1A63A

The nmr structure of the rna binding domain of e.coli rho factor suggests possible rna-protein interactions, 10 structures
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
130
structure length
130
Chain Sequence
MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVNFDKPENARNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHO
publication title The NMR structure of the RNA binding domain of E. coli rho factor suggests possible RNA-protein interactions.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Transcription termination
total genus 26
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 1998-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07497 Rho_RNA_bind Rho termination factor, RNA-binding domain
A PF07498 Rho_N Rho termination factor, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.10 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 1a63A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1a63A02
4JI2Q 4A3LH 2ZTCA 3RN5A 1VQNA 2ALYB 5C44H 3BJUA 4A3MH 3S14H 2K52A 1CKOA 2JQOA 5GAEC 1LYLA 3IRBA 3CCMA 1WCMH 2DUDA 1UE7A 3G71A 1MKHA 3HKSA 4YY3L 5ELOA 1YJ9A 5IYDH 4LFCQ 4A93G 1NJIC 2CFMA 3L7ZC 1QUQB 1E1TA 1I3QH 1KAWA 2A19A 2B3GA 5JJLA 1E7ZA 3PV0A 3H0GG 3OTOL 4DV6L 4P71A 4Y52H 2WAQE 3AYHB 3MXNB 2Y0SE 1NMFA 1RL2A 3J7ZC 1Y1WH 2JA5G 4KLKA 1V1QA 4JI4Q 3I4NG 2R93H 3M4QA 2XGTA 1WOCA 3NBHB 1K9MC 4XIGS 1N36Q 3S17H 1Z47A 4A75A 2GN5A 4R1JA 4GKJL 3J7A5 2B63G 3STBC 4JI0L 4DR6Q 5IYCH 3NEMA 4O0AA 3ICEA 3GDEA 2K75A 3A5UA 3LGJA 5IWAL 4A3EG 5J3BA 3HFZB 4X66L 4BBSH 3W1BA 1FJGL 1SMXA 3EN2A 4JYAQ 4DK3C 3VDYA 3S1RH 5IP9H 4DR1L 2R92H 1HZ9A 4IPHA 4LF7Q 2I5LX 3GTPH 1XMQQ 3CMEA 5C0XJ 3PIPA 2A8VA 2A1AA 3A5ZB 4DV5L 1SROA 4HJ8A 1EQRA 4B3TL 1JMCA 3S1QH 1KC8C 1N32Q 3J81j 4AIMA 1I94L 1NTGA 2CKZB 3FKIG 3KDFB 2Y0SG 4BXXG 1YI2A 1GVPA 3NENA 1SR3A 4LF9Q 1XTDA 2UUAL 