1A5VA

Asv integrase core domain with hiv-1 integrase inhibitor y3 and mn cation
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Structure of the catalytic domain of avian sarcoma virus integrase with a bound HIV-1 integrase-targeted inhibitor.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
molecule tags Hydrolase
total genus 51
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1a5vA00
4F2RA 5J2NA 5HROA 4LSNA 3ZSRA 4B9SA 4FJIA 4JS4A 1HQEA 4FJKA 3G10A 3QO9A 3SPYA 1JKHA 2DY4A 2GV9A 3AA2A 3SV3A 1NK8A 1BQNA 2R7YA 1T8EA 2F8TA 3OVNA 3RRHA 3U3YA 1S6PA 3SJJA 5FDLA 4PQUA 1O1WA 5HRRA 4H8KA 3VQQA 3SI6A 4TSXA 1RDDA 3DOKA 2KW4A 3K2PA 4CEOA 4FW2A 1L3TA 3MAQA 4FJ9A 1BI4B 1WSJA 2Z1GA 5J1EA 4EP5A 4FYDA 4NYFA 5KGWA 4CF1A 4KO0A 2D5RA 1L3UA 3NAEA 1SL0A 1HPZA 2IDOA 1VSDA 3AV9A 1ASWA 3DLEA 4LH5A 5T7BA 3OJSA 3ULDA 4Z4HA 4ELVA 1WSEA 4H4MA 4CFCA 1EKEA 3OYCA 1CXQA 1WAFA 4KTQA 3OYAA 2Y1JA 3AVMA 2D0AA 2E4LA 2ZE2A 4CHOA 3NDKA 2DFEA 1UA1A 3NCIA 2G8FA 3LP0A 2D0CA 3HVRA 1S1UA 4KV8A 3V9UA 2QK9A 4DQPA 2X78A 3NGIA 3OYFA 3HXMA 1ZBUA 1VSLA 3L8BA 1JLFA 5HRSA 4Y1CA 4JRPA 1NK7A 2AJQA 4LSLA 3MXIA 1IH7A 1RNHA 1JL2A 3CQ8A 4CHNA 1D8YA 3RMDA 2OPRA 4NYNA 4JLHA 1LWCA 1RCHA 2QXFA 1GOAA 4KHUA 3HO1A 4O0JA 1WSFA 3KD5E 1IG9A 1TVRA 3LZIA 2Z1JA 3VQ5A 3M8QA 1BHLA 3CM6A 3NH0A 3OYDA 3CFRA 4CGJA 4NCGA 5FRMA 3OYEA 3QIPA 3NF9A 3DRPA 3ZSOA 1RILA 2QKKA 1D9DA 2Q3SA 3THVA 2PY5A 4KB1A 1LV5A 5CY4A 4CEDA 2KFZA 1LW0A 3VQ8A 4Z0UA 4FK4A 4CK1A 2W42A 4OGCA 2HNDA 3P1GA 4C8OA 4RW6A 1RDBA 3CFPA 3RMCA 4DQQA 4M3XA 3PUFA 3AVNA 1C1BA 1N5YA 3MECA 3EYZA 3RTVA 4OLBA 3V1OA 4IG0A 4UQGA 4DTOA 1HMVA 3OS1A 3SQ1A 2FBYA 4DTXA 4W5NA 1RT5A 1IKXA 2KFNA 1QS4A 4DLEA 3RRGA 4O55A 2X6SA 4FZYA 4CHPA 1KLNA 1CZ9A 3MEDA 4AHTA 4HCBA 5KRSA 3O4NA 4DSJA 1FK9A 1LAVA 3VQ6A 5JS1A 1QHTA 4DTPA 4PY5A 4HTUA 5J2PA 4C8LA 2YHAA 4E7IA 4CJEA 4W5TA 1U47A 1NJXA 4EP4A 4F3OA 3P5JA 2G8VA 2P51A 1ASUA 1Z25A 3IRXA 4QOZB 1S1TA 2GUIA 1CLQA 4ELTA 3WNHA 4RW8A 2X6NA 1RTHA 4DTJA 4B9UA 2VWKA 3ISNC 4FLWA 2IOCA 1I3AA 4FLYA 4GMJB 3NF8A 3NF7A 2BE2A 1S1WA 1QQCA 1BI4A 4E89A 1S6QA 4O0IA 3K58A 3QEIA 5HLFA 4I7FA 4CJFA 1C1AA 3OYLA 3AVCA 4CEQA 3KLFA 3QERA 3AO1A 3QINA 4CJTA 3OY9A 4CFDA 4J2AA 3AA5X 3LP3A 3SQ2A 5CZ1A 4BE0A 1NOZA 1X9MA 3K59A 1HYZA 4Y1DA 3P83D 2XY8A 3KLIA 4KKOA 1VSHA 3M8SA 1XHZA 2E6LA 3ZSYA 1Q8IA 3SQ0A 1MU2A 1KVBA 1Q9XA 4I2PA 1JL1A 2NUBA 2RPIA 3H08A 3MEEA 1VK0A 5I3UA 1EX4A 1NKEA 1TKXA 3DYAA 3K5LA 4DQSA 1RTDA 4DSEA 1RBSA 4M3YA 2XHBA 2E6MA 3U3GA 2HVHA 4LY7A 5C25A 1EP4A 1WN7A 3IS9A 3OYBA 1HNVA 4ELUA 4M3RA 3TAGA 1VSJA 3QETA 4DSKA 4KPYA 4IKFA 3QEVA 2HHSA 1XC9A 1TKTA 2IS3A 1UAXA 4CHYA 4BE1A 4O5BA 2ZD1A 1QSYA 4M3UA 4Z4CA 5KI6A 1B9FA 1CXUA 3AVFA 4BDZA 4HUFA 3AO2A 5DK5A 1J54A 4CGHA 5K14A 4Q5VA 3SCXA 2P1JA 3L2VA 4BWJA 4E3SA 1TK0A 4KFBA 2G8WA 4C8NA 3OYKA 3NHGA 2HMIA 4M3ZA 5HRNA 4FVMA 4R5PA 3C6UA 3L2UA 4E7KA 3OYNA 2B6AA 4B08A 4JS5A 1U45A 3HPHA 3VQ9A 4BACA 3WNEA 3CG7A 3NF6A 1SKRA 4G1QA 1C0TA 1S1XA 4AH9A 4CEFA 3AVGA 4CF2A 2KTQA 1RDCA 3DLKA 4E7JA 1RT2A 4NCBA 4KHQA 2LSNA 2OPPA 2DFFA 3C95A 4OPJA 3M8RA 1TL1A 2OPQA 4JRQA 3S3MA 3VQAA 3DLBA 1JXEA 1YT3A 4PUOA 4CCHA 4BDPA 3QEWA 4QAGA 3SV4A 3A2FA 4KI4A 2BANA 4KREA 4CHZA 4CFAA 2RN2A 1NJZA 5D3GA 1SL1A 2HW3A 1NK9A 4FLXA 1NKCA 1QE1A 2YHBA 3E01A 1JLGA 3OYIA 3NH1A 2G8UA 2OZSA 1TGOA 3VA3A 1X1PA 2DFHA 3AVLA 2XY6A 3TANA 1NKBA 4E1MA 3VQ4A 1XI1A 3DLRA 4CK3A 3T19A 1XHXA 1RBRA 1HYSA 2ETJA 3M8PA 3ASMA 3DRSA 2OPSA 5KTQA 2KZMA 4B9TA 4IFVA 1ITGA 4DTSA 4KHNA 1RT3A 4CJQA 1J5OA 3NBPA 4CF0A 4FJXA 2Z1HA 3RWUA 3DOLA 4PWDA 4BWMA 1FKPA 4OKKA 3NGYA 3TAMA 3HP6A 5C24A 3LZJA 4CEEA 1WSGA 4O4GA 3F73A 4DWIA 3PO4A 4DU1A 4DSLA 1ZBHA 4F8RA 3HP9A 4B8AB 3K5MA 3QNNA 1ZBFA 1TKDA 4B9NA 3KJVA 4QCLA 3AO5A 3AVKA 3SYZA 4B3OA 3RR7A 3HT3A 3PX4A 1L5UA 2PZSA 2HVIA 4N76A 3O3GA 1NK4A 3SUQA 4YFUA 1SUQA 3S9HA 4HCCA 4M3WA 2OA8A 2HHTA 4W5QA 1S9GA 1YTUA 3OJUA 4FJ7A 2G8IA 5E41A 4E7LA 1A5VA 4DF4A 3QEPA 4FK2A 4XIUA 1W0HA 3VQCA 4KB0A 1KFDA 5EU7A 4CGGA 3AA3A 3KIOA 2VWJA 4F2SA 3ZT1A 3SPZA 4EZ9A 4AHUA 5KRTA 4CJVA 3AA4A 3KLHA 1U4BA 3AVBA 1A5XA 2FC0A 3TAEA 3ZSQA 2YKMA 3L2RA 4DQIA 1RTJA 5HBMA 4DU3A 3LDSA 5C42A 4L8RB 3PX0A 1JLCA 1KLMA 3CFOA 4PA1A 4AHCA 2ITGA 4CJRA 4CESA 1G15A 3B6OA 1NK6A 2OYQA 3PV8A 3LPUA 4OLAA 4FW1A 2XY5A 3CYMA 1KCFA 3WNFA 4CJ5A 3TAQA 1HJRA 4AHVA 3TABA 4CERA 4HVJA 1HYVA 4CJWA 4FM0A 1C6VA 3AO4A 2I5JA 3I0RA 4FM1A 1X9SA 4DG1A 4ZTFA 1D9FA 3UIQA 4J2DA 1B92A 4FLVA 4KRFA 1C0MA 1WNSA 1VSKA 3AVHA 4CECA 2VG6A 3K5OA 1EETA 2YNFA 4DF8A 4F4KA 4CF8A 3DMJA 1TK8A 1BISA 4CK2A 1J9AA 3HSTB 1R0AA 4FXDA 4M45A 3O3HA 1W9HA 3HK2A 1IKVA 1U48A 3ZT3A 3JYTA 1BQMA 2FBTA 3I0SA 4DTUA 4M3TA 4DFMA 1S5JA 1KSPA 1RBUA 4IFYA 4BE2A 4DSFA 3G0ZA 3PO5A 1REVA 4B9MA 1X9WA 1BGXT 1C1CA 1BIUA 2GBZA 3NFAA 3ZCMA 4KI6A 1YVUA 3DRRA 5SZTA 2PYLA 3FFIA 3C94A 3ZSXA 3O3FA 1S1VA 1VRUA 3C6TA 3TI0A 3S3OA 3HL8A 2HHUA 4EZ6A 4AILC 1CZBA 1RBTA 3DLGA 3VQEA 2Y1IA 2A1RA 4NCAA 2XY7A 3LAKA 2ZQBA 4GW6A 1D5AA 5CYQA 4HUGA 3D0PA 1UWBA 1UOCA 3SZ2A 3V81A 3NE6A 1RT1A 1L3VA 1KRPA 3L2QA 3KTQA 4O44A 2IC3A 4CGIA 3NH2A 3OYMA 3KK1A 1JXBA 5DMRA 3LWMA 4HUEA 3V9WA 3VA0A 1J53A 4E19A 2XO7A 3SNNA 4C8MA 1S9EA 4FLUA 1WSIA 1T05A 1KVCA 4DSIA 4CJLA 3HPGA 1JLQA 4RW4A 3I8DA 3MXJA 4KHYA 5HRPA 4CIFA 4N5SA 3OS0A 3KLGA 2JGUA 3L2WA 3ZT0A 3EY1A 2G8HA 3SUPA 1JLBA 3OS2A 4FK0A 4FJJA 1FXXA 3AVJA 1GOBA 4CJPA 4FLTA 4Q0BA 4FJGA 4BDYA 3AO3A 3T1AA 1NK0A 3KD1E 1NOYA 3KLEA 1WSHA 1KTQA 3BGRA 3VN5A 1SKSA 1IO2A 3MEGA 2P5GA 1BCOA 2DTUA 1DLOA 3ZT4A 3RR8A 1YTAA 3O4QA 2D0BA 4M41A 2A1SA 2JLEA 3PX6A 1WAJA 3KKSA 3QEXA 4CFBA 4CGDA 4CJ3A 1KVAA 1VSMA 3LANA 4DTNA 4N56A 4FJ8A 1LAWA 3QLHA 4E1NA 3K5NA 4I9QA 4OPKA 3DI6A 4KTZA 1U04A 2IGIA 1XWLA 3JSMA 2IAJA 3HVTA 1RBVA 4LH4A 4W5RA 1NK5A 1Q9YA 2HHXA 1TAUA 1IKWA 3LWLA 3NGZA 3TAFA 2KZZA 4DTRA 2QKBA 4RW9A 4DS5A 4CJ4A 4HHTA 5HP1A 4MFBA 3IAYA 4CJKA 4CHQA 5FRNA 5J2QA 4ZHRA 1NJWA 1Z26A 4IDKA 4CIEA 4DFKA 4AHSA 3AVIA 1I39A 2EX3A 3AVAA 3HYFA 3IG1A 1BIZA 2G8KA 3LP2A 4KTWA 1T03A 3V9XA 1HRHA 1BL3A 3EZ5A 1FKOA 3ZSVA 4B9LA 1TKZA 3D45A 1VSFA 4WE1A 4CJUA 2HHWA 4FCYA 2HB5A 1HNIA 4CJSA 3QESA 3S3NA 4DTMA 2Z1IA 1RT6A 2XRIA 5FROA 3V9SA 1NJYA 5JS2A 1RT7A 3ZSZA 5KGXA 4FJLA 3KK3A 2ATQA 3OYJA 2P5OA 1TL3A 3TWHA 3HPOA 1TV6A 3KK2A 3QNOA 4KHSA 1SL2A 2B5JA 2X74A 2BDPA 4C8KA 4B9VA 4Z4IA 4CIGA 1LW2A 3DLHA 5SWMA 4K8ZA 1U49A 1BCMA 5J2MA 2OZMA 1ZBIA 4IG3A 4CEBA 2O4IA 1ASVA 3MXMA 1DTTA 4CGFA 1JLAA 3OYGA 2VG7A 2YNIA 2RF2A 2HNYA 4Z4GA 4FZXC 4FJNA 3PY8A 4Z4FA 3LAMA 3BDPA 2O4GA 3CM5A 4KAZA 5I42A 4LD0A 3TAPA 4M42A 1LWEA 1GOCA 4ID1A 4CF9A 3HM9A 1WLJA 3SUNA 3ITHA 2F8SA 1VSIA 3V1RA 3V1QA 4I9LA 3K57A 1EXQA 4DS4A 1K6YA 4OJRA 4B8CA 1VSEA 2YNGA 3RMBA 3WNGA 4F3TA 2B4JA 3V4IA 1C0UA 4GVMA 4CE9A 1SKWA 5CZ2A 1L3SA 4OGEA 3LP1A 1SV5A 3V9ZA 4FJHA 4FM2A 1ZBLA 4CEAA 4W5OA 4J2EA 4OKJA 1KFSA 1LWFA 1QSSA 3HJFA 1F21A 3VQ7A 3VQBA 3LPTA 4I2QA 4RW7A 3TARA 4IBNA 2BGGA 2F96A 3L3UA 1IKYA 3T3FA 4OVLA 3RMAA 4N41A 4MQ3A 3DM2A 1TAQA 2HNZA 4CEZA 2PYJA 4KHWA 3V6DA 3ZT2A 1TK5A 1QTMA 1RDAA 4J2BA 2VG5A 4FLZA 1DTQA 1Y97A 4DQRA 4YNQA 4ID5A 1N6QA 4DFPA 4E0DA 2HHVA 2EHGA 3L3VA 4DFJA 2KQ2A 4AHRA 4E7HA 4ZTJA 2YV0X 4FJMA 2WOMA 3LALA 1UA0A 1B9DA 4Z4EA 1HQUA 3TR8A 3ZSWA 4H4OA 4FJ5A 1A5WA 2WONA 4N47A 1VRTA 2YNHA 2YKNA 3QIOA 1ZYQA 2HHQA 3VQPA 3F9KA 2RKIA 3SQ4A 1QSLA 3ALYA 3VQDA 3OYHA 1RT4A 2FBVA 3B6PA 3U6FA 4K8XA 4OKEA 4RG8A 1RTIA 2FBXA 4DU4A 3KKRA 4ICLA 5CYMA 3SUOA 1T7PA 1JLEA 4DLGA 4FZZA 4DMNA
chains in the Genus database with same CATH superfamily
5GADP 4DR7K 2KKZA 3W3DA 3G10A 3AA2A 5BRDA 1BQNA 3SJJA 3U3YA 3SJHA 5FDLA 3UKUA 1VQ9N 3CETA 2KW4A 3K2PA 1RFQA 1XQSC 1BI4B 2Z1GA 1OH5A 4XH1A 1NOYA 4Z4HA 4H4MA 3WXMB 5AFUA 1EKEA 1VQ8N 1WAFA 4KTQA 3WQTA 5HOOA 3A5NC 5M1NA 3NDKA 5BPMA 2DFEA 1VQ7N 3LP0A 4WFNL 1S1UA 3WUHA 5M1OA 3HXMA 1VSLA 3P31A 4O8UA 3IMXA 1IH7A 3CQ8A 4J8FA 1D8YA 3TU5A 4NYNA 1NWKA 5JICA 3HO1A 3CCLN 1Q82O 3KD5E 3TSQA 3M8QA 1BHLA 3CFRA 4ISEA 3QIPA 2QKKA 1D9DA 1K73O 1EWQA 3GDQA 4CEDA 3KZBA 4FK4A 2W42A 4OGCA 2HNDA 2E88A 4RW6A 3CFPA 1RDWX 3RMCA 4OO1J 2ZGZA 3RTVA 4OLBA 4IG0A 4U67L 3OS1A 1S22A 1NGHA 4H5RA 2FSKA 4CHPA 3O9UA 4HCBA 4JI5K 4DR6K 3O4NA 4CZGA 2P9SA 1NBWA 1QHTA 3P38A 4HTUA 4QS8A 4C8LA 4H5VA 4E7IA 5BPNA 1U47A 1ASUA 4NXNK 1CLQA 2GUIA 4ELTA 4DTJA 3ISNC 3DXMB 4FLWA 1I3AA 4FLYA 4GMJB 3NF8A 4FWKA 4WF9L 4H5WA 1HKCA 4CEQA 3AA5X 3SQ2A 1NOZA 1XNQK 4Y1DA 1XHZA 1VSHA 3ZSYA 1Q8IA 4X65K 1Q9XA 4MLEA 3Q7BA 4I2PA 4WFAL 2RPIA 1RTDA 3LDQA 5AQUA 4DQSA 3L6QA 3K5LA 1YI2N 2E2PA 4M3YA 4FWRA 3C7NB 3ZEUB 1S72N 3PSIA 3TAGA 3DJCA 3QETA 4KPYA 3MWTA 5EVZA 2DPNA 3H1QA 4CHYA 3LM2A 2ZD1A 4O5BA 5E26A 1QSYA 1B9FA 1CXUA 3D2FB 2P9UA 5DK5A 2YHYA 5C2FA 4E3SA 3NHGA 2HMIA 5HRNA 3TSUA 3L2UA 3OYNA 4JS5A 3HPHA 4UY8O 2ZM6K 4PKIA 3O80A 4CZFA 4G1QA 1C0TA 4AH9A 4CZJA 3SBTA 1BG3A 1RDCA 4KHQA 2QI2A 3C95A 4OPJA 2DFFA 3M8RA 4JRQA 3VQAA 1JXEA 4PUOA 4CCHA 3QEWA 1Q86O 2VQEK 4KREA 4CHZA 1NKCA 