA 1D9FA 1GOBA 2G8HA 4CFBA 3DRSA 3TABA 4IG0A 4MFBA 4HUFA 4FXDA 2PYLA 2KZMA 1S1VA 4I2PA 1FKOA 3TAMA 2QK9A 1L3UA 3TR8A 3DOLA 3CFRA 3HVTA 5KTQA 3RRGA 1CLQA 4LD0A 3QEIA 2HNDA 3AVCA 3DLRA 4Z4CA 2YKNA 4FW1A 3AO5A 1W0HA 4FLWA 2NUBA 4FLXA 2PY5A 4KHNA 5HRNA 4KB1A 4AHRA 4LSNA 1IKXA 3ZSQA 4BWMA 3QETA 1XI1A 4FJLA 1GOCA 1B9FA 2X78A 5E41A 2Z1IA 3M8SA 1BCMA 3QERA 5I3UA 3ZSRA 4FLYA 2AJQA 3QINA 3WNEA 1X9SA 2XY5A 4IFVA 3I8DA 1D9DA 3DMJA 3C6UA 3AVLA 4EP4A 3KLEA 2G8FA 4DU4A 4F3OA 4FJJA 1S6QA 4DLGA 4JRPA 3IAYA 4C8KA 3HK2A 4FJXA 3AVGA 1IO2A 2KTQA 1WSFA 3TI0A 1QE1A 2BGGA 3DRPA 4KV8A 4YNQA 2P1JA 1RTJA 5KGXA 4M42A 1UA0A 1NK5A 1RT5A 4DTUA 2JGUA 5CZ2A 5D3GA 3ZSYA 3CG7A 1TK5A 1JLEA 1A5VA 3LALA 2WOMA 3NGYA 3QLHA 2P51A 2HHWA 4KTQA 4DU3A 1RT4A 2HVIA 2HW3A 3PX4A 3UIQA 3HO1A 2IGIA 3HL8A 3SYZA 4DMNA 3SJJA 1RBRA 1RDAA 4CEEA 3NHGA 4E7HA 3O3HA 1WSGA 2RN2A 3DI6A 3LPTA 3VN5A 4CJLA 4CE9A 4BE2A 4BE0A 3TAGA 1J5OA 3HXMA 2YNGA 4PWDA 1D5AA 2G8IA 3I0RA 3AVAA 1RNHA 4DG1A 3QIPA 1RBTA 1LV5A 4KKOA 3S3NA 2FC0A 3A2FA 4CIGA 3PX6A 4HHTA 1MU2A 4GVMA 2IS3A 4E0DA 5J2MA 4M3UA 2HHVA 4IG3A 1ITGA 1RBUA 4W5OA 4KHWA 1TKDA 1VSIA 1HQEA 1S6PA 4FZYA 1RTHA 1FK9A 3CFPA 4CF0A 1FXXA 4IKFA 3TAQA 2Y1JA 3M8QA 3OYCA 1UWBA 2BDPA 3DYAA 2JLEA 1G15A 1A5XA 4K8ZA 3B6OA 1N6QA 3OYHA 1JLQA 1LW0A 1SL1A 4CEAA 2ZQBA 3KLFA 1NJXA 4Z4FA 4O5BA 2WONA 4B9LA 2IOCA 3OYBA 4ZTFA 1HQUA 4CEFA 4I7FA 2GBZA 3OYEA 2RF2A 1T7PA 2X6NA 1BQNA 4O55A 4E1NA 4OPKA 3ULDA 2F8TA 3QNNA 3S3MA 1Q8IA 4DF4A 4FZZA 1QSLA 3SV4A 3ZT4A 4QOZB 1VRUA 4E7KA 4O0IA 3SNNA 1ZBUA 4BE1A 2P5OA 3EY1A 1RILA 4AILC 1RDBA 3G10A 3VA0A 3OYGA 2PYJA 2HHUA 4CEQA 3LZJA 1BIZA 3HPOA 1WSIA 4G1QA 1JL2A 4HUEA 1L3SA 2IDOA 4RW6A 3DLGA 4FZXC 4OJRA 3VQQA 3WNGA 4CJFA 5T7BA 1T8EA 2KFNA 2OZMA 5EU7A 4CK3A 4C8NA 2B6AA 1VRTA 4LH5A 4FJGA 4KHSA 3VQ7A 4OLBA 1N5YA 1XWLA 3HSTB 1TKXA 5C24A 1IKVA 4IBNA 3RR7A 4DTMA 1U49A 3SCXA 1JKHA 1NJWA 1VSFA 2X74A 3BGRA 4DFPA 3LAKA 4M3YA 4CF9A 1NOZA 1KTQA 1C0MA 3ZSXA 2HHSA 3OS0A 4CGFA 4FLUA 1VSHA 2YKMA 4M41A 4CFCA 3D45A 4KI6A 4M45A 3I0SA 1TGOA 4NCBA 3AVJA 3CFOA 4I2QA 4W5TA 4DSKA 1SL2A 3VQ6A 3S9HA 1TV6A 4N56A 3HT3A 2KZZA 3JSMA 1WAFA 5KRTA 4FVMA 3C95A 3DLBA 4N76A 1ZBHA 4BWJA 3ZT1A 4NCAA 4DFKA 3ZT0A 3ZSVA 2Y1IA 1UA1A 3CM6A 3LZIA 3KK1A 3S3OA 3K58A 4FM1A 3PO5A 3HP6A 1RDDA 4W5RA 3MECA 3VQPA 3NDKA 1JXBA 3O3FA 3MEGA 3HM9A 4CESA 3HPHA 3HPGA 4CJWA 2A1RA 1T03A 4EZ6A 4M3RA 4DS5A 4K8XA 4L8RB 4FJNA 4FYDA 2B4JA 4DLEA 3FFIA 2O4IA 1X9MA 4FM2A 1X1PA 1UAXA 3ASMA 4CJUA 4E3SA 2HNZA 4KPYA 3NGIA 3EZ5A 2P5GA 4JS5A 1NK7A 2DFHA 3KK3A 3RMCA 3BDPA 4B3OA 3L2UA 1NOYA 1I3AA 3SUOA 1EXQA 3AVFA 5FROA 2YNIA 1BGXT 3ZCMA 1XHXA 4E7JA 3V4IA 4FM0A 4FJHA 1JLAA 2F8SA 3L2VA 1VSEA 4ZTJA 3ZT2A 4HVJA 1TKTA 2OZSA 3ISNC 3K2PA 3LP2A 5J2NA 3TWHA 3PX0A 4BACA 4CHNA 1JLFA 3DLEA 3AA5X 3QESA 2BE2A 5KRSA 3SZ2A 3THVA 2D5RA 3VQ8A 4B9VA 2XY8A 1RT3A 3H08A 4Z4EA 1NK8A 4O4GA 3SQ4A 1XC9A 1BI4B 1HPZA 1C1AA 4CGHA 1ASWA 4CCHA 2Z1GA 3OYIA 2DTUA 1GOAA 1DLOA 2OPSA 4CEDA 1RBVA 3ITHA 5JS1A 2YNHA 1KLNA 3M8RA 3MXMA 4CGJA 3OYDA 4FLTA 3L2QA 1L5UA 4FK2A 1A5WA 3L2WA 4ID5A 3LANA 3EYZA 3C6TA 4KHQA 4AH9A 1S1WA 1TAQA 5C25A 2E4LA 4OKKA 4Z4IA 3VQ5A 3HP9A 3SUNA 3OS2A 3RWUA 3CQ8A 3PO4A 1NKBA 4FCYA 2DFFA 3AO1A 4DTXA 2IC3A 1Y97A 4PQUA 1KCFA 3KLGA 1Q9XA 3OYKA 4J2BA 3IG1A 1O1WA 3AVMA 2Q3SA 3QNOA 3QEXA 5HRRA 4CJ3A 3AVIA 5I42A 2VG5A 3TAFA 1RT7A 3LWMA 4DQIA 4HTUA 5KI6A 4DTOA 3QIOA 4ELTA 3K59A 2HHQA 1YTUA 2E6MA 4Y1DA 1ZBLA 5J2QA 4RW8A 4KTWA 1XHZA 4FJIA 3LP1A 4Y1CA 1B9DA 2KW4A 3NFAA 3OJSA 3B6PA 4I9LA 4QCLA 4LSLA 1U04A 3KIOA 4FLZA 1J54A 1SUQA 1ZYQA 4RW9A 4DWIA 4WE1A 2VG7A 4HCBA 4FJKA 1WNSA 1FKPA 2G8WA 4KHUA 2PZSA 4DQPA 4M3WA 1TL1A 1UOCA 4KB0A 4CK2A 4YFUA 4AHUA 3AVHA 3ZT3A 1S5JA 4E19A 2ZE2A 3QEVA 5C42A 2ETJA 3DLKA 4CJSA 3K5MA 1BHLA 5KGWA 2VG6A 4PUOA 5CZ1A 2YV0X 4OLAA 4FJ5A 4CJ5A 1S1TA 3CYMA 1BI4A 1NJZA 3SUPA 3V81A 3AA3A 1L3VA 1ZBIA 3ZSZA 5HBMA 4CHYA 5J1EA 3V9WA 3T3FA 1I39A 1JL1A 3AVBA 4LY7A 4QAGA 2EHGA 3NCIA 1BCOA 1SKRA 1KFSA 3SQ2A 4M3ZA 3QO9A 5CY4A 1QS4A 1RTIA 2F96A 1ZBFA 4CHOA 4I9QA 1KFDA 3SI6A 5CYMA 2VWJA 3VA3A 1WAJA 1VSMA 3MXIA 1NJYA 3NGZA 2G8VA 4E1MA 4F4KA 1DTTA 1BQMA 3KKRA 3WNHA 4XIUA 1JLGA 5HRPA 4KFBA 3TANA 1S9GA 2W42A 1BISA 2ITGA 4B9TA 1RCHA 4CK1A 3KK2A 5FDLA 1JXEA 2HB5A 3F9KA 4KREA 4F8RA 1RT6A 1WN7A 2OA8A 1KLMA 3PUFA 3TARA 4W5NA 1LWCA 3V9SA 3OJUA 1WLJA 4CJEA 5DMRA 3KKSA 3OYFA 4KHYA 1C0TA 4Q0BA 1NKEA 4KI4A 1KVAA 1TK8A 1HNIA 4DTRA 4NCGA 4CEZA 4NYFA 2Z1JA 3AA4A 3VQAA 4DS4A 1TKZA 2HNYA 4CF8A 2DFEA 3DOKA 1VSLA 1LAWA 4Q5VA 1RTDA 5HROA 3L2RA 3RTVA 1Q9YA 4DSJA 3LP3A 3L8BA 3TAEA 2QKKA 4KAZA 4E89A 4H4OA 5K14A 2FBYA 1LWEA 3KLIA 1HYVA 3DRRA 2X6SA 4CJVA 1Z25A 4OKJA 3VQCA 2KFZA 3LAMA 3PV8A 3NF6A 4DSFA 4F2SA 3K57A 3NH0A 3MEDA 3SQ1A 2KQ2A 3P5JA 1RDCA 3MXJA 4ZHRA 3NBPA 1TVRA 3V9UA 1NK0A 1HJRA 3NE6A 1Z26A 1LW2A 4CJPA 1NK9A 1W9HA 2BANA 4CGDA 2I5JA 1EETA 4HUGA 4E7LA 2G8UA 3RR8A 4AHVA 1U45A 1JLCA 3V1RA 4CEBA 4EP5A 1HMVA 3NAEA 1CZBA 2FBTA 4FW2A 4IDKA 4DQRA 1C6VA 3HYFA 5SWMA 4DU1A 3AVKA 3RMBA 3IS9A 3MAQA 4OGEA 2DY4A 1SV5A 2RKIA 4BDYA 3V1QA 4FJ8A 4M3TA 2QXFA 4KO0A 3VQEA 4TSXA 1WSHA 3MEEA 4CHQA 1U4BA 2IAJA 4HCCA 4B8CA 3KTQA 4DSLA 3DM2A 2QKBA 1TAUA 1C1CA 4DQSA 1NK6A 4UQGA 4J2DA 3K5LA 3AA2A 3KJVA 4DQQA 2D0CA 4DSIA 2XHBA 4FK4A 4LH4A 3HVRA 3V6DA 1L3TA 2XRIA 4CGGA 2HMIA 4R5PA 2Z1HA 3AV9A 3AVNA 4C8MA 4B9NA 4ELVA 2D0AA 3NH2A 3AO3A 4B8AB 4F2RA 4Z0UA 1EX4A 4H8KA 3NH1A 1C0UA 4CERA 3KD5E 3D0PA 4RW4A 2YHAA 4CIEA 4W5QA 4PA1A 4CFAA 4Z4HA 3G0ZA 2EX3A 5CYQA 1VSKA 4BDPA 2ATQA 4EZ9A 2ZD1A 5HP1A 1EKEA 1QTMA 4M3XA 4DTPA 4GMJB 3IRXA 1QQCA 3U6FA 4DFJA 4C8LA 4MQ3A 1EP4A 2XY6A 3HJFA 1R0AA 1WSJA 4H4MA 1NKCA 1CZ9A 4JRQA 1BL3A 1LWFA 4B08A 1T05A 4N5SA 4N41A 1S1XA 3V9ZA 4CHZA 1YT3A 3SV3A 3U3YA 2R7YA
chains in the Genus database with same CATH superfamily
1SKWA 2HHTA 1ZC6A 1Q81O 1W97L 3O3GA 4H0TB 1RT2A 4CJKA 2G8KA 1HYZA 3OVNA 4KTZA 3QEPA 3ID8A 3ALYA 4E7IA 4N47A 2OPQA 4AF1A 3PY8A 1RBSA 5AQIA 4OPHA 2JWLA 4Y0WA 4JLHA 2LSNA 1T6DA 4XH1A 3VTHA 4CHPA 4GV6A 1GLBG 3VQ9A 3NF8A 1DTQA 3VQBA 5AQJA 2O4GA 3O4NA 4CJ7A 4A5AA 3V1OA 3KVGA 3SJHA 4F3TA 1Z05A 2PBDA 3LDNA 1REVA 3U4LA 1K8KB 3SPZA 2OANA 2HBMA 4J2AA 4FLVA 1CXUA 5LY3A 1BOTO 4AHSA 2E1YA 3OYAA 3TTFA 1VK0A 2QWQA 3SUQA 3CJ7A 1QSYA 2RPIA 2FBVA 3F5TA 3U3GA 3QEWA 3FZHA 3TAPA 5BRFA 5EXWA 4CJRA 1TYQB 4V19S 1HNWK 3G4SN 2OYQA 1HX1A 4JKHA 3SK3A 3ZSOA 2XO7A 5FRMA 3SQ0A 4Z4GA 4CBWA 4O8UA 4FJ9A 3MCAB 1SKSA 2A5XA 2G8HA 2PYLA 1S1VA 1Q82O 1TUYA 5BRDA 2H3GX 3CCVN 3RRGA 3OBYA 4CZKA 3AVCA 3DLRA 3AO5A 1W0HA 2NUBA 3E9LA 5JLHA 4BWMA 5C10A 1XI1A 3ZYYX 2UUBK 3M8SA 1BCMA 5I3UA 4FLYA 3G25A 3QINA 3I8DA 3DMJA 2F9WA 4EP4A 3KLEA 4F3OA 4FJJA 2P9IA 5KQ8A 4WQ4C 3VOVA 1VAZA 4DLGA 1DT9A 3D2FB 3WXKA 3DRPA 5AQWA 5KGXA 2YHXA 5C12A 1NK5A 3ZSYA 1JLEA 3B8AX 3CJCA 1RT4A 2HVIA 3PX4A 3UIQA 2P9SA 3ENBA 3SYZA 2OTLN 1RBRA 3T69A 2NNWA 4WCEL 1WSGA 4CBXA 1FW6A 1NGCA 3AVAA 2UXDK 1RBTA 4LFAK 5EX5A 4CIGA 1MU2A 2IS3A 5J2MA 4IG3A 1RBUA 4W5OA 2RE2A 2QWOA 3D2EA 4FZYA 1RTHA 2JWKA 4IKFA 3LDOA 2Y1JA 1NG9A 3DYAA 1G15A 3ZETA 3ZX2A 4EAHD 1SL1A 4CEAA 4C23A 3P39A 2F4VK 3H1QA 5AJ3K 2O8FB 2IOCA 3I56N 3WEEA 4CEFA 2GBZA 3OYEA 1T7PA 2HSTA 2F8TA 3AAPA 4DF4A 2GWKA 4O0IA 1VQ7N 2P5OA 3ATUA 1NGIA 4LFBK 2E8AA 4AILC 3G10A 3VA0A 1M90O 2PYJA 3LZJA 4FWNA 1WSIA 4HUEA 1JL2A 2IDOA 4NLBA 2QEXN 1GLFO 3I33A 4CJFA 2B6AA 4LH5A 2ZGYA 3HSTB 1BA0A 1TKXA 1IKVA 1XNQK 3BGRA 5AZJB 3SMSA 4M3YA 3VGMA 1YHQN 1NOZA 3O9QA 3TSPA 2YKMA 4KI6A 2NLXA 3MX2A 2E2PA 5ADXH 4H0OA 1HNXK 3CFOA 4W5TA 3VQ6A 3HT3A 3JSMA 4CI6A 4QS9A 4N76A 4DR5K 4IJAA 4DFKA 3ZSVA 2QWRA 1MA9B 3LZIA 3S3OA 4DCHA 3K58A 3CCEN 4W5RA 3MECA 1CZAN 3VQPA 3MEGA 4EZ6A 1NLVA 3HPHA 4L8RB 2QWLA 4DS5A 3FFIA 1XNRK 1X9MA 4FM2A 1X1PA 3ASMA 1Y64A 3S41A 3SUOA 1EXQA 5FROA 4LF5K 4H5RA 2F8SA 2DPNA 4ZTJA 1TKTA 4KH4A 2OZSA 3CMEN 3TWHA 3PX0A 5BR9A 1JCGA 3SZ2A 3H08A 1WBDA 4Z4EA 4O4GA 4BVOA 1KAZA 5BR8K 1IBKK 4CCHA 1OH6A 2Z1GA 3QBXA 3EEQA 1BA1A 3CQXA 1KLNA 3CC4N 4FK2A 3O80A 3L2QA 1L5UA 3VTIA 1HKGA 3HBTA 4KHQA 4OKKA 3RWUA 3IUCA 4KH5A 3VGKA 4PQUA 1Q9XA 1NJIO 1P8ZA 5JVGL 3QFPA 2D4WA 3AVIA 2ASMA 2D1KA 3CPWM 3TAFA 5GAGP 3R1XA 2W41A 2Q31A 4KTWA 2CH6A 1XHZA 2KW4A 3NFAA 2NZTA 4I9LA 1KQSM 1J54A 1ZYQA 4HCBA 2VG7A 1R59O 3UKRB 4KHUA 4LF8K 2PZSA 2Q1NA 5AQHA 1TL1A 1LCUA 4CK2A 4AHUA 4LF6K 1QQOA 1E4FT 1V4SA 3VGLA 3K5MA 1S1TA 4DR1K 3BY5A 3ZX3A 3V81A 2O8EB 1ZBIA 4CHYA 4QAGA 1ATNA 3AVBA 4FWMA 4I9QA 1ZBFA 3SI6A 4DR6K 1VSMA 2UU9K 1DTTA 4XIUA 4XH5A 1S9GA 2W42A 2ITGA 3AGKA 3CI5A 4B9TA 1NGAA 1QQMA 2YJFA 3KK2A 1JXEA 4F8RA 1KLMA 2VCPA 3PUFA 4W5NA 1LWCA 1WLJA 3KKSA 3VESA 2E2NA 1C0TA 3U9ZA 1HNIA 4NCGA 5AQPA 4DS4A 4CF8A 4Q5VA 3DOKA 1LAWA 3L2RA 1QZ5A 3RTVA 3HRGA 3THXB 