5JJIA 2VZAA 4TQUS 2HJQA 4X62Q 1M90C 1OXVA 2NZHA 3I7FA 4PZ6A 5DLQE 1N34L 4BA1I 3CCSA 3CF5A 1HNXQ 4KHZA 1L0WA 3CCLA 1I6HH 4JBKA 1MJEA 4B3ML 5IP7G 1IBMQ 3GTMH 3GTJH 1JJ2A 1ASZA 3CPFA 1B8AA 2VQEL 3J81c 2UXCQ 2K14A 1K73C 3T1YL 2LXJA 4YHHQ 4YWMA 1UE5A 4JBJA 3ERSX 3CC4A 2D0OA 1EOVA 1WFQA 3K0XA 4GS3A 4HIKA 4JI3Q 3PO3G 1PH7A 1CKNB 2N78A 4OO1I 1MJCA 5IYBH 4IPDA 3BZKA 5FLMH 4HJ5A 4B3RL 1YHQA 1B7YB 2NN6G 4FDBA 3AFQA 3TRZA 1YVCA 5C4XH 2YTXA 5AJ3L 3PF5A 5IY0A 4QGUA 1HR0W 1VQ5A 3PUWA 4JI6Q 1YIJA 2F3IA 4C2MH 4IPGA 2MO1A 4IO9A 1XPUA 1TWCH 1IXRA 1LM0A 3HOYG 1WJJA 1N33Q 2RCNA 4AH6A 4C3JH 1BKBA 4YCVA 4KHPQ 1FL0A 1L2FA 1K3RA 3KFUA 4QQBX 2QNCA 3UDXA 4JOIA 2N49A 1X6OA 4BBRH 2BA1A 4GNXB 2E2HH 4JI2L 1MIUA 2HIXA 3U4ZA 5GAHC 5C4JH 4AYBG 4R4IA 2EXDA 5IT9c 4ME3A 1OXTA 4JI1Q 1R9TH 1HNWQ 4EQ5A 4JI8Q 2ATWA 2HIVA 4UP7A 4LFCL 2IX1A 1EQQA 3RZDH 2VL6A 2Z6KC 4L5QA 1S3OA 3U4VA 3ULLA 4A3CH 3S16H 1YJNA 4JI4L 2VY3A 2WB1E 1GO3E 2V1CC 1EIYB 4YCUA 1BBUA 2VS1A 2ZM6Q 3HOWG 2L15A 4JCVE 2ZJRA 4A3KG 5FLXc 1YITA 4DPGA 3HOVH 4LW1A 4GKKL 1YEZA 4K0KL 1SE8A 3F1ZA 3CXCA 1C7YA 1JT8A 1FGUA 1VQEA 4JG2A 1EN7A 3M7NA 2Z6KA 4DR6L 4GLAC 4A93H 2NVYH 4HIMA 4JI5Q 2ZJQA 4LUOA 3M4PA 1IL2A 3HKZE 4UY8C 3H0GH 2NVQH 1ASYA 4JYAL 4DR7Q 2JA8H 4A3GG 4PMWA 3U50C 4UP8A 3GTGH 2JA5H 4JI7Q 3I4NH 1Y14B 4LF7L 3MEFA 1PH8A 1XMQL 2YU9H 3E0EA 1E7LA 1E24A 1KD1C 4HJ7A 2HHHQ 3KOJA 1IYJB 1G6PA 1N32L 3KYHC 1Q81C 5FJ8H 4NXMQ 4A76A 1S40A 4YCWA 2JA6G 2B63H 2UXBL 1Y1VH 4DV2Q 4X64Q 2BH8A 4DV7Q 1QVGA 4QL5A 3UDIA 4IPCA 3J81i 4JV5Q 2WB1G 2BA0A 4A3EH 1X65A 2R7DA 3E9HA 4DR2Q 2PQAA 4X6AH 4GLXA 4LF9L 4ALPA 5C0XI 1KRSA 4DR5Q 4A3FH 2ZTDA 4IOAA 4X62L 4X65Q 2IT1A 4IJLA 1VQBA 1HNXL 3D0FA 4GN5A 4LWCA 1NMGA 5BR8Q 4DR4L 4IFDG 1IBML 1VCIA 2YYZA 3K81C 4KI0A 2R7ZG 4Y7NH 3UE0A 3S2DH 4POFA 1O7IA 2UXCL 1C9OA 1EIFA 3FKIH 2I0QA 4LF8Q 4BXXH 5C44G 2Q2TA 4B3SQ 4YHHL 4YWKA 2NVTH 4QIWE 2MQHA 