3BZKA 1QE1A 1JLGA 2G8UA 3TANA 4E1MA 3VQ4A 5M1PA 2P9IB 5AQNA 1BA0A 3BY5A 2A41A 3DRSA 2KZMA 4L3QA 1IBMK 4B9TA 4CZEA 4DTSA 2D1KA 4DV6K 4FJXA 4BGAA 4OKKA 3HP6A 3LZJA 2P9PA 1YUWA 4DR4K 1BU6O 2WBNA 5MLCQ 3BZCA 3F73A 4DWIA 4DSLA 4IXCA 3K5MA 4B8AB 1S3XA 3SYZA 4FWLA 4JKBA 4BRIA 3RR7A 3HT3A 3L4IA 4N76A 1OH8A 1SUQA 2D0PA 2P9NA 4BRCA 2GTDA 2HHTA 3OJUA 2G8IA 3HOSA 1P90A 1A5VA 5IWAK 4CZMA 3TTCA 3QEPA 3DWLA 1VQNN 3E66A 3SK3A 4FWMA 1U4BA 3AVBA 3ENHA 2UUBK 2YX6A 5A2QO 3N4QA 4CESA 5FPEA 4FOIA 4B3TK 1DKGD 1QQMA 3MCPA 4CBUA 3WNFA 3JXUA 3TAQA 3VF4A 1IJJA 4CJWA 1C6VA 4FM1A 3UIQA 1VSKA 1HNXK 3VEVA 4CECA 3K5OA 3WT0A 3GG4A 2YNFA 1P8ZA 4DR2K 4DF8A 1EWRA 5AQSA 2HBMA 4CK2A 2F7TA 1IKVA 3JYTA 1BQMA 4DTUA 3PO5A 3ZCMA 1BIUA 2GX9A 4KI6A 1HKGA 5SZTA 4FOEA 3OTOK 4FSVA 2WTUA 4U7BA 1VQMN 3LDPA 4K42A 3O3FA 1VRUA 3ZETB 3R9PA 3LAKA 3SZ2A 1RT1A 4CBXA 1YAGA 1T3VA 4CD1A 1U2VA 4IO8A 4CGIA 5DMRA 2OCEA 4B1WB 2XO7A 4C8MA 1S9EA 1OH7A 4DSIA 2P9SB 1JLQA 3M1FA 3MXJA 4KHYA 5HRPA 4N5SA 3KLGA 2JGUA 2G8HA 1JLBA 3LM9A 2QWMA 2VCPA 4IJAA 2JWLA 2QWOA 2OTLN 1C0GA 1NU0A 1J6ZA 1SKSA 3MEGA 3UB5A 2VGMA 2D0OA 3ZT4A 1YTAA 3O4QA 3PX6A 3TSPA 4YOXA 4KH5A 4JK8A 4YORA 1V4SA 3LANA 4FJ8A 3QLHA 2FSNA 3K5NA 3HOTA 1K9MO 2IGIA 4JI8K 4AM7A 2IAJA 4W5RA 4LH4A 2HBKA 4X62K 1TAUA 2KLAA 3LWLA 2KZZA 4IDHA 5AZIA 4RW9A 4DS5A 4FWQA 5AJ3K 4HHTA 3CC7N 3THWA 2O8DA 3AY9A 3DXKA 1Z26A 2G8KA 1T03A 2W6KA 3QFPA 1BA1A 3D7EO 3EZ5A 4MO5A 5FPMA 3ZSVA 1TKZA 1VSFA 3WXIA 5FROA 4F9OA 3H3NO 3Q7CA 4B3MK 2NLXA 2BDPA 4Z4IA 2O4IA 4CEBA 1ASVA 2VG7A 4Z4GA 4FJNA 2E5LK 2A3ZA 2O4GA 4PKGA 4LD0A 3TAPA 4M42A 4WQ5A 5EOYA 4B3SK 1C0FA 1MWKA 3V1QA 4I9LA 4JHDA 1EXQA 3K57A 4DS4A 4OJRA 4B8CA 1VSEA 3WNGA 4F3TA 4GVMA 1SKWA 4A2AA 4JI6K 2O8CA 4BRAA 4FJHA 4XH5A 4OKJA 1F21A 5LJVA 4JKEA 4I2QA 5DM6L 4IBNA 1BUPA 1NMNA 4N41A 1R59O 4OVLA 3LDOA 1TAQA 1VQ4N 5C12A 3V6DA 1RDAA 4J2BA 5AQTA 1DTQA 1Y97A 4DQRA 4YNQA 4E0DA 1N6QA 3WXLA 3VEZA 2KQ2A 1NM1A 2YV0X 2WOMA 5DM7L 3TR8A 4N47A 3FR0A 3ALYA 4IOCL 1YITN 1NGIA 2FBXA 4FPBA 3KKRA 2QWLA 1NGAA 4PHTX 4H0OA 2A5XA 5JVHL 3QO9A 2DY4A 1HUXA 3ZX0A 1NK8A 2R7YA 3MN9A 2A6AA 3OW2M 1O1WA 1W7AA 1LCUA 3EE9A 4JK7A 1ZBSA 1RDDA 3DOKA 4CEOA 2ZJRL 3MAQA 4H0XB 4FJ9A 1V4TA 4LH5A 5AZJB 3AV9A 2RE2A 3ULDA 4ELVA 1WSEA 4BR9A 4CFCA 2H3GX 3OYCA 4IJNA 4FVUA 2QWNA 3OYAA 2D0AA 2E4LA 4CHOA 1NG9A 1NGDA 1UA1A 3J81O 1ILYA 4KV8A 4YOYA 3OYFA 1ZBUA 3L8BA 1ATRA 1N36K 1RNHA 3L0QA 4GV3A 3RMDA 4XH4A 2ZJQL 2OPRA 4JLHA 1LWCA 2QXFA 4O0JA 4A5AA 1M1KO 4H03B 3D2EA 2Z1JA 3LZIA 3NH0A 3C6AA 3OYDA 2P9LA 4NCGA 5FRMA 3OYEA 5M1FA 1RILA 5M1KA 3WXKA 3THVA 4KB1A 2KFZA 4Z0UA 4BQLA 4CK1A 3O5BA 1U2VB 4C8OA 1OVQA 4M3XA 3MECA 3IUCA 5LJWA 1IKXA 2V7YA 1YHQN 3THXB 3T69A 4FZYA 4EHUA 4AHTA 5KRSA 3O4WA 1LAVA 4BG9A 2YHAA 3QDKA 1QZ5A 4A59A 1NJXA 4DV4K 4F3OA 1FJGK 1QQOA 2G8VA 1Z25A 2BUPA 3O8MA 1GLLO 1ATSA 1ESVA 3HTVA 2VWKA 5AQKA 2WFBA 2IOCA 3A5MC 3I8BA 3NF7A 4E89A 3CCJN 1S6QA 3QEIA 1N34K 2D4WA 5KPTA 3AO1A 3QINA 1XUPO 3SAHA 3K59A 1HR0K 1HYZA 3P83D 3BF3A 5AFUH 5AZIB 3AAQA 1WUAA 5AQQA 1NKEA 1JL1A 3A0IX 3DXKB 3MEEA 1VK0A 4DSEA 1RBSA 4B1XB 3U3GA 2CGJA 4LY7A 5C25A 1EP4A 3OYBA 2GELA 5F1XA 5KPZA 4M3RA 2V51B 3PIPL 1VSJA 2QXLA 4IKFA 1XC9A 2E2OA 5EY4A 4M3UA 5KI6A 1HX1A 5IT9O 4Q5VA 3SCXA 2P1JA 3L2VA 1TK0A 4HWIA 1XNRK 4M3ZA 4YDUA 4FVMA 3C6UA 4BACA 5AQMA 3CG7A 3J7YP 3CCVN 4CEFA 2NRTA 4BRFA 4CF2A 2UXBK 2PZSA 3SMSA 3DLBA 1YJ9N 1TL1A 2QWRA 4NLBA 4BDPA 2W6LA 3SV4A 1QVFM 3F2KA 5D3GA 1SL1A 3EKSA 3E9LA 2O8CB 3E01A 2HF3A 2HF4A 3OYIA 4Z94A 3NH1A 2OZSA 3VA3A 2DFHA 3AVLA 2XY6A 2RHKA 4CZHA 3T19A 2YJFA 2OPSA 5AQRA 5KTQA 3T1HK 4IOAL 4DKWA 1NGJA 1J5OA 3RWUA 3R6MA 4PWDA 4BWMA 4YY3K 4G9ZA 1K8KB 3ID6A 5BR8K 2QW9A 1ZBHA 2CH6A 4K41A 3CCSN 3RSEB 3QNNA 1DEJA 3U8XA 1TKDA 4CZKA 3KJVA 4B3OA 2PFUA 4IZ9A 1NJIO 1NK4A 4YFUA 1XMOK 2ZGYA 1S9GA 4LF8K 5I9EB 2WC9A 3WXJA 4DF4A 4YOVA 4JD2B 1W0HA 1QHAA 5BPLA 1KFDA 4CGGA 3KIOA 2IVNA 2VWJA 4F2SA 3SPZA 2YJEA 4AHUA 3AA4A 3KLHA 2UUAK 1A5XA 2E1YA 3ZSQA 4DQIA 3WEEA 1RTJA 3LDSA 5C42A 4BVPA 4PA1A 2ITGA 4K43A 2ITMA 3G4SN 1G15A 4BRQA 4FW1A 2P9KA 3CYMA 4A5BA 4CJ5A 3R1XA 4AHVA 2NNWA 3THYA 1HYVA 5JVGL 4FM0A 2AP1A 1X9SA 4DG1A 4ZTFA 4KRFA 1JCFA 2O8EB 1C0MA 4WQ4C 2OANA 2OTJN 3KWIA 2BH1A 1W2BM 4YOWA 4CF8A 5KQ8A 1R0AA 1J9AA 4FWOA 4BR4A 1M90O 4JNEA 2UXDK 4YDUC 3SLCA 1RBUA 1E4FT 4IFYA 4B9MA 1BGXT 3DRRA 2PYLA 4OPHA 2Q2RA 1TYQB 3K9KA 3G71N 3FFIA 4LF5K 4BC3A 3TI0A 4EZ6A 4AILC 1CZBA 5FLXO 3VQEA 2A1RA 1ZXOA 4NCAA 5BN8A 5AR0A 1DGKN 2KHOA 1D5AA 3D0PA 5LMUK 1UOCA 3JAMO 3F5TA 4O8KA 4O44A 3C0BA 3HI0A 3LWMA 4GKKK 4GV6A 3CC4N 3VA0A 2O8BA 4FLUA 1WSIA 4FO0A 1KVCA 4QS9A 2J4RA 3FE1A 3CERA 2Q0RA 2F9TA 3TTFA 3L2WA 3EY1A 3ZT0A 3GOIA 2UXCK 5AQHA 3VENA 3CJAA 4FJJA 2YCHA 1SAZA 4FJGA 4RWTA 3T1AA 1O13A 4PL7A 1YJWN 1WSHA 3BGRA 3VN5A 1IO2A 2DTUA 1DLOA 3PSFA 4M41A 2A1SA 2JWKA 3KKSA 1MA9B 3QEXA 4CGDA 1KVAA 1VSMA 1VHXA 4DTNA 4N56A 1LAWA 4I9QA 3L4QA 4OPKA 4KTZA 3CCMN 1XWLA 1RBVA 1NK5A 1Q9YA 3VPZA 2HHXA 4BQZA 4BRMA 3NGZA 4DTRA 2QKBA 3ULEA 1VQON 4CJ4A 5HP1A 4MFBA 3FZKA 1MWMA 2F9WA 1IBKK 4CHQA 2EX3A 3AVAA 4DV5K 2VGNA 2AA4A 1HRHA 2HHWA 3MCAB 5AQVA 3PIOL 3V9SA 1RT7A 5KGXA 3UKUB 3KK3A 3CQXA 5KPRA 4JKHA 1X3MA 3HPOA 3QNOA 2ASOA 1SL2A 2B5JA 2X74A 3MWPA 3DLHA 2FLOA 4K8ZA 1U49A 3FZFA 3OBYA 3MXMA 1Q81O 2RF2A 5LL6Z 2YHWA 3CM5A 2NRRA 5I42A 5FPNA 3SUNA 3ITHA 1VSIA 3H1VX 5LMNK 2YNGA 2B4JA 4QS7A 3V4IA 2HMPA 2ASPA 1L3SA 4OGEA 1GLBG 2HBLA 1SV5A 1RGIA 4JI7K 1KFSA 2FSJA 1BWFO 3TARA 2BGGA 2Q31A 4OX9K 2F96A 3L3UA 4BROA 3RMAA 1KAYA 2VWBA 3DM2A 3CJ7A 3CI5A 3H3OB 2VG5A 5AQFA 4GNIA 3H46O 3CF5L 4ID5A 4MLHA 3T1YK 4B3RK 2HHVA 2EHGA 3ATVA 3LDNA 4AHRA 4E7HA 3LALA 5AQYA 4Z4EA 1HQUA 3ZSWA 4FJ5A 2IVPA 3QIOA 3SAGA 2E2QA 1FW6A 4CW7B 3BEXA 1QSLA 4BR2A 1N33K 2FBVA 3U6FA 1ZC6A 4NXMK 3P4IA 4JN4A 3SUOA 4ICLA 1SZ2A 3C6HA 4F2RA 2HHHK 5J2NA 5HROA 4JS4A 1HQEA 3SBGA 1GLCG 3RRHA 1S6PA 4H8KA 3SI6A 3CCRN 4FW2A 4EP5A 4BR5A 4NYFA 4JI1K 4CF1A 1L3UA 3NAEA 1XC3A 2IDOA 4FPAA 3OJSA 3ZYYX 3CJBA 3J80O 5AQJA 3AVMA 2ZE2A 3HM8A 3G25A 3NCIA 4A2BA 4M63C 2QK9A 3J7AP 4DQPA 1H1VA 3NGIA 2BTFA 5HRSA 4Y1CA 4JRPA 3MXIA 3AARA 1JL2A 4JV5K 1WSFA 1W97L 3O1WA 4B1UB 1IG9A 4EFHA 2P9UB 4ISFA 4CGJA 4IO9L 3NF9A 3DRPA 3ZSOA 5BRHA 2Q3SA 4RTFD 2PY5A 1LV5A 5CY4A 4KBOA 1RDBA 1OH6A 3O08A 3B8AX 1NGCA 4BR7A 2V52B 3KVGA 3EYZA 3V1OA 4UQGA 3R3LA 4IWVA 3SQ1A 2FBYA 3TTDA 4E1JA 1QS4A 4DLEA 2KFNA 4O55A 1Y64A 2Q97A 4GVEA 3VQ6A 4DTPA 4CJEA 2NRVA 3P5JA 4QOZB 2GWKA 1S1TA 3T7ZA 3WNHA 1RTHA 4BG8A 4B9UA 5JLFA 4NO7A 3VEOA 1QQCA 1BI4A 2OA8A 4O0IA 3EEQA 3K58A 5HLFA 3O9TA 3QERA 2P9PB 4OPAA 4CJTA 3DLLL 4CFDA 4J2AA 3LP3A 5CZ1A 4BE0A 3M5RA 1SQKA 4MDAA 4JKGA 1XMQK 4KKOA 2XY8A 3KLIA 3HSCA 2E6LA 3GE1A 2I7PA 3SQ0A 3VGLA 1MU2A 1KVBA 3H08A 2A42A 3KK7A 5I3UA 1EX4A 1TKXA 1WN7A 2P9NB 3IS9A 3O9QA 1HNVA 1VQPN 4ELUA 4JKFA 1OVYA 3ENBA 3QEVA 4BE1A 1UAXA 1SS6A 4Z4CA 2IVOA 4HUFA 1J54A 2O8FA 2G8WA 1Z6RA 4C8NA 1LOTB 4DV3K 2I7NA 4M7YA 3VQ9A 3VTHA 4WFBL 4IEEA 3DLKA 4E7JA 1RT2A 4NCBA 1HJOA 1QQNA 2LSNA 2OPPA 3NVKA 3S3MA 3VERA 3G6EN 3A2FA 2FXUA 4KI4A 2BANA 2RN2A 4A57A 2HW3A 3S41A 3LL3A 1GLFO 4PKHA 4AF1A 4DV1K 4BRKA 1XI1A 3DLRA 3GL1A 3EE8A 1RBRA 5AQGA 4XEIA 3ASMA 4BC5A 1J5EK 4H5TA 4JAXA 3K0SA 4KHNA 4AM6A 1RT3A 2QEXN 2Q36A 3NBPA 3DOLA 1E4GT 3TAMA 5C24A 4CEEA 3A5LC 1WSGA 4O4GA 4CI6A 3PO4A 4DU1A 4F8RA 3UE5A 5AQZA 4B9NA 4QCLA 4LF7K 3AO5A 1OKJA 3AVKA 3VMFB 4WQ5C 1L5UA 4A62A 2HVIA 3O3GA 3F9MA 1N8RO 3C7NA 3ZEUA 1YTUA 4FJ7A 4E7LA 3EN9A 5GAEP 3D2FA 4XIUA 3CCUN 1WB9A 3FLCO 1G99A 5KRTA 2YKMA 3L2RA 5HBMA 4DU3A 3CFOA 4CJRA 4AHCA 3N4PA 1NK6A 2OYQA 4JI0K 3LPUA 1Z05A 3MX5A 1IG8A 4C1NI 2XY5A 4OLAA 1KCFA 1HJRA 2EWSA 1EQYA 4CERA 3DAWA 2I5JA 4J2DA 4GKJK 1B92A 3MDQA 1YIJN 5TKWA 3AVHA 2V7ZA 1U6ZA 2VG6A 3THWB 2O8DB 4Y0WA 3DMJA 4FXDA 1BISA 4M45A 5M1QA 1W9HA 5ADXA 3O3HA 1U48A 3NMUA 2P9IA 2FBTA 3I0SA 4DFMA 1S5JA 4BE2A 2QWPA 1REVA 4BRGA 1X9WA 3NFAA 1C1CA 3QBXA 1HPMA 1YVUA 2HHUA 1S1VA 1RBTA 3DLGA 1VAZA 2XY7A 2ZQBA 4GW6A 1NGGA 3NE6A 1L3VA 1KRPA 3CPEA 2IC3A 3OYMA 3NH2A 3C65A 1VQKN 4C1NK 1J53A 4E19A 5CHIA 3EZWA 1BDGA 2VQFK 4RW4A 3I8DA 2W41A 3KHYA 4JHDB 3OS2A 3O6WA 1QZ6A 4CVNE 4CJPA 5AQXA 4BDYA 4BC2A 1WBBA 4H0TB 2P5GA 1MDUB 1BCOA 3RR8A 5F0XA 4CJ3A 3E1YA 4JKGB 5KQDA 3SAFA 4BRDA 4E1NA 3DI6A 4A61A 3FZLA 3BF1A 5BRFA 3JSMA 3OHRA 3HVTA 3J7ZO 1NGFA 3TAFA 3MX2A 4LFCK 3IAYA 4CJKA 5FRNA 3RVCA 1I39A 4BRNA 1BIZA 3LP2A 4JYAK 2O8FB 1FKOA 4FCYA 2HB5A 1HNIA 1YVNA 5C15A 3QESA 2Z1IA 1ATNA 5JS2A 3ZSZA 4FJLA 2ATQA 5C0YA 3OYJA 2P5OA 3U9DA 1YF5L 3KK2A 4KHSA 3VEYA 3ZETA 4C8KA 2ASMA 3CHWA 3ZX3A 4B9VA 4CIGA 2YI1A 3M3ZA 1LW2A 5SWMA 1BCMA 5J2MA 3K9JA 3I55N 4CGFA 1JLAA 5CR4A 4JI2K 3PY8A 3BDPA 4KAZA 1JCEA 4H0VB 1GOCA 4ID1A 3HM9A 1WLJA 4KH6A 3I33A 3RMBA 5CZ2A 2QTDA 1ZBLA 3A5OC 4CEAA 4J2EA 1LWFA 3D2EB 1QSSA 3VQ7A 3E9PA 3LDLA 3AAPA 4RW7A 4YOUA 4JEPA 2P9LB 4MQ3A 3BUZB 3VETA 4CEZA 4EAHD 1TK5A 1QTMA 4FLZA 4B1VA 4DFPA 3AGRA 3QICA 2UYTA 3H6EA 4DR1K 1B9DA 