3FZKA 4BQLA 4X66K 5HL7L 3A0IX 3L6QA 1X3MA 1NGBA 3VEWA 1GLAG 3MEDA 3SQ1A 2O8DA 4FOIA 4XEIA 3FLCO 3GOIA 4PL7A 3MXJA 4B3RK 1YJWN 3BZCA 4GKJK 1C0FA 1EETA 2I5JA 5AQGA 1YAGA 4EP5A 3NAEA 3OW2M 2FBTA 4KHPK 3QFUA 3MAQA 2QXFA 4TSXA 3MEEA 2IAJA 4B8CA 3KTQA 4DSLA 3DM2A 1QHAA 1K8KA 4DQSA 4J2DA 3K5LA 4DSIA 4DQQA 3OBWA 4FK4A 4LH4A 3VMFB 3HVRA 4YOVA 2HHHK 4R5PA 4NB4A 5EY4A 3AV9A 3AVNA 4B9NA 1BO5O 2E20A 4F2RA 3NH1A 1C0UA 4I6MA 3KD5E 4CIEA 4PA1A 2EX3A 5GINA 2A40A 4C1NK 4FSVA 3EZWA 4JNEA 4MQ3A 1CZ9A 4JRQA 5LMUK 1T05A 1S1XA 4JKBA 4DTJA 1QVGM 4FO0A 5M1OA 3ZSWA 1NBWA 5LMNK 2UXCK 1NK4A 4B9SA 1TL3A 3LWLA 2OPPA 3IMXA 4BDZA 1HNVA 2HHXA 2YNFA 3CJAA 4CGIA 3LDSA 3LP0A 4OVLA 3KD1E 3SAGA 4DR4K 3IDHA 1KSPA 5AQYA 2E6LA 3VERA 4GY2B 2GTDA 2D0BA 1J53A 3C94A 3P1GA 4CJTA 3T1AA 3J81O 1CXQA 3SPYA 1J9AA 1VQ4N 3O4QA 3FZFA 2A1SA 2KKZA 4DV1K 4FJMA 2E2OA 3THYA 3CQYA 3QB0A 4PHTX 5AQVA 1WBBA 5DK5A 5HRSA 3T19A 1B92A 1MWMA 1BIUA 3LPUA 1K9MO 2GUPA 4GNIA 3CCRN 3WNFA 4PY5A 3LDLA 2YCHA 5AR0A 4CZEA 4O0JA 4JEPA 5SZTA 2XY7A 1HJOA 3L3UA 4B9QA 1X3NA 2OPRA 1C1BA 4ELUA 3RRHA 3SBGA 1GOBA 3DRSA 2NRZA 4I2PA 5C2DA 1L3UA 3TR8A 3DOLA 2I7PA 5KTQA 1CLQA 1KAYA 2NRHA 2HNDA 4Z4CA 5JMVA 3WXJA 4FLWA 5FPMA 2PY5A 4KB1A 4BRQA 3QETA 1HR0K 2X78A 1NM1A 4IXCA 2WFBA 4JI0K 3ZSRA 3K0SA 3WNEA 4BREA 1X9SA 3EO3A 3AVLA 4FPAA 1S6QA 3DXMB 1G99A 1KD1O 4JRPA 4FJXA 1IO2A 1WSFA 3MMVA 3TI0A 2BGGA 2P9LA 4M42A 1RT5A 5D3GA 3E9OA 4H5TA 3CG7A 1J5EK 1WB9A 3LALA 2HHWA 3NGYA 3VEXA 4KTQA 1VQ8N 2HW3A 1JCFA 1YJ9N 5AZJA 3HO1A 3HL8A 4JI3K 5TKYA 4DMNA 3SJJA 1W2BM 4CEEA 3OTOK 2RN2A 3DI6A 4MDBA 3LL3A 4PWDA 4H5WA 3QIPA 4YORA 1YVNA 5H1SQ 3R6MA 3HZ6A 4HHTA 4GVMA 4M3UA 4MLHA 1HQEA 4A61A 4JKGA 4WFBL 3M8QA 2BDPA 1UWBA 5GAEP 4MDAA 2JLEA 3Q7CA 1A5XA 4FWOA 3B6OA 1N6QA 2WC9A 4BC4A 3KLFA 1NJXA 4Z4FA 3M5RA 4DV5K 4NO7A 3CCQN 3EN9A 2RF2A 1I94K 3ULDA 3N4QA 3QNNA 3DXKB 1QSLA 3SV4A 3ZT4A 4E7KA 3SNNA 3BF1A 3MX5A 2WUSA 4CEQA 2ZJPL 4JHDB 1YXQA 3DLGA 4RW6A 4A2BA 3AAQA 4OJRA 3VQQA 3WNGA 2KFNA 1T8EA 1GLDG 4CK3A 1VRTA 4QS8A 4KHSA 4OLBA 1N5YA 1XWLA 3O4WA 1VQKN 2NRTA 1K73O 3RR7A 4CZLA 1U49A 1VSFA 2X74A 4WQ5C 2ZJRL 1RGIA 2HF4A 3T7ZA 1KTQA 1C0MA 3ZSXA 4H5VA 4FPBA 4M41A 1C0GA 2Q0UA 4M45A 3AVJA 4N56A 1WAFA 3Q7BA 4NXNK 4FVMA 1OKJA 2BH1A 2O8CB 3ZT0A 1UA1A 5A2QO 3PO5A 1NMNA 2CH5A 3CETA 3HP6A 3NDKA 3O3FA 3WXMB 1YUWA 4BRNA 3UKRA 4M7XA 4FWSA 3CJ1A 4E3SA 3NGIA 1NK7A 2E5LK 1BGXT 5AFUA 2QW9A 1VSEA 3CXCM 3C7NB 3ZT2A 3AGRA 4HVJA 1VQON 3K2PA 1OH7A 5CHIA 3THWB 1N34K 5AQTA 3M6GA 4K0KK 3AA5X 2BE2A 3THVA 2D5RA 1Z6RA 5LL6Z 3VQ8A 2XY8A 1RT3A 3I8BA 3WQTA 1GOAA 3H6EA 3DWLA 3QMLA 1IG8A 4CEDA 4H0VB 5JS1A 2YNHA 3M8RA 3MXMA 3ULEA 4CGJA 3OYDA 3L2WA 3LANA 4AH9A 1S1WA 1TAQA 2P9UB 4Z4IA 2KHOA 3VQ5A 4YDUC 3CQ8A 3UB5A 2DFFA 1GLJO 3EE8A 1KCFA 1WOQA 2F7TA 3H1VX 4BGBA 4CJ3A 3ZLJA 4B1WB 5I42A 2AP1A 2VG5A 4PKIA 3K9KA 4NLCA 4HTUA 5KI6A 4B1UB 4ELTA 4Y1DA 1M1KO 4FJIA 3LP1A 4Y1CA 1B9DA 4JI4K 5AZIB 5LJVA 3B6PA 3OJSA 2UUCK 5AQMA 4LSLA 4FLZA 4WE1A 4BC3A 4JKEA 2V52B 5AQZA 2G8WA 1J6ZA 4DQPA 4KB0A 3WUHA 3RSEB 1D4XA 3AVHA 4DV6K 3ZT3A 2VWBA 3QEVA 1BHLA 2VG6A 4ILJA 4CD3A 3FZLA 3TPQA 3CYMA 1BI4A 4BY9C 5KPZA 1L3VA 4IFEA 2GWJA 3ZSZA 4K41A 1I39A 2EHGA 1BCOA 4JN4A 4EHUA 2F96A 1RTIA 2VWJA 1WAJA 2G8VA 4NXMK 3NGZA 3FR0A 3HOTA 1RCHA 4CK1A 5FDLA 2HB5A 4KREA 3CCMN 4WYBA 2Q97A 5F1XA 3OJUA 3V9SA 3OYFA 5DMRA 5IT9O 4Q0BA 1NKEA 4WF9L 1TK8A 4DTRA 4NYFA 1EQYA 1TKZA 4BRPA 1RTDA 1VSLA 5HROA 1LWEA 3BF3A 3C0BA 3DRRA 3VQCA 2KFZA 3NF6A 2VYPA 5BPLA 4M7YA 1NWKA 2KQ2A 3V9UA 4JV5K 1LW2A 2A42A 3O6WA 2G8UA 4HUGA 4CVNE 4AHVA 4B1ZA 2O8BA 1CZBA 3MN7A 4IDKA 4DQRA 3HYFA 4GVEA 1NGHA 3RMBA 3O08A 4M3TA 3U9DA 4HCCA 4K42A 4BRMA 4DHYA 3BEXA 3WT0A 4CGGA 3CJ9A 4ELVA 2FXUA 4A57A 2QWNA 3NH2A 2VGNA 4Z0UA 1EX4A 4PL8A 3J7AP 4JI5K 2YHAA 1SQKA 4JK8A 5F2RA 4W5QA 4EZ9A 4BDPA 1VSKA 2ATQA 5HP1A 1EKEA 4DTPA 5DM6L 1QQCA 4DFJA 1EP4A 3HJFA 5M1FA 1NKCA 1BL3A 4B08A 4UY8O 4IEIA 1WUAA 1SZ2A 4N5SA 3V9ZA 2F9TA 3C65A 4M63C 4JD2B 2R7YA 1ZBSA 3U3YA 4DFMA 1U47A 4BRKA 4JI8K 1IH7A 5HOOA 4CZJA 4FL9A 1QSSA 3CC2N 3DLLL 1KVCA 1XUPO 3OYJA 1D8YA 4CJ4A 3OHRA 4IOCL 4OKEA 1IG9A 2GUIA 3AO2A 4FVUA 4LC9B 2P9PB 4H03B 3P83D 4F9OA 1Q7YO 3V9XA 2VWKA 3GDQA 3FGUA 4CJQA 2NRVA 3OYNA 3E01A 3VQ4A 4ICLA 5I9EB 4RCHA 1KRPA 3CCLN 3VQDA 1IKYA 4CEOA 3VEOA 3MDQA 1K6YA 4FJ7A 1S9EA 4FWRA 2P9IB 4K25A 3OYMA 4ID1A 4BR4A 1P90A 2CGLA 4DTSA 4DR2K 4B9UA 4DKWA 4OPAA 1U2VA 3WXLA 2QWPA 1DGKN 4FWLA 3H3NO 3OYLA 3CM5A 4NYNA 5E84A 5DM7L 1QVFM 1QHTA 4RG8A 2YHBA 1JLBA 2P9SB 3M3ZA 4BRHA 4OPJA 3H46O 4IDHA 5HLFA 1KVBA 4FWKA 5BRHA 3DAWA 3K5NA 1S1UA 3EE9A 1HRHA 1D9FA 1S22A 4CFBA 4DV2K 4BR0A 4FOEA 4IG0A 4HUFA 4FXDA 5EOYA 1N8RO 3TAMA 2QK9A 3SMPA 1N36K 3CFRA 2ASPA 3HVTA 5JLFA 5GADP 5CE3A 2YKNA 4YOWA 4BRCA 5HRNA 5FLXO 4LSNA 3HTVA 1IKXA 3ZSQA 3ZETB 4FJLA 1B9FA 2Z1IA 3G71N 1BDGA 2AJQA 3J8AA 2P9NB 1U6ZA 3O9UA 4IFVA 3WEEB 2PFUA 1D9DA 3AY9A 3C6UA 2VQFK 4DU4A 3C6HA 4K43A 1IJJA 3AVGA 3F9MA 3JXUA 2KTQA 4JHDA 2FSJA 1QE1A 4YNQA 2P1JA 1RTJA 3MWPA 1UA0A 4DTUA 2P9KB 5CZ2A 1OH5A 4BRGA 1A5VA 2WOMA 5TKWA 4BR2A 1TYQA 2D0OA 2IGIA 1EWQA 2FF3B 3O3HA 4BE2A 3TAGA 3HXMA 2YNGA 1D5AA 2G8IA 3IKMA 3I0RA 3MCPA 4DG1A 5MLCQ 1BUPA 4B3MK 5C0YA 3S3NA 1O13A 3PX6A 4O5FA 3G6EN 5AQNA 4BRLA 3O1BA 4E0DA 1NGDA 3QBWA 1FK9A 3N4PA 1IV0A 4CF0A 4B3TK 1FXXA 4IWVA 3TAQA 3HSCA 1T6CA 4FWQA 3ENHA 4IOXA 3OYHA 1JLQA 1LW0A 2GEMA 3LM2A 2ZQBA 5FPNA 4O5BA 3ZEUB 4GKKK 4B9LA 4C1NI 4MO4A 5AQSA 4ZTFA 2Q36A 2W6LA 4MLEA 4E1NA 4OPKA 3FZMA 1W7AA 3C7NA 3S3MA 4FZZA 3R9PA 1VRUA 5E26A 3MN9A 4BG8A 4BQZA 3EKUA 1ZBUA 3D2FA 3CHWA 4BE1A 2V7YA 4LF7K 1RILA 4MO5A 1RDBA 3OYGA 2HMPA 1BIZA 4YOXA 4A59A 3HPOA 4G1QA 1L3SA 1HKCA 3RVCA 4FZXC 2OZMA 4C8NA 1N32K 2WBNA 3W0LA 2I7NA 4IOAL 2FSKA 3D7EO 4DTMA 4A2AA 1JKHA 3LAKA 4CF9A 1HPMA 3JAMO 3OS0A 1VSHA 4CFCA 3D45A 3L4QA 2IVPA 2D0PA 4NCBA 4I2QA 2ZM6K 4DSKA 1SL2A 5ELZA 3S9HA 3O8MA 1TV6A 2KZZA 5KRTA 4YY3K 1OH8A 3DLBA 3C95A 1ZBHA 4BWJA 4NCAA 2Y1IA 1ILYA 3KK1A 1MWKA 1RDDA 4CZGA 1DKGD 1JXBA 3HM9A 2A1RA 1RDWX 4FYDA 4K8XA 1E4GT 2B4JA 2Q0RA 4DLEA 4YOUA 2O4IA 2O8FA 3SBTA 3M1FA 4U7BA 3PIPL 4JS5A 3KZBA 3PSIA 3RMCA 2FSNA 3BDPA 1I3AA 3AVFA 3CCSN 2YNIA 3V4IA 3ID6A 4FM0A 4JKFA 4FJHA 1JLAA 2HBJA 2CGJA 3LP2A 5J2NA 3TTDA 1JJ2M 1JLFA 3DLEA 3QESA 2HOEA 4JI1K 5KRSA 3LM9A 5AQRA 2QI2A 4DR3K 4B1XB 4B9VA 3SQ4A 1HPZA 1C1AA 1XMOK 4X62K 2BTFA 3OYIA 2DTUA 1DLOA 3E9PA 3GG4A 1BWFO 3HOSA 4WQ4A 1SS6A 2YI1A 3EYZA 3C6TA 5AQUA 5C25A 2E4LA 3HP9A 3SUNA 3OS2A 3PO4A 3J7YP 1NKBA 3AO1A 4DTXA 2IVNA 3JS6A 3KLGA 4GV3A 4BC2A 2OTJN 4BRFA 3CCUN 3OYKA 4J2BA 3IG1A 4A62A 3C6AA 4HTLA 3LWMA 4DQIA 4DTOA 4OO1J 2E6MA 5AQKA 1ZBLA 5J2QA 4RW8A 5LJWA 2W6KA 4QCLA 1U04A 5M1PA 2EWSA 4RW9A 2A41A 2Q2RA 4FJKA 1WNSA 1FKPA 2O8DB 3R8EA 3KK7A 1UOCA 4KH6A 1GLLO 3MN6A 5M1KA 1DEJA 1S5JA 3O5BA 4H0YB 2ZE2A 2YHWA 3LDQA 3DLKA 5KGWA 2E88A 4DV4K 5BN8A 3T1YK 3VF2A 1NMDA 3CIPA 1NJZA 3K9JA 3SUPA 3FFKB 4IEEA 4A5BA 5HBMA 5J1EA 1RFQA 3H45C 1JL1A 4LY7A 3NCIA 1NGFA 4M3ZA 3QO9A 1H1VA 1QS4A 5CY4A 1KFDA 5CYMA 1XMQK 5M1NA 4E1MA 4F4KA 3KKRA 3CMAN 1HLUA 3WNHA 1JLGA 3TANA 3F2KA 1BISA 3F9KA 3ATVA 4BRIA 4CJEA 4I6MB 4KHYA 2QM1A 4KI4A 1KVAA 3W3DA 4AM7A 4CEZA 4R79A 2Z1JA 3VQAA 2HNYA 5BN9A 2DFEA 4DSJA 3LP3A 3TAEA 2QKKA 1IBMK 5K14A 4JD2A 3KLIA 2FLOA 4CJVA 3WXIA 5AQFA 3TTCA 4OKJA 3VF6A 3LAMA 4F2SA 4DSFA 4DQ8A 3K57A 3NH0A 4PKHA 3P5JA 4JK7A 1RDCA 4ZHRA 3NE6A 5GIOA 1Z26A 4CJPA 1W9HA 4CGDA 4E7LA 2P9PA 1U45A 1JLCA 1HMVA 3UKUB 4FW2A 4DV0K 2UYTA 4IO8A 2O8EA 4PKGA 2UXBK 4DU1A 3E66A 3IS9A 4OGEA 2DY4A 4X65K 3V1QA 3PSFA 4KO0A 3VQEA 1X9JA 1WSHA 1U4BA 2KLAA 2QKBA 1T3VA 1TAUA 2WTUA 1BG3A 4UQGA 3AA2A 3KJVA 2XHBA 3A5MC 3V6DA 3L0QA 1L3TA 3CCJN 2CGKA 2Z1HA 4JI6K 2YJEA 4C8MA 2D0AA 4B8AB 4YOYA 4H8KA 3THYB 4RW4A 4CFAA 3PIOL 5CYQA 1QTMA 4M3XA 4GMJB 3IRXA 1S72N 3THXA 4C8LA 2XY6A 1R0AA 2VGMA 1WSJA 5AFUH 1YIJN 1RDUA 2FBXA 1WSEA 1EO1A 3RMAA 1VQMN 5J2PA 3NF7A 3M8PA 3K5OA 3QICA 1HKBA 1LAVA 1TK0A 1X9WA 1YTAA 4O44A 1Q86O 4OGCA 4B9MA 4JK9A 3EL2A 3E1YA 4CF2A 4DSEA 1V4TA 3AO4A 4BROA 2V7ZA 4AHTA 5ADXA 5FRNA 5JS2A 4JS4A 4FK0A 4CECA 5KPRA 3SAHA 1OVQA 1VSJA 2P9NA 3H3OB 1ESVA 1YVUA 4CIFA 1E3MA 4H5NA 3RMDA 3F73A 1HUXA 2GX9A 2HVHA 2YX6A 1VSDA 2GV9A 3OY9A 5B8HA 3OS1A 3KLHA 2P9KA 4C8OA 2IIRA 1ASVA 3JYTA 3DLHA 2P9LB 5FPEA 4DTNA 1SL0A 2B5JA 3P31A 1VHXA 3A8YA 3VF4A 4YHHK 3NF9A 4IFYA 1U48A 4DB3A 4CF1A 1F21A 3UE5A 4J2EA 4CZIA 1NGGA 1RT1A 4DF8A 4AQYK 1N33K 3L3VA 5BPNA 1ASUA 1NU0A 4KRFA 4GW6A 3NMUA 1IKWA 3L4IA 4RW7A 4CFDA 4GV9A 4AHCA 2IVOA 3TABA 1KAXA 4MFBA 4KBOA 3CJBA 2KZMA 4BR5A 3TU5A 1FKOA 4E1JA 5JVHL 2NRRA 1QZ6A 4LD0A 3QEIA 3CF5L 4FW1A 4JKGB 1XQSC 4FLXA 5AQOA 4KHNA 3PLAA 3ZEUA 4AHRA 3TSQA 4X64K 1T44A 1GOCA 5E41A 1HNZK 4ILGB 3QERA 4HWIA 