4GOPB 1FVIA 1Z9FA 1PFSA 4BY1G 4AQYQ 3CMAA 4GN3B 1P16A 3I4OA 2R7FA 5LMNW 1PH6A 1Q1BA 1I50H 5IYDG 3BU2A 3G6EA 1L1OB 2D0PA 5H1SE 1VQIA 4A3IG 2EIFA 2WAQG 4JI6L 5IP7H 3FHWA 3CCVA 1UE6A 3CCUA 1PH1A 1HR0Q 3PIOA 1PYSB 2KHJA 1OXSC 2PMZE 1UWVA 4XTCS 3PUYA 4EX5A 4KHPL 3RN2A 1N9WA 4TVAB 3TQYA 4MZ9A 1XNRQ 3SGIA 2ID0A 1J5EQ 1TWAH 1WYDA 3PO3H 1IZ6A 2CWPA 3F8TA 4DUZQ 4L5SA 2Q2HA 3A0JA 4UP9A 1BVSA 2AMCB 1XMOQ 5M3FG 1IBKL 2N8NA 3BZCA 3K7UC 4RG1A 5LMUQ 1K8AC 2JK8A 4JI1L 1QZGA 3AQQA 1G291 1QVCA 3KF6B 2YTVA 5IE8A 1HNWL 5HGQA 2JJQA 4JI8L 3G4SA 3M4OH 3PCOB 4OX9Q 3AEVA 4MTNA 4OWTB 1SRUA 3F2BA 3HOYH 4BY7G 5IP9G 3KJOA 3S2HH 3F2DA 1PH5A 3I4MG 3H3VI 4MNOA 4LFBQ 1Q8KA 2OWOA 3I2ZA 1N8RC 1QUQA 1EYGA 4POGA 1NE3A 2F52A 2K5NA 2UUBQ 1E22A 2ZM6L 4DV3Q 1XJVA 1VQAA 1E1OA 4IFDJ 1NY4A 4QY7A 1KL9A 1YHAA 1Q82C 2UU9Q 1TWFH 2PI2E 2PI2A 3UDFA 4A3JH 2NVXH 4BA2I 1VQ8A 1CUKA 3GD7A 4JI5L 1EFWA 4LF5Q 3W1GA 1YHBA 4LUVA 3HOUG 1CSPA 4NPSA 2QA4A 1KIXA 1EWIA 4A3DG 3PO2G 2EQSA 4DR7L 1PH4A 1SFOH 4PZ7A 3PGZA 4H02A 4JI7L 3ER0A 3HOXG 2OTLA 2K50A 3S1NH 3CC7A 2LSSA 2VUMG 3CW2C 3HOWH 1X54A 2AKWB 4A3KH 2ZTEA 1VQOA 2HHHL 2KCMA 2JA7G 2FXQA 2N3SA 1KHIA 5K36G 4NXML 5M3MG 2UXDQ 2AWNA 5M5WH 4DV2L 4X64L 1JE5A 4DV7L 3CQZH 2KENA 5HY6A 3WWVA 4JV5L 3L2PA 2NN6I 1OXUA 4DR2L 2MO0A 1QVFA 4PZ8A 1YJWA 1N36L 1K83H 1VQKA 3KDFA 1SLJA 3M9BA 4DR5L 3T1HQ 3PUXA 3CC2A 4B3MQ 4L5RC 1TWHH 4X65L 3HOZG 3M85A 2D62A 1BBWA 1KQSA 4A3BG 5BR8L 2IHFA 3CPWA 1C0AA 3GO5A 5C3EG 2HT1A 1GM5A 1WI5A 4DR3Q 1A0IA 2H5XA 3PSIA 1YNXA 1PV4A 4LF4Q 2JA6H 1Q7YC 4OWWB 1PH9A 3KF8B 5GQOA 4L5TA 1H95A 4P75A 4LF6Q 3J80c 3CD6A 4APVA 1KXLA 2QGQA 2JA9A 1Q12A 2RF4A 4UPAA 4LUZA 1VQDA 2OTJA 5LMNQ 1IBLQ 1U0LA 1CKNA 2Q2IA 2YV5A 4YWLA 4C3HH 1AH9A 4A3GH 2UUCQ 3OYYA 2AHOB 4DV1Q 1HR0L 1CKMA 3CCQA 4GNXC 1XNQQ 2R7ZH 2NZOA 3TS2A 4HIDA 4JC0A 3CCJA 2JEAI 1Q46A 1S72A 1X3EA 4DV0Q 4IOCA 4NXNQ 2E5LQ 3PUVA 3M3YH 