3PLAA 4H4OA 2HOEA 2WONA 1VRTA 2YNHA 4PL8A 4R79A 3VQPA 3SQ4A 3VQDA 1EO1A 1RT4A 3B6PA 4RG8A 4DU4A 4KHPK 1JLEA 2Q0UA 2CH5A 4FZZA 1T44A 4DMNA 3CMAN 4LSNA 3ZSRA 4B9SA 1YXQA 4FJIA 4FJKA 3SPYA 1JKHA 2GV9A 3SV3A 5GAGP 1T8EA 2F8TA 3OBWA 3OVNA 4PQUA 3MN5A 5HRRA 1YJNN 3VQQA 4TSXA 1L3TA 5FPDA 3ATUA 4JKCA 1WSJA 5J1EA 1N32K 4BR0A 4FYDA 5KGWA 3U9ZA 3AGKA 2D5RA 4KO0A 1SL0A 1HPZA 4DSJA 1VSDA 3DLEA 1ASWA 5T7BA 1KD1O 1KAXA 5B8HA 1CXQA 2Y1JA 3CJ1A 2GUPA 1I94K 1QVGM 2G8FA 2D0CA 3HVRA 2QM1A 4HTLA 4BRHA 3V9UA 2X78A 3A8YA 3VTIA 1JLFA 4BRLA 1NK7A 2AJQA 4LSLA 2VYPA 4BC4A 3HBTA 4CHNA 4H0YB 1RCHA 4BRPA 1GOAA 4KHUA 2NZTA 1NGEA 1TUYA 3ZLJA 3WQUA 1TVRA 3VQ5A 3CM6A 3SMPA 1BOTO 3QBWA 4GV9A 4JI4K 5C2DA 4JKDA 1LW0A 3VQ8A 5EX5A 3P1GA 4IEIA 3JS6A 3VEWA 4DQQA 3VEXA 3PUFA 1JJ2M 3FFKB 3AVNA 1C1BA 1N5YA 5JMVA 4DTOA 1HMVA 4DHYA 4DTXA 3ENOA 4W5NA 1RT5A 3RRGA 2X6SA 1KLNA 1CZ9A 3MEDA 1FK9A 5JS1A 2E8AA 4PY5A 5J2PA 4W5TA 4M7XA 4EP4A 2NRXA 4CBWA 2P51A 3IRXA 4RW8A 1GLJO 2X6NA 2HSTA 2BE2A 1S1WA 4I7FA 4CJFA 1C1AA 2HBJA 3AVCA 3OYLA 3KLFA 2FF3B 5AZJA 3OY9A 3QB0A 1X9MA 3FZMA 3M8SA 4DV2K 5E84A 3W0LA 2NUBA 4DV7K 3P39A 2Q1NA 3DYAA 3O9RA 3MN7A 3KWGA 4B1ZA 2XHBA 2E6MA 4RCHA 2HVHA 4DSKA 3EO3A 2HHSA 1TKTA 1HLUA 2IS3A 1VQ5N 1TUUA 4NLCA 3AVFA 4BDZA 3I56N 3AO2A 4FWNA 4LFBK 4CGHA 5K14A 4BWJA 4WCEL 4KFBA 3OYKA 4K25A 5TKYA 4IOXA 4R5PA 3WEEB 4E7KA 2B6AA 4B08A 1U45A 4EIAA 3WNEA 3CCQN 3NF6A 1SKRA 2PAVA 1S1XA 3AVGA 2ZWHA 4AQYK 2KTQA 5AQOA 2P9KB 1CZAN 5GIPA 4NB4A 2OPQA 4ISGA 1YT3A 3THYB 4BGBA 4QAGA 2UUCK 2ZF5O 4I6MA 4JKAA 4CFAA 1NJZA 1IV0A 3THXA 1HNZK 4MO4A 1NK9A 4FLXA 2YHBA 4FL9A 1TGOA 1NKBA 1X1PA 2ZJPL 4BVOA 2QWQA 4CK3A 1XHXA 2E1ZA 1HYSA 2ETJA 3M8PA 4IFVA 3GBTA 1ITGA 4LF4K 4CJQA 4CF0A 2Z1HA 1FKPA 3HZ6A 4O5FA 2A40A 3NGYA 3VGKA 4KH4A 4JI3K 4X64K 2NRHA 3UKRA 1GLEG 4BY9C 4LC9B 4DQ8A 5BR9A 3HP9A 1KAZA 2O8BB 1ZBFA 4DCHA 5GIOA 2GEMA 3PX4A 1HNWK 1JCGA 4HCCA 3SUQA 4M3WA 3S9HA 4W5QA 3VF2A 3M6GA 5E41A 3R8EA 1HKBA 4FK2A 4DV0K 2FF6A 4KB0A 3VQCA 5EU7A 5GAHP 3AA3A 3ZT1A 5C10A 4EZ9A 4CJVA 5AQPA 3H45C 2FC0A 3TAEA 1E3MA 3CJ9A 3MMVA 4L8RB 1NNEA 3PX0A 1JLCA 1KLMA 4DR3K 3B6OA 4C23A 3PV8A 3TPQA 1X3NA 4YHHK 3TABA 4DB3A 4HVJA 2E2NA 3I0RA 3AO4A 1D9FA 3HK2A 4FLVA 5CE3A 1NMDA 1WNSA 3ULEB 3O1BA 1NLVA 3MK6A 3OA9A 1EETA 4JK9A 4F4KA 2E20A 1TK8A 3HSTB 3CXCM 3CC2N 3ZT3A 2UU9K 4BREA 4M3TA 1KSPA 4DSFA 3G0ZA 2GBZA 4WYBA 3VGMA 3C94A 3ZSXA 3C6TA 4CZIA 3S3OA 3HL8A 1K8KA 4EHTA 2Y1IA 5BREA 5CYQA 4HUGA 1UWBA 3CCEN 4ILHA 5AQIA 3V81A 3L2QA 3KTQA 4ILGB 3KK1A 1X9JA 2QA4N 3V9WA 3RSEA 1JXBA 4HUEA 3CPWM 3SNNA 1T05A 4CJLA 3HPGA 4CIFA 3OS0A 2YHXA 3SUPA 3CIPA 3ID8A 1GLAG 4FK0A 1FXXA 3AVJA 1GOBA 3J8AA 4FLTA 2NRZA 4Q0BA 1DT9A 3QFUA 4JD2A 1BO5O 3AO3A 1NK0A 3IFRA 3KD1E 1VQLN 3KLEA 1Q7YO 1KTQA 3MN6A 4DUYK 5HL7L 2D0BA 2JLEA 1WAJA 3D6RA 2IIRA 4CFBA 4V19S 3DXMA 4DUZK 4ILJA 4K0KK 4LF6K 1U04A 2W40A 5JLHA 2PBDA 5EXWA 3E9OA 1VQ6N 5BN9A 1IKWA 3CJCA 4MDBA 2O8EA 1RDUA 4H5NA 2WUSA 5GINA 5J2QA 1GLDG 4ZHRA 1NJWA 4IDKA 4CIEA 4CZLA 4AHSA 4DFKA 3AVIA 4LF9K 3HYFA 3IG1A 1WOQA 4KTWA 3V9XA 5ADXH 2CGLA 1BL3A 4B9LA 3EL2A 3D45A 4WE1A 4CJUA 4CJSA 3S3NA 4DTMA 1RT6A 2XRIA 1NJYA 2CGKA 1TYQA 5AQLA 2NRWA 1TL3A 3TWHA 1TV6A 1D4XA 5H1SQ 1KC8O 4YOTA 3FGUA 4FWPA 3VOVA 2OZMA 1ZBIA 4IG3A 1KXPA 3QMLA 1DTTA 3HRGA 3OYGA 1WBDA 2YNIA 3CMEN 2HNYA 5ELZA 4I6MB 4FZXC 4Z4FA 3BP8A 3LAMA 1T6CA 1Q18A 1K8AO 1LWEA 3EKUA 4CF9A 2F8SA 4B9QA 2F4VK 3V1RA 1KQSM 1K6YA 4GY2B 4CD3A 3ZX2A 1C0UA 3VF6A 4CE9A 4CJ7A 3FZHA 3LP1A 3V9ZA 4FM2A 3NVMA 4W5OA 4X66K 2GWJA 4IFEA 3HJFA 5AQWA 3VQBA 3IKMA 3LPTA 5F2RA 1IKYA 3T3FA 4LFAK 3U4LA 2HNZA 2PYJA 4KHWA 3UKRB 3CD6N 3ZT2A 4B1YB 3VESA 3L3VA 4DFJA 1IBLK 4ZTJA 4FJMA 1UA0A 1A5WA 3O9SA 1T6DA 3IDHA 2YKNA 1ZYQA 2HHQA 4H0PA 4WQ4A 3F9KA 2RKIA 3OYHA 3CQYA 4K8XA 4OKEA 5LY3A 1RTIA 1T7PA 4FWSA 5CYMA 4DR5K 1NGBA 4DLGA
chains in the Genus database with same CATH topology
4F2RA 5J2NA 5HROA 4LSNA 3ZSRA 4B9SA 4FJIA 4JS4A 1HQEA 4FJKA 3G10A 3QO9A 3SPYA 1JKHA 2DY4A 2GV9A 3AA2A 3SV3A 1NK8A 1BQNA 2R7YA 1T8EA 2F8TA 3OVNA 3RRHA 3U3YA 1S6PA 3SJJA 5FDLA 4PQUA 1O1WA 5HRRA 4H8KA 3VQQA 3SI6A 4TSXA 1RDDA 3DOKA 2KW4A 3K2PA 4CEOA 4FW2A 1L3TA 3MAQA 4FJ9A 1BI4B 1WSJA 2Z1GA 5J1EA 4EP5A 4FYDA 4NYFA 5KGWA 4CF1A 4KO0A 2D5RA 1L3UA 3NAEA 1SL0A 1HPZA 2IDOA 1VSDA 3AV9A 1ASWA 3DLEA 4LH5A 5T7BA 3OJSA 3ULDA 4Z4HA 4ELVA 1WSEA 4H4MA 4CFCA 1EKEA 3OYCA 1CXQA 1WAFA 4KTQA 3OYAA 2Y1JA 3AVMA 2D0AA 2E4LA 2ZE2A 4CHOA 3NDKA 2DFEA 1UA1A 3NCIA 2G8FA 3LP0A 2D0CA 3HVRA 1S1UA 4KV8A 3V9UA 2QK9A 4DQPA 2X78A 3NGIA 3OYFA 3HXMA 1ZBUA 1VSLA 3L8BA 1JLFA 5HRSA 4Y1CA 4JRPA 1NK7A 2AJQA 4LSLA 3MXIA 1IH7A 1RNHA 1JL2A 3CQ8A 4CHNA 1D8YA 3RMDA 2OPRA 4NYNA 4JLHA 1LWCA 1RCHA 2QXFA 1GOAA 4KHUA 3HO1A 4O0JA 1WSFA 3KD5E 1IG9A 1TVRA 3LZIA 2Z1JA 3VQ5A 3M8QA 1BHLA 3CM6A 3NH0A 3OYDA 3CFRA 4CGJA 4NCGA 5FRMA 3OYEA 3QIPA 3NF9A 3DRPA 3ZSOA 1RILA 2QKKA 1D9DA 2Q3SA 3THVA 2PY5A 4KB1A 1LV5A 5CY4A 4CEDA 2KFZA 1LW0A 3VQ8A 4Z0UA 4FK4A 4CK1A 2W42A 4OGCA 2HNDA 3P1GA 4C8OA 4RW6A 1RDBA 3CFPA 3RMCA 4DQQA 4M3XA 3PUFA 3AVNA 1C1BA 1N5YA 3MECA 3EYZA 3RTVA 4OLBA 3V1OA 4IG0A 4UQGA 4DTOA 1HMVA 3OS1A 3SQ1A 2FBYA 4DTXA 4W5NA 1RT5A 1IKXA 2KFNA 1QS4A 4DLEA 3RRGA 4O55A 2X6SA 4FZYA 4CHPA 1KLNA 1CZ9A 3MEDA 4AHTA 4HCBA 5KRSA 3O4NA 4DSJA 1FK9A 1LAVA 3VQ6A 5JS1A 1QHTA 4DTPA 4PY5A 4HTUA 5J2PA 4C8LA 2YHAA 4E7IA 4CJEA 4W5TA 1U47A 1NJXA 4EP4A 4F3OA 3P5JA 2G8VA 2P51A 1ASUA 1Z25A 3IRXA 4QOZB 1S1TA 2GUIA 1CLQA 4ELTA 3WNHA 4RW8A 2X6NA 1RTHA 4DTJA 4B9UA 2VWKA 3ISNC 4FLWA 2IOCA 1I3AA 4FLYA 4GMJB 3NF8A 3NF7A 2BE2A 1S1WA 1QQCA 1BI4A 4E89A 1S6QA 4O0IA 3K58A 3QEIA 5HLFA 4I7FA 4CJFA 1C1AA 3OYLA 3AVCA 4CEQA 3KLFA 3QERA 3AO1A 3QINA 4CJTA 3OY9A 4CFDA 4J2AA 3AA5X 3LP3A 3SQ2A 5CZ1A 4BE0A 1NOZA 1X9MA 3K59A 1HYZA 4Y1DA 3P83D 2XY8A 3KLIA 4KKOA 1VSHA 3M8SA 1XHZA 2E6LA 3ZSYA 1Q8IA 3SQ0A 1MU2A 1KVBA 1Q9XA 4I2PA 1JL1A 2NUBA 2RPIA 3H08A 3MEEA 1VK0A 5I3UA 1EX4A 1NKEA 1TKXA 3DYAA 3K5LA 4DQSA 1RTDA 4DSEA 1RBSA 4M3YA 2XHBA 2E6MA 3U3GA 2HVHA 4LY7A 5C25A 1EP4A 1WN7A 3IS9A 3OYBA 1HNVA 4ELUA 4M3RA 3TAGA 1VSJA 3QETA 4DSKA 4KPYA 4IKFA 3QEVA 2HHSA 1XC9A 1TKTA 2IS3A 1UAXA 4CHYA 4BE1A 4O5BA 2ZD1A 1QSYA 4M3UA 4Z4CA 5KI6A 1B9FA 1CXUA 3AVFA 4BDZA 4HUFA 3AO2A 5DK5A 1J54A 4CGHA 5K14A 4Q5VA 3SCXA 2P1JA 3L2VA 4BWJA 4E3SA 1TK0A 4KFBA 2G8WA 4C8NA 3OYKA 3NHGA 2HMIA 4M3ZA 5HRNA 4FVMA 4R5PA 3C6UA 3L2UA 4E7KA 3OYNA 2B6AA 4B08A 4JS5A 1U45A 3HPHA 3VQ9A 4BACA 3WNEA 3CG7A 3NF6A 1SKRA 4G1QA 1C0TA 1S1XA 4AH9A 4CEFA 3AVGA 4CF2A 2KTQA 1RDCA 3DLKA 4E7JA 1RT2A 4NCBA 4KHQA 2LSNA 2OPPA 2DFFA 3C95A 4OPJA 3M8RA 1TL1A 2OPQA 4JRQA 3S3MA 3VQAA 3DLBA 1JXEA 1YT3A 4PUOA 4CCHA 4BDPA 3QEWA 4QAGA 3SV4A 3A2FA 4KI4A 2BANA 4KREA 4CHZA 4CFAA 2RN2A 1NJZA 5D3GA 1SL1A 2HW3A 1NK9A 4FLXA 1NKCA 1QE1A 2YHBA 3E01A 1JLGA 3OYIA 3NH1A 2G8UA 2OZSA 1TGOA 3VA3A 1X1PA 2DFHA 3AVLA 2XY6A 3TANA 1NKBA 4E1MA 3VQ4A 1XI1A 3DLRA 4CK3A 3T19A 1XHXA 1RBRA 1HYSA 2ETJA 3M8PA 3ASMA 3DRSA 2OPSA 5KTQA 2KZMA 4B9TA 4IFVA 1ITGA 4DTSA 4KHNA 1RT3A 4CJQA 1J5OA 3NBPA 4CF0A 4FJXA 2Z1HA 3RWUA 3DOLA 4PWDA 4BWMA 1FKPA 4OKKA 3NGYA 3TAMA 3HP6A 5C24A 3LZJA 4CEEA 1WSGA 4O4GA 3F73A 4DWIA 3PO4A 4DU1A 4DSLA 1ZBHA 4F8RA 3HP9A 4B8AB 3K5MA 3QNNA 1ZBFA 1TKDA 4B9NA 3KJVA 4QCLA 3AO5A 3AVKA 3SYZA 4B3OA 3RR7A 3HT3A 3PX4A 1L5UA 2PZSA 2HVIA 4N76A 3O3GA 1NK4A 3SUQA 4YFUA 1SUQA 3S9HA 4HCCA 4M3WA 2OA8A 2HHTA 4W5QA 1S9GA 1YTUA 3OJUA 4FJ7A 2G8IA 5E41A 4E7LA 1A5VA 4DF4A 3QEPA 4FK2A 4XIUA 1W0HA 3VQCA 4KB0A 1KFDA 5EU7A 4CGGA 3AA3A 3KIOA 2VWJA 4F2SA 3ZT1A 3SPZA 4EZ9A 4AHUA 5KRTA 4CJVA 3AA4A 3KLHA 1U4BA 3AVBA 1A5XA 2FC0A 3TAEA 3ZSQA 2YKMA 3L2RA 4DQIA 1RTJA 5HBMA 4DU3A 3LDSA 5C42A 4L8RB 3PX0A 1JLCA 1KLMA 3CFOA 4PA1A 4AHCA 2ITGA 4CJRA 4CESA 1G15A 3B6OA 1NK6A 2OYQA 3PV8A 3LPUA 4OLAA 4FW1A 2XY5A 3CYMA 1KCFA 3WNFA 4CJ5A 3TAQA 1HJRA 4AHVA 3TABA 4CERA 4HVJA 1HYVA 4CJWA 4FM0A 1C6VA 3AO4A 2I5JA 3I0RA 4FM1A 1X9SA 4DG1A 4ZTFA 1D9FA 3UIQA 4J2DA 1B92A 4FLVA 4KRFA 1C0MA 1WNSA 1VSKA 3AVHA 4CECA 2VG6A 3K5OA 1EETA 2YNFA 4DF8A 4F4KA 4CF8A 3DMJA 1TK8A 1BISA 4CK2A 1J9AA 3HSTB 1R0AA 4FXDA 4M45A 3O3HA 1W9HA 3HK2A 1IKVA 1U48A 3ZT3A 3JYTA 1BQMA 2FBTA 3I0SA 4DTUA 4M3TA 4DFMA 1S5JA 1KSPA 1RBUA 4IFYA 4BE2A 4DSFA 3G0ZA 3PO5A 1REVA 4B9MA 1X9WA 1BGXT 1C1CA 1BIUA 2GBZA 3NFAA 3ZCMA 4KI6A 1YVUA 3DRRA 5SZTA 2PYLA 3FFIA 3C94A 3ZSXA 3O3FA 1S1VA 1VRUA 3C6TA 3TI0A 3S3OA 3HL8A 2HHUA 4EZ6A 4AILC 1CZBA 1RBTA 3DLGA 3VQEA 2Y1IA 2A1RA 4NCAA 2XY7A 3LAKA 2ZQBA 4GW6A 1D5AA 5CYQA 4HUGA 3D0PA 1UWBA 1UOCA 3SZ2A 3V81A 3NE6A 1RT1A 1L3VA 1KRPA 3L2QA 3KTQA 4O44A 2IC3A 4CGIA 3NH2A 3OYMA 3KK1A 1JXBA 5DMRA 3LWMA 4HUEA 3V9WA 3VA0A 1J53A 4E19A 2XO7A 3SNNA 4C8MA 1S9EA 4FLUA 1WSIA 1T05A 1KVCA 4DSIA 4CJLA 3HPGA 1JLQA 4RW4A 3I8DA 3MXJA 4KHYA 5HRPA 4CIFA 4N5SA 3OS0A 3KLGA 2JGUA 3L2WA 3ZT0A 3EY1A 2G8HA 3SUPA 1JLBA 3OS2A 4FK0A 4FJJA 1FXXA 3AVJA 1GOBA 4CJPA 4FLTA 4Q0BA 4FJGA 4BDYA 3AO3A 3T1AA 1NK0A 3KD1E 1NOYA 3KLEA 