3AARA 4ILHA 2XY5A 3HM8A 4Z94A 1LOTB 4BRDA 2G8FA 4BRAA 3IAYA 4C8KA 3HK2A 1FJGK 2A6AA 4KV8A 4EHTA 2FF6A 3NVMA 2JGUA 4CBUA 2QA4N 1TK5A 3QLHA 1YITN 2P51A 4DU3A 2HF3A 4CD1A 5F0XA 1NGEA 4LFCK 1RDAA 3NHGA 4E7HA 3LPTA 1J5OA 1HYSA 3VN5A 4CJLA 4CE9A 4BE0A 3CERA 1RNHA 1LV5A 4KKOA 1EWRA 2FC0A 2GELA 3A2FA 5GAHP 5GIPA 2HHVA 3SLCA 1ITGA 4KHWA 2ZJQL 3KHYA 4J8FA 2RHKA 1YJNN 1ZXOA 1TKDA 1VSIA 1NNEA 1S6PA 2E2QA 3CFPA 2ZF5O 4DV7K 1YI2N 3OYCA 5FPDA 3VENA 4K8ZA 3KWGA 3SAFA 3KWIA 3ZX0A 3U8XA 2WONA 3OYBA 4IJNA 1HQUA 4I7FA 2V51B 2X6NA 1BQNA 4O55A 4B1YB 3DXMA 5AQXA 1Q8IA 2ASOA 3BZKA 4QOZB 4JYAK 4G9ZA 4B3SK 1ATSA 2QWMA 3EY1A 2QTDA 5M1QA 2ZGZA 5AQLA 2HHUA 4H0PA 3CPEA 3GBTA 2J4RA 3O9RA 4BC5A 5T7BA 2PAVA 2ITMA 4DV3K 3DJCA 5EU7A 1NGJA 4FJGA 3VQ7A 5C24A 4IBNA 4BR7A 4H0XB 3ULEB 3SCXA 1NJWA 4DFPA 3TSUA 5KQDA 2HHSA 4CGFA 4FLUA 3P4IA 1QQNA 4U67L 3I0SA 1TGOA 3BP8A 4ISFA 4RTFD 3ZT1A 4BG9A 4JKDA 3CM6A 4FM1A 3D2EB 3OA9A 3NVKA 4CESA 4CJWA 3HPGA 1T03A 4FJNA 4M3RA 3I55N 1UAXA 4CJUA 2HNZA 4KPYA 3EZ5A 2P5GA 2DFHA 3KK3A 4B3OA 3DXKA 3L2UA 1NOYA 3ZCMA 2E1ZA 1XHXA 4E7JA 2YHYA 1VQ5N 4LF4K 3L2VA 2ZWHA 4DUZK 3ISNC 1VQNN 4BACA 1VQPN 4CHNA 3T1HK 1NK8A 1XC9A 1BI4B 4CGHA 1ASWA 5C2FA 3A5NC 2OPSA 1RBVA 3ITHA 4BR9A 2VQEK 4CZFA 2NRWA 4FLTA 4B1VA 1A5WA 3IFRA 4ID5A 5JICA 3O9SA 4CZMA 4FCYA 4FWPA 2IC3A 1Y97A 4BGAA 5AQQA 1KXPA 3CC7N 4YOTA 1O1WA 3VEZA 3AVMA 2Q3SA 3QNOA 1VQ6N 3QEXA 5HRRA 2O8CA 3MWTA 3J7ZO 1RT7A 3A5LC 4RWTA 3QIOA 1GLEG 3K59A 2HHQA 1K8AO 1YTUA 3O1WA 2OCEA 3LDPA 3ENOA 3KIOA 4DUYK 1SUQA 3BUZB 4DWIA 2QXLA 1ATRA 3P38A 4O8KA 4JI2K 3EKSA 4M3WA 4YFUA 5C15A 3UKUA 4E19A 3THWA 5C42A 2ETJA 2HBKA 4CJSA 3D6RA 4OX9K 5IWAK 1OVYA 4PUOA 5CZ1A 2YV0X 2HBLA 4FJ5A 4OLAA 4CJ5A 2O8BB 3A5OC 3AA3A 4XH4A 3V9WA 3T3FA 1KFSA 1SKRA 1XC3A 3SQ2A 3FE1A 3CD6N 4CHOA 1YF5L 3VA3A 3MXIA 1NJYA 2P9UA 4IZ9A 1BQMA 3J80O 5HRPA 4KFBA 5CR4A 2NRXA 4JKAA 1RT6A 1WN7A 3O9TA 3GL1A 3VEYA 3TARA 2OA8A 3VETA 4CZHA 4DR7K 4QS7A 1Q18A 1KC8O 3GE1A 4EFHA 3AA4A 4ISEA 1VQ9N 4WQ5A 1Q9YA 1TUUA 3L8BA 4KAZA 4E89A 4H4OA 5AZIA 2FBYA 4AM6A 1HYVA 2X6SA 1Z25A 4IO9L 1IBLK 3PV8A 4JI7K 4EIAA 4L3QA 3RSEA 2W40A 3NBPA 1TVRA 1NK0A 1HJRA 4ISGA 1NK9A 2BANA 3RR8A 3V1RA 4CEBA 2UUAK 1C6VA 5SWMA 3AVKA 1SV5A 2RKIA 4BDYA 4FJ8A 4CHQA 5KPTA 1MDUB 1S3XA 1C1CA 1NK6A 3R3LA 2D0CA 4WFNL 5BREA 3MK6A 4BVPA 2XRIA 1VQLN 2HMIA 4CW7B 3AO3A 1GLCG 2AA4A 3HI0A 3MN5A 3VEVA 2A3ZA 2BUPA 4CERA 3D0PA 5BPMA 3QDKA 4Z4HA 3G0ZA 2ZD1A 1JCEA 4JKCA 4WFAL 1U2VB 5EVZA 3WQUA 3U6FA 3VPZA 1SAZA 4H4MA 4YDUA 4LF9K 1LWFA 1BU6O 4N41A 4CHZA 4JAXA 1YT3A 3SV3A
chains in the Genus database with same CATH topology
1SKWA 4DTJA 2FBXA 4DFMA 1U47A 2HHTA 1WSEA 3RMAA 1IH7A 3ZSWA 3O3GA 5J2PA 3NF7A 3M8PA 1RT2A 3K5OA 4CJKA 2G8KA 1NK4A 1LAVA 1HYZA 1QSSA 3OVNA 1KVCA 4KTZA 1TL3A 3OYJA 3QEPA 4B9SA 3ALYA 3LWLA 1YTAA 2OPPA 1X9WA 1TK0A 1D8YA 4CJ4A 4E7IA 4BDZA 4N47A 2OPQA 1HNVA 4OKEA 2HHXA 4O44A 3PY8A 2YNFA 1RBSA 1IG9A 4OGCA 2GUIA 3AO2A 4CGIA 3LDSA 3LP0A 4OVLA 4JLHA 4B9MA 3KD1E 3P83D 2LSNA 1HYSA 3V9XA 2VWKA 4CHPA 4CF2A 4DSEA 3AO4A 1KSPA 3VQ9A 4AHTA 4CJQA 5FRNA 3NF8A 1DTQA 5JS2A 4JS4A 3VQBA 2E6LA 4FK0A 3OYNA 3E01A 4CECA 3VQ4A 4ICLA 2D0BA 1J53A 1VSJA 2O4GA 3C94A 3P1GA 3O4NA 3T1AA 4CJTA 1KRPA 1CXQA 3SPYA 3V1OA 1J9AA 1YVUA 4CIFA 4F3TA 3O4QA 3VQDA 1IKYA 1REVA 4CEOA 3RMDA 3SPZA 3F73A 2A1SA 1K6YA 4FJ7A 4J2AA 4FJMA 2HVHA 1S9EA 4FLVA 1CXUA 1VSDA 2GV9A 3OY9A 4AHSA 3OYMA 3OS1A 4ID1A 3OYAA 3KLHA 4DTSA 4B9UA 4C8OA 5DK5A 5HRSA 1ASVA 1VK0A 3T19A 1B92A 3LPUA 1BIUA 3JYTA 3SUQA 1QSYA 3DLHA 1SL0A 4DTNA 2RPIA 2B5JA 2FBVA 3WNFA 3OYLA 3CM5A 3U3GA 3NF9A 4PY5A 4IFYA 4NYNA 1U48A 4CF1A 1F21A 1QHTA 3QEWA 4RG8A 3TAPA 4J2EA 4CJRA 2YHBA 4O0JA 1JLBA 1RT1A 5SZTA 4DF8A 2OYQA 2XY7A 3L3UA 4OPJA 3ZSOA 2XO7A 3L3VA 5HLFA 5FRMA 2OPRA 3SQ0A 1C1BA 1KVBA 4Z4GA 4FJ9A 4ELUA 1ASUA 4KRFA 4GW6A 3K5NA 1S1UA 1IKWA 1HRHA 4RW7A 4CFDA 3RRHA 1SKSA 4AHCA 1D9FA 1GOBA 2G8HA 4CFBA 3DRSA 3TABA 4IG0A 4MFBA 4HUFA 4FXDA 2PYLA 2KZMA 1S1VA 4I2PA 1FKOA 3TAMA 2QK9A 1L3UA 3TR8A 3DOLA 3CFRA 3HVTA 5KTQA 3RRGA 1CLQA 4LD0A 3QEIA 2HNDA 3AVCA 3DLRA 4Z4CA 2YKNA 4FW1A 3AO5A 1W0HA 4FLWA 2NUBA 4FLXA 2PY5A 4KHNA 5HRNA 4KB1A 4AHRA 4LSNA 1IKXA 3ZSQA 4BWMA 3QETA 1XI1A 4FJLA 1GOCA 1B9FA 2X78A 5E41A 2Z1IA 3M8SA 1BCMA 3QERA 5I3UA 3ZSRA 4FLYA 2AJQA 3QINA 3WNEA 1X9SA 2XY5A 4IFVA 3I8DA 1D9DA 3DMJA 3C6UA 3AVLA 4EP4A 3KLEA 2G8FA 4DU4A 4F3OA 4FJJA 1S6QA 4DLGA 4JRPA 3IAYA 4C8KA 3HK2A 4FJXA 3AVGA 1IO2A 2KTQA 1WSFA 3TI0A 1QE1A 2BGGA 3DRPA 4KV8A 4YNQA 2P1JA 1RTJA 5KGXA 4M42A 1UA0A 1NK5A 1RT5A 4DTUA 2JGUA 5CZ2A 5D3GA 3ZSYA 3CG7A 1TK5A 1JLEA 1A5VA 3LALA 2WOMA 3NGYA 3QLHA 2P51A 2HHWA 4KTQA 4DU3A 1RT4A 2HVIA 2HW3A 3PX4A 3UIQA 3HO1A 2IGIA 3HL8A 3SYZA 4DMNA 3SJJA 1RBRA 1RDAA 4CEEA 3NHGA 4E7HA 3O3HA 1WSGA 2RN2A 3DI6A 3LPTA 3VN5A 4CJLA 4CE9A 4BE2A 4BE0A 3TAGA 1J5OA 3HXMA 2YNGA 4PWDA 1D5AA 2G8IA 3I0RA 3AVAA 1RNHA 4DG1A 3QIPA 1RBTA 1LV5A 4KKOA 3S3NA 2FC0A 3A2FA 4CIGA 3PX6A 4HHTA 1MU2A 4GVMA 2IS3A 4E0DA 5J2MA 4M3UA 2HHVA 4IG3A 1ITGA 1RBUA 4W5OA 4KHWA 1TKDA 1VSIA 1HQEA 1S6PA 4FZYA 1RTHA 1FK9A 3CFPA 4CF0A 1FXXA 4IKFA 3TAQA 2Y1JA 3M8QA 3OYCA 1UWBA 2BDPA 3DYAA 2JLEA 1G15A 1A5XA 4K8ZA 3B6OA 1N6QA 3OYHA 1JLQA 1LW0A 1SL1A 4CEAA 2ZQBA 3KLFA 1NJXA 4Z4FA 4O5BA 2WONA 4B9LA 2IOCA 3OYBA 4ZTFA 1HQUA 4CEFA 4I7FA 2GBZA 3OYEA 2RF2A 1T7PA 2X6NA 1BQNA 4O55A 4E1NA 4OPKA 3ULDA 2F8TA 3QNNA 3S3MA 1Q8IA 4DF4A 4FZZA 1QSLA 3SV4A 3ZT4A 4QOZB 1VRUA 4E7KA 4O0IA 3SNNA 1ZBUA 4BE1A 2P5OA 3EY1A 1RILA 4AILC 1RDBA 3G10A 3VA0A 3OYGA 2PYJA 2HHUA 4CEQA 3LZJA 1BIZA 3HPOA 1WSIA 4G1QA 1JL2A 4HUEA 1L3SA 2IDOA 4RW6A 3DLGA 4FZXC 4OJRA 3VQQA 3WNGA 4CJFA 5T7BA 1T8EA 2KFNA 2OZMA 5EU7A 4CK3A 4C8NA 2B6AA 1VRTA 4LH5A 4FJGA 4KHSA 3VQ7A 4OLBA 1N5YA 1XWLA 3HSTB 1TKXA 5C24A 1IKVA 4IBNA 3RR7A 4DTMA 1U49A 3SCXA 1JKHA 1NJWA 1VSFA 2X74A 3BGRA 4DFPA 3LAKA 4M3YA 4CF9A 1NOZA 1KTQA 1C0MA 3ZSXA 2HHSA 3OS0A 4CGFA 4FLUA 1VSHA 2YKMA 4M41A 4CFCA 3D45A 4KI6A 4M45A 3I0SA 1TGOA 4NCBA 3AVJA 3CFOA 4I2QA 4W5TA 4DSKA 1SL2A 3VQ6A 3S9HA 1TV6A 4N56A 3HT3A 2KZZA 3JSMA 1WAFA 5KRTA 4FVMA 3C95A 3DLBA 4N76A 1ZBHA 4BWJA 3ZT1A 4NCAA 4DFKA 3ZT0A 3ZSVA 2Y1IA 1UA1A 3CM6A 3LZIA 3KK1A 3S3OA 3K58A 4FM1A 3PO5A 3HP6A 1RDDA 4W5RA 3MECA 3VQPA 3NDKA 1JXBA 3O3FA 3MEGA 3HM9A 4CESA 3HPHA 3HPGA 4CJWA 2A1RA 1T03A 4EZ6A 4M3RA 4DS5A 4K8XA 4L8RB 4FJNA 4FYDA 2B4JA 4DLEA 3FFIA 2O4IA 1X9MA 4FM2A 1X1PA 1UAXA 3ASMA 4CJUA 4E3SA 2HNZA 4KPYA 3NGIA 3EZ5A 2P5GA 4JS5A 1NK7A 2DFHA 3KK3A 3RMCA 3BDPA 4B3OA 3L2UA 1NOYA 1I3AA 3SUOA 1EXQA 3AVFA 5FROA 2YNIA 1BGXT 3ZCMA 1XHXA 4E7JA 3V4IA 4FM0A 4FJHA 1JLAA 2F8SA 3L2VA 1VSEA 4ZTJA 3ZT2A 4HVJA 1TKTA 2OZSA 3ISNC 3K2PA 3LP2A 5J2NA 3TWHA 3PX0A 4BACA 4CHNA 1JLFA 3DLEA 3AA5X 3QESA 2BE2A 5KRSA 3SZ2A 3THVA 2D5RA 3VQ8A 4B9VA 2XY8A 1RT3A 3H08A 4Z4EA 1NK8A 4O4GA 3SQ4A 1XC9A 1BI4B 1HPZA 1C1AA 4CGHA 1ASWA 4CCHA 2Z1GA 3OYIA 2DTUA 1GOAA 1DLOA 2OPSA 4CEDA 1RBVA 3ITHA 5JS1A 2YNHA 1KLNA 3M8RA 3MXMA 4CGJA 3OYDA 4FLTA 3L2QA 1L5UA 4FK2A 1A5WA 3L2WA 4ID5A 3LANA 3EYZA 3C6TA 4KHQA 4AH9A 1S1WA 1TAQA 5C25A 2E4LA 4OKKA 4Z4IA 3VQ5A 3HP9A 3SUNA 3OS2A 3RWUA 3CQ8A 3PO4A 1NKBA 4FCYA 2DFFA 3AO1A 4DTXA 2IC3A 1Y97A 4PQUA 1KCFA 3KLGA 1Q9XA 3OYKA 4J2BA 3IG1A 1O1WA 3AVMA 2Q3SA 3QNOA 3QEXA 5HRRA 4CJ3A 3AVIA 5I42A 2VG5A 3TAFA 1RT7A 3LWMA 4DQIA 4HTUA 5KI6A 4DTOA 3QIOA 4ELTA 3K59A 2HHQA 1YTUA 2E6MA 4Y1DA 1ZBLA 5J2QA 4RW8A 4KTWA 1XHZA 4FJIA 3LP1A 4Y1CA 1B9DA 2KW4A 3NFAA 3OJSA 3B6PA 4I9LA 4QCLA 4LSLA 1U04A 3KIOA 4FLZA 1J54A 1SUQA 1ZYQA 4RW9A 4DWIA 4WE1A 2VG7A 4HCBA 4FJKA 1WNSA 1FKPA 2G8WA 4KHUA 2PZSA 4DQPA 4M3WA 1TL1A 1UOCA 4KB0A 4CK2A 4YFUA 4AHUA 3AVHA 3ZT3A 1S5JA 4E19A 2ZE2A 3QEVA 5C42A 2ETJA 3DLKA 4CJSA 3K5MA 1BHLA 5KGWA 2VG6A 4PUOA 5CZ1A 2YV0X 4OLAA 4FJ5A 4CJ5A 1S1TA 3CYMA 1BI4A 1NJZA 3SUPA 3V81A 3AA3A 1L3VA 1ZBIA 3ZSZA 5HBMA 4CHYA 5J1EA 3V9WA 3T3FA 1I39A 1JL1A 3AVBA 4LY7A 4QAGA 2EHGA 3NCIA 1BCOA 1SKRA 1KFSA 3SQ2A 4M3ZA 3QO9A 5CY4A 1QS4A 1RTIA 2F96A 1ZBFA 4CHOA 4I9QA 1KFDA 3SI6A 5CYMA 2VWJA 3VA3A 1WAJA 1VSMA 3MXIA 1NJYA 3NGZA 2G8VA 4E1MA 4F4KA 1DTTA 1BQMA 3KKRA 3WNHA 4XIUA 1JLGA 5HRPA 4KFBA 3TANA 1S9GA 2W42A 1BISA 2ITGA 4B9TA 1RCHA 4CK1A 3KK2A 5FDLA 1JXEA 2HB5A 3F9KA 4KREA 4F8RA 1RT6A 1WN7A 2OA8A 1KLMA 3PUFA 3TARA 4W5NA 1LWCA 3V9SA 3OJUA 1WLJA 4CJEA 5DMRA 3KKSA 3OYFA 4KHYA 1C0TA 4Q0BA 1NKEA 4KI4A 1KVAA 1TK8A 1HNIA 4DTRA 4NCGA 4CEZA 4NYFA 2Z1JA 3AA4A 3VQAA 4DS4A 1TKZA 2HNYA 4CF8A 2DFEA 3DOKA 1VSLA 1LAWA 4Q5VA 1RTDA 5HROA 3L2RA 3RTVA 1Q9YA 4DSJA 3LP3A 3L8BA 3TAEA 2QKKA 4KAZA 4E89A 4H4OA 5K14A 2FBYA 1LWEA 3KLIA 1HYVA 3DRRA 2X6SA 4CJVA 1Z25A 4OKJA 3VQCA 2KFZA 3LAMA 3PV8A 3NF6A 4DSFA 4F2SA 3K57A 3NH0A 3MEDA 3SQ1A 2KQ2A 3P5JA 1RDCA 3MXJA 4ZHRA 3NBPA 1TVRA 