1XNRL 3HOVG 3TEHB 1J5EL 4LNQA 2F4VQ 1VS0A 4DUYQ 1VQ4A 4BY1H 3UDGA 3JC66 4DUZL 3F2CA 3H3VH 4HJ9A 1V9PA 2C35B 1XMOL 3CP0A 1UE1A 1GD7A 1Q1EA 5LMUL 3HKZG 1V43A 4GNXA 4A3IH 2VQFQ 2AWOA 2CCZA 3NELA 4A3LG 4A4IA 4LFAQ 4A3MG 4OX9L 5M5YH 4OWXB 4OXPA 2JA8G 4JI3L 1LTLA 1YZ6A 4DV4Q 1X56A 1VQJA 2K5HA 4P73A 1HNZQ 1OTCA 1TWGH 1WCMG 4P72A 1K8GA 5ELNA 1B70B 3STBD 4LFBL 1A63A 4JBWA 5JEAG 3JAMc 4PG3A 4K0KQ 4GKKQ 2GVAA 1EUJA 3S15H 2HQLA 5EAYA 5FJ8G 2UUBL 2WFWA 1VQGA 4DV3L 1Y1VG 5M3FH 1VQ7A 2UU9L 1DGSA 3K80C 1Y1WG 1M1KC 1N33L 2R93G 4WJ3M 5GAGC 3GTKH 1D7QA 3GTQH 1YBYA 3RLOA 3ULJA 3OW2A 1Q86C 4LF5L 3S1MH 4HIOA 5GROA 4A3FG 2CQOA 4DAMA 4BY7H 4WJ4A 3Q8DA 4C3IH 4DK6C 1VQMA 3I4MH 4OO1G 5JJKA 3W5OA 4YY3Q 1G51A 5M5XH 1JB7A 5IYCG 4IFDI 2Z0SA 1GKHA 2ASBA 2OQKA 1JJCB 4BBSG 2UXBQ 3OTOQ 2RHSB 1VQ6A 4DV6Q 2KBNA 1VQ9A 3A74A 1HJPA 2JE6I 4DAYB 1PHJA 1JJGA 2R92G 2GVBA 2MFIA 3AFPA 3D31A 1W3SA 2UXDL 2IHEA 3PF4A 4R4OA 2MNAA 4J15A 3RNUA 2PNHA 1PH3A 3H15A 3CCRA 1QZHA 1KRTA 3HOUH 4OONA 4A3DH 1X55A 2BH2A 3PO2H 4GKJQ 3EBEA 1HZAA 3T1HL 4JI0Q 3J80i 1PA6A 1RIPA 3RZOH 4DR4Q 3FP9A 1XPOA 1I5FA 1LUZA 3K8AA 4AYBE 3B6YA 2R6GA 3I55A 3HOXH 5IWAQ 4RMFA 2VUMH 1T9HA 4X66Q 3ZJYC 1VQPA 1FJGQ 3GTLH 1K0RA 3EIVA 2OQ0A 2QEXA 4GOPC 2JA7H 2DGYA 3S24A 4DR3L 4NB3A 4DR1Q 2RHQB 2K4KA 4LF4L 5M3MH 4GN4B 4QJFA 4JBMA 2IX0A 1PH2A 4R4TA 2ES2A 1X9NA 4DV5Q 1HH2P 1L1OC 5JEAJ 1TXYA 4JOIC 1X3FA 4B3TQ 2KCTA 3ULPA 4LF6L 1PVOA 2PQAB 5E7NA 2VW9A 4R4CA 1I94Q 2QNFA 3RLFA 1PYBA 1XPRA 3HOZH 4GOPA 3I56A 5LMNL 1IBLL 2I5MX 2LXKA 3CCEA 4A3BH 4O2DA 2UUAQ 3U58A 2UUCL 5C3EH 1UEBA 3TREA 4DV1L 5IYBG 1XNQL 4DKAC 5FLMG 1L1OA 1N34Q 2Q2UA 3L0OA 5C4XG 4DV0L 4NXNL 1W2BA 2K5VA 3RR5A 5GADC 2E5LL 3PUZA 2IY5B 1IBKQ 1VQCA 2F4VL 4DUYL 3TS0A 1D8LA 2VQEQ 3CAMA 3K7AH 3JAMi 4A3JG 1SN8A 1HZBA 2E2IH 1A8VA 3T1YQ 2E8GA 3DM3A 3E9IA 3RLNA 1AE2A 2VQFL 3DLLA 4BBRG 2ZJPA 4LF8L 4P74A 4GLVB 2OCEA 3KLWA 4B3SL 4LFAL 1E3PA 2B29A 2JEBI 2KHIA 4DV4L 4B3RQ 1VQLA 3G48A 4HJAA 1HNZL 2WP8J 1VQFA 4AQYL 3KF6A 5AJ3Q 1VQHA 2E2JH 1AE3A 2VNUD 2XTIA 2YTYA 4DNIA 5C0XG 1U5KA 1CSQA 2I5HA 4IJHA 3UE1A 3GTOH 1P8LA 1A62A 1J6QA 2CWAA 1OXXK 1E7DA 4A3CG 3KJPA 1NBWA 1X3GA 4R4QA 1HZCA