1WSHA 1KTQA 3BGRA 3VN5A 1SKSA 1IO2A 3MEGA 2P5GA 1BCOA 2DTUA 1DLOA 3ZT4A 3RR8A 1YTAA 3O4QA 2D0BA 4M41A 2A1SA 2JLEA 3PX6A 1WAJA 3KKSA 3QEXA 4CFBA 4CGDA 4CJ3A 1KVAA 1VSMA 3LANA 4DTNA 4N56A 4FJ8A 1LAWA 3QLHA 4E1NA 3K5NA 4I9QA 4OPKA 3DI6A 4KTZA 1U04A 2IGIA 1XWLA 3JSMA 2IAJA 3HVTA 1RBVA 4LH4A 4W5RA 1NK5A 1Q9YA 2HHXA 1TAUA 1IKWA 3LWLA 3NGZA 3TAFA 2KZZA 4DTRA 2QKBA 4RW9A 4DS5A 4CJ4A 4HHTA 5HP1A 4MFBA 3IAYA 4CJKA 4CHQA 5FRNA 5J2QA 4ZHRA 1NJWA 1Z26A 4IDKA 4CIEA 4DFKA 4AHSA 3AVIA 1I39A 2EX3A 3AVAA 3HYFA 3IG1A 1BIZA 2G8KA 3LP2A 4KTWA 1T03A 3V9XA 1HRHA 1BL3A 3EZ5A 1FKOA 3ZSVA 4B9LA 1TKZA 3D45A 1VSFA 4WE1A 4CJUA 2HHWA 4FCYA 2HB5A 1HNIA 4CJSA 3QESA 3S3NA 4DTMA 2Z1IA 1RT6A 2XRIA 5FROA 3V9SA 1NJYA 5JS2A 1RT7A 3ZSZA 5KGXA 4FJLA 3KK3A 2ATQA 3OYJA 2P5OA 1TL3A 3TWHA 3HPOA 1TV6A 3KK2A 3QNOA 4KHSA 1SL2A 2B5JA 2X74A 2BDPA 4C8KA 4B9VA 4Z4IA 4CIGA 1LW2A 3DLHA 5SWMA 4K8ZA 1U49A 1BCMA 5J2MA 2OZMA 1ZBIA 4IG3A 4CEBA 2O4IA 1ASVA 3MXMA 1DTTA 4CGFA 1JLAA 3OYGA 2VG7A 2YNIA 2RF2A 2HNYA 4Z4GA 4FZXC 4FJNA 3PY8A 4Z4FA 3LAMA 3BDPA 2O4GA 3CM5A 4KAZA 5I42A 4LD0A 3TAPA 4M42A 1LWEA 1GOCA 4ID1A 4CF9A 3HM9A 1WLJA 3SUNA 3ITHA 2F8SA 1VSIA 3V1RA 3V1QA 4I9LA 3K57A 1EXQA 4DS4A 1K6YA 4OJRA 4B8CA 1VSEA 2YNGA 3RMBA 3WNGA 4F3TA 2B4JA 3V4IA 1C0UA 4GVMA 4CE9A 1SKWA 5CZ2A 1L3SA 4OGEA 3LP1A 1SV5A 3V9ZA 4FJHA 4FM2A 1ZBLA 4CEAA 4W5OA 4J2EA 4OKJA 1KFSA 1LWFA 1QSSA 3HJFA 1F21A 3VQ7A 3VQBA 3LPTA 4I2QA 4RW7A 3TARA 4IBNA 2BGGA 2F96A 3L3UA 1IKYA 3T3FA 4OVLA 3RMAA 4N41A 4MQ3A 3DM2A 1TAQA 2HNZA 4CEZA 2PYJA 4KHWA 3V6DA 3ZT2A 1TK5A 1QTMA 1RDAA 4J2BA 2VG5A 4FLZA 1DTQA 1Y97A 4DQRA 4YNQA 4ID5A 1N6QA 4DFPA 4E0DA 2HHVA 2EHGA 3L3VA 4DFJA 2KQ2A 4AHRA 4E7HA 4ZTJA 2YV0X 4FJMA 2WOMA 3LALA 1UA0A 1B9DA 4Z4EA 1HQUA 3TR8A 3ZSWA 4H4OA 4FJ5A 1A5WA 2WONA 4N47A 1VRTA 2YNHA 2YKNA 3QIOA 1ZYQA 2HHQA 3VQPA 3F9KA 2RKIA 3SQ4A 1QSLA 3ALYA 3VQDA 3OYHA 1RT4A 2FBVA 3B6PA 3U6FA 4K8XA 4OKEA 4RG8A 1RTIA 2FBXA 4DU4A 3KKRA 4ICLA 5CYMA 3SUOA 1T7PA 1JLEA 4DLGA 4FZZA 4DMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F2R A;  5J2N A;  5HRO A;  4LSN A;  3ZSR A;  4B9S A;  4FJI A;  4JS4 A;  1HQE A;  4FJK A;  3G10 A;  3QO9 A;  3SPY A;  1JKH A;  2DY4 A;  2GV9 A;  3AA2 A;  3SV3 A;  1NK8 A;  1BQN A;  2R7Y A;  1T8E A;  2F8T A;  3OVN A;  3RRH A;  3U3Y A;  1S6P A;  3SJJ A;  5FDL A;  4PQU A;  1O1W A;  5HRR A;  4H8K A;  3VQQ A;  3SI6 A;  4TSX A;  1RDD A;  3DOK A;  2KW4 A;  3K2P A;  4CEO A;  4FW2 A;  1L3T A;  3MAQ A;  4FJ9 A;  1BI4 B;  1WSJ A;  2Z1G A;  5J1E A;  4EP5 A;  4FYD A;  4NYF A;  5KGW A;  4CF1 A;  4KO0 A;  2D5R A;  1L3U A;  3NAE A;  1SL0 A;  1HPZ A;  2IDO A;  1VSD A;  3AV9 A;  1ASW A;  3DLE A;  4LH5 A;  5T7B A;  3OJS A;  3ULD A;  4Z4H A;  4ELV A;  1WSE A;  4H4M A;  4CFC A;  1EKE A;  3OYC A;  1CXQ A;  1WAF A;  4KTQ A;  3OYA A;  2Y1J A;  3AVM A;  2D0A A;  2E4L A;  2ZE2 A;  4CHO A;  3NDK A;  2DFE A;  1UA1 A;  3NCI A;  2G8F A;  3LP0 A;  2D0C A;  3HVR A;  1S1U A;  4KV8 A;  3V9U A;  2QK9 A;  4DQP A;  2X78 A;  3NGI A;  3OYF A;  3HXM A;  1ZBU A;  1VSL A;  3L8B A;  1JLF A;  5HRS A;  4Y1C A;  4JRP A;  1NK7 A;  2AJQ A;  4LSL A;  3MXI A;  1IH7 A;  1RNH A;  1JL2 A;  3CQ8 A;  4CHN A;  1D8Y A;  3RMD A;  2OPR A;  4NYN A;  4JLH A;  1LWC A;  1RCH A;  2QXF A;  1GOA A;  4KHU A;  3HO1 A;  4O0J A;  1WSF A;  3KD5 E;  1IG9 A;  1TVR A;  3LZI A;  2Z1J A;  3VQ5 A;  3M8Q A;  1BHL A;  3CM6 A;  3NH0 A;  3OYD A;  3CFR A;  4CGJ A;  4NCG A;  5FRM A;  3OYE A;  3QIP A;  3NF9 A;  3DRP A;  3ZSO A;  1RIL A;  2QKK A;  1D9D A;  2Q3S A;  3THV A;  2PY5 A;  4KB1 A;  1LV5 A;  5CY4 A;  4CED A;  2KFZ A;  1LW0 A;  3VQ8 A;  4Z0U A;  4FK4 A;  4CK1 A;  2W42 A;  4OGC A;  2HND A;  3P1G A;  4C8O A;  4RW6 A;  1RDB A;  3CFP A;  3RMC A;  4DQQ A;  4M3X A;  3PUF A;  3AVN A;  1C1B A;  1N5Y A;  3MEC A;  3EYZ A;  3RTV A;  4OLB A;  3V1O A;  4IG0 A;  4UQG A;  4DTO A;  1HMV A;  3OS1 A;  3SQ1 A;  2FBY A;  4DTX A;  4W5N A;  1RT5 A;  1IKX A;  2KFN A;  1QS4 A;  4DLE A;  3RRG A;  4O55 A;  2X6S A;  4FZY A;  4CHP A;  1KLN A;  1CZ9 A;  3MED A;  4AHT A;  4HCB A;  5KRS A;  3O4N A;  4DSJ A;  1FK9 A;  1LAV A;  3VQ6 A;  5JS1 A;  1QHT A;  4DTP A;  4PY5 A;  4HTU A;  5J2P A;  4C8L A;  2YHA A;  4E7I A;  4CJE A;  4W5T A;  1U47 A;  1NJX A;  4EP4 A;  4F3O A;  3P5J A;  2G8V A;  2P51 A;  1ASU A;  1Z25 A;  3IRX A;  4QOZ B;  1S1T A;  2GUI A;  1CLQ A;  4ELT A;  3WNH A;  4RW8 A;  2X6N A;  1RTH A;  4DTJ A;  4B9U A;  2VWK A;  3ISN C;  4FLW A;  2IOC A;  1I3A A;  4FLY A;  4GMJ B;  3NF8 A;  3NF7 A;  2BE2 A;  1S1W A;  1QQC A;  1BI4 A;  4E89 A;  1S6Q A;  4O0I A;  3K58 A;  3QEI A;  5HLF A;  4I7F A;  4CJF A;  1C1A A;  3OYL A;  3AVC A;  4CEQ A;  3KLF A;  3QER A;  3AO1 A;  3QIN A;  4CJT A;  3OY9 A;  4CFD A;  4J2A A;  3AA5 X;  3LP3 A;  3SQ2 A;  5CZ1 A;  4BE0 A;  1NOZ A;  1X9M A;  3K59 A;  1HYZ A;  4Y1D A;  3P83 D;  2XY8 A;  3KLI A;  4KKO A;  1VSH A;  3M8S A;  1XHZ A;  2E6L A;  3ZSY A;  1Q8I A;  3SQ0 A;  1MU2 A;  1KVB A;  1Q9X A;  4I2P A;  1JL1 A;  2NUB A;  2RPI A;  3H08 A;  3MEE A;  1VK0 A;  5I3U A;  1EX4 A;  1NKE A;  1TKX A;  3DYA A;  3K5L A;  4DQS A;  1RTD A;  4DSE A;  1RBS A;  4M3Y A;  2XHB A;  2E6M A;  3U3G A;  2HVH A;  4LY7 A;  5C25 A;  1EP4 A;  1WN7 A;  3IS9 A;  3OYB A;  1HNV A;  4ELU A;  4M3R A;  3TAG A;  1VSJ A;  3QET A;  4DSK A;  4KPY A;  4IKF A;  3QEV A;  2HHS A;  1XC9 A;  1TKT A;  2IS3 A;  1UAX A;  4CHY A;  4BE1 A;  4O5B A;  2ZD1 A;  1QSY A;  4M3U A;  4Z4C A;  5KI6 A;  1B9F A;  1CXU A;  3AVF A;  4BDZ A;  4HUF A;  3AO2 A;  5DK5 A;  1J54 A;  4CGH A;  5K14 A;  4Q5V A;  3SCX A;  2P1J A;  3L2V A;  4BWJ A;  4E3S A;  1TK0 A;  4KFB A;  2G8W A;  4C8N A;  3OYK A;  3NHG A;  2HMI A;  4M3Z A;  5HRN A;  4FVM A;  4R5P A;  3C6U A;  3L2U A;  4E7K A;  3OYN A;  2B6A A;  4B08 A;  4JS5 A;  1U45 A;  3HPH A;  3VQ9 A;  4BAC A;  3WNE A;  3CG7 A;  3NF6 A;  1SKR A;  4G1Q A;  1C0T A;  1S1X A;  4AH9 A;  4CEF A;  3AVG A;  4CF2 A;  2KTQ A;  1RDC A;  3DLK A;  4E7J A;  1RT2 A;  4NCB A;  4KHQ A;  2LSN A;  2OPP A;  2DFF A;  3C95 A;  4OPJ A;  3M8R A;  1TL1 A;  2OPQ A;  4JRQ A;  3S3M A;  3VQA A;  3DLB A;  1JXE A;  1YT3 A;  4PUO A;  4CCH A;  4BDP A;  3QEW A;  4QAG A;  3SV4 A;  3A2F A;  4KI4 A;  2BAN A;  4KRE A;  4CHZ A;  4CFA A;  2RN2 A;  1NJZ A;  5D3G A;  1SL1 A;  2HW3 A;  1NK9 A;  4FLX A;  1NKC A;  1QE1 A;  2YHB A;  3E01 A;  1JLG A;  3OYI A;  3NH1 A;  2G8U A;  2OZS A;  1TGO A;  3VA3 A;  1X1P A;  2DFH A;  3AVL A;  2XY6 A;  3TAN A;  1NKB A;  4E1M A;  3VQ4 A;  1XI1 A;  3DLR A;  4CK3 A;  3T19 A;  1XHX A;  1RBR A;  1HYS A;  2ETJ A;  3M8P A;  3ASM A;  3DRS A;  2OPS A;  5KTQ A;  2KZM A;  4B9T A;  4IFV A;  1ITG A;  4DTS A;  4KHN A;  1RT3 A;  4CJQ A;  1J5O A;  3NBP A;  4CF0 A;  4FJX A;  2Z1H A;  3RWU A;  3DOL A;  4PWD A;  4BWM A;  1FKP A;  4OKK A;  3NGY A;  3TAM A;  3HP6 A;  5C24 A;  3LZJ A;  4CEE A;  1WSG A;  4O4G A;  3F73 A;  4DWI A;  3PO4 A;  4DU1 A;  4DSL A;  1ZBH A;  4F8R A;  3HP9 A;  4B8A B;  3K5M A;  3QNN A;  1ZBF A;  1TKD A;  4B9N A;  3KJV A;  4QCL A;  3AO5 A;  3AVK A;  3SYZ A;  4B3O A;  3RR7 A;  3HT3 A;  3PX4 A;  1L5U A;  2PZS A;  2HVI A;  4N76 A;  3O3G A;  1NK4 A;  3SUQ A;  4YFU A;  1SUQ A;  3S9H A;  4HCC A;  4M3W A;  2OA8 A;  2HHT A;  4W5Q A;  1S9G A;  1YTU A;  3OJU A;  4FJ7 A;  2G8I A;  5E41 A;  4E7L A;  1A5V A;  4DF4 A;  3QEP A;  4FK2 A;  4XIU A;  1W0H A;  3VQC A;  4KB0 A;  1KFD A;  5EU7 A;  4CGG A;  3AA3 A;  3KIO A;  2VWJ A;  4F2S A;  3ZT1 A;  3SPZ A;  4EZ9 A;  4AHU A;  5KRT A;  4CJV A;  3AA4 A;  3KLH A;  1U4B A;  3AVB A;  1A5X A;  2FC0 A;  3TAE A;  3ZSQ A;  2YKM A;  3L2R A;  4DQI A;  1RTJ A;  5HBM A;  4DU3 A;  3LDS A;  5C42 A;  4L8R B;  3PX0 A;  1JLC A;  1KLM A;  3CFO A;  4PA1 A;  4AHC A;  2ITG A;  4CJR A;  4CES A;  1G15 A;  3B6O A;  1NK6 A;  2OYQ A;  3PV8 A;  3LPU A;  4OLA A;  4FW1 A;  2XY5 A;  3CYM A;  1KCF A;  3WNF A;  4CJ5 A;  3TAQ A;  1HJR A;  4AHV A;  3TAB A;  4CER A;  4HVJ A;  1HYV A;  4CJW A;  4FM0 A;  1C6V A;  3AO4 A;  2I5J A;  3I0R A;  4FM1 A;  1X9S A;  4DG1 A;  4ZTF A;  1D9F A;  3UIQ A;  4J2D A;  1B92 A;  4FLV A;  4KRF A;  1C0M A;  1WNS A;  1VSK A;  3AVH A;  4CEC A;  2VG6 A;  3K5O A;  1EET A;  2YNF A;  4DF8 A;  4F4K A;  4CF8 A;  3DMJ A;  1TK8 A;  1BIS A;  4CK2 A;  1J9A A;  3HST B;  1R0A A;  4FXD A;  4M45 A;  3O3H A;  1W9H A;  3HK2 A;  1IKV A;  1U48 A;  3ZT3 A;  3JYT A;  1BQM A;  2FBT A;  3I0S A;  4DTU A;  4M3T A;  4DFM A;  1S5J A;  1KSP A;  1RBU A;  4IFY A;  4BE2 A;  4DSF A;  3G0Z A;  3PO5 A;  1REV A;  4B9M A;  1X9W A;  1BGX T;  1C1C A;  1BIU A;  2GBZ A;  3NFA A;  3ZCM A;  4KI6 A;  1YVU A;  3DRR A;  5SZT A;  2PYL A;  3FFI A;  3C94 A;  3ZSX A;  3O3F A;  1S1V A;  1VRU A;  3C6T A;  3TI0 A;  3S3O A;  3HL8 A;  2HHU A;  4EZ6 A;  4AIL C;  1CZB A;  1RBT A;  3DLG A;  3VQE A;  2Y1I A;  2A1R A;  4NCA A;  2XY7 A;  3LAK A;  2ZQB A;  4GW6 A;  1D5A A;  5CYQ A;  4HUG