3V9UA 1NK0A 1HJRA 3NE6A 1Z26A 1LW2A 4CJPA 1NK9A 1W9HA 2BANA 4CGDA 2I5JA 1EETA 4HUGA 4E7LA 2G8UA 3RR8A 4AHVA 1U45A 1JLCA 3V1RA 4CEBA 4EP5A 1HMVA 3NAEA 1CZBA 2FBTA 4FW2A 4IDKA 4DQRA 1C6VA 3HYFA 5SWMA 4DU1A 3AVKA 3RMBA 3IS9A 3MAQA 4OGEA 2DY4A 1SV5A 2RKIA 4BDYA 3V1QA 4FJ8A 4M3TA 2QXFA 4KO0A 3VQEA 4TSXA 1WSHA 3MEEA 4CHQA 1U4BA 2IAJA 4HCCA 4B8CA 3KTQA 4DSLA 3DM2A 2QKBA 1TAUA 1C1CA 4DQSA 1NK6A 4UQGA 4J2DA 3K5LA 3AA2A 3KJVA 4DQQA 2D0CA 4DSIA 2XHBA 4FK4A 4LH4A 3HVRA 3V6DA 1L3TA 2XRIA 4CGGA 2HMIA 4R5PA 2Z1HA 3AV9A 3AVNA 4C8MA 4B9NA 4ELVA 2D0AA 3NH2A 3AO3A 4B8AB 4F2RA 4Z0UA 1EX4A 4H8KA 3NH1A 1C0UA 4CERA 3KD5E 3D0PA 4RW4A 2YHAA 4CIEA 4W5QA 4PA1A 4CFAA 4Z4HA 3G0ZA 2EX3A 5CYQA 1VSKA 4BDPA 2ATQA 4EZ9A 2ZD1A 5HP1A 1EKEA 1QTMA 4M3XA 4DTPA 4GMJB 3IRXA 1QQCA 3U6FA 4DFJA 4C8LA 4MQ3A 1EP4A 2XY6A 3HJFA 1R0AA 1WSJA 4H4MA 1NKCA 1CZ9A 4JRQA 1BL3A 1LWFA 4B08A 1T05A 4N5SA 4N41A 1S1XA 3V9ZA 4CHZA 1YT3A 3SV3A 3U3YA 2R7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SKW A;  4DTJ A;  2FBX A;  4DFM A;  1U47 A;  2HHT A;  1WSE A;  3RMA A;  1IH7 A;  3ZSW A;  3O3G A;  5J2P A;  3NF7 A;  3M8P A;  1RT2 A;  3K5O A;  4CJK A;  2G8K A;  1NK4 A;  1LAV A;  1HYZ A;  1QSS A;  3OVN A;  1KVC A;  4KTZ A;  1TL3 A;  3OYJ A;  3QEP A;  4B9S A;  3ALY A;  3LWL A;  1YTA A;  2OPP A;  1X9W A;  1TK0 A;  1D8Y A;  4CJ4 A;  4E7I A;  4BDZ A;  4N47 A;  2OPQ A;  1HNV A;  4OKE A;  2HHX A;  4O44 A;  3PY8 A;  2YNF A;  1RBS A;  1IG9 A;  4OGC A;  2GUI A;  3AO2 A;  4CGI A;  3LDS A;  3LP0 A;  4OVL A;  4JLH A;  4B9M A;  3KD1 E;  3P83 D;  2LSN A;  1HYS A;  3V9X A;  2VWK A;  4CHP A;  4CF2 A;  4DSE A;  3AO4 A;  1KSP A;  3VQ9 A;  4AHT A;  4CJQ A;  5FRN A;  3NF8 A;  1DTQ A;  5JS2 A;  4JS4 A;  3VQB A;  2E6L A;  4FK0 A;  3OYN A;  3E01 A;  4CEC A;  3VQ4 A;  4ICL A;  2D0B A;  1J53 A;  1VSJ A;  2O4G A;  3C94 A;  3P1G A;  3O4N A;  3T1A A;  4CJT A;  1KRP A;  1CXQ A;  3SPY A;  3V1O A;  1J9A A;  1YVU A;  4CIF A;  4F3T A;  3O4Q A;  3VQD A;  1IKY A;  1REV A;  4CEO A;  3RMD A;  3SPZ A;  3F73 A;  2A1S A;  1K6Y A;  4FJ7 A;  4J2A A;  4FJM A;  2HVH A;  1S9E A;  4FLV A;  1CXU A;  1VSD A;  2GV9 A;  3OY9 A;  4AHS A;  3OYM A;  3OS1 A;  4ID1 A;  3OYA A;  3KLH A;  4DTS A;  4B9U A;  4C8O A;  5DK5 A;  5HRS A;  1ASV A;  1VK0 A;  3T19 A;  1B92 A;  3LPU A;  1BIU A;  3JYT A;  3SUQ A;  1QSY A;  3DLH A;  1SL0 A;  4DTN A;  2RPI A;  2B5J A;  2FBV A;  3WNF A;  3OYL A;  3CM5 A;  3U3G A;  3NF9 A;  4PY5 A;  4IFY A;  4NYN A;  1U48 A;  4CF1 A;  1F21 A;  1QHT A;  3QEW A;  4RG8 A;  3TAP A;  4J2E A;  4CJR A;  2YHB A;  4O0J A;  1JLB A;  1RT1 A;  5SZT A;  4DF8 A;  2OYQ A;  2XY7 A;  3L3U A;  4OPJ A;  3ZSO A;  2XO7 A;  3L3V A;  5HLF A;  5FRM A;  2OPR A;  3SQ0 A;  1C1B A;  1KVB A;  4Z4G A;  4FJ9 A;  4ELU A;  1ASU A;  4KRF A;  4GW6 A;  3K5N A;  1S1U A;  1IKW A;  1HRH A;  4RW7 A;  4CFD A;  3RRH A;  1SKS A;  4AHC A;  1D9F A;  1GOB A;  2G8H A;  4CFB A;  3DRS A;  3TAB A;  4IG0 A;  4MFB A;  4HUF A;  4FXD A;  2PYL A;  2KZM A;  1S1V A;  4I2P A;  1FKO A;  3TAM A;  2QK9 A;  1L3U A;  3TR8 A;  3DOL A;  3CFR A;  3HVT A;  5KTQ A;  3RRG A;  1CLQ A;  4LD0 A;  3QEI A;  2HND A;  3AVC A;  3DLR A;  4Z4C A;  2YKN A;  4FW1 A;  3AO5 A;  1W0H A;  4FLW A;  2NUB A;  4FLX A;  2PY5 A;  4KHN A;  5HRN A;  4KB1 A;  4AHR A;  4LSN A;  1IKX A;  3ZSQ A;  4BWM A;  3QET A;  1XI1 A;  4FJL A;  1GOC A;  1B9F A;  2X78 A;  5E41 A;  2Z1I A;  3M8S A;  1BCM A;  3QER A;  5I3U A;  3ZSR A;  4FLY A;  2AJQ A;  3QIN A;  3WNE A;  1X9S A;  2XY5 A;  4IFV A;  3I8D A;  1D9D A;  3DMJ A;  3C6U A;  3AVL A;  4EP4 A;  3KLE A;  2G8F A;  4DU4 A;  4F3O A;  4FJJ A;  1S6Q A;  4DLG A;  4JRP A;  3IAY A;  4C8K A;  3HK2 A;  4FJX A;  3AVG A;  1IO2 A;  2KTQ A;  1WSF A;  3TI0 A;  1QE1 A;  2BGG A;  3DRP A;  4KV8 A;  4YNQ A;  2P1J A;  1RTJ A;  5KGX A;  4M42 A;  1UA0 A;  1NK5 A;  1RT5 A;  4DTU A;  2JGU A;  5CZ2 A;  5D3G A;  3ZSY A;  3CG7 A;  1TK5 A;  1JLE A;  1A5V A;  3LAL A;  2WOM A;  3NGY A;  3QLH A;  2P51 A;  2HHW A;  4KTQ A;  4DU3 A;  1RT4 A;  2HVI A;  2HW3 A;  3PX4 A;  3UIQ A;  3HO1 A;  2IGI A;  3HL8 A;  3SYZ A;  4DMN A;  3SJJ A;  1RBR A;  1RDA A;  4CEE A;  3NHG A;  4E7H A;  3O3H A;  1WSG A;  2RN2 A;  3DI6 A;  3LPT A;  3VN5 A;  4CJL A;  4CE9 A;  4BE2 A;  4BE0 A;  3TAG A;  1J5O A;  3HXM A;  2YNG A;  4PWD A;  1D5A A;  2G8I A;  3I0R A;  3AVA A;  1RNH A;  4DG1 A;  3QIP A;  1RBT A;  1LV5 A;  4KKO A;  3S3N A;  2FC0 A;  3A2F A;  4CIG A;  3PX6 A;  4HHT A;  1MU2 A;  4GVM A;  2IS3 A;  4E0D A;  5J2M A;  4M3U A;  2HHV A;  4IG3 A;  1ITG A;  1RBU A;  4W5O A;  4KHW A;  1TKD A;  1VSI A;  1HQE A;  1S6P A;  4FZY A;  1RTH A;  1FK9 A;  3CFP A;  4CF0 A;  1FXX A;  4IKF A;  3TAQ A;  2Y1J A;  3M8Q A;  3OYC A;  1UWB A;  2BDP A;  3DYA A;  2JLE A;  1G15 A;  1A5X A;  4K8Z A;  3B6O A;  1N6Q A;  3OYH A;  1JLQ A;  1LW0 A;  1SL1 A;  4CEA A;  2ZQB A;  3KLF A;  1NJX A;  4Z4F A;  4O5B A;  2WON A;  4B9L A;  2IOC A;  3OYB A;  4ZTF A;  1HQU A;  4CEF A;  4I7F A;  2GBZ A;  3OYE A;  2RF2 A;  1T7P A;  2X6N A;  1BQN A;  4O55 A;  4E1N A;  4OPK A;  3ULD A;  2F8T A;  3QNN A;  3S3M A;  1Q8I A;  4DF4 A;  4FZZ A;  1QSL A;  3SV4 A;  3ZT4 A;  4QOZ B;  1VRU A;  4E7K A;  4O0I A;  3SNN A;  1ZBU A;  4BE1 A;  2P5O A;  3EY1 A;  1RIL A;  4AIL C;  1RDB A;  3G10 A;  3VA0 A;  3OYG A;  2PYJ A;  2HHU A;  4CEQ A;  3LZJ A;  1BIZ A;  3HPO A;  1WSI A;  4G1Q A;  1JL2 A;  4HUE A;  1L3S A;  2IDO A;  4RW6 A;  3DLG A;  4FZX C;  4OJR A;  3VQQ A;  3WNG A;  4CJF A;  5T7B A;  1T8E A;  2KFN A;  2OZM A;  5EU7 A;  4CK3 A;  4C8N A;  2B6A A;  1VRT A;  4LH5 A;  4FJG A;  4KHS A;  3VQ7 A;  4OLB A;  1N5Y A;  1XWL A;  3HST B;  1TKX A;  5C24 A;  1IKV A;  4IBN A;  3RR7 A;  4DTM A;  1U49 A;  3SCX A;  1JKH A;  1NJW A;  1VSF A;  2X74 A;  3BGR A;  4DFP A;  3LAK A;  4M3Y A;  4CF9 A;  1NOZ A;  1KTQ A;  1C0M A;  3ZSX A;  2HHS A;  3OS0 A;  4CGF A;  4FLU A;  1VSH A;  2YKM A;  4M41 A;  4CFC A;  3D45 A;  4KI6 A;  4M45 A;  3I0S A;  1TGO A;  4NCB A;  3AVJ A;  3CFO A;  4I2Q A;  4W5T A;  4DSK A;  1SL2 A;  3VQ6 A;  3S9H A;  1TV6 A;  4N56 A;  3HT3 A;  2KZZ A;  3JSM A;  1WAF A;  5KRT A;  4FVM A;  3C95 A;  3DLB A;  4N76 A;  1ZBH A;  4BWJ A;  3ZT1 A;  4NCA A;  4DFK A;  3ZT0 A;  3ZSV A;  2Y1I A;  1UA1 A;  3CM6 A;  3LZI A;  3KK1 A;  3S3O A;  3K58 A;  4FM1 A;  3PO5 A;  3HP6 A;  1RDD A;  4W5R A;  3MEC A;  3VQP A;  3NDK A;  1JXB A;  3O3F A;  3MEG A;  3HM9 A;  4CES A;  3HPH A;  3HPG A;  4CJW A;  2A1R A;  1T03 A;  4EZ6 A;  4M3R A;  4DS5 A;  4K8X A;  4L8R B;  4FJN A;  4FYD A;  2B4J A;  4DLE A;  3FFI A;  2O4I A;  1X9M A;  4FM2 A;  1X1P A;  1UAX A;  3ASM A;  4CJU A;  4E3S A;  2HNZ A;  4KPY A;  3NGI A;  3EZ5 A;  2P5G A;  4JS5 A;  1NK7 A;  2DFH A;  3KK3 A;  3RMC A;  3BDP A;  4B3O A;  3L2U A;  1NOY A;  1I3A A;  3SUO A;  1EXQ A;  3AVF A;  5FRO A;  2YNI A;  1BGX T;  3ZCM A;  1XHX A;  4E7J A;  3V4I A;  4FM0 A;  4FJH A;  1JLA A;  2F8S A;  3L2V A;  1VSE A;  4ZTJ A;  3ZT2 A;  4HVJ A;  1TKT A;  2OZS A;  3ISN C;  3K2P A;  3LP2 A;  5J2N A;  3TWH A;  3PX0 A;  4BAC A;  4CHN A;  1JLF A;  3DLE A;  3AA5 X;  3QES A;  2BE2 A;  5KRS A;  3SZ2 A;  3THV A;  2D5R A;  3VQ8 A;  4B9V A;  2XY8 A;  1RT3 A;  3H08 A;  4Z4E A;  1NK8 A;  4O4G A;  3SQ4 A;  1XC9 A;  1BI4 B;  1HPZ A;  1C1A A;  4CGH A;  1ASW A;  4CCH A;  2Z1G A;  3OYI A;  2DTU A;  1GOA A;  1DLO A;  2OPS A;  4CED A;  1RBV A;  3ITH A;  5JS1 A;  2YNH A;  1KLN A;  3M8R A;  3MXM A;  4CGJ A;  3OYD A;  4FLT A;  3L2Q A;  1L5U A;  4FK2 A;  1A5W A;  3L2W A;  4ID5 A;  3LAN A;  3EYZ A;  3C6T A;  4KHQ A;  4AH9 A;  1S1W A;  1TAQ A;  5C25 A;  2E4L A;  4OKK A;  4Z4I A;  3VQ5 A;  3HP9 A;  3SUN A;  3OS2 A;  3RWU A;  3CQ8 A;  3PO4 A;  1NKB A;  4FCY A;  2DFF A;  3AO1 A;  4DTX A;  2IC3 A;  1Y97 A;  4PQU A;  1KCF A;  3KLG A;  1Q9X A;  3OYK A;  4J2B A;  3IG1 A;  1O1W A;  3AVM A;  2Q3S A;  3QNO A;  3QEX A;  5HRR A;  4CJ3 A;  3AVI A;  5I42 A;  2VG5 A;  3TAF A;  1RT7 A;  3LWM A;  4DQI A;  4HTU A;  5KI6 A;  4DTO A;  3QIO A;  4ELT A;  3K59 A;  2HHQ A;  1YTU A;  2E6M A;  4Y1D A;  1ZBL A;  5J2Q A;  4RW8 A;  4KTW A;  1XHZ A;  4FJI A;  3LP1 A;  4Y1C A;  1B9D A;  2KW4 A;  3NFA A;  3OJS A;  3B6P A;  4I9L A;  4QCL A;  4LSL A;  1U04 A;  3KIO A;  4FLZ A;  1J54 A;  1SUQ A;  1ZYQ A;  4RW9 A;  4DWI A;  4WE1 A;  2VG7 A;  4HCB A;  4FJK A;  1WNS A;  1FKP A;  2G8W A;  4KHU A;  2PZS A;  4DQP A;  4M3W A;  1TL1 A;  1UOC A;  4KB0 A;  4CK2 A;  4YFU A;  4AHU A;  3AVH A;  3ZT3 A;  1S5J A;  4E19 A;  2ZE2 A;  3QEV A;  5C42 A;  2ETJ A;  3DLK A;  4CJS A;  3K5M A;  1BHL A;  5KGW A;  2VG6 A;  4PUO A;  5CZ1 A;  2YV0 X;  4OLA A;  4FJ5 A;  4CJ5 A;  1S1T A;  3CYM A;  1BI4 A;  