chains in the Genus database with same CATH superfamily
3NXWA 1VQNA 4A3MH 4ZKBB 3S14H 2K52A 1LTBD 3IRBA 2DUDA 3RMHA 1HTPA 3HKSA 3T4AC 4YY3L 1QNUA 3S2HB 1YJ9A 4LFCQ 4A93G 3L7ZC 4IN3A 4MTKA 3PV0A 5C4XB 3D4RA 2WAQE 3MXNB 4QMGA 2L9HA 3SXHA 4AYBB 4JI4Q 4C2MB 2XGTA 3JAML 1QNKA 1TWFB 4XIGS 3OWFA 4C3JB 5A35A 1V1PB 4GKJL 3Q23A 4DR6Q 5IYCH 1SYEA 4ULLA 2K75A 3A5UA 1UNSA 4FXKC 4XQNA 4X66L 3EN2A 3S1NB 1X3QA 2LKVA 2D9UA 5IT9E 4KV6A 3QWNA 1XMQQ 4DNRB 3K5NA 4HJ8A 4QF4A 2OEOA 1EU3A 3FKIG 2CKZB 3D3RA 2Y0SG 1PMRA 4J1MA 1BF4A 2F0UA 3R2TA 5CMDA 4ZCKA 5EBCA 4TQUS 5DM63 1R4PB 5FLXE 1OXVA 2CH4W 5DLQE 5DNFA 4A93B 3CCSA 3CCLA 1I6HH 1MJEA 4CDCC 2E2DC 3GTMH 1ASZA 2VQEL 2QDBA 3MFGA 1RTNA 2KEDA 4PNYA 1S5ED 1K73C 2XWJB 3ERSX 3CC4A 2D0OA 1WFQA 2B2UA 3QO2A 2NWGA 5IGGA 4C3IG 2N78A 5CV7A 1MJCA 5IYBH 1A2UA 4IPDA 1FGBD 2Q8IB 3TRZA 1YVCA 5FKAC 5AJ3L 1CHQD 5IY0A 4QGUA 1VQ5A 2A5HA 2TMPA 4JI6Q 2MO1A 4IO9A 3M3YB 1IXRA 1WJJA 2F0WA 4AH6A 4KHPQ 1FL0A 1K3RA 3EVQA 3KFUA 2QNCA 1D5ZC 3SK5A 2E2HH 3HG9A 3LNNA 3U4ZA 5C4JH 3FKIB 2Y0SB 3ONAB 3SEBA 1R9TH 4EQ5A 2HIVA 4UP7A 4LFCL 1EQQA 1ICWA 2Z6KC 1TIID 1YJNA 4JI4L 1T5EA 2MHVA 1GO3E 5FO7B 3KBXA 3ND9A 1BBUA 1BNZA 4A3KG 1YITA 4K0KL 2K5QA 2HD3A 3K58A 1KLUD 1SE8A 2IL8A 3CXCA 1YNJD 1A2TA 1FD7D 1VQEA 4JG2A 5E4WC 4DR6L 4C3IB 4HIMA 2ZJQA 4LUOA 3HKZE 3NBIA 3H0GH 2HDLA 2CHBD 5FOBB 1ASYA 2JA8H 3URYA 3U50C 3GTGH 2JA5H 3I4NH 1Y14B 3MEFA 1XMQL 3HRZC 1KD1C 5CIUA 4KJOA 3ND8A 2B2YC 3KYHC 1TS4A 2EYPA 4NXMQ 1KLGD 4DA2A 1S40A 2B63H 4DV2Q 2JVWA 4A3DB 3PO2B 1Y02A 1K3BC 2WB1G 2MP1A 5KNDA 1X65A 2R7DA 4L6TB 1HUNA 1OO9B 1KRSA 2NVXB 4A3FH 