A;  3D0P A;  1UWB A;  1UOC A;  3SZ2 A;  3V81 A;  3NE6 A;  1RT1 A;  1L3V A;  1KRP A;  3L2Q A;  3KTQ A;  4O44 A;  2IC3 A;  4CGI A;  3NH2 A;  3OYM A;  3KK1 A;  1JXB A;  5DMR A;  3LWM A;  4HUE A;  3V9W A;  3VA0 A;  1J53 A;  4E19 A;  2XO7 A;  3SNN A;  4C8M A;  1S9E A;  4FLU A;  1WSI A;  1T05 A;  1KVC A;  4DSI A;  4CJL A;  3HPG A;  1JLQ A;  4RW4 A;  3I8D A;  3MXJ A;  4KHY A;  5HRP A;  4CIF A;  4N5S A;  3OS0 A;  3KLG A;  2JGU A;  3L2W A;  3ZT0 A;  3EY1 A;  2G8H A;  3SUP A;  1JLB A;  3OS2 A;  4FK0 A;  4FJJ A;  1FXX A;  3AVJ A;  1GOB A;  4CJP A;  4FLT A;  4Q0B A;  4FJG A;  4BDY A;  3AO3 A;  3T1A A;  1NK0 A;  3KD1 E;  1NOY A;  3KLE A;  1WSH A;  1KTQ A;  3BGR A;  3VN5 A;  1SKS A;  1IO2 A;  3MEG A;  2P5G A;  1BCO A;  2DTU A;  1DLO A;  3ZT4 A;  3RR8 A;  1YTA A;  3O4Q A;  2D0B A;  4M41 A;  2A1S A;  2JLE A;  3PX6 A;  1WAJ A;  3KKS A;  3QEX A;  4CFB A;  4CGD A;  4CJ3 A;  1KVA A;  1VSM A;  3LAN A;  4DTN A;  4N56 A;  4FJ8 A;  1LAW A;  3QLH A;  4E1N A;  3K5N A;  4I9Q A;  4OPK A;  3DI6 A;  4KTZ A;  1U04 A;  2IGI A;  1XWL A;  3JSM A;  2IAJ A;  3HVT A;  1RBV A;  4LH4 A;  4W5R A;  1NK5 A;  1Q9Y A;  2HHX A;  1TAU A;  1IKW A;  3LWL A;  3NGZ A;  3TAF A;  2KZZ A;  4DTR A;  2QKB A;  4RW9 A;  4DS5 A;  4CJ4 A;  4HHT A;  5HP1 A;  4MFB A;  3IAY A;  4CJK A;  4CHQ A;  5FRN A;  5J2Q A;  4ZHR A;  1NJW A;  1Z26 A;  4IDK A;  4CIE A;  4DFK A;  4AHS A;  3AVI A;  1I39 A;  2EX3 A;  3AVA A;  3HYF A;  3IG1 A;  1BIZ A;  2G8K A;  3LP2 A;  4KTW A;  1T03 A;  3V9X A;  1HRH A;  1BL3 A;  3EZ5 A;  1FKO A;  3ZSV A;  4B9L A;  1TKZ A;  3D45 A;  1VSF A;  4WE1 A;  4CJU A;  2HHW A;  4FCY A;  2HB5 A;  1HNI A;  4CJS A;  3QES A;  3S3N A;  4DTM A;  2Z1I A;  1RT6 A;  2XRI A;  5FRO A;  3V9S A;  1NJY A;  5JS2 A;  1RT7 A;  3ZSZ A;  5KGX A;  4FJL A;  3KK3 A;  2ATQ A;  3OYJ A;  2P5O A;  1TL3 A;  3TWH A;  3HPO A;  1TV6 A;  3KK2 A;  3QNO A;  4KHS A;  1SL2 A;  2B5J A;  2X74 A;  2BDP A;  4C8K A;  4B9V A;  4Z4I A;  4CIG A;  1LW2 A;  3DLH A;  5SWM A;  4K8Z A;  1U49 A;  1BCM A;  5J2M A;  2OZM A;  1ZBI A;  4IG3 A;  4CEB A;  2O4I A;  1ASV A;  3MXM A;  1DTT A;  4CGF A;  1JLA A;  3OYG A;  2VG7 A;  2YNI A;  2RF2 A;  2HNY A;  4Z4G A;  4FZX C;  4FJN A;  3PY8 A;  4Z4F A;  3LAM A;  3BDP A;  2O4G A;  3CM5 A;  4KAZ A;  5I42 A;  4LD0 A;  3TAP A;  4M42 A;  1LWE A;  1GOC A;  4ID1 A;  4CF9 A;  3HM9 A;  1WLJ A;  3SUN A;  3ITH A;  2F8S A;  1VSI A;  3V1R A;  3V1Q A;  4I9L A;  3K57 A;  1EXQ A;  4DS4 A;  1K6Y A;  4OJR A;  4B8C A;  1VSE A;  2YNG A;  3RMB A;  3WNG A;  4F3T A;  2B4J A;  3V4I A;  1C0U A;  4GVM A;  4CE9 A;  1SKW A;  5CZ2 A;  1L3S A;  4OGE A;  3LP1 A;  1SV5 A;  3V9Z A;  4FJH A;  4FM2 A;  1ZBL A;  4CEA A;  4W5O A;  4J2E A;  4OKJ A;  1KFS A;  1LWF A;  1QSS A;  3HJF A;  1F21 A;  3VQ7 A;  3VQB A;  3LPT A;  4I2Q A;  4RW7 A;  3TAR A;  4IBN A;  2BGG A;  2F96 A;  3L3U A;  1IKY A;  3T3F A;  4OVL A;  3RMA A;  4N41 A;  4MQ3 A;  3DM2 A;  1TAQ A;  2HNZ A;  4CEZ A;  2PYJ A;  4KHW A;  3V6D A;  3ZT2 A;  1TK5 A;  1QTM A;  1RDA A;  4J2B A;  2VG5 A;  4FLZ A;  1DTQ A;  1Y97 A;  4DQR A;  4YNQ A;  4ID5 A;  1N6Q A;  4DFP A;  4E0D A;  2HHV A;  2EHG A;  3L3V A;  4DFJ A;  2KQ2 A;  4AHR A;  4E7H A;  4ZTJ A;  2YV0 X;  4FJM A;  2WOM A;  3LAL A;  1UA0 A;  1B9D A;  4Z4E A;  1HQU A;  3TR8 A;  3ZSW A;  4H4O A;  4FJ5 A;  1A5W A;  2WON A;  4N47 A;  1VRT A;  2YNH A;  2YKN A;  3QIO A;  1ZYQ A;  2HHQ A;  3VQP A;  3F9K A;  2RKI A;  3SQ4 A;  1QSL A;  3ALY A;  3VQD A;  3OYH A;  1RT4 A;  2FBV A;  3B6P A;  3U6F A;  4K8X A;  4OKE A;  4RG8 A;  1RTI A;  2FBX A;  4DU4 A;  3KKR A;  4ICL A;  5CYM A;  3SUO A;  1T7P A;  1JLE A;  4DLG A;  4FZZ A;  4DMN A; 
#chains in the Genus database with same CATH topology
 5GAD P;  4DR7 K;  2KKZ A;  3W3D A;  3G10 A;  3AA2 A;  5BRD A;  1BQN A;  3SJJ A;  3U3Y A;  3SJH A;  5FDL A;  3UKU A;  1VQ9 N;  3CET A;  2KW4 A;  3K2P A;  1RFQ A;  1XQS C;  1BI4 B;  2Z1G A;  1OH5 A;  4XH1 A;  1NOY A;  4Z4H A;  4H4M A;  3WXM B;  5AFU A;  1EKE A;  1VQ8 N;  1WAF A;  4KTQ A;  3WQT A;  5HOO A;  3A5N C;  5M1N A;  3NDK A;  5BPM A;  2DFE A;  1VQ7 N;  3LP0 A;  4WFN L;  1S1U A;  3WUH A;  5M1O A;  3HXM A;  1VSL A;  3P31 A;  4O8U A;  3IMX A;  1IH7 A;  3CQ8 A;  4J8F A;  1D8Y A;  3TU5 A;  4NYN A;  1NWK A;  5JIC A;  3HO1 A;  3CCL N;  1Q82 O;  3KD5 E;  3TSQ A;  3M8Q A;  1BHL A;  3CFR A;  4ISE A;  3QIP A;  2QKK A;  1D9D A;  1K73 O;  1EWQ A;  3GDQ A;  4CED A;  3KZB A;  4FK4 A;  2W42 A;  4OGC A;  2HND A;  2E88 A;  4RW6 A;  3CFP A;  1RDW X;  3RMC A;  4OO1 J;  2ZGZ A;  3RTV A;  4OLB A;  4IG0 A;  4U67 L;  3OS1 A;  1S22 A;  1NGH A;  4H5R A;  2FSK A;  4CHP A;  3O9U A;  4HCB A;  4JI5 K;  4DR6 K;  3O4N A;  4CZG A;  2P9S A;  1NBW A;  1QHT A;  3P38 A;  4HTU A;  4QS8 A;  4C8L A;  4H5V A;  4E7I A;  5BPN A;  1U47 A;  1ASU A;  4NXN K;  1CLQ A;  2GUI A;  4ELT A;  4DTJ A;  3ISN C;  3DXM B;  4FLW A;  1I3A A;  4FLY A;  4GMJ B;  3NF8 A;  4FWK A;  4WF9 L;  4H5W A;  1HKC A;  4CEQ A;  3AA5 X;  3SQ2 A;  1NOZ A;  1XNQ K;  4Y1D A;  1XHZ A;  1VSH A;  3ZSY A;  1Q8I A;  4X65 K;  1Q9X A;  4MLE A;  3Q7B A;  4I2P A;  4WFA L;  2RPI A;  1RTD A;  3LDQ A;  5AQU A;  4DQS A;  3L6Q A;  3K5L A;  1YI2 N;  2E2P A;  4M3Y A;  4FWR A;  3C7N B;  3ZEU B;  1S72 N;  3PSI A;  3TAG A;  3DJC A;  3QET A;  4KPY A;  3MWT A;  5EVZ A;  2DPN A;  3H1Q A;  4CHY A;  3LM2 A;  2ZD1 A;  4O5B A;  5E26 A;  1QSY A;  1B9F A;  1CXU A;  3D2F B;  2P9U A;  5DK5 A;  2YHY A;  5C2F A;  4E3S A;  3NHG A;  2HMI A;  5HRN A;  3TSU A;  3L2U A;  3OYN A;  4JS5 A;  3HPH A;  4UY8 O;  2ZM6 K;  4PKI A;  3O80 A;  4CZF A;  4G1Q A;  1C0T A;  4AH9 A;  4CZJ A;  3SBT A;  1BG3 A;  1RDC A;  4KHQ A;  2QI2 A;  3C95 A;  4OPJ A;  2DFF A;  3M8R A;  4JRQ A;  3VQA A;  1JXE A;  4PUO A;  4CCH A;  3QEW A;  1Q86 O;  2VQE K;  4KRE A;  4CHZ A;  1NKC A;  3BZK A;  1QE1 A;  1JLG A;  2G8U A;  3TAN A;  4E1M A;  3VQ4 A;  5M1P A;  2P9I B;  5AQN A;  1BA0 A;  3BY5 A;  2A41 A;  3DRS A;  2KZM A;  4L3Q A;  1IBM K;  4B9T A;  4CZE A;  4DTS A;  2D1K A;  4DV6 K;  4FJX A;  4BGA A;  4OKK A;  3HP6 A;  3LZJ A;  2P9P A;  1YUW A;  4DR4 K;  1BU6 O;  2WBN A;  5MLC Q;  3BZC A;  3F73 A;  4DWI A;  4DSL A;  4IXC A;  3K5M A;  4B8A B;  1S3X A;  3SYZ A;  4FWL A;  4JKB A;  4BRI A;  3RR7 A;  3HT3 A;  3L4I A;  4N76 A;  1OH8 A;  1SUQ A;  2D0P A;  2P9N A;  4BRC A;  2GTD A;  2HHT A;  3OJU A;  2G8I A;  3HOS A;  1P90 A;  1A5V A;  5IWA K;  4CZM A;  3TTC A;  3QEP A;  3DWL A;  1VQN N;  3E66 A;  3SK3 A;  4FWM A;  1U4B A;  3AVB A;  3ENH A;  2UUB K;  2YX6 A;  5A2Q O;  3N4Q A;  4CES A;  5FPE A;  4FOI A;  4B3T K;  1DKG D;  1QQM A;  3MCP A;  4CBU A;  3WNF A;  3JXU A;  3TAQ A;  3VF4 A;  1IJJ A;  4CJW A;  1C6V A;  4FM1 A;  3UIQ A;  1VSK A;  1HNX K;  3VEV A;  4CEC A;  3K5O A;  3WT0 A;  3GG4 A;  2YNF A;  1P8Z A;  4DR2 K;  4DF8 A;  1EWR A;  5AQS A;  2HBM A;  4CK2 A;  2F7T A;  1IKV A;  3JYT A;  1BQM A;  4DTU A;  3PO5 A;  3ZCM A;  1BIU A;  2GX9 A;  4KI6 A;  1HKG A;  5SZT A;  4FOE A;  3OTO K;  4FSV A;  2WTU A;  4U7B A;  1VQM N;  3LDP A;  4K42 A;  3O3F A;  1VRU A;  3ZET B;  3R9P A;  3LAK A;  3SZ2 A;  1RT1 A;  4CBX A;  1YAG A;  1T3V A;  4CD1 A;  1U2V A;  4IO8 A;  4CGI A;  5DMR A;  2OCE A;  4B1W B;  2XO7 A;  4C8M A;  1S9E A;  1OH7 A;  4DSI A;  2P9S B;  1JLQ A;  3M1F A;  3MXJ A;  4KHY A;  5HRP A;  4N5S A;  3KLG A;  2JGU A;  2G8H A;  1JLB A;  3LM9 A;  2QWM A;  2VCP A;  4IJA A;  2JWL A;  2QWO A;  2OTL N;  1C0G A;  1NU0 A;  1J6Z A;  1SKS A;  3MEG A;  3UB5 A;  2VGM A;  2D0O A;  3ZT4 A;  1YTA A;  3O4Q A;  3PX6 A;  3TSP A;  4YOX A;  4KH5 A;  4JK8 A;  4YOR A;  1V4S A;  3LAN A;  4FJ8 A;  3QLH A;  2FSN A;  3K5N A;  3HOT A;  1K9M O;  2IGI A;  4JI8 K;  4AM7 A;  2IAJ A;  4W5R A;  4LH4 A;  2HBK A;  4X62 K;  1TAU A;  2KLA A;  3LWL A;  2KZZ A;  4IDH A;  5AZI A;  4RW9 A;  4DS5 A;  4FWQ A;  5AJ3 K;  4HHT A;  3CC7 N;  3THW A;  2O8D A;  3AY9 A;  3DXK A;  1Z26 A;  2G8K A;  1T03 A;  2W6K A;  3QFP A;  1BA1 A;  3D7E O;  3EZ5 A;  4MO5 A;  5FPM A;  3ZSV A;  1TKZ A;  1VSF A;  3WXI A;  5FRO A;  4F9O A;  3H3N O;  3Q7C A;  4B3M K;  2NLX A;  2BDP A;  4Z4I A;  2O4I A;  4CEB A;  1ASV A;  2VG7 A;  4Z4G A;  4FJN A;  2E5L K;  2A3Z A;  2O4G A;  4PKG A;  4LD0 A;  3TAP A;  4M42 A;  4WQ5 A;  5EOY A;  4B3S K;  1C0F A;  1MWK A;  3V1Q A;  4I9L A;  4JHD A;  1EXQ A;  3K57 A;  4DS4 A;  4OJR A;  4B8C A;  1VSE A;  3WNG A;  4F3T A;  4GVM A;  1SKW A;  4A2A A;  4JI6 K;  2O8C A;  4BRA A;  4FJH A;  4XH5 A;  4OKJ A;  1F21 A;  5LJV A;  4JKE A;  4I2Q A;  5DM6 L;  4IBN A;  1BUP A;  1NMN A;  4N41 A;  1R59 O;  4OVL A;  3LDO A;  1TAQ A;  1VQ4 N;  5C12 A;  3V6D A;  1RDA A;  4J2B A;  5AQT A;  1DTQ A;  1Y97 A;  4DQR A;  4YNQ A;  4E0D A;  1N6Q A;  3WXL A;  3VEZ A;  2KQ2 A;  1NM1 A;  2YV0 X;  2WOM A;  5DM7 L;  3TR8 A;  4N47 A;  3FR0 A;  3ALY A;  4IOC L;  1YIT N;  1NGI A;  2FBX A;  4FPB A;  3KKR