1NJZ A;  3SUP A;  3V81 A;  3AA3 A;  1L3V A;  1ZBI A;  3ZSZ A;  5HBM A;  4CHY A;  5J1E A;  3V9W A;  3T3F A;  1I39 A;  1JL1 A;  3AVB A;  4LY7 A;  4QAG A;  2EHG A;  3NCI A;  1BCO A;  1SKR A;  1KFS A;  3SQ2 A;  4M3Z A;  3QO9 A;  5CY4 A;  1QS4 A;  1RTI A;  2F96 A;  1ZBF A;  4CHO A;  4I9Q A;  1KFD A;  3SI6 A;  5CYM A;  2VWJ A;  3VA3 A;  1WAJ A;  1VSM A;  3MXI A;  1NJY A;  3NGZ A;  2G8V A;  4E1M A;  4F4K A;  1DTT A;  1BQM A;  3KKR A;  3WNH A;  4XIU A;  1JLG A;  5HRP A;  4KFB A;  3TAN A;  1S9G A;  2W42 A;  1BIS A;  2ITG A;  4B9T A;  1RCH A;  4CK1 A;  3KK2 A;  5FDL A;  1JXE A;  2HB5 A;  3F9K A;  4KRE A;  4F8R A;  1RT6 A;  1WN7 A;  2OA8 A;  1KLM A;  3PUF A;  3TAR A;  4W5N A;  1LWC A;  3V9S A;  3OJU A;  1WLJ A;  4CJE A;  5DMR A;  3KKS A;  3OYF A;  4KHY A;  1C0T A;  4Q0B A;  1NKE A;  4KI4 A;  1KVA A;  1TK8 A;  1HNI A;  4DTR A;  4NCG A;  4CEZ A;  4NYF A;  2Z1J A;  3AA4 A;  3VQA A;  4DS4 A;  1TKZ A;  2HNY A;  4CF8 A;  2DFE A;  3DOK A;  1VSL A;  1LAW A;  4Q5V A;  1RTD A;  5HRO A;  3L2R A;  3RTV A;  1Q9Y A;  4DSJ A;  3LP3 A;  3L8B A;  3TAE A;  2QKK A;  4KAZ A;  4E89 A;  4H4O A;  5K14 A;  2FBY A;  1LWE A;  3KLI A;  1HYV A;  3DRR A;  2X6S A;  4CJV A;  1Z25 A;  4OKJ A;  3VQC A;  2KFZ A;  3LAM A;  3PV8 A;  3NF6 A;  4DSF A;  4F2S A;  3K57 A;  3NH0 A;  3MED A;  3SQ1 A;  2KQ2 A;  3P5J A;  1RDC A;  3MXJ A;  4ZHR A;  3NBP A;  1TVR A;  3V9U A;  1NK0 A;  1HJR A;  3NE6 A;  1Z26 A;  1LW2 A;  4CJP A;  1NK9 A;  1W9H A;  2BAN A;  4CGD A;  2I5J A;  1EET A;  4HUG A;  4E7L A;  2G8U A;  3RR8 A;  4AHV A;  1U45 A;  1JLC A;  3V1R A;  4CEB A;  4EP5 A;  1HMV A;  3NAE A;  1CZB A;  2FBT A;  4FW2 A;  4IDK A;  4DQR A;  1C6V A;  3HYF A;  5SWM A;  4DU1 A;  3AVK A;  3RMB A;  3IS9 A;  3MAQ A;  4OGE A;  2DY4 A;  1SV5 A;  2RKI A;  4BDY A;  3V1Q A;  4FJ8 A;  4M3T A;  2QXF A;  4KO0 A;  3VQE A;  4TSX A;  1WSH A;  3MEE A;  4CHQ A;  1U4B A;  2IAJ A;  4HCC A;  4B8C A;  3KTQ A;  4DSL A;  3DM2 A;  2QKB A;  1TAU A;  1C1C A;  4DQS A;  1NK6 A;  4UQG A;  4J2D A;  3K5L A;  3AA2 A;  3KJV A;  4DQQ A;  2D0C A;  4DSI A;  2XHB A;  4FK4 A;  4LH4 A;  3HVR A;  3V6D A;  1L3T A;  2XRI A;  4CGG A;  2HMI A;  4R5P A;  2Z1H A;  3AV9 A;  3AVN A;  4C8M A;  4B9N A;  4ELV A;  2D0A A;  3NH2 A;  3AO3 A;  4B8A B;  4F2R A;  4Z0U A;  1EX4 A;  4H8K A;  3NH1 A;  1C0U A;  4CER A;  3KD5 E;  3D0P A;  4RW4 A;  2YHA A;  4CIE A;  4W5Q A;  4PA1 A;  4CFA A;  4Z4H A;  3G0Z A;  2EX3 A;  5CYQ A;  1VSK A;  4BDP A;  2ATQ A;  4EZ9 A;  2ZD1 A;  5HP1 A;  1EKE A;  1QTM A;  4M3X A;  4DTP A;  4GMJ B;  3IRX A;  1QQC A;  3U6F A;  4DFJ A;  4C8L A;  4MQ3 A;  1EP4 A;  2XY6 A;  3HJF A;  1R0A A;  1WSJ A;  4H4M A;  1NKC A;  1CZ9 A;  4JRQ A;  1BL3 A;  1LWF A;  4B08 A;  1T05 A;  4N5S A;  4N41 A;  1S1X A;  3V9Z A;  4CHZ A;  1YT3 A;  3SV3 A;  3U3Y A;  2R7Y A; 
#chains in the Genus database with same CATH topology
 1SKW A;  2HHT A;  1ZC6 A;  1Q81 O;  1W97 L;  3O3G A;  4H0T B;  1RT2 A;  4CJK A;  2G8K A;  1HYZ A;  3OVN A;  4KTZ A;  3QEP A;  3ID8 A;  3ALY A;  4E7I A;  4N47 A;  2OPQ A;  4AF1 A;  3PY8 A;  1RBS A;  5AQI A;  4OPH A;  2JWL A;  4Y0W A;  4JLH A;  2LSN A;  1T6D A;  4XH1 A;  3VTH A;  4CHP A;  4GV6 A;  1GLB G;  3VQ9 A;  3NF8 A;  1DTQ A;  3VQB A;  5AQJ A;  2O4G A;  3O4N A;  4CJ7 A;  4A5A A;  3V1O A;  3KVG A;  3SJH A;  4F3T A;  1Z05 A;  2PBD A;  3LDN A;  1REV A;  3U4L A;  1K8K B;  3SPZ A;  2OAN A;  2HBM A;  4J2A A;  4FLV A;  1CXU A;  5LY3 A;  1BOT O;  4AHS A;  2E1Y A;  3OYA A;  3TTF A;  1VK0 A;  2QWQ A;  3SUQ A;  3CJ7 A;  1QSY A;  2RPI A;  2FBV A;  3F5T A;  3U3G A;  3QEW A;  3FZH A;  3TAP A;  5BRF A;  5EXW A;  4CJR A;  1TYQ B;  4V19 S;  1HNW K;  3G4S N;  2OYQ A;  1HX1 A;  4JKH A;  3SK3 A;  3ZSO A;  2XO7 A;  5FRM A;  3SQ0 A;  4Z4G A;  4CBW A;  4O8U A;  4FJ9 A;  3MCA B;  1SKS A;  2A5X A;  2G8H A;  2PYL A;  1S1V A;  1Q82 O;  1TUY A;  5BRD A;  2H3G X;  3CCV N;  3RRG A;  3OBY A;  4CZK A;  3AVC A;  3DLR A;  3AO5 A;  1W0H A;  2NUB A;  3E9L A;  5JLH A;  4BWM A;  5C10 A;  1XI1 A;  3ZYY X;  2UUB K;  3M8S A;  1BCM A;  5I3U A;  4FLY A;  3G25 A;  3QIN A;  3I8D A;  3DMJ A;  2F9W A;  4EP4 A;  3KLE A;  4F3O A;  4FJJ A;  2P9I A;  5KQ8 A;  4WQ4 C;  3VOV A;  1VAZ A;  4DLG A;  1DT9 A;  3D2F B;  3WXK A;  3DRP A;  5AQW A;  5KGX A;  2YHX A;  5C12 A;  1NK5 A;  3ZSY A;  1JLE A;  3B8A X;  3CJC A;  1RT4 A;  2HVI A;  3PX4 A;  3UIQ A;  2P9S A;  3ENB A;  3SYZ A;  2OTL N;  1RBR A;  3T69 A;  2NNW A;  4WCE L;  1WSG A;  4CBX A;  1FW6 A;  1NGC A;  3AVA A;  2UXD K;  1RBT A;  4LFA K;  5EX5 A;  4CIG A;  1MU2 A;  2IS3 A;  5J2M A;  4IG3 A;  1RBU A;  4W5O A;  2RE2 A;  2QWO A;  3D2E A;  4FZY A;  1RTH A;  2JWK A;  4IKF A;  3LDO A;  2Y1J A;  1NG9 A;  3DYA A;  1G15 A;  3ZET A;  3ZX2 A;  4EAH D;  1SL1 A;  4CEA A;  4C23 A;  3P39 A;  2F4V K;  3H1Q A;  5AJ3 K;  2O8F B;  2IOC A;  3I56 N;  3WEE A;  4CEF A;  2GBZ A;  3OYE A;  1T7P A;  2HST A;  2F8T A;  3AAP A;  4DF4 A;  2GWK A;  4O0I A;  1VQ7 N;  2P5O A;  3ATU A;  1NGI A;  4LFB K;  2E8A A;  4AIL C;  3G10 A;  3VA0 A;  1M90 O;  2PYJ A;  3LZJ A;  4FWN A;  1WSI A;  4HUE A;  1JL2 A;  2IDO A;  4NLB A;  2QEX N;  1GLF O;  3I33 A;  4CJF A;  2B6A A;  4LH5 A;  2ZGY A;  3HST B;  1BA0 A;  1TKX A;  1IKV A;  1XNQ K;  3BGR A;  5AZJ B;  3SMS A;  4M3Y A;  3VGM A;  1YHQ N;  1NOZ A;  3O9Q A;  3TSP A;  2YKM A;  4KI6 A;  2NLX A;  3MX2 A;  2E2P A;  5ADX H;  4H0O A;  1HNX K;  3CFO A;  4W5T A;  3VQ6 A;  3HT3 A;  3JSM A;  4CI6 A;  4QS9 A;  4N76 A;  4DR5 K;  4IJA A;  4DFK A;  3ZSV A;  2QWR A;  1MA9 B;  3LZI A;  3S3O A;  4DCH A;  3K58 A;  3CCE N;  4W5R A;  3MEC A;  1CZA N;  3VQP A;  3MEG A;  4EZ6 A;  1NLV A;  3HPH A;  4L8R B;  2QWL A;  4DS5 A;  3FFI A;  1XNR K;  1X9M A;  4FM2 A;  1X1P A;  3ASM A;  1Y64 A;  3S41 A;  3SUO A;  1EXQ A;  5FRO A;  4LF5 K;  4H5R A;  2F8S A;  2DPN A;  4ZTJ A;  1TKT A;  4KH4 A;  2OZS A;  3CME N;  3TWH A;  3PX0 A;  5BR9 A;  1JCG A;  3SZ2 A;  3H08 A;  1WBD A;  4Z4E A;  4O4G A;  4BVO A;  1KAZ A;  5BR8 K;  1IBK K;  4CCH A;  1OH6 A;  2Z1G A;  3QBX A;  3EEQ A;  1BA1 A;  3CQX A;  1KLN A;  3CC4 N;  4FK2 A;  3O80 A;  3L2Q A;  1L5U A;  3VTI A;  1HKG A;  3HBT A;  4KHQ A;  4OKK A;  3RWU A;  3IUC A;  4KH5 A;  3VGK A;  4PQU A;  1Q9X A;  1NJI O;  1P8Z A;  5JVG L;  3QFP A;  2D4W A;  3AVI A;  2ASM A;  2D1K A;  3CPW M;  3TAF A;  5GAG P;  3R1X A;  2W41 A;  2Q31 A;  4KTW A;  2CH6 A;  1XHZ A;  2KW4 A;  3NFA A;  2NZT A;  4I9L A;  1KQS M;  1J54 A;  1ZYQ A;  4HCB A;  2VG7 A;  1R59 O;  3UKR B;  4KHU A;  4LF8 K;  2PZS A;  2Q1N A;  5AQH A;  1TL1 A;  1LCU A;  4CK2 A;  4AHU A;  4LF6 K;  1QQO A;  1E4F T;  1V4S A;  3VGL A;  3K5M A;  1S1T A;  4DR1 K;  3BY5 A;  3ZX3 A;  3V81 A;  2O8E B;  1ZBI A;  4CHY A;  4QAG A;  1ATN A;  3AVB A;  4FWM A;  4I9Q A;  1ZBF A;  3SI6 A;  4DR6 K;  1VSM A;  2UU9 K;  1DTT A;  4XIU A;  4XH5 A;  1S9G A;  2W42 A;  2ITG A;  3AGK A;  3CI5 A;  4B9T A;  1NGA A;  1QQM A;  2YJF A;  3KK2 A;  1JXE A;  4F8R A;  1KLM A;  2VCP A;  3PUF A;  4W5N A;  1LWC A;  1WLJ A;  3KKS A;  3VES A;  2E2N A;  1C0T A;  3U9Z A;  1HNI A;  4NCG A;  5AQP A;  4DS4 A;  4CF8 A;  4Q5V A;  3DOK A;  1LAW A;  3L2R A;  1QZ5 A;  3RTV A;  3HRG A;  3THX B;  3FZK A;  4BQL A;  4X66 K;  5HL7 L;  3A0I X;  3L6Q A;  1X3M A;  1NGB A;  3VEW A;  1GLA G;  3MED A;  3SQ1 A;  2O8D A;  4FOI A;  4XEI A;  3FLC O;  3GOI A;  4PL7 A;  3MXJ A;  4B3R K;  1YJW N;  3BZC A;  4GKJ K;  1C0F A;  1EET A;  2I5J A;  5AQG A;  1YAG A;  4EP5 A;  3NAE A;  3OW2 M;  2FBT A;  4KHP K;  3QFU A;  3MAQ A;  2QXF A;  4TSX A;  3MEE A;  2IAJ A;  4B8C A;  3KTQ A;  4DSL A;  3DM2 A;  1QHA A;  1K8K A;  4DQS A;  4J2D A;  3K5L A;  4DSI A;  4DQQ A;  3OBW A;  4FK4 A;  4LH4 A;  3VMF B;  3HVR A;  4YOV A;  2HHH K;  4R5P A;  4NB4 A;  5EY4 A;  3AV9 A;  3AVN A;  4B9N A;  1BO5 O;  2E20 A;  4F2R A;  3NH1 A;  1C0U A;  4I6M A;  3KD5 E;  4CIE A;  4PA1 A;  2EX3 A;  5GIN A;  2A40 A;  4C1N K;  4FSV A;  3EZW A;  4JNE A;  4MQ3 A;  1CZ9 A;  4JRQ A;  5LMU K;  1T05 A;  1S1X A;  4JKB A;  4DTJ A;  1QVG M;  4FO0 A;  5M1O A;  3ZSW A;  1NBW A;  5LMN K;  2UXC K;  1NK4 A;  4B9S A;  1TL3 A;  3LWL A;  2OPP A;  3IMX A;  4BDZ A;  1HNV A;  2HHX A;  2YNF A;  3CJA A;  4CGI A;  3LDS A;  3LP0 A;  4OVL A;  3KD1 E;  3SAG A;  4DR4 K;  3IDH A;  1KSP A;  5AQY A;  2E6L A;  3VER A;  4GY2 B;  2GTD A;  2D0B A;  1J53 A;  3C94 A;  3P1G A;  4CJT A;  3T1A A;  3J81 O;  1CXQ A;  3SPY A;  1J9A A;  1VQ4 N;  3O4Q A;  3FZF A;  2A1S A;  2KKZ A;  4DV1 K;  4FJM A;  2E2O A;  3THY A;  3CQY A;  3QB0 A;  4PHT X;  5AQV A;  1WBB A;  5DK5 A;  5HRS A;  3T19 A;  1B92 A;  1MWM A;  1BIU A;  3LPU A;  1K9M O;  2GUP A;  4GNI A;  3CCR N;  