2ZTDA 4IOAA 4BWGB 3E6ZX 1LT5D 4LWCA 2Z8LA 1TT2A 4FF4A 2F0EA 5EGTA 4POFA 1CHPD 4FYDA 4G4KA 5KNBA 1AN8A 4BXXH 2X6GA 4YWKA 1SDFA 2MQHA 1KAAA 1HXYD 5M5WB 3A56A 1VQIA 3CQZB 1BCPD 1Q90A 4C1NK 4JI6L 3SK6A 2GA4B 4IQZA 1K83B 3PIOA 2KHJA 2RNOA 1BCPC 1OXSC 1SNQA 1B3AA 1O80A 3HZXA 3HEJA 4EX5A 4KHPL 1KDBA 1PLFA 2ID0A 1IZ6A 1XTCD 3RD4A 4L5SA 2Q2HA 3A0JA 2AMCB 1WD0A 3BZCA 2B2VA 3K7UC 4O42A 4RG1A 5LMUQ 5CC4A 2WB1B 1F9PA 1KDCA 3M4OH 4HSPA 2AQ1B 3AB9A 3F2BA 2A74C 4DN4M 3F2DA 1JB3A 2Q8RE 3H3VI 3GTOB 1X3PA 1HRJA 1Q8KA 1MSHA 3D6CA 4H44C 3I72A 4DV3Q 1A6XA 4QY7A 1KL9A 4A3MB 5A2QE 1YHAA 4CGYB 3S14B 2UU9Q 3C46A 4A3JH 3TMEA 4HCEA 1BR9A 3MA2B 1CUKA 4LF5Q 1F77A 4NPSA 3GV6A 2QA4A 1ILQA 5IT9L 4JVZA 2OTLA 2K50A 3L3OC 1FYCA 3HOWH 4F7XA 2ZTEA 3MXUA 3I90A 2JA7G 1PTOB 2RA4A 1KHIA 5K36G 4NXML 2UXDQ 1XX8A 4DV2L 3VR4A 2NZ1D 2KENA 2MO0A 5FLXL 2MUYA 1JC7A 1LABA 1VQKA 4A3GH 3KDFA 2KQ3A 2EYFA 3PUXA 3V05A 2WIIB 2PZTA 3LX0A 4DFAA 1C0AA 4DR3Q 4LF4Q 2JA6H 3MTSA 5GQOA 4L5TA 1KABA 2J7ZA 4APVA 1KXLA 1AP0A 1JWMD 2XRSD 4UPAA 2OTJA 2HQEA 1U0LA 4CJ2C 4GZYC 1PZKD 2Q2IA 4C3HH 2AHOB 3CCQA 1XNQQ 1CA5A 2KVDA 4HIDA 3GTMB 1E0BA 1Q46A 4NXNQ 4EVOA 3A55A 1JORA 4LNQA 3GTLB 2F4VQ 2JA7B 3K57A 1CM9A 3CP0A 2BOSA 5LMUL 1V43A 1SYDA 4G7HC 4A4IA 4LFAQ 5M5YH 4DF7A 4OXPA 2JA8G 4JI3L 1LTLA 4DV4Q 1HNZQ 2K5HA 4MHEA 5ELNA 3STBD 2L1BA 3LWUA 2EYLA 2GVAA 1EUJA 3OWEB 4CKEA 3S15H 2HQLA 2M2LA 5EAYA 1VQGA 4DV3L 2E2HB 2ZXPA 2FMMA 1SE3A 3ZYYX 3I8ZA 1VQ7A 5C4JB 3D8GA 2UU9L 2BE5D 1DZ1A 1KHCA 1E2VA 5GAGC 3GTKH 1DD2A 3RLOA 3OW2A 1Q86C 4LF5L 4A3FG 2CQOA 3I4MH 2B8FA 5ELCA 1G51A 1JB7A 2K5DA 1LV9A 3D4WA 1D5MC 2EY5A 3OTOQ 2JE6I 5ELDA 3AFPA 1RDPD 3D31A 2UXDL 2KHSA 3PF4A 4R4OA 1PH3A 1IW7C 3H15A 2B2UC 3I73A 3H94A 3HOUH 1EY9A 1HZAA 1PA6A 3W3AA 1QOHA 1LUZA 1UUPA 3IKJA 3HOXH 2JA8B 4RMFA 1O7LA 2JA5B 1VQPA 4ZYSA 1Z6HA 3BDOA 4DR3L 1U4MA 4DR1Q 2EYJA 4LF4L 5M3MH 4GN4B 