A;  2QWL A;  1NGA A;  4PHT X;  4H0O A;  2A5X A;  5JVH L;  3QO9 A;  2DY4 A;  1HUX A;  3ZX0 A;  1NK8 A;  2R7Y A;  3MN9 A;  2A6A A;  3OW2 M;  1O1W A;  1W7A A;  1LCU A;  3EE9 A;  4JK7 A;  1ZBS A;  1RDD A;  3DOK A;  4CEO A;  2ZJR L;  3MAQ A;  4H0X B;  4FJ9 A;  1V4T A;  4LH5 A;  5AZJ B;  3AV9 A;  2RE2 A;  3ULD A;  4ELV A;  1WSE A;  4BR9 A;  4CFC A;  2H3G X;  3OYC A;  4IJN A;  4FVU A;  2QWN A;  3OYA A;  2D0A A;  2E4L A;  4CHO A;  1NG9 A;  1NGD A;  1UA1 A;  3J81 O;  1ILY A;  4KV8 A;  4YOY A;  3OYF A;  1ZBU A;  3L8B A;  1ATR A;  1N36 K;  1RNH A;  3L0Q A;  4GV3 A;  3RMD A;  4XH4 A;  2ZJQ L;  2OPR A;  4JLH A;  1LWC A;  2QXF A;  4O0J A;  4A5A A;  1M1K O;  4H03 B;  3D2E A;  2Z1J A;  3LZI A;  3NH0 A;  3C6A A;  3OYD A;  2P9L A;  4NCG A;  5FRM A;  3OYE A;  5M1F A;  1RIL A;  5M1K A;  3WXK A;  3THV A;  4KB1 A;  2KFZ A;  4Z0U A;  4BQL A;  4CK1 A;  3O5B A;  1U2V B;  4C8O A;  1OVQ A;  4M3X A;  3MEC A;  3IUC A;  5LJW A;  1IKX A;  2V7Y A;  1YHQ N;  3THX B;  3T69 A;  4FZY A;  4EHU A;  4AHT A;  5KRS A;  3O4W A;  1LAV A;  4BG9 A;  2YHA A;  3QDK A;  1QZ5 A;  4A59 A;  1NJX A;  4DV4 K;  4F3O A;  1FJG K;  1QQO A;  2G8V A;  1Z25 A;  2BUP A;  3O8M A;  1GLL O;  1ATS A;  1ESV A;  3HTV A;  2VWK A;  5AQK A;  2WFB A;  2IOC A;  3A5M C;  3I8B A;  3NF7 A;  4E89 A;  3CCJ N;  1S6Q A;  3QEI A;  1N34 K;  2D4W A;  5KPT A;  3AO1 A;  3QIN A;  1XUP O;  3SAH A;  3K59 A;  1HR0 K;  1HYZ A;  3P83 D;  3BF3 A;  5AFU H;  5AZI B;  3AAQ A;  1WUA A;  5AQQ A;  1NKE A;  1JL1 A;  3A0I X;  3DXK B;  3MEE A;  1VK0 A;  4DSE A;  1RBS A;  4B1X B;  3U3G A;  2CGJ A;  4LY7 A;  5C25 A;  1EP4 A;  3OYB A;  2GEL A;  5F1X A;  5KPZ A;  4M3R A;  2V51 B;  3PIP L;  1VSJ A;  2QXL A;  4IKF A;  1XC9 A;  2E2O A;  5EY4 A;  4M3U A;  5KI6 A;  1HX1 A;  5IT9 O;  4Q5V A;  3SCX A;  2P1J A;  3L2V A;  1TK0 A;  4HWI A;  1XNR K;  4M3Z A;  4YDU A;  4FVM A;  3C6U A;  4BAC A;  5AQM A;  3CG7 A;  3J7Y P;  3CCV N;  4CEF A;  2NRT A;  4BRF A;  4CF2 A;  2UXB K;  2PZS A;  3SMS A;  3DLB A;  1YJ9 N;  1TL1 A;  2QWR A;  4NLB A;  4BDP A;  2W6L A;  3SV4 A;  1QVF M;  3F2K A;  5D3G A;  1SL1 A;  3EKS A;  3E9L A;  2O8C B;  3E01 A;  2HF3 A;  2HF4 A;  3OYI A;  4Z94 A;  3NH1 A;  2OZS A;  3VA3 A;  2DFH A;  3AVL A;  2XY6 A;  2RHK A;  4CZH A;  3T19 A;  2YJF A;  2OPS A;  5AQR A;  5KTQ A;  3T1H K;  4IOA L;  4DKW A;  1NGJ A;  1J5O A;  3RWU A;  3R6M A;  4PWD A;  4BWM A;  4YY3 K;  4G9Z A;  1K8K B;  3ID6 A;  5BR8 K;  2QW9 A;  1ZBH A;  2CH6 A;  4K41 A;  3CCS N;  3RSE B;  3QNN A;  1DEJ A;  3U8X A;  1TKD A;  4CZK A;  3KJV A;  4B3O A;  2PFU A;  4IZ9 A;  1NJI O;  1NK4 A;  4YFU A;  1XMO K;  2ZGY A;  1S9G A;  4LF8 K;  5I9E B;  2WC9 A;  3WXJ A;  4DF4 A;  4YOV A;  4JD2 B;  1W0H A;  1QHA A;  5BPL A;  1KFD A;  4CGG A;  3KIO A;  2IVN A;  2VWJ A;  4F2S A;  3SPZ A;  2YJE A;  4AHU A;  3AA4 A;  3KLH A;  2UUA K;  1A5X A;  2E1Y A;  3ZSQ A;  4DQI A;  3WEE A;  1RTJ A;  3LDS A;  5C42 A;  4BVP A;  4PA1 A;  2ITG A;  4K43 A;  2ITM A;  3G4S N;  1G15 A;  4BRQ A;  4FW1 A;  2P9K A;  3CYM A;  4A5B A;  4CJ5 A;  3R1X A;  4AHV A;  2NNW A;  3THY A;  1HYV A;  5JVG L;  4FM0 A;  2AP1 A;  1X9S A;  4DG1 A;  4ZTF A;  4KRF A;  1JCF A;  2O8E B;  1C0M A;  4WQ4 C;  2OAN A;  2OTJ N;  3KWI A;  2BH1 A;  1W2B M;  4YOW A;  4CF8 A;  5KQ8 A;  1R0A A;  1J9A A;  4FWO A;  4BR4 A;  1M90 O;  4JNE A;  2UXD K;  4YDU C;  3SLC A;  1RBU A;  1E4F T;  4IFY A;  4B9M A;  1BGX T;  3DRR A;  2PYL A;  4OPH A;  2Q2R A;  1TYQ B;  3K9K A;  3G71 N;  3FFI A;  4LF5 K;  4BC3 A;  3TI0 A;  4EZ6 A;  4AIL C;  1CZB A;  5FLX O;  3VQE A;  2A1R A;  1ZXO A;  4NCA A;  5BN8 A;  5AR0 A;  1DGK N;  2KHO A;  1D5A A;  3D0P A;  5LMU K;  1UOC A;  3JAM O;  3F5T A;  4O8K A;  4O44 A;  3C0B A;  3HI0 A;  3LWM A;  4GKK K;  4GV6 A;  3CC4 N;  3VA0 A;  2O8B A;  4FLU A;  1WSI A;  4FO0 A;  1KVC A;  4QS9 A;  2J4R A;  3FE1 A;  3CER A;  2Q0R A;  2F9T A;  3TTF A;  3L2W A;  3EY1 A;  3ZT0 A;  3GOI A;  2UXC K;  5AQH A;  3VEN A;  3CJA A;  4FJJ A;  2YCH A;  1SAZ A;  4FJG A;  4RWT A;  3T1A A;  1O13 A;  4PL7 A;  1YJW N;  1WSH A;  3BGR A;  3VN5 A;  1IO2 A;  2DTU A;  1DLO A;  3PSF A;  4M41 A;  2A1S A;  2JWK A;  3KKS A;  1MA9 B;  3QEX A;  4CGD A;  1KVA A;  1VSM A;  1VHX A;  4DTN A;  4N56 A;  1LAW A;  4I9Q A;  3L4Q A;  4OPK A;  4KTZ A;  3CCM N;  1XWL A;  1RBV A;  1NK5 A;  1Q9Y A;  3VPZ A;  2HHX A;  4BQZ A;  4BRM A;  3NGZ A;  4DTR A;  2QKB A;  3ULE A;  1VQO N;  4CJ4 A;  5HP1 A;  4MFB A;  3FZK A;  1MWM A;  2F9W A;  1IBK K;  4CHQ A;  2EX3 A;  3AVA A;  4DV5 K;  2VGN A;  2AA4 A;  1HRH A;  2HHW A;  3MCA B;  5AQV A;  3PIO L;  3V9S A;  1RT7 A;  5KGX A;  3UKU B;  3KK3 A;  3CQX A;  5KPR A;  4JKH A;  1X3M A;  3HPO A;  3QNO A;  2ASO A;  1SL2 A;  2B5J A;  2X74 A;  3MWP A;  3DLH A;  2FLO A;  4K8Z A;  1U49 A;  3FZF A;  3OBY A;  3MXM A;  1Q81 O;  2RF2 A;  5LL6 Z;  2YHW A;  3CM5 A;  2NRR A;  5I42 A;  5FPN A;  3SUN A;  3ITH A;  1VSI A;  3H1V X;  5LMN K;  2YNG A;  2B4J A;  4QS7 A;  3V4I A;  2HMP A;  2ASP A;  1L3S A;  4OGE A;  1GLB G;  2HBL A;  1SV5 A;  1RGI A;  4JI7 K;  1KFS A;  2FSJ A;  1BWF O;  3TAR A;  2BGG A;  2Q31 A;  4OX9 K;  2F96 A;  3L3U A;  4BRO A;  3RMA A;  1KAY A;  2VWB A;  3DM2 A;  3CJ7 A;  3CI5 A;  3H3O B;  2VG5 A;  5AQF A;  4GNI A;  3H46 O;  3CF5 L;  4ID5 A;  4MLH A;  3T1Y K;  4B3R K;  2HHV A;  2EHG A;  3ATV A;  3LDN A;  4AHR A;  4E7H A;  3LAL A;  5AQY A;  4Z4E A;  1HQU A;  3ZSW A;  4FJ5 A;  2IVP A;  3QIO A;  3SAG A;  2E2Q A;  1FW6 A;  4CW7 B;  3BEX A;  1QSL A;  4BR2 A;  1N33 K;  2FBV A;  3U6F A;  1ZC6 A;  4NXM K;  3P4I A;  4JN4 A;  3SUO A;  4ICL A;  1SZ2 A;  3C6H A;  4F2R A;  2HHH K;  5J2N A;  5HRO A;  4JS4 A;  1HQE A;  3SBG A;  1GLC G;  3RRH A;  1S6P A;  4H8K A;  3SI6 A;  3CCR N;  4FW2 A;  4EP5 A;  4BR5 A;  4NYF A;  4JI1 K;  4CF1 A;  1L3U A;  3NAE A;  1XC3 A;  2IDO A;  4FPA A;  3OJS A;  3ZYY X;  3CJB A;  3J80 O;  5AQJ A;  3AVM A;  2ZE2 A;  3HM8 A;  3G25 A;  3NCI A;  4A2B A;  4M63 C;  2QK9 A;  3J7A P;  4DQP A;  1H1V A;  3NGI A;  2BTF A;  5HRS A;  4Y1C A;  4JRP A;  3MXI A;  3AAR A;  1JL2 A;  4JV5 K;  1WSF A;  1W97 L;  3O1W A;  4B1U B;  1IG9 A;  4EFH A;  2P9U B;  4ISF A;  4CGJ A;  4IO9 L;  3NF9 A;  3DRP A;  3ZSO A;  5BRH A;  2Q3S A;  4RTF D;  2PY5 A;  1LV5 A;  5CY4 A;  4KBO A;  1RDB A;  1OH6 A;  3O08 A;  3B8A X;  1NGC A;  4BR7 A;  2V52 B;  3KVG A;  3EYZ A;  3V1O A;  4UQG A;  3R3L A;  4IWV A;  3SQ1 A;  2FBY A;  3TTD A;  4E1J A;  1QS4 A;  4DLE A;  2KFN A;  4O55 A;  1Y64 A;  2Q97 A;  4GVE A;  3VQ6 A;  4DTP A;  4CJE A;  2NRV A;  3P5J A;  4QOZ B;  2GWK A;  1S1T A;  3T7Z A;  3WNH A;  1RTH A;  4BG8 A;  4B9U A;  5JLF A;  4NO7 A;  3VEO A;  1QQC A;  1BI4 A;  2OA8 A;  4O0I A;  3EEQ A;  3K58 A;  5HLF A;  3O9T A;  3QER A;  2P9P B;  4OPA A;  4CJT A;  3DLL L;  4CFD A;  4J2A A;  3LP3 A;  5CZ1 A;  4BE0 A;  3M5R A;  1SQK A;  4MDA A;  4JKG A;  1XMQ K;  4KKO A;  2XY8 A;  3KLI A;  3HSC A;  2E6L A;  3GE1 A;  2I7P A;  3SQ0 A;  3VGL A;  1MU2 A;  1KVB A;  3H08 A;  2A42 A;  3KK7 A;  5I3U A;  1EX4 A;  1TKX A;  1WN7 A;  2P9N B;  3IS9 A;  3O9Q A;  1HNV A;  1VQP N;  4ELU A;  4JKF A;  1OVY A;  3ENB A;  3QEV A;  4BE1 A;  1UAX A;  1SS6 A;  4Z4C A;  2IVO A;  4HUF A;  1J54 A;  2O8F A;  2G8W A;  1Z6R A;  4C8N A;  1LOT B;  4DV3 K;  2I7N A;  4M7Y A;  3VQ9 A;  3VTH A;  4WFB L;  4IEE A;  3DLK A;  4E7J A;  1RT2 A;  4NCB A;  1HJO A;  1QQN A;  2LSN A;  2OPP A;  3NVK A;  3S3M A;  3VER A;  3G6E N;  3A2F A;  2FXU A;  4KI4 A;  2BAN A;  2RN2 A;  4A57 A;  2HW3 A;  3S41 A;  3LL3 A;  1GLF O;  4PKH A;  4AF1 A;  4DV1 K;  4BRK A;  1XI1 A;  3DLR A;  3GL1 A;  3EE8 A;  1RBR A;  5AQG A;  4XEI A;  3ASM A;  4BC5 A;  1J5E K;  4H5T A;  4JAX A;  3K0S A;  4KHN A;  4AM6 A;  1RT3 A;  2QEX N;  2Q36 A;  3NBP A;  3DOL A;  1E4G T;  3TAM A;  5C24 A;  4CEE A;  3A5L C;  1WSG A;  4O4G A;  4CI6 A;  3PO4 A;  4DU1 A;  4F8R A;  3UE5 A;  5AQZ A;  4B9N A;  4QCL A;  4LF7 K;  3AO5 A;  1OKJ A;  3AVK A;  3VMF B;  4WQ5 C;  1L5U A;  4A62 A;  2HVI A;  3O3G A;  3F9M A;  1N8R O;  3C7N A;  3ZEU A;  1YTU A;  4FJ7 A;  4E7L A;  3EN9 A;  5GAE P;  3D2F A;  4XIU A;  3CCU N;  1WB9 A;  3FLC O;  1G99 A;  5KRT A;  2YKM A;  3L2R A;  5HBM A;  4DU3 A;  3CFO A;  4CJR A;  4AHC A;  3N4P A;  1NK6 A;  2OYQ A;  4JI0 K;  3LPU A;  1Z05 A;  3MX5 A;  1IG8 A;  4C1N I;  2XY5 A;  4OLA A;  1KCF A;  1HJR A;  2EWS A;  1EQY A;  4CER A;  3DAW A;  2I5J A;  4J2D A;  4GKJ K;  1B92 A;  3MDQ A;  1YIJ N;  5TKW A;  3AVH A;  2V7Z A;  1U6Z A;  2VG6 A;  3THW B;  2O8D B;  4Y0W A;  3DMJ A;  4FXD A;  1BIS A;  4M45 A;  5M1Q A;  1W9H A;  5ADX A;  3O3H A;  1U48 A;  3NMU A;  2P9I A;  2FBT A;  3I0S A;  4DFM A;  1S5J A;  4BE2 A;  2QWP A;  1REV A;  4BRG A;  1X9W A;  3NFA A;  1C1C A;  3QBX A;  1HPM A;  1YVU A;  2HHU A;  1S1V A;  1RBT A;  3DLG A;  1VAZ A;  2XY7 A;  2ZQB A;  4GW6 A;  1NGG A;  3NE6 A;  1L3V A;  1KRP A;  3CPE A;  2IC3 A;  3OYM A;  3NH2 A;  3C65 A;  1VQK N;  4C1N K;  1J53 A;  4E19 A;  5CHI A;  3EZW A;  1BDG A;  2VQF K;  4RW4 A;  3I8D A;  2W41 A;  3KHY A;  4JHD B;  3OS2 A;  3O6W A;  1QZ6 A;  4CVN E;  4CJP A;  5AQX A;  4BDY A;  4BC2 A;  1WBB A;  4H0T B;  2P5G A;  1MDU B;  1BCO A;  3RR8 A;  5F0X A;  4CJ3 A;  3E1Y A;  4JKG B;  5KQD A;  3SAF A;  4BRD A;  4E1N A;  3DI6 A;  4A61 A;  3FZL A;  3BF1 A;  5BRF A;  3JSM A;  3OHR A;  3HVT A;  3J7Z O;  1NGF A;  3TAF A;  3MX2 A;  4LFC K;  3IAY A;  4CJK A;  5FRN A;  3RVC A;  1I39 A;  4BRN A;  1BIZ A;  3LP2 A;  4JYA K;  2O8F B;  1FKO A;  4FCY A;  2HB5 A;  1HNI A;  1YVN A;  5C15 A;  3QES A;  2Z1I A;  1ATN A;  5JS2 A;  3ZSZ A;  4FJL A;  2ATQ A;  5C0Y A;  3OYJ A;  2P5O A;  3U9D A;  1YF5 L;  3KK2 A;  4KHS A;  3VEY A;  3ZET A;  4C8K A;  2ASM A;  3CHW A;  3ZX3 A;  4B9V A;  4CIG A;  2YI1 A;  3M3Z A;  1LW2 A;  5SWM A;  1BCM A;  5J2M A;  3K9J A;  3I55 N;  4CGF A;  1JLA A;  5CR4 A;  4JI2 K;  3PY8 A;  3BDP A;  4KAZ A;  1JCE A;  4H0V B;  1GOC A;  4ID1 A;  3HM9 A;  1WLJ A;  4KH6 A;  3I33 A;  3RMB A;  5CZ2 A;  2QTD A;  1ZBL A;  3A5O C;  4CEA A;  4J2E A;  1LWF A;  3D2E B;  1QSS A;  3VQ7 A;  3E9P A;  3LDL A;  3AAP A;  4RW7 A;  4YOU A;  4JEP A;  2P9L B;  4MQ3 A;  3BUZ B;  3VET A;  4CEZ A;  4EAH D;  1TK5 A;  1QTM A;  4FLZ A;  4B1V A;  4DFP A;  3AGR A;  3QIC A;  2UYT A;  3H6E A;  4DR1 K;  1B9D A;  3PLA A;  4H4O A;  2HOE A;  2WON A;  1VRT A;  2YNH A;  4PL8 A;  4R79 A;  3VQP A;  3SQ4 A;  3VQD A;  1EO1 A;  1RT4 A;  3B6P A;  4RG8 A;  4DU4 A;  4KHP K;  1JLE A;  2Q0U A;  2CH5 A;  4FZZ A;  1T44 A;  4DMN A;  3CMA N;  4LSN A;  3ZSR A;  4B9S A;  1YXQ A;  4FJI A;  4FJK A;  3SPY A;  1JKH A;  2GV9 A;  3SV3 A;  5GAG P;  1T8E A;  2F8T A;  3OBW A;  3OVN A;  4PQU A;  3MN5 A;  5HRR A;  1YJN N;  3VQQ A;  4TSX A;  1L3T A;  5FPD A;  3ATU A;  4JKC A;  1WSJ A;  5J1E A;  1N32 K;  4BR0 A;  4FYD A;  5KGW A;  3U9Z A;  3AGK A;  2D5R A;  4KO0 A;  1SL0 A;  1HPZ A;  4DSJ A;  1VSD A;  3DLE A;  1ASW A;  5T7B A;  1KD1 O;  1KAX A;  5B8H A;  1CXQ A;  2Y1J A;  3CJ1 A;  2GUP A;  1I94 K;  1QVG M;  2G8F A;  2D0C A;  3HVR A;  2QM1 A;  4HTL A;  4BRH A;  3V9U A;  2X78 A;  3A8Y A;  3VTI A;  1JLF A;  4BRL A;  1NK7 A;  2AJQ A;  4LSL A;  2VYP A;  4BC4 A;  3HBT A;  4CHN A;  4H0Y B;  1RCH A;  4BRP A;  1GOA A;  4KHU A;  2NZT A;  1NGE A;  1TUY A;  3ZLJ A;  3WQU A;  1TVR A;  3VQ5 A;  3CM6 A;  3SMP A;  1BOT O;  3QBW A;  4GV9 A;  4JI4 K;  5C2D A;  4JKD A;  1LW0 A;  3VQ8 A;  5EX5 A;  3P1G A;  4IEI A;  3JS6 A;  3VEW A;  4DQQ A;  3VEX A;  3PUF A;  1JJ2 M;  3FFK B;  3AVN A;  1C1B A;  1N5Y A;  5JMV A;  4DTO A;  1HMV A;  4DHY A;  4DTX A;  3ENO A;  4W5N A;  1RT5 A;  3RRG A;  2X6S A;  1KLN A;  1CZ9 A;  3MED A;  1FK9 A;  5JS1 A;  2E8A A;  4PY5 A;  5J2P A;  4W5T A;  4M7X A;  4EP4 A;  2NRX A;  4CBW A;  2P51 A;  3IRX A;  4RW8 A;  1GLJ O;  2X6N A;  2HST A;  2BE2 A;  1S1W A;  4I7F A;  4CJF A;  1C1A A;  2HBJ A;  3AVC A;  3OYL A;  3KLF A;  2FF3 B;  5AZJ A;  3OY9 A;  3QB0 A;  1X9M A;  3FZM A;  3M8S A;  4DV2 K;  5E84 A;  3W0L A;  2NUB A;  4DV7 K;  3P39 A;  2Q1N A;  3DYA A;  3O9R A;  3MN7 A;  3KWG A;  4B1Z A;  2XHB A;  2E6M A;  4RCH A;  2HVH A;  4DSK A;  3EO3 A;  2HHS A;  1TKT A;  1HLU A;  2IS3 A;  1VQ5 N;  1TUU A;  4NLC A;  3AVF A;  4BDZ A;  3I56 N;  3AO2 A;  4FWN A;  4LFB K;  4CGH A;  5K14 A;  4BWJ A;  4WCE L;  4KFB A;  3OYK A;  4K25 A;  5TKY A;  4IOX A;  4R5P A;  3WEE B;  4E7K A;  2B6A A;  4B08 A;  1U45 A;  4EIA A;  3WNE A;  3CCQ N;  3NF6 A;  1SKR A;  2PAV A;  1S1X A;  3AVG A;  2ZWH A;  4AQY K;  2KTQ A;  5AQO A;  2P9K B;  1CZA N;  5GIP A;  4NB4 A;  2OPQ A;  4ISG A;  1YT3 A;  3THY B;  4BGB A;  4QAG A;  2UUC K;  2ZF5 O;  4I6M A;  4JKA A;  4CFA A;  1NJZ A;  1IV0 A;  3THX A;  1HNZ K;  4MO4 A;  1NK9 A;  4FLX A;  2YHB A;  4FL9 A;  1TGO A;  1NKB A;  1X1P A;  2ZJP L;  4BVO A;  2QWQ A;  4CK3 A;  1XHX A;  2E1Z A;  1HYS A;  2ETJ A;  3M8P A;  4IFV A;  3GBT A;  1ITG A;  4LF4 K;  4CJQ A;  4CF0 A;  2Z1H A;  1FKP A;  3HZ6 A;  4O5F A;  2A40 A;  3NGY A;  3VGK A;  4KH4 A;  4JI3 K;  4X64 K;  2NRH A;  3UKR A;  1GLE G;  4BY9 C;  4LC9 B;  4DQ8 A;  5BR9 A;  3HP9 A;  1KAZ A;  2O8B B;  1ZBF A;  4DCH A;  5GIO A;  2GEM A;  3PX4 A;  1HNW K;  1JCG A;  4HCC A;  3SUQ A;  4M3W A;  3S9H A;  4W5Q A;  3VF2 A;  3M6G A;  5E41 A;  3R8E A;  1HKB A;  4FK2 A;  4DV0 K;  2FF6 A;  4KB0 A;  3VQC A;  5EU7 A;  5GAH P;  3AA3 A;  3ZT1 A;  5C10 A;  4EZ9 A;  4CJV A;  5AQP A;  3H45 C;  2FC0 A;  3TAE A;  1E3M A;  3CJ9 A;  3MMV A;  4L8R B;  1NNE A;  3PX0 A;  1JLC A;  1KLM A;  4DR3 K;  3B6O A;  4C23 A;  3PV8 A;  3TPQ A;  1X3N A;  4YHH K;  3TAB A;  4DB3 A;  4HVJ A;  2E2N A;  3I0R A;  3AO4 A;  1D9F A;  3HK2 A;  4FLV A;  5CE3 A;  1NMD A;  1WNS A;  3ULE B;  3O1B A;  1NLV A;  3MK6 A;  3OA9 A;  1EET A;  4JK9 A;  4F4K A;  2E20 A;  1TK8 A;  3HST B;  3CXC M;  3CC2 N;  3ZT3 A;  2UU9 K;  4BRE A;  4M3T A;  1KSP A;  4DSF A;  3G0Z A;  2GBZ A;  4WYB A;  3VGM A;  3C94 A;  3ZSX A;  3C6T A;  4CZI A;  3S3O A;  3HL8 A;  1K8K A;  4EHT A;  2Y1I A;  5BRE A;  5CYQ A;  4HUG A;  1UWB A;  3CCE N;  4ILH A;  5AQI A;  3V81 A;  3L2Q A;  3KTQ A;  4ILG B;  3KK1 A;  1X9J A;  2QA4 N;  3V9W A;  3RSE A;  1JXB A;  4HUE A;  3CPW M;  3SNN A;  1T05 A;  4CJL A;  3HPG A;  4CIF A;  3OS0 A;  2YHX A;  3SUP A;  3CIP A;  3ID8 A;  1GLA G;  4FK0 A;  1FXX A;  3AVJ A;  1GOB A;  3J8A A;  4FLT A;  2NRZ A;  4Q0B A;  1DT9 A;  3QFU A;  4JD2 A;  1BO5 O;  3AO3 A;  1NK0 A;  3IFR A;  3KD1 E;  1VQL N;  3KLE A;  1Q7Y O;  1KTQ A;  3MN6 A;  4DUY K;  5HL7 L;  2D0B A;  2JLE A;  1WAJ A;  3D6R A;  2IIR A;  4CFB A;  4V19 S;  3DXM A;  4DUZ K;  4ILJ A;  4K0K K;  4LF6 K;  1U04 A;  2W40 A;  5JLH A;  2PBD A;  5EXW A;  3E9O A;  1VQ6 N;  5BN9 A;  1IKW A;  3CJC A;  4MDB A;  2O8E A;  1RDU A;  4H5N A;  2WUS A;  5GIN A;  5J2Q A;  1GLD G;  4ZHR A;  1NJW A;  4IDK A;  4CIE A;  4CZL A;  4AHS A;  4DFK A;  3AVI A;  4LF9 K;  3HYF A;  3IG1 A;  1WOQ A;  4KTW A;  3V9X A;  5ADX H;  2CGL A;  1BL3 A;  4B9L A;  3EL2 A;  3D45 A;  4WE1 A;  4CJU A;  4CJS A;  3S3N A;  4DTM A;  1RT6 A;  2XRI A;  1NJY A;  2CGK A;  1TYQ A;  5AQL A;  2NRW A;  1TL3 A;  3TWH A;  1TV6 A;  1D4X A;  5H1S Q;  1KC8 O;  4YOT A;  3FGU A;  4FWP A;  3VOV A;  2OZM A;  1ZBI A;  4IG3 A;  1KXP A;  3QML A;  1DTT A;  3HRG A;  3OYG A;  1WBD A;  2YNI A;  3CME N;  2HNY A;  5ELZ A;  4I6M B;  4FZX C;  4Z4F A;  3BP8 A;  3LAM A;  1T6C A;  1Q18 A;  1K8A O;  1LWE A;  3EKU A;  4CF9 A;  2F8S A;  4B9Q A;  2F4V K;  3V1R A;  1KQS M;  1K6Y A;  4GY2 B;  4CD3 A;  3ZX2 A;  1C0U A;  3VF6 A;  4CE9 A;  4CJ7 A;  3FZH A;  3LP1 A;  3V9Z A;  4FM2 A;  3NVM A;  4W5O A;  4X66 K;  2GWJ A;  4IFE A;  3HJF A;  5AQW A;  3VQB A;  3IKM A;  3LPT A;  5F2R A;  1IKY A;  3T3F A;  4LFA K;  3U4L A;  2HNZ A;  2PYJ A;  4KHW A;  3UKR B;  3CD6 N;  3ZT2 A;  4B1Y B;  3VES A;  3L3V A;  4DFJ A;  1IBL K;  4ZTJ A;  4FJM A;  1UA0 A;  1A5W A;  3O9S A;  1T6D A;  3IDH A;  2YKN A;  1ZYQ A;  2HHQ A;  4H0P A;  4WQ4 A;  3F9K A;  2RKI A;  3OYH A;  3CQY A;  4K8X A;  4OKE A;  5LY3 A;  1RTI A;  1T7P A;  4FWS A;  5CYM A;  4DR5 K;  1NGB A;  4DLG A; 
#chains in the Genus database with same CATH homology
 4F2R A;  5J2N A;  5HRO A;  4LSN A;  3ZSR A;  4B9S A;  4FJI A;  4JS4 A;  1HQE A;  4FJK A;  3G10 A;  3QO9 A;  3SPY A;  1JKH A;  2DY4 A;  2GV9 A;  3AA2 A;  3SV3 A;  1NK8 A;  1BQN A;  2R7Y A;  1T8E A;  2F8T A;  3OVN A;  3RRH A;  3U3Y A;  1S6P A;  3SJJ A;  5FDL A;  4PQU A;  1O1W A;  5HRR A;  4H8K A;  3VQQ A;  3SI6 A;  4TSX A;  1RDD A;  3DOK A;  2KW4 A;  3K2P A;  4CEO A;  4FW2 A;  1L3T A;  3MAQ A;  4FJ9 A;  1BI4 B;  1WSJ A;  2Z1G A;  5J1E A;  4EP5 A;  4FYD A;  4NYF A;  5KGW A;  4CF1 A;  4KO0 A;  2D5R A;  1L3U A;  3NAE A;  1SL0 A;  1HPZ A;  2IDO A;  1VSD A;  3AV9 A;  1ASW A;  3DLE A;  4LH5 A;  5T7B A;  3OJS A;  3ULD A;  4Z4H A;  4ELV A;  1WSE A;  4H4M A;  4CFC A;  1EKE A;  3OYC A;  1CXQ A;  1WAF A;  4KTQ A;  3OYA A;  2Y1J A;  3AVM A;  2D0A A;  2E4L A;  2ZE2 A;  4CHO A;  3NDK A;  2DFE A;  1UA1 A;  3NCI A;  2G8F A;  3LP0 A;  2D0C A;  3HVR A;  1S1U A;  4KV8 A;  3V9U A;  2QK9 A;  4DQP A;  2X78 A;  3NGI A;  3OYF A;  3HXM A;  1ZBU A;  1VSL A;  3L8B A;  1JLF A;  5HRS A;  4Y1C A;  4JRP A;  1NK7 A;  2AJQ A;  4LSL A;  3MXI A;  1IH7 A;  1RNH A;  1JL2 A;  3CQ8 A;  4CHN A;  1D8Y A;  3RMD A;  2OPR A;  4NYN A;  4JLH A;  1LWC A;  1RCH A;  2QXF A;  1GOA A;  4KHU A;  3HO1 A;  4O0J A;  1WSF A;  3KD5 E;  1IG9 A;  1TVR A;  3LZI A;  2Z1J A;  3VQ5 A;  3M8Q A;  1BHL A;  3CM6 A;  3NH0 A;  3OYD A;  3CFR A;  4CGJ A;  4NCG A;  5FRM A;  3OYE A;  3QIP A;  3NF9 A;  3DRP A;  3ZSO A;  1RIL A;  2QKK A;  1D9D A;  2Q3S A;  3THV A;  2PY5 A;  4KB1 A;  1LV5 A;  5CY4 A;  4CED A;  2KFZ A;  1LW0 A;  3VQ8 A;  4Z0U A;  4FK4 A;  4CK1 A;  2W42 A;  4OGC A;  2HND A;  3P1G A;  4C8O A;  4RW6 A;  1RDB A;  3CFP A;  3RMC A;  4DQQ A;  4M3X A;  3PUF A;  3AVN A;  1C1B A;  1N5Y A;  3MEC A;  3EYZ A;  3RTV A;  4OLB A;  3V1O A;  4IG0 A;  4UQG A;  4DTO A;  1HMV A;  3OS1 A;  3SQ1 A;  2FBY A;  4DTX A;  4W5N A;  1RT5 A;  1IKX A;  2KFN A;  1QS4 A;  4DLE A;  3RRG A;  4O55 A;  2X6S A;  4FZY A;  4CHP A;  1KLN A;  1CZ9 A;  3MED A;  4AHT A;  4HCB A;  5KRS A;  3O4N A;  4DSJ A;  1FK9 A;  1LAV A;  3VQ6 A;  5JS1 A;  1QHT A;  4DTP A;  4PY5 A;  4HTU A;  5J2P A;  4C8L A;  2YHA A;  4E7I A;  4CJE A;  4W5T A;  1U47 A;  1NJX A;  4EP4 A;  4F3O A;  3P5J A;  2G8V A;  2P51 A;  1ASU A;  1Z25 A;  3IRX A;  4QOZ B;  1S1T A;  2GUI A;  1CLQ A;  4ELT A;  3WNH A;  4RW8 A;  2X6N A;  1RTH A;  4DTJ A;  4B9U A;  2VWK A;  3ISN C;  4FLW A;  2IOC A;  1I3A A;  4FLY A;  4GMJ B;  3NF8 A;  3NF7 A;  2BE2 A;  1S1W A;  1QQC A;  1BI4 A;  4E89 A;  1S6Q A;  4O0I A;  3K58 A;  3QEI A;  5HLF A;  4I7F A;  4CJF A;  1C1A A;  3OYL A;  3AVC A;  4CEQ A;  3KLF A;  3QER A;  3AO1 A;  3QIN A;  4CJT A;  3OY9 A;  4CFD A;  4J2A A;  3AA5 X;  3LP3 A;  3SQ2 A;  5CZ1 A;  4BE0 A;  1NOZ A;  1X9M A;  3K59 A;  1HYZ A;  4Y1D A;  3P83 D;  2XY8 A;  3KLI A;  4KKO A;  1VSH A;  3M8S A;  1XHZ A;  2E6L A;  3ZSY A;  1Q8I A;  3SQ0 A;  1MU2 A;  1KVB A;  1Q9X A;  4I2P A;  1JL1 A;  2NUB A;  2RPI A;  3H08 A;  3MEE A;  1VK0 A;  5I3U A;  1EX4 A;  1NKE A;  1TKX A;  3DYA A;  3K5L A;  4DQS A;  1RTD A;  4DSE A;  1RBS A;  4M3Y A;  2XHB A;  2E6M A;  3U3G A;  2HVH A;  4LY7 A;  5C25 A;  1EP4 A;  1WN7 A;  3IS9 A;  3OYB A;  1HNV A;  4ELU A;  4M3R A;  3TAG A;  1VSJ A;  3QET A;  4DSK A;  4KPY A;  4IKF A;  3QEV A;  2HHS A;  1XC9 A;  1TKT A;  2IS3 A;  1UAX A;  4CHY A;  4BE1 A;  4O5B A;  2ZD1 A;  1QSY A;  4M3U A;  4Z4C A;  5KI6 A;  1B9F A;  1CXU A;  3AVF A;  4BDZ A;  4HUF A;  3AO2 A;  5DK5 A;  1J54 A;  4CGH A;  5K14 A;  4Q5V A;  3SCX A;  2P1J A;  3L2V A;  4BWJ A;  4E3S A;  1TK0 A;  4KFB A;  2G8W A;  4C8N A;  3OYK A;  3NHG A;  2HMI A;  4M3Z A;  5HRN A;  4FVM A;  4R5P A;  3C6U A;  3L2U A;  4E7K A;  3OYN A;  2B6A A;  4B08 A;  4JS5 A;  1U45 A;  3HPH A;  3VQ9 A;  4BAC A;  3WNE A;  3CG7 A;  3NF6 A;  1SKR A;  4G1Q A;  1C0T A;  1S1X A;  4AH9 A;  4CEF A;  3AVG A;  4CF2 A;  2KTQ A;  1RDC A;  3DLK A;  4E7J A;  1RT2 A;  4NCB A;  4KHQ A;  2LSN A;  2OPP A;  2DFF A;  3C95 A;  4OPJ A;  3M8R A;  1TL1 A;  2OPQ A;  4JRQ A;  3S3M A;  3VQA A;  3DLB A;  1JXE A;  1YT3 A;  4PUO A;  4CCH A;  4BDP A;  3QEW A;  4QAG A;  3SV4 A;  3A2F A;  4KI4 A;  2BAN A;  4KRE A;  4CHZ A;  4CFA A;  2RN2 A;  1NJZ A;  5D3G A;  1SL1 A;  2HW3 A;  1NK9 A;  4FLX A;  1NKC A;  1QE1 A;  2YHB A;  3E01 A;  1JLG A;  3OYI A;  3NH1 A;  2G8U A;  2OZS A;  1TGO A;  3VA3 A;  1X1P A;  2DFH A;  3AVL A;  2XY6 A;  3TAN A;  1NKB A;  4E1M A;  3VQ4 A;  1XI1 A;  3DLR A;  4CK3 A;  3T19 A;  1XHX A;  1RBR A;  1HYS A;  2ETJ A;  3M8P A;  3ASM A;  3DRS A;  2OPS A;  5KTQ A;  2KZM A;  4B9T A;  4IFV A;  1ITG A;  4DTS A;  4KHN A;  1RT3 A;  4CJQ A;  1J5O A;  3NBP A;  4CF0 A;  4FJX A;  2Z1H A;  3RWU A;  3DOL A;  4PWD A;  4BWM A;  1FKP A;  4OKK A;  3NGY A;  3TAM A;  3HP6 A;  5C24 A;  3LZJ A;  4CEE A;  1WSG A;  4O4G A;  3F73 A;  4DWI A;  3PO4 A;  4DU1 A;  4DSL A;  1ZBH A;  4F8R A;  3HP9 A;  4B8A B;  3K5M A;  3QNN A;  1ZBF A;  1TKD A;  4B9N A;  3KJV A;  4QCL A;  3AO5 A;  3AVK A;  3SYZ A;  4B3O A;  3RR7 A;  3HT3 A;  3PX4 A;  1L5U A;  2PZS A;  2HVI A;  4N76 A;  3O3G A;  1NK4 A;  3SUQ A;  4YFU A;  1SUQ A;  3S9H A;  4HCC A;  4M3W A;  2OA8 A;  2HHT A;  4W5Q A;  1S9G A;  1YTU A;  3OJU A;  4FJ7 A;  2G8I A;  5E41 A;  4E7L A;  1A5V A;  4DF4 A;  3QEP A;  4FK2 A;  4XIU A;  1W0H A;  3VQC A;  4KB0 A;  1KFD A;  5EU7 A;  4CGG A;  3AA3 A;  3KIO A;  2VWJ A;  4F2S A;  3ZT1 A;  3SPZ A;  4EZ9 A;  4AHU A;  5KRT A;  4CJV A;  3AA4 A;  3KLH A;  1U4B A;  3AVB A;  1A5X A;  2FC0 A;  3TAE A;  3ZSQ A;  2YKM A;  3L2R A;  4DQI A;  1RTJ A;  5HBM A;  4DU3 A;  3LDS A;  5C42 A;  4L8R B;  3PX0 A;  1JLC A;  1KLM A;  3CFO A;  4PA1 A;  4AHC A;  2ITG A;  4CJR A;  4CES A;  1G15 A;  3B6O A;  1NK6 A;  2OYQ A;  3PV8 A;  3LPU A;  4OLA A;  4FW1 A;  2XY5 A;  3CYM A;  1KCF A;  3WNF A;  4CJ5 A;  3TAQ A;  1HJR A;  4AHV A;  3TAB A;  4CER A;  4HVJ A;  1HYV A;  4CJW A;  4FM0 A;  1C6V A;  3AO4 A;  2I5J A;  3I0R A;  4FM1 A;  1X9S A;  4DG1 A;  4ZTF A;  1D9F A;  3UIQ A;  4J2D A;  1B92 A;  4FLV A;  4KRF A;  1C0M A;  1WNS A;  1VSK A;  3AVH A;  4CEC A;  2VG6 A;  3K5O A;  1EET A;  2YNF A;  4DF8 A;  4F4K A;  4CF8 A;  3DMJ A;  1TK8 A;  1BIS A;  4CK2 A;  1J9A A;  3HST B;  1R0A A;  4FXD A;  4M45 A;  3O3H A;  1W9H A;  3HK2 A;  1IKV A;  1U48 A;  3ZT3 A;  3JYT A;  1BQM A;  2FBT A;  3I0S A;  4DTU A;  4M3T A;  4DFM A;  1S5J A;  1KSP A;  1RBU A;  4IFY A;  4BE2 A;  4DSF A;  3G0Z A;  3PO5 A;  1REV A;  4B9M A;  1X9W A;  1BGX T;  1C1C A;  1BIU A;  2GBZ A;  3NFA A;  3ZCM A;  4KI6 A;  1YVU A;  3DRR A;  5SZT A;  2PYL A;  3FFI A;  3C94 A;  3ZSX A;  3O3F A;  1S1V A;  1VRU A;  3C6T A;  3TI0 A;  3S3O A;  3HL8 A;  2HHU A;  4EZ6 A;  4AIL C;  1CZB A;  1RBT A;  3DLG A;  3VQE A;  2Y1I A;  2A1R A;  4NCA A;  2XY7 A;  3LAK A;  2ZQB A;  4GW6 A;  1D5A A;  5CYQ A;  4HUG A;  3D0P A;  1UWB A;  1UOC A;  3SZ2 A;  3V81 A;  3NE6 A;  1RT1 A;  1L3V A;  1KRP A;  3L2Q A;  3KTQ A;  4O44 A;  2IC3 A;  4CGI A;  3NH2 A;  3OYM A;  3KK1 A;  1JXB A;  5DMR A;  3LWM A;  4HUE A;  3V9W A;  3VA0 A;  1J53 A;  4E19 A;  2XO7 A;  3SNN A;  4C8M A;  1S9E A;  4FLU A;  1WSI A;  1T05 A;  1KVC A;  4DSI A;  4CJL A;  3HPG A;  1JLQ A;  4RW4 A;  3I8D A;  3MXJ A;  4KHY A;  5HRP A;  4CIF A;  4N5S A;  3OS0 A;  3KLG A;  2JGU A;  3L2W A;  3ZT0 A;  3EY1 A;  2G8H A;  3SUP A;  1JLB A;  3OS2 A;  4FK0 A;  4FJJ A;  1FXX A;  3AVJ A;  1GOB A;  4CJP A;  4FLT A;  4Q0B A;  4FJG A;  4BDY A;  3AO3 A;  3T1A A;  1NK0 A;  3KD1 E;  1NOY A;  3KLE A;  1WSH A;  1KTQ A;  3BGR A;  3VN5 A;  1SKS A;  1IO2 A;  3MEG A;  2P5G A;  1BCO A;  2DTU A;  1DLO A;  3ZT4 A;  3RR8 A;  1YTA A;  3O4Q A;  2D0B A;  4M41 A;  2A1S A;  2JLE A;  3PX6 A;  1WAJ A;  3KKS A;  3QEX A;  4CFB A;  4CGD A;  4CJ3 A;  1KVA A;  1VSM A;  3LAN A;  4DTN A;  4N56 A;  4FJ8 A;  1LAW A;  3QLH A;  4E1N A;  3K5N A;  4I9Q A;  4OPK A;  3DI6 A;  4KTZ A;  1U04 A;  2IGI A;  1XWL A;  3JSM A;  2IAJ A;  3HVT A;  1RBV A;  4LH4 A;  4W5R A;  1NK5 A;  1Q9Y A;  2HHX A;  1TAU A;  1IKW A;  3LWL A;  3NGZ A;  3TAF A;  2KZZ A;  4DTR A;  2QKB A;  4RW9 A;  4DS5 A;  4CJ4 A;  4HHT A;  5HP1 A;  4MFB A;  3IAY A;  4CJK A;  4CHQ A;  5FRN A;  5J2Q A;  4ZHR A;  1NJW A;  1Z26 A;  4IDK A;  4CIE A;  4DFK A;  4AHS A;  3AVI A;  1I39 A;  2EX3 A;  3AVA A;  3HYF A;  3IG1 A;  1BIZ A;  2G8K A;  3LP2 A;  4KTW A;  1T03 A;  3V9X A;  1HRH A;  1BL3 A;  3EZ5 A;  1FKO A;  3ZSV A;  4B9L A;  1TKZ A;  3D45 A;  1VSF A;  4WE1 A;  4CJU A;  2HHW A;  4FCY A;  2HB5 A;  1HNI A;  4CJS A;  3QES A;  3S3N A;  4DTM A;  2Z1I A;  1RT6 A;  2XRI A;  5FRO A;  3V9S A;  1NJY A;  5JS2 A;  1RT7 A;  3ZSZ A;  5KGX A;  4FJL A;  3KK3 A;  2ATQ A;  3OYJ A;  2P5O A;  1TL3 A;  3TWH A;  3HPO A;  1TV6 A;  3KK2 A;  3QNO A;  4KHS A;  1SL2 A;  2B5J A;  2X74 A;  2BDP A;  4C8K A;  4B9V A;  4Z4I A;  4CIG A;  1LW2 A;  3DLH A;  5SWM A;  4K8Z A;  1U49 A;  1BCM A;  5J2M A;  2OZM A;  1ZBI A;  4IG3 A;  4CEB A;  2O4I A;  1ASV A;  3MXM A;  1DTT A;  4CGF A;  1JLA A;  3OYG A;  2VG7 A;  2YNI A;  2RF2 A;  2HNY A;  4Z4G A;  4FZX C;  4FJN A;  3PY8 A;  4Z4F A;  3LAM A;  3BDP A;  2O4G A;  3CM5 A;  4KAZ A;  5I42 A;  4LD0 A;  3TAP A;  4M42 A;  1LWE A;  1GOC A;  4ID1 A;  4CF9 A;  3HM9 A;  1WLJ A;  3SUN A;  3ITH A;  2F8S A;  1VSI A;  3V1R A;  3V1Q A;  4I9L A;  3K57 A;  1EXQ A;  4DS4 A;  1K6Y A;  4OJR A;  4B8C A;  1VSE A;  2YNG A;  3RMB A;  3WNG A;  4F3T A;  2B4J A;  3V4I A;  1C0U A;  4GVM A;  4CE9 A;  1SKW A;  5CZ2 A;  1L3S A;  4OGE A;  3LP1 A;  1SV5 A;  3V9Z A;  4FJH A;  4FM2 A;  1ZBL A;  4CEA A;  4W5O A;  4J2E A;  4OKJ A;  1KFS A;  1LWF A;  1QSS A;  3HJF A;  1F21 A;  3VQ7 A;  3VQB A;  3LPT A;  4I2Q A;  4RW7 A;  3TAR A;  4IBN A;  2BGG A;  2F96 A;  3L3U A;  1IKY A;  3T3F A;  4OVL A;  3RMA A;  4N41 A;  4MQ3 A;  3DM2 A;  1TAQ A;  2HNZ A;  4CEZ A;  2PYJ A;  4KHW A;  3V6D A;  3ZT2 A;  1TK5 A;  1QTM A;  1RDA A;  4J2B A;  2VG5 A;  4FLZ A;  1DTQ A;  1Y97 A;  4DQR A;  4YNQ A;  4ID5 A;  1N6Q A;  4DFP A;  4E0D A;  2HHV A;  2EHG A;  3L3V A;  4DFJ A;  2KQ2 A;  4AHR A;  4E7H A;  4ZTJ A;  2YV0 X;  4FJM A;  2WOM A;  3LAL A;  1UA0 A;  1B9D A;  4Z4E A;  1HQU A;  3TR8 A;  3ZSW A;  4H4O A;  4FJ5 A;  1A5W A;  2WON A;  4N47 A;  1VRT A;  2YNH A;  2YKN A;  3QIO A;  1ZYQ A;  2HHQ A;  3VQP A;  3F9K A;  2RKI A;  3SQ4 A;  1QSL A;  3ALY A;  3VQD A;  3OYH A;  1RT4 A;  2FBV A;  3B6P A;  3U6F A;  4K8X A;  4OKE A;  4RG8 A;  1RTI A;  2FBX A;  4DU4 A;  3KKR A;  4ICL A;  5CYM A;  3SUO A;  1T7P A;  1JLE A;  4DLG A;  4FZZ A;  4DMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...