3WNF A;  4PY5 A;  3LDL A;  2YCH A;  5AR0 A;  4CZE A;  4O0J A;  4JEP A;  5SZT A;  2XY7 A;  1HJO A;  3L3U A;  4B9Q A;  1X3N A;  2OPR A;  1C1B A;  4ELU A;  3RRH A;  3SBG A;  1GOB A;  3DRS A;  2NRZ A;  4I2P A;  5C2D A;  1L3U A;  3TR8 A;  3DOL A;  2I7P A;  5KTQ A;  1CLQ A;  1KAY A;  2NRH A;  2HND A;  4Z4C A;  5JMV A;  3WXJ A;  4FLW A;  5FPM A;  2PY5 A;  4KB1 A;  4BRQ A;  3QET A;  1HR0 K;  2X78 A;  1NM1 A;  4IXC A;  2WFB A;  4JI0 K;  3ZSR A;  3K0S A;  3WNE A;  4BRE A;  1X9S A;  3EO3 A;  3AVL A;  4FPA A;  1S6Q A;  3DXM B;  1G99 A;  1KD1 O;  4JRP A;  4FJX A;  1IO2 A;  1WSF A;  3MMV A;  3TI0 A;  2BGG A;  2P9L A;  4M42 A;  1RT5 A;  5D3G A;  3E9O A;  4H5T A;  3CG7 A;  1J5E K;  1WB9 A;  3LAL A;  2HHW A;  3NGY A;  3VEX A;  4KTQ A;  1VQ8 N;  2HW3 A;  1JCF A;  1YJ9 N;  5AZJ A;  3HO1 A;  3HL8 A;  4JI3 K;  5TKY A;  4DMN A;  3SJJ A;  1W2B M;  4CEE A;  3OTO K;  2RN2 A;  3DI6 A;  4MDB A;  3LL3 A;  4PWD A;  4H5W A;  3QIP A;  4YOR A;  1YVN A;  5H1S Q;  3R6M A;  3HZ6 A;  4HHT A;  4GVM A;  4M3U A;  4MLH A;  1HQE A;  4A61 A;  4JKG A;  4WFB L;  3M8Q A;  2BDP A;  1UWB A;  5GAE P;  4MDA A;  2JLE A;  3Q7C A;  1A5X A;  4FWO A;  3B6O A;  1N6Q A;  2WC9 A;  4BC4 A;  3KLF A;  1NJX A;  4Z4F A;  3M5R A;  4DV5 K;  4NO7 A;  3CCQ N;  3EN9 A;  2RF2 A;  1I94 K;  3ULD A;  3N4Q A;  3QNN A;  3DXK B;  1QSL A;  3SV4 A;  3ZT4 A;  4E7K A;  3SNN A;  3BF1 A;  3MX5 A;  2WUS A;  4CEQ A;  2ZJP L;  4JHD B;  1YXQ A;  3DLG A;  4RW6 A;  4A2B A;  3AAQ A;  4OJR A;  3VQQ A;  3WNG A;  2KFN A;  1T8E A;  1GLD G;  4CK3 A;  1VRT A;  4QS8 A;  4KHS A;  4OLB A;  1N5Y A;  1XWL A;  3O4W A;  1VQK N;  2NRT A;  1K73 O;  3RR7 A;  4CZL A;  1U49 A;  1VSF A;  2X74 A;  4WQ5 C;  2ZJR L;  1RGI A;  2HF4 A;  3T7Z A;  1KTQ A;  1C0M A;  3ZSX A;  4H5V A;  4FPB A;  4M41 A;  1C0G A;  2Q0U A;  4M45 A;  3AVJ A;  4N56 A;  1WAF A;  3Q7B A;  4NXN K;  4FVM A;  1OKJ A;  2BH1 A;  2O8C B;  3ZT0 A;  1UA1 A;  5A2Q O;  3PO5 A;  1NMN A;  2CH5 A;  3CET A;  3HP6 A;  3NDK A;  3O3F A;  3WXM B;  1YUW A;  4BRN A;  3UKR A;  4M7X A;  4FWS A;  3CJ1 A;  4E3S A;  3NGI A;  1NK7 A;  2E5L K;  1BGX T;  5AFU A;  2QW9 A;  1VSE A;  3CXC M;  3C7N B;  3ZT2 A;  3AGR A;  4HVJ A;  1VQO N;  3K2P A;  1OH7 A;  5CHI A;  3THW B;  1N34 K;  5AQT A;  3M6G A;  4K0K K;  3AA5 X;  2BE2 A;  3THV A;  2D5R A;  1Z6R A;  5LL6 Z;  3VQ8 A;  2XY8 A;  1RT3 A;  3I8B A;  3WQT A;  1GOA A;  3H6E A;  3DWL A;  3QML A;  1IG8 A;  4CED A;  4H0V B;  5JS1 A;  2YNH A;  3M8R A;  3MXM A;  3ULE A;  4CGJ A;  3OYD A;  3L2W A;  3LAN A;  4AH9 A;  1S1W A;  1TAQ A;  2P9U B;  4Z4I A;  2KHO A;  3VQ5 A;  4YDU C;  3CQ8 A;  3UB5 A;  2DFF A;  1GLJ O;  3EE8 A;  1KCF A;  1WOQ A;  2F7T A;  3H1V X;  4BGB A;  4CJ3 A;  3ZLJ A;  4B1W B;  5I42 A;  2AP1 A;  2VG5 A;  4PKI A;  3K9K A;  4NLC A;  4HTU A;  5KI6 A;  4B1U B;  4ELT A;  4Y1D A;  1M1K O;  4FJI A;  3LP1 A;  4Y1C A;  1B9D A;  4JI4 K;  5AZI B;  5LJV A;  3B6P A;  3OJS A;  2UUC K;  5AQM A;  4LSL A;  4FLZ A;  4WE1 A;  4BC3 A;  4JKE A;  2V52 B;  5AQZ A;  2G8W A;  1J6Z A;  4DQP A;  4KB0 A;  3WUH A;  3RSE B;  1D4X A;  3AVH A;  4DV6 K;  3ZT3 A;  2VWB A;  3QEV A;  1BHL A;  2VG6 A;  4ILJ A;  4CD3 A;  3FZL A;  3TPQ A;  3CYM A;  1BI4 A;  4BY9 C;  5KPZ A;  1L3V A;  4IFE A;  2GWJ A;  3ZSZ A;  4K41 A;  1I39 A;  2EHG A;  1BCO A;  4JN4 A;  4EHU A;  2F96 A;  1RTI A;  2VWJ A;  1WAJ A;  2G8V A;  4NXM K;  3NGZ A;  3FR0 A;  3HOT A;  1RCH A;  4CK1 A;  5FDL A;  2HB5 A;  4KRE A;  3CCM N;  4WYB A;  2Q97 A;  5F1X A;  3OJU A;  3V9S A;  3OYF A;  5DMR A;  5IT9 O;  4Q0B A;  1NKE A;  4WF9 L;  1TK8 A;  4DTR A;  4NYF A;  1EQY A;  1TKZ A;  4BRP A;  1RTD A;  1VSL A;  5HRO A;  1LWE A;  3BF3 A;  3C0B A;  3DRR A;  3VQC A;  2KFZ A;  3NF6 A;  2VYP A;  5BPL A;  4M7Y A;  1NWK A;  2KQ2 A;  3V9U A;  4JV5 K;  1LW2 A;  2A42 A;  3O6W A;  2G8U A;  4HUG A;  4CVN E;  4AHV A;  4B1Z A;  2O8B A;  1CZB A;  3MN7 A;  4IDK A;  4DQR A;  3HYF A;  4GVE A;  1NGH A;  3RMB A;  3O08 A;  4M3T A;  3U9D A;  4HCC A;  4K42 A;  4BRM A;  4DHY A;  3BEX A;  3WT0 A;  4CGG A;  3CJ9 A;  4ELV A;  2FXU A;  4A57 A;  2QWN A;  3NH2 A;  2VGN A;  4Z0U A;  1EX4 A;  4PL8 A;  3J7A P;  4JI5 K;  2YHA A;  1SQK A;  4JK8 A;  5F2R A;  4W5Q A;  4EZ9 A;  4BDP A;  1VSK A;  2ATQ A;  5HP1 A;  1EKE A;  4DTP A;  5DM6 L;  1QQC A;  4DFJ A;  1EP4 A;  3HJF A;  5M1F A;  1NKC A;  1BL3 A;  4B08 A;  4UY8 O;  4IEI A;  1WUA A;  1SZ2 A;  4N5S A;  3V9Z A;  2F9T A;  3C65 A;  4M63 C;  4JD2 B;  2R7Y A;  1ZBS A;  3U3Y A;  4DFM A;  1U47 A;  4BRK A;  4JI8 K;  1IH7 A;  5HOO A;  4CZJ A;  4FL9 A;  1QSS A;  3CC2 N;  3DLL L;  1KVC A;  1XUP O;  3OYJ A;  1D8Y A;  4CJ4 A;  3OHR A;  4IOC L;  4OKE A;  1IG9 A;  2GUI A;  3AO2 A;  4FVU A;  4LC9 B;  2P9P B;  4H03 B;  3P83 D;  4F9O A;  1Q7Y O;  3V9X A;  2VWK A;  3GDQ A;  3FGU A;  4CJQ A;  2NRV A;  3OYN A;  3E01 A;  3VQ4 A;  4ICL A;  5I9E B;  4RCH A;  1KRP A;  3CCL N;  3VQD A;  1IKY A;  4CEO A;  3VEO A;  3MDQ A;  1K6Y A;  4FJ7 A;  1S9E A;  4FWR A;  2P9I B;  4K25 A;  3OYM A;  4ID1 A;  4BR4 A;  1P90 A;  2CGL A;  4DTS A;  4DR2 K;  4B9U A;  4DKW A;  4OPA A;  1U2V A;  3WXL A;  2QWP A;  1DGK N;  4FWL A;  3H3N O;  3OYL A;  3CM5 A;  4NYN A;  5E84 A;  5DM7 L;  1QVF M;  1QHT A;  4RG8 A;  2YHB A;  1JLB A;  2P9S B;  3M3Z A;  4BRH A;  4OPJ A;  3H46 O;  4IDH A;  5HLF A;  1KVB A;  4FWK A;  5BRH A;  3DAW A;  3K5N A;  1S1U A;  3EE9 A;  1HRH A;  1D9F A;  1S22 A;  4CFB A;  4DV2 K;  4BR0 A;  4FOE A;  4IG0 A;  4HUF A;  4FXD A;  5EOY A;  1N8R O;  3TAM A;  2QK9 A;  3SMP A;  1N36 K;  3CFR A;  2ASP A;  3HVT A;  5JLF A;  5GAD P;  5CE3 A;  2YKN A;  4YOW A;  4BRC A;  5HRN A;  5FLX O;  4LSN A;  3HTV A;  1IKX A;  3ZSQ A;  3ZET B;  4FJL A;  1B9F A;  2Z1I A;  3G71 N;  1BDG A;  2AJQ A;  3J8A A;  2P9N B;  1U6Z A;  3O9U A;  4IFV A;  3WEE B;  2PFU A;  1D9D A;  3AY9 A;  3C6U A;  2VQF K;  4DU4 A;  3C6H A;  4K43 A;  1IJJ A;  3AVG A;  3F9M A;  3JXU A;  2KTQ A;  4JHD A;  2FSJ A;  1QE1 A;  4YNQ A;  2P1J A;  1RTJ A;  3MWP A;  1UA0 A;  4DTU A;  2P9K B;  5CZ2 A;  1OH5 A;  4BRG A;  1A5V A;  2WOM A;  5TKW A;  4BR2 A;  1TYQ A;  2D0O A;  2IGI A;  1EWQ A;  2FF3 B;  3O3H A;  4BE2 A;  3TAG A;  3HXM A;  2YNG A;  1D5A A;  2G8I A;  3IKM A;  3I0R A;  3MCP A;  4DG1 A;  5MLC Q;  1BUP A;  4B3M K;  5C0Y A;  3S3N A;  1O13 A;  3PX6 A;  4O5F A;  3G6E N;  5AQN A;  4BRL A;  3O1B A;  4E0D A;  1NGD A;  3QBW A;  1FK9 A;  3N4P A;  1IV0 A;  4CF0 A;  4B3T K;  1FXX A;  4IWV A;  3TAQ A;  3HSC A;  1T6C A;  4FWQ A;  3ENH A;  4IOX A;  3OYH A;  1JLQ A;  1LW0 A;  2GEM A;  3LM2 A;  2ZQB A;  5FPN A;  4O5B A;  3ZEU B;  4GKK K;  4B9L A;  4C1N I;  4MO4 A;  5AQS A;  4ZTF A;  2Q36 A;  2W6L A;  4MLE A;  4E1N A;  4OPK A;  3FZM A;  1W7A A;  3C7N A;  3S3M A;  4FZZ A;  3R9P A;  1VRU A;  5E26 A;  3MN9 A;  4BG8 A;  4BQZ A;  3EKU A;  1ZBU A;  3D2F A;  3CHW A;  4BE1 A;  2V7Y A;  4LF7 K;  1RIL A;  4MO5 A;  1RDB A;  3OYG A;  2HMP A;  1BIZ A;  4YOX A;  4A59 A;  3HPO A;  4G1Q A;  1L3S A;  1HKC A;  3RVC A;  4FZX C;  2OZM A;  4C8N A;  1N32 K;  2WBN A;  3W0L A;  2I7N A;  4IOA L;  2FSK A;  3D7E O;  4DTM A;  4A2A A;  1JKH A;  3LAK A;  4CF9 A;  1HPM A;  3JAM O;  3OS0 A;  1VSH A;  4CFC A;  3D45 A;  3L4Q A;  2IVP A;  2D0P A;  4NCB A;  4I2Q A;  2ZM6 K;  4DSK A;  1SL2 A;  5ELZ A;  3S9H A;  3O8M A;  1TV6 A;  2KZZ A;  5KRT A;  4YY3 K;  1OH8 A;  3DLB A;  3C95 A;  1ZBH A;  4BWJ A;  4NCA A;  2Y1I A;  1ILY A;  3KK1 A;  1MWK A;  1RDD A;  4CZG A;  1DKG D;  1JXB A;  3HM9 A;  2A1R A;  1RDW X;  4FYD A;  4K8X A;  1E4G T;  2B4J A;  2Q0R A;  4DLE A;  4YOU A;  2O4I A;  2O8F A;  3SBT A;  3M1F A;  4U7B A;  3PIP L;  4JS5 A;  3KZB A;  3PSI A;  3RMC A;  2FSN A;  3BDP A;  1I3A A;  3AVF A;  3CCS N;  2YNI A;  3V4I A;  3ID6 A;  4FM0 A;  4JKF A;  4FJH A;  1JLA A;  2HBJ A;  2CGJ A;  3LP2 A;  5J2N A;  3TTD A;  1JJ2 M;  1JLF A;  3DLE A;  3QES A;  2HOE A;  4JI1 K;  5KRS A;  3LM9 A;  5AQR A;  2QI2 A;  4DR3 K;  4B1X B;  4B9V A;  3SQ4 A;  1HPZ A;  1C1A A;  1XMO K;  4X62 K;  2BTF A;  3OYI A;  2DTU A;  1DLO A;  3E9P A;  3GG4 A;  1BWF O;  3HOS A;  4WQ4 A;  1SS6 A;  2YI1 A;  3EYZ A;  3C6T A;  5AQU A;  5C25 A;  2E4L A;  3HP9 A;  3SUN A;  3OS2 A;  3PO4 A;  3J7Y P;  1NKB A;  3AO1 A;  4DTX A;  2IVN A;  3JS6 A;  3KLG A;  4GV3 A;  4BC2 A;  2OTJ N;  4BRF A;  3CCU N;  3OYK A;  4J2B A;  3IG1 A;  4A62 A;  3C6A A;  4HTL A;  3LWM A;  4DQI A;  4DTO A;  4OO1 J;  2E6M A;  5AQK A;  1ZBL A;  5J2Q A;  4RW8 A;  5LJW A;  2W6K A;  4QCL A;  1U04 A;  5M1P A;  2EWS A;  4RW9 A;  2A41 A;  2Q2R A;  4FJK A;  1WNS A;  1FKP A;  2O8D B;  3R8E A;  3KK7 A;  1UOC A;  4KH6 A;  1GLL O;  3MN6 A;  5M1K A;  1DEJ A;  1S5J A;  3O5B A;  4H0Y B;  2ZE2 A;  2YHW A;  3LDQ A;  3DLK A;  5KGW A;  2E88 A;  4DV4 K;  5BN8 A;  3T1Y K;  3VF2 A;  1NMD A;  3CIP A;  1NJZ A;  3K9J A;  3SUP A;  3FFK B;  4IEE A;  4A5B A;  5HBM A;  5J1E A;  1RFQ A;  3H45 C;  1JL1 A;  4LY7 A;  3NCI A;  1NGF A;  4M3Z A;  3QO9 A;  1H1V A;  1QS4 A;  5CY4 A;  1KFD A;  5CYM A;  1XMQ K;  5M1N A;  4E1M A;  4F4K A;  3KKR A;  3CMA N;  1HLU A;  3WNH A;  1JLG A;  3TAN A;  3F2K A;  1BIS A;  3F9K A;  3ATV A;  4BRI A;  4CJE A;  4I6M B;  4KHY A;  2QM1 A;  4KI4 A;  1KVA A;  3W3D A;  4AM7 A;  4CEZ A;  4R79 A;  2Z1J A;  3VQA A;  2HNY A;  5BN9 A;  2DFE A;  4DSJ A;  3LP3 A;  3TAE A;  2QKK A;  1IBM K;  5K14 A;  4JD2 A;  3KLI A;  2FLO A;  4CJV A;  3WXI A;  5AQF A;  3TTC A;  4OKJ A;  3VF6 A;  3LAM A;  4F2S A;  4DSF A;  4DQ8 A;  3K57 A;  3NH0 A;  4PKH A;  3P5J A;  4JK7 A;  1RDC A;  4ZHR A;  3NE6 A;  5GIO A;  1Z26 A;  4CJP A;  1W9H A;  4CGD A;  4E7L A;  2P9P A;  1U45 A;  1JLC A;  1HMV A;  3UKU B;  4FW2 A;  4DV0 K;  2UYT A;  4IO8 A;  2O8E A;  4PKG A;  2UXB K;  4DU1 A;  3E66 A;  3IS9 A;  4OGE A;  2DY4 A;  4X65 K;  3V1Q A;  3PSF A;  4KO0 A;  3VQE A;  1X9J A;  1WSH A;  1U4B A;  2KLA A;  2QKB A;  1T3V A;  1TAU A;  2WTU A;  1BG3 A;  4UQG A;  3AA2 A;  3KJV A;  2XHB A;  3A5M C;  3V6D A;  3L0Q A;  1L3T A;  3CCJ N;  2CGK A;  2Z1H A;  4JI6 K;  2YJE A;  4C8M A;  2D0A A;  4B8A B;  4YOY A;  4H8K A;  3THY B;  4RW4 A;  4CFA A;  3PIO L;  5CYQ A;  1QTM A;  4M3X A;  4GMJ B;  3IRX A;  1S72 N;  3THX A;  4C8L A;  2XY6 A;  1R0A A;  2VGM A;  1WSJ A;  5AFU H;  1YIJ N;  1RDU A;  2FBX A;  1WSE A;  1EO1 A;  3RMA A;  1VQM N;  5J2P A;  3NF7 A;  3M8P A;  3K5O A;  3QIC A;  1HKB A;  1LAV A;  1TK0 A;  1X9W A;  1YTA A;  4O44 A;  1Q86 O;  4OGC A;  4B9M A;  4JK9 A;  3EL2 A;  3E1Y A;  4CF2 A;  4DSE A;  1V4T A;  3AO4 A;  4BRO A;  2V7Z A;  4AHT A;  5ADX A;  5FRN A;  5JS2 A;  4JS4 A;  4FK0 A;  4CEC A;  5KPR A;  3SAH A;  1OVQ A;  1VSJ A;  2P9N A;  3H3O B;  1ESV A;  1YVU A;  4CIF A;  1E3M A;  4H5N A;  3RMD A;  3F73 A;  1HUX A;  2GX9 A;  2HVH A;  2YX6 A;  1VSD A;  2GV9 A;  3OY9 A;  5B8H A;  3OS1 A;  3KLH A;  2P9K A;  4C8O A;  2IIR A;  1ASV A;  3JYT A;  3DLH A;  2P9L B;  5FPE A;  4DTN A;  1SL0 A;  2B5J A;  3P31 A;  1VHX A;  3A8Y A;  3VF4 A;  4YHH K;  3NF9 A;  4IFY A;  1U48 A;  4DB3 A;  4CF1 A;  1F21 A;  3UE5 A;  4J2E A;  4CZI A;  1NGG A;  1RT1 A;  4DF8 A;  4AQY K;  1N33 K;  3L3V A;  5BPN A;  1ASU A;  1NU0 A;  4KRF A;  4GW6 A;  3NMU A;  1IKW A;  3L4I A;  4RW7 A;  4CFD A;  4GV9 A;  4AHC A;  2IVO A;  3TAB A;  1KAX A;  4MFB A;  4KBO A;  3CJB A;  2KZM A;  4BR5 A;  3TU5 A;  1FKO A;  4E1J A;  5JVH L;  2NRR A;  1QZ6 A;  4LD0 A;  3QEI A;  3CF5 L;  4FW1 A;  4JKG B;  1XQS C;  4FLX A;  5AQO A;  4KHN A;  3PLA A;  3ZEU A;  4AHR A;  3TSQ A;  4X64 K;  1T44 A;  1GOC A;  5E41 A;  1HNZ K;  4ILG B;  3QER A;  4HWI A;  3AAR A;  4ILH A;  2XY5 A;  3HM8 A;  4Z94 A;  1LOT B;  4BRD A;  2G8F A;  4BRA A;  3IAY A;  4C8K A;  3HK2 A;  1FJG K;  2A6A A;  4KV8 A;  4EHT A;  2FF6 A;  3NVM A;  2JGU A;  4CBU A;  2QA4 N;  1TK5 A;  3QLH A;  1YIT N;  2P51 A;  4DU3 A;  2HF3 A;  4CD1 A;  5F0X A;  1NGE A;  4LFC K;  1RDA A;  3NHG A;  4E7H A;  3LPT A;  1J5O A;  1HYS A;  3VN5 A;  4CJL A;  4CE9 A;  4BE0 A;  3CER A;  1RNH A;  1LV5 A;  4KKO A;  1EWR A;  2FC0 A;  2GEL A;  3A2F A;  5GAH P;  5GIP A;  2HHV A;  3SLC A;  1ITG A;  4KHW A;  2ZJQ L;  3KHY A;  4J8F A;  2RHK A;  1YJN N;  1ZXO A;  1TKD A;  1VSI A;  1NNE A;  1S6P A;  2E2Q A;  3CFP A;  2ZF5 O;  4DV7 K;  1YI2 N;  3OYC A;  5FPD A;  3VEN A;  4K8Z A;  3KWG A;  3SAF A;  3KWI A;  3ZX0 A;  3U8X A;  2WON A;  3OYB A;  4IJN A;  1HQU A;  4I7F A;  2V51 B;  2X6N A;  1BQN A;  4O55 A;  4B1Y B;  3DXM A;  5AQX A;  1Q8I A;  2ASO A;  3BZK A;  4QOZ B;  4JYA K;  4G9Z A;  4B3S K;  1ATS A;  2QWM A;  3EY1 A;  2QTD A;  5M1Q A;  2ZGZ A;  5AQL A;  2HHU A;  4H0P A;  3CPE A;  3GBT A;  2J4R A;  3O9R A;  4BC5 A;  5T7B A;  2PAV A;  2ITM A;  4DV3 K;  3DJC A;  5EU7 A;  1NGJ A;  4FJG A;  3VQ7 A;  5C24 A;  4IBN A;  4BR7 A;  4H0X B;  3ULE B;  3SCX A;  1NJW A;  4DFP A;  3TSU A;  5KQD A;  2HHS A;  4CGF A;  4FLU A;  3P4I A;  1QQN A;  4U67 L;  3I0S A;  1TGO A;  3BP8 A;  4ISF A;  4RTF D;  3ZT1 A;  4BG9 A;  4JKD A;  3CM6 A;  4FM1 A;  3D2E B;  3OA9 A;  3NVK A;  4CES A;  4CJW A;  3HPG A;  1T03 A;  4FJN A;  4M3R A;  3I55 N;  1UAX A;  4CJU A;  2HNZ A;  4KPY A;  3EZ5 A;  2P5G A;  2DFH A;  3KK3 A;  4B3O A;  3DXK A;  3L2U A;  1NOY A;  3ZCM A;  2E1Z A;  1XHX A;  4E7J A;  2YHY A;  1VQ5 N;  4LF4 K;  3L2V A;  2ZWH A;  4DUZ K;  3ISN C;  1VQN N;  4BAC A;  1VQP N;  4CHN A;  3T1H K;  1NK8 A;  1XC9 A;  1BI4 B;  4CGH A;  1ASW A;  5C2F A;  3A5N C;  2OPS A;  1RBV A;  3ITH A;  4BR9 A;  2VQE K;  4CZF A;  2NRW A;  4FLT A;  4B1V A;  1A5W A;  3IFR A;  4ID5 A;  5JIC A;  3O9S A;  4CZM A;  4FCY A;  4FWP A;  2IC3 A;  1Y97 A;  4BGA A;  5AQQ A;  1KXP A;  3CC7 N;  4YOT A;  1O1W A;  3VEZ A;  3AVM A;  2Q3S A;  3QNO A;  1VQ6 N;  3QEX A;  5HRR A;  2O8C A;  3MWT A;  3J7Z O;  1RT7 A;  3A5L C;  4RWT A;  3QIO A;  1GLE G;  3K59 A;  2HHQ A;  1K8A O;  1YTU A;  3O1W A;  2OCE A;  3LDP A;  3ENO A;  3KIO A;  4DUY K;  1SUQ A;  3BUZ B;  4DWI A;  2QXL A;  1ATR A;  3P38 A;  4O8K A;  4JI2 K;  3EKS A;  4M3W A;  4YFU A;  5C15 A;  3UKU A;  4E19 A;  3THW A;  5C42 A;  2ETJ A;  2HBK A;  4CJS A;  3D6R A;  4OX9 K;  5IWA K;  1OVY A;  4PUO A;  5CZ1 A;  2YV0 X;  2HBL A;  4FJ5 A;  4OLA A;  4CJ5 A;  2O8B B;  3A5O C;  3AA3 A;  4XH4 A;  3V9W A;  3T3F A;  1KFS A;  1SKR A;  1XC3 A;  3SQ2 A;  3FE1 A;  3CD6 N;  4CHO A;  1YF5 L;  3VA3 A;  3MXI A;  1NJY A;  2P9U A;  4IZ9 A;  1BQM A;  3J80 O;  5HRP A;  4KFB A;  5CR4 A;  2NRX A;  4JKA A;  1RT6 A;  1WN7 A;  3O9T A;  3GL1 A;  3VEY A;  3TAR A;  2OA8 A;  3VET A;  4CZH A;  4DR7 K;  4QS7 A;  1Q18 A;  1KC8 O;  3GE1 A;  4EFH A;  3AA4 A;  4ISE A;  1VQ9 N;  4WQ5 A;  1Q9Y A;  1TUU A;  3L8B A;  4KAZ A;  4E89 A;  4H4O A;  5AZI A;  2FBY A;  4AM6 A;  1HYV A;  2X6S A;  1Z25 A;  4IO9 L;  1IBL K;  3PV8 A;  4JI7 K;  4EIA A;  4L3Q A;  3RSE A;  2W40 A;  3NBP A;  1TVR A;  1NK0 A;  1HJR A;  4ISG A;  1NK9 A;  2BAN A;  3RR8 A;  3V1R A;  4CEB A;  2UUA K;  1C6V A;  5SWM A;  3AVK A;  1SV5 A;  2RKI A;  4BDY A;  4FJ8 A;  4CHQ A;  5KPT A;  1MDU B;  1S3X A;  1C1C A;  1NK6 A;  3R3L A;  2D0C A;  4WFN L;  5BRE A;  3MK6 A;  4BVP A;  2XRI A;  1VQL N;  2HMI A;  4CW7 B;  3AO3 A;  1GLC G;  2AA4 A;  3HI0 A;  3MN5 A;  3VEV A;  2A3Z A;  2BUP A;  4CER A;  3D0P A;  5BPM A;  3QDK A;  4Z4H A;  3G0Z A;  2ZD1 A;  1JCE A;  4JKC A;  4WFA L;  1U2V B;  5EVZ A;  3WQU A;  3U6F A;  3VPZ A;  1SAZ A;  4H4M A;  4YDU A;  4LF9 K;  1LWF A;  1BU6 O;  4N41 A;  4CHZ A;  4JAX A;  1YT3 A;  3SV3 A; 
#chains in the Genus database with same CATH homology
 1SKW A;  4DTJ A;  2FBX A;  4DFM A;  1U47 A;  2HHT A;  1WSE A;  3RMA A;  1IH7 A;  3ZSW A;  3O3G A;  5J2P A;  3NF7 A;  3M8P A;  1RT2 A;  3K5O A;  4CJK A;  2G8K A;  1NK4 A;  1LAV A;  1HYZ A;  1QSS A;  3OVN A;  1KVC A;  4KTZ A;  1TL3 A;  3OYJ A;  3QEP A;  4B9S A;  3ALY A;  3LWL A;  1YTA A;  2OPP A;  1X9W A;  1TK0 A;  1D8Y A;  4CJ4 A;  4E7I A;  4BDZ A;  4N47 A;  2OPQ A;  1HNV A;  4OKE A;  2HHX A;  4O44 A;  3PY8 A;  2YNF A;  1RBS A;  1IG9 A;  4OGC A;  2GUI A;  3AO2 A;  4CGI A;  3LDS A;  3LP0 A;  4OVL A;  4JLH A;  4B9M A;  3KD1 E;  3P83 D;  2LSN A;  1HYS A;  3V9X A;  2VWK A;  4CHP A;  4CF2 A;  4DSE A;  3AO4 A;  1KSP A;  3VQ9 A;  4AHT A;  4CJQ A;  5FRN A;  3NF8 A;  1DTQ A;  5JS2 A;  4JS4 A;  3VQB A;  2E6L A;  4FK0 A;  3OYN A;  3E01 A;  4CEC A;  3VQ4 A;  4ICL A;  2D0B A;  1J53 A;  1VSJ A;  2O4G A;  3C94 A;  3P1G A;  3O4N A;  3T1A A;  4CJT A;  1KRP A;  1CXQ A;  3SPY A;  3V1O A;  1J9A A;  1YVU A;  4CIF A;  4F3T A;  3O4Q A;  3VQD A;  1IKY A;  1REV A;  4CEO A;  3RMD A;  3SPZ A;  3F73 A;  2A1S A;  1K6Y A;  4FJ7 A;  4J2A A;  4FJM A;  2HVH A;  1S9E A;  4FLV A;  1CXU A;  1VSD A;  2GV9 A;  3OY9 A;  4AHS A;  3OYM A;  3OS1 A;  4ID1 A;  3OYA A;  3KLH A;  4DTS A;  4B9U A;  4C8O A;  5DK5 A;  5HRS A;  1ASV A;  1VK0 A;  3T19 A;  1B92 A;  3LPU A;  1BIU A;  3JYT A;  3SUQ A;  1QSY A;  3DLH A;  1SL0 A;  4DTN A;  2RPI A;  2B5J A;  2FBV A;  3WNF A;  3OYL A;  3CM5 A;  3U3G A;  3NF9 A;  4PY5 A;  4IFY A;  4NYN A;  1U48 A;  4CF1 A;  1F21 A;  1QHT A;  3QEW A;  4RG8 A;  3TAP A;  4J2E A;  4CJR A;  2YHB A;  4O0J A;  1JLB A;  1RT1 A;  5SZT A;  4DF8 A;  2OYQ A;  2XY7 A;  3L3U A;  4OPJ A;  3ZSO A;  2XO7 A;  3L3V A;  5HLF A;  5FRM A;  2OPR A;  3SQ0 A;  1C1B A;  1KVB A;  4Z4G A;  4FJ9 A;  4ELU A;  1ASU A;  4KRF A;  4GW6 A;  3K5N A;  1S1U A;  1IKW A;  1HRH A;  4RW7 A;  4CFD A;  3RRH A;  1SKS A;  4AHC A;  1D9F A;  1GOB A;  2G8H A;  4CFB A;  3DRS A;  3TAB A;  4IG0 A;  4MFB A;  4HUF A;  4FXD A;  2PYL A;  2KZM A;  1S1V A;  4I2P A;  1FKO A;  3TAM A;  2QK9 A;  1L3U A;  3TR8 A;  3DOL A;  3CFR A;  3HVT A;  5KTQ A;  3RRG A;  1CLQ A;  4LD0 A;  3QEI A;  2HND A;  3AVC A;  3DLR A;  4Z4C A;  2YKN A;  4FW1 A;  3AO5 A;  1W0H A;  4FLW A;  2NUB A;  4FLX A;  2PY5 A;  4KHN A;  5HRN A;  4KB1 A;  4AHR A;  4LSN A;  1IKX A;  3ZSQ A;  4BWM A;  3QET A;  1XI1 A;  4FJL A;  1GOC A;  1B9F A;  2X78 A;  5E41 A;  2Z1I A;  3M8S A;  1BCM A;  3QER A;  5I3U A;  3ZSR A;  4FLY A;  2AJQ A;  3QIN A;  3WNE A;  1X9S A;  2XY5 A;  4IFV A;  3I8D A;  1D9D A;  3DMJ A;  3C6U A;  3AVL A;  4EP4 A;  3KLE A;  2G8F A;  4DU4 A;  4F3O A;  4FJJ A;  1S6Q A;  4DLG A;  4JRP A;  3IAY A;  4C8K A;  3HK2 A;  4FJX A;  3AVG A;  1IO2 A;  2KTQ A;  1WSF A;  3TI0 A;  1QE1 A;  2BGG A;  3DRP A;  4KV8 A;  4YNQ A;  2P1J A;  1RTJ A;  5KGX A;  4M42 A;  1UA0 A;  1NK5 A;  1RT5 A;  4DTU A;  2JGU A;  5CZ2 A;  5D3G A;  3ZSY A;  3CG7 A;  1TK5 A;  1JLE A;  1A5V A;  3LAL A;  2WOM A;  3NGY A;  3QLH A;  2P51 A;  2HHW A;  4KTQ A;  4DU3 A;  1RT4 A;  2HVI A;  2HW3 A;  3PX4 A;  3UIQ A;  3HO1 A;  2IGI A;  3HL8 A;  3SYZ A;  4DMN A;  3SJJ A;  1RBR A;  1RDA A;  4CEE A;  3NHG A;  4E7H A;  3O3H A;  1WSG A;  2RN2 A;  3DI6 A;  3LPT A;  3VN5 A;  4CJL A;  4CE9 A;  4BE2 A;  4BE0 A;  3TAG A;  1J5O A;  3HXM A;  2YNG A;  4PWD A;  1D5A A;  2G8I A;  3I0R A;  3AVA A;  1RNH A;  4DG1 A;  3QIP A;  1RBT A;  1LV5 A;  4KKO A;  3S3N A;  2FC0 A;  3A2F A;  4CIG A;  3PX6 A;  4HHT A;  1MU2 A;  4GVM A;  2IS3 A;  4E0D A;  5J2M A;  4M3U A;  2HHV A;  4IG3 A;  1ITG A;  1RBU A;  4W5O A;  4KHW A;  1TKD A;  1VSI A;  1HQE A;  1S6P A;  4FZY A;  1RTH A;  1FK9 A;  3CFP A;  4CF0 A;  1FXX A;  4IKF A;  3TAQ A;  2Y1J A;  3M8Q A;  3OYC A;  1UWB A;  2BDP A;  3DYA A;  2JLE A;  1G15 A;  1A5X A;  4K8Z A;  3B6O A;  1N6Q A;  3OYH A;  1JLQ A;  1LW0 A;  1SL1 A;  4CEA A;  2ZQB A;  3KLF A;  1NJX A;  4Z4F A;  4O5B A;  2WON A;  4B9L A;  2IOC A;  3OYB A;  4ZTF A;  1HQU A;  4CEF A;  4I7F A;  2GBZ A;  3OYE A;  2RF2 A;  1T7P A;  2X6N A;  1BQN A;  4O55 A;  4E1N A;  4OPK A;  3ULD A;  2F8T A;  3QNN A;  3S3M A;  1Q8I A;  4DF4 A;  4FZZ A;  1QSL A;  3SV4 A;  3ZT4 A;  4QOZ B;  1VRU A;  4E7K A;  4O0I A;  3SNN A;  1ZBU A;  4BE1 A;  2P5O A;  3EY1 A;  1RIL A;  4AIL C;  1RDB A;  3G10 A;  3VA0 A;  3OYG A;  2PYJ A;  2HHU A;  4CEQ A;  3LZJ A;  1BIZ A;  3HPO A;  1WSI A;  4G1Q A;  1JL2 A;  4HUE A;  1L3S A;  2IDO A;  4RW6 A;  3DLG A;  4FZX C;  4OJR A;  3VQQ A;  3WNG A;  4CJF A;  5T7B A;  1T8E A;  2KFN A;  2OZM A;  5EU7 A;  4CK3 A;  4C8N A;  2B6A A;  1VRT A;  4LH5 A;  4FJG A;  4KHS A;  3VQ7 A;  4OLB A;  1N5Y A;  1XWL A;  3HST B;  1TKX A;  5C24 A;  1IKV A;  4IBN A;  3RR7 A;  4DTM A;  1U49 A;  3SCX A;  1JKH A;  1NJW A;  1VSF A;  2X74 A;  3BGR A;  4DFP A;  3LAK A;  4M3Y A;  4CF9 A;  1NOZ A;  1KTQ A;  1C0M A;  3ZSX A;  2HHS A;  3OS0 A;  4CGF A;  4FLU A;  1VSH A;  2YKM A;  4M41 A;  4CFC A;  3D45 A;  4KI6 A;  4M45 A;  3I0S A;  1TGO A;  4NCB A;  3AVJ A;  3CFO A;  4I2Q A;  4W5T A;  4DSK A;  1SL2 A;  3VQ6 A;  3S9H A;  1TV6 A;  4N56 A;  3HT3 A;  2KZZ A;  3JSM A;  1WAF A;  5KRT A;  4FVM A;  3C95 A;  3DLB A;  4N76 A;  1ZBH A;  4BWJ A;  3ZT1 A;  4NCA A;  4DFK A;  3ZT0 A;  3ZSV A;  2Y1I A;  1UA1 A;  3CM6 A;  3LZI A;  3KK1 A;  3S3O A;  3K58 A;  4FM1 A;  3PO5 A;  3HP6 A;  1RDD A;  4W5R A;  3MEC A;  3VQP A;  3NDK A;  1JXB A;  3O3F A;  3MEG A;  3HM9 A;  4CES A;  3HPH A;  3HPG A;  4CJW A;  2A1R A;  1T03 A;  4EZ6 A;  4M3R A;  4DS5 A;  4K8X A;  4L8R B;  4FJN A;  4FYD A;  2B4J A;  4DLE A;  3FFI A;  2O4I A;  1X9M A;  4FM2 A;  1X1P A;  1UAX A;  3ASM A;  4CJU A;  4E3S A;  2HNZ A;  4KPY A;  3NGI A;  3EZ5 A;  2P5G A;  4JS5 A;  1NK7 A;  2DFH A;  3KK3 A;  3RMC A;  3BDP A;  4B3O A;  3L2U A;  1NOY A;  1I3A A;  3SUO A;  1EXQ A;  3AVF A;  5FRO A;  2YNI A;  1BGX T;  3ZCM A;  1XHX A;  4E7J A;  3V4I A;  4FM0 A;  4FJH A;  1JLA A;  2F8S A;  3L2V A;  1VSE A;  4ZTJ A;  3ZT2 A;  4HVJ A;  1TKT A;  2OZS A;  3ISN C;  3K2P A;  3LP2 A;  5J2N A;  3TWH A;  3PX0 A;  4BAC A;  4CHN A;  1JLF A;  3DLE A;  3AA5 X;  3QES A;  2BE2 A;  5KRS A;  3SZ2 A;  3THV A;  2D5R A;  3VQ8 A;  4B9V A;  2XY8 A;  1RT3 A;  3H08 A;  4Z4E A;  1NK8 A;  4O4G A;  3SQ4 A;  1XC9 A;  1BI4 B;  1HPZ A;  1C1A A;  4CGH A;  1ASW A;  4CCH A;  2Z1G A;  3OYI A;  2DTU A;  1GOA A;  1DLO A;  2OPS A;  4CED A;  1RBV A;  3ITH A;  5JS1 A;  2YNH A;  1KLN A;  3M8R A;  3MXM A;  4CGJ A;  3OYD A;  4FLT A;  3L2Q A;  1L5U A;  4FK2 A;  1A5W A;  3L2W A;  4ID5 A;  3LAN A;  3EYZ A;  3C6T A;  4KHQ A;  4AH9 A;  1S1W A;  1TAQ A;  5C25 A;  2E4L A;  4OKK A;  4Z4I A;  3VQ5 A;  3HP9 A;  3SUN A;  3OS2 A;  3RWU A;  3CQ8 A;  3PO4 A;  1NKB A;  4FCY A;  2DFF A;  3AO1 A;  4DTX A;  2IC3 A;  1Y97 A;  4PQU A;  1KCF A;  3KLG A;  1Q9X A;  3OYK A;  4J2B A;  3IG1 A;  1O1W A;  3AVM A;  2Q3S A;  3QNO A;  3QEX A;  5HRR A;  4CJ3 A;  3AVI A;  5I42 A;  2VG5 A;  3TAF A;  1RT7 A;  3LWM A;  4DQI A;  4HTU A;  5KI6 A;  4DTO A;  3QIO A;  4ELT A;  3K59 A;  2HHQ A;  1YTU A;  2E6M A;  4Y1D A;  1ZBL A;  5J2Q A;  4RW8 A;  4KTW A;  1XHZ A;  4FJI A;  3LP1 A;  4Y1C A;  1B9D A;  2KW4 A;  3NFA A;  3OJS A;  3B6P A;  4I9L A;  4QCL A;  4LSL A;  1U04 A;  3KIO A;  4FLZ A;  1J54 A;  1SUQ A;  1ZYQ A;  4RW9 A;  4DWI A;  4WE1 A;  2VG7 A;  4HCB A;  4FJK A;  1WNS A;  1FKP A;  2G8W A;  4KHU A;  2PZS A;  4DQP A;  4M3W A;  1TL1 A;  1UOC A;  4KB0 A;  4CK2 A;  4YFU A;  4AHU A;  3AVH A;  3ZT3 A;  1S5J A;  4E19 A;  2ZE2 A;  3QEV A;  5C42 A;  2ETJ A;  3DLK A;  4CJS A;  3K5M A;  1BHL A;  5KGW A;  2VG6 A;  4PUO A;  5CZ1 A;  2YV0 X;  4OLA A;  4FJ5 A;  4CJ5 A;  1S1T A;  3CYM A;  1BI4 A;  1NJZ A;  3SUP A;  3V81 A;  3AA3 A;  1L3V A;  1ZBI A;  3ZSZ A;  5HBM A;  4CHY A;  5J1E A;  3V9W A;  3T3F A;  1I39 A;  1JL1 A;  3AVB A;  4LY7 A;  4QAG A;  2EHG A;  3NCI A;  1BCO A;  1SKR A;  1KFS A;  3SQ2 A;  4M3Z A;  3QO9 A;  5CY4 A;  1QS4 A;  1RTI A;  2F96 A;  1ZBF A;  4CHO A;  4I9Q A;  1KFD A;  3SI6 A;  5CYM A;  2VWJ A;  3VA3 A;  1WAJ A;  1VSM A;  3MXI A;  1NJY A;  3NGZ A;  2G8V A;  4E1M A;  4F4K A;  1DTT A;  1BQM A;  3KKR A;  3WNH A;  4XIU A;  1JLG A;  5HRP A;  4KFB A;  3TAN A;  1S9G A;  2W42 A;  1BIS A;  2ITG A;  4B9T A;  1RCH A;  4CK1 A;  3KK2 A;  5FDL A;  1JXE A;  2HB5 A;  3F9K A;  4KRE A;  4F8R A;  1RT6 A;  1WN7 A;  2OA8 A;  1KLM A;  3PUF A;  3TAR A;  4W5N A;  1LWC A;  3V9S A;  3OJU A;  1WLJ A;  4CJE A;  5DMR A;  3KKS A;  3OYF A;  4KHY A;  1C0T A;  4Q0B A;  1NKE A;  4KI4 A;  1KVA A;  1TK8 A;  1HNI A;  4DTR A;  4NCG A;  4CEZ A;  4NYF A;  2Z1J A;  3AA4 A;  3VQA A;  4DS4 A;  1TKZ A;  2HNY A;  4CF8 A;  2DFE A;  3DOK A;  1VSL A;  1LAW A;  4Q5V A;  1RTD A;  5HRO A;  3L2R A;  3RTV A;  1Q9Y A;  4DSJ A;  3LP3 A;  3L8B A;  3TAE A;  2QKK A;  4KAZ A;  4E89 A;  4H4O A;  5K14 A;  2FBY A;  1LWE A;  3KLI A;  1HYV A;  3DRR A;  2X6S A;  4CJV A;  1Z25 A;  4OKJ A;  3VQC A;  2KFZ A;  3LAM A;  3PV8 A;  3NF6 A;  4DSF A;  4F2S A;  3K57 A;  3NH0 A;  3MED A;  3SQ1 A;  2KQ2 A;  3P5J A;  1RDC A;  3MXJ A;  4ZHR A;  3NBP A;  1TVR A;  3V9U A;  1NK0 A;  1HJR A;  3NE6 A;  1Z26 A;  1LW2 A;  4CJP A;  1NK9 A;  1W9H A;  2BAN A;  4CGD A;  2I5J A;  1EET A;  4HUG A;  4E7L A;  2G8U A;  3RR8 A;  4AHV A;  1U45 A;  1JLC A;  3V1R A;  4CEB A;  4EP5 A;  1HMV A;  3NAE A;  1CZB A;  2FBT A;  4FW2 A;  4IDK A;  4DQR A;  1C6V A;  3HYF A;  5SWM A;  4DU1 A;  3AVK A;  3RMB A;  3IS9 A;  3MAQ A;  4OGE A;  2DY4 A;  1SV5 A;  2RKI A;  4BDY A;  3V1Q A;  4FJ8 A;  4M3T A;  2QXF A;  4KO0 A;  3VQE A;  4TSX A;  1WSH A;  3MEE A;  4CHQ A;  1U4B A;  2IAJ A;  4HCC A;  4B8C A;  3KTQ A;  4DSL A;  3DM2 A;  2QKB A;  1TAU A;  1C1C A;  4DQS A;  1NK6 A;  4UQG A;  4J2D A;  3K5L A;  3AA2 A;  3KJV A;  4DQQ A;  2D0C A;  4DSI A;  2XHB A;  4FK4 A;  4LH4 A;  3HVR A;  3V6D A;  1L3T A;  2XRI A;  4CGG A;  2HMI A;  4R5P A;  2Z1H A;  3AV9 A;  3AVN A;  4C8M A;  4B9N A;  4ELV A;  2D0A A;  3NH2 A;  3AO3 A;  4B8A B;  4F2R A;  4Z0U A;  1EX4 A;  4H8K A;  3NH1 A;  1C0U A;  4CER A;  3KD5 E;  3D0P A;  4RW4 A;  2YHA A;  4CIE A;  4W5Q A;  4PA1 A;  4CFA A;  4Z4H A;  3G0Z A;  2EX3 A;  5CYQ A;  1VSK A;  4BDP A;  2ATQ A;  4EZ9 A;  2ZD1 A;  5HP1 A;  1EKE A;  1QTM A;  4M3X A;  4DTP A;  4GMJ B;  3IRX A;  1QQC A;  3U6F A;  4DFJ A;  4C8L A;  4MQ3 A;  1EP4 A;  2XY6 A;  3HJF A;  1R0A A;  1WSJ A;  4H4M A;  1NKC A;  1CZ9 A;  4JRQ A;  1BL3 A;  1LWF A;  4B08 A;  1T05 A;  4N5S A;  4N41 A;  1S1X A;  3V9Z A;  4CHZ A;  1YT3 A;  3SV3 A;  3U3Y A;  2R7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...