2EJFC 3SHLA 1X9NA 4R8NA 3WOEA 2B63B 1PVOA 4B3TQ 4HN7A 1GXDC 2KCTA 3TP7A 2PQAB 1CTMA 3RLFA 4GOPA 3I56A 4FNFA 5FK9C 4A3FB 3CCEA 4O2DA 1K8MA 2A6EC 2LC3A 1A15A 5C3EH 1UEBA 1XNQL 5FLMG 2IX3A 1I4PA 5CBEE 1MI2A 4NXNL 2K5VA 3TDQA 2FFKB 1VQCA 1EFID 2PZUA 2F4VL 3K7AH 4A3JG 1SN8A 2LD7A 3T1YQ 3K5LA 3DM3A 1STNA 3RLNA 3NWTA 4LFAL 4LF8L 4P74A 3KLWA 5IGFA 1Y69U 2B29A 4DV4L 4HJAA 1HNZL 1A3TA 5C0XG 1B9NA 1TY2A 2A73B 2L4NA 3VA7A 5A2QL 1LT3D 1L0XB 1IYVA 2CWAA 1NR2A 3KJPA 4GN5A 2K1BA 4K5WA 5EQ0A 2ALYB 5C44H 3M4OB 2KVEA 5IGDA 5GAEC 1JOKA 2EPBA 1MKHA 4L8JA 1D5XC 5ELBA 2K7VA 5JEAH 1RHPA 5BN4A 2A19A 5JJLA 4XQQA 1KAWA 1E7ZA 3OTOL 4Y52H 3MXGA 1R4QB 4I7ZC 4TRDA 1NMFA 1Y1WH 2R93H 3NBHB 1K9MC 1N36Q 3QKJA 4A3JB 3S17H 1A3UA 4A75A 2GN5A 5COYA 4R1JA 3J7A5 5KYIA 3NEMA 3NUCA 5EJWA 5J3BA 1QG7A 4BBSH 1SSOA 1VF7A 4DK3C 3VDYA 3RUZA 1SJHD 1D1IA 2CW0D 3S1RH 4DR1L 4OEMB 3CMEA 5C0XJ 2A1AA 1EQRA 4B3TL 2KFVA 2RDHA 4K2KA 4E6IA 1N32Q 1B50A 1GUOA 2QDLA 1NTGA 2PYKA 1YI2A 2F0SA 4KJNA 2K04A 4CJ0B 4LF9Q 1XTDA 4K8JA 3NPPA 2HJQA 4X62Q 1M90C 4PZ6A 2NZHA 3I7FA 2QKIC 3QJYA 5EKLA 2F0JA 1H9RA 5IP7G 3GTJH 1ENAA 2O2LD 3NHHA 1B8AA 4ABNA 3J81c 2Z6BA 2UXCQ 3T1YL 1DM0B 4YHHQ 4JBJA 1M8AA 3KLSX 1EOVA 4HIKA 3OOCA 2C9OA 2F0DA 4HJ5A 4C3HB 2FMCA 4FDBA 1I4HA 5EPKA 5C4ZA 2F3IA 2IPKD 4O1NA 1N33Q 5EPJA 4EQOA 3UDXA 4JOIA 2N49A 4GNXB 4BBRH 5JJZA 1V1PA 1JQYD 2HIXA 3OIPA 2F0MA 2AQ2B 5GAHC 4AYBG 4ME3A 2NVTB 5M5YB 2F0TA 1EWHA 3DUZA 5LL6X 4U673 4Q0FA 2I46A 3S15B 3T13A 4FXGC 3U4VA 3ULLA 4A3CH 2B2TA 1LTRD 1LO5D 4YCUA 2JP1A 2E76C 2ZJRA 4GKKL 3P7JA 3R8BA 3GTKB 4DAYA 2NUCA 1C7YA 1EY5A 2ICEC 3M7NA 3FLGA 3I4MB 2A6HD 2NVYH 5CR3A 1IL2A 4WRDA 1EYAA 2A69D 4K6DA 1EYDA 1K28A 1BCPB 1NR4A 3VYSA 2LMCB 4H7BA 3N6RA 2YU9H 2F0HA 1E7LA 3F2UA 4HJ7A 3KOJA 1IYJB 1F9RA 2ZXOA 2D2CC 1N32L 1G6PA 5FJ8H 4A76A 4XXEA 2BH8A 4JV5Q 3J81i 2BA0A 4A3EH 2PW5A 4DR2Q 4X6AH 4LF9L 1HHVA 1ILPA 4X62L 4V0BA 4IJLA 3GV3A 4IUNA 5CORA 1VQBA 5M3MB 2YYZA 4QCLA 3K81C 4KI0A 2R7ZG 3TP6A 1O7IA 2UXCL 2HCCA 5C44G 4B3SQ 2O5IC 4YHHL 4HTHA 1PFSA 4AQYQ 1V1OA 2EE1A 2HDMA 1RKNA 5LMNW 1IL8A 1Q1BA 3KK7A 1L1OB 5KGUA 5C3EB 1PFBA 2EY1A 2XIWA 1I4XA 2RSOA 2QEJC 1SYGA 3NTHA 3CCVA 1HR0Q 4G7OC 1JICA 4PV1C 2O5JC 2PMZE 1ENFA 1UWVA 2VB3X 3EA6A 4EQNA 1N9WA 1VF5C 4XT3B 1TWAH 3PO3H 3KBGA 4G7ZC 4DUZQ 1XMOQ 4CDDC 1IBKL 5M3FG 1GJXA 1GOZA 2NN6H 2JK8A 1QZGA 3DEOA 3AQQA 4B9WA 5D3DA 5IE8A 2YTVA 3J7AV 2K33A 4EQPA 3AEVA 1DOLA 4BY7G 3HOYH 4DAVA 1EWCA 1PH5A 3VR6A 2NTSA 1NNXA 1F2YA 3I2ZA 1N8RC 2X69A 3HKZB 1QUQA 1EYGA 2R7ZB 5C44B 1DONA 2PI2E 3UDFA 2K32A 3KLSA 1PZJD 2O4XA 1D6EC 3MAQA 1EQVA 5ISRA 4A3DG 3PO2G 2EQSA 2LS01 1SFOH 2SNSA 3J7YW 3K59A 1S5CD 2RDGA 1Y1WB 3CRKC 1X54A 2AKWB 4XYOA 5EPLA 1TWGB 3E3XA 2E75C 1B4OA 3S17B 1UEAB 3MWYW 4XQJA 3OW7A 1STYA 4JV5L 5M3FB 3L2PA 2NN6I 4DR2L 1QVFA 3CC2A 1SLJA 4B3MQ 3T1HQ 4RH6A 1TWHH 2XWBB 3GTQB 3M85A 2D62A 4BY7B 1BBWA 1IYUA 3S1RB 4A3BG 3O13A 4KY5A 2B8GA 1FNWA 3DXJC 2HT1A 1GM5A 1PV4A 1YNJC 4RCNA 1EIGA 1PH9A 2KECA 5T1IA 1H95A 4LF6Q 3OIQA 1Q12A 4R9WA 4LUZA 1VQDA 1WTQA 1IBLQ 1CKNA 1U4PA 2EVBA 4IFDH 1T5XD 3VA5A 2UUCQ 3TN2A 1HR0L 1EEID 1CKMA 4GNXC 5CGKA 1HPCA 1PZID 5G3LD 3CCJA 1X3EA 4DV0Q 4ODGA 3TEHB 4HAEA 4DUYQ 4BY1H 2MPMA 3UDGA 3H3VH 4KY7A 3F2CA 3NK9A 4DUZL 3NWSA 1GKUB 1V9PA 3A7LA 1XMOL 1UE1A 2NTTA 2DNEA 1IKMA 2B2WC 1JE4A 4CJ1B 4A3IH 2JSOA 2F03A 2VQFQ 5IODA 3NELA 4IALA 4N8FA 2JN4A 2F0PA 4A3MG 3BS1A 3PIO3 1X56A 1VQJA 2WQGA 4P72A 4A3BB 1G8ZD 5FJ8G 2WFWA 1PFMA 1DGSA 4WJ3M 3ULJA 4TKOB 1AZPA 2PPBC 3SDZA 1JR0D 4J6HA 3KUPA 4N9PA 3H91A 3W5OA 4IFDI 5IYCG 2J0TD 1GKHA 2D5DA 2ASBA 2UXBQ 4DV6Q 2XRQD 2E2JB 3DWPA 1VQ9A 1HJPA 2RSNA 1J8IA 1JJGA 1W3SA 1BDOA 1PRTF 1SBBB 4J15A 5C4HA 1ZS9A 2RKSA 1QZHA 1KRTA 1EY6A 3EJIA 2BH2A 3EBEA 3ITPA 3T1HL 1AEXA 4JI0Q 4DR4Q 3RZOH 1I5FA 1VMPA 3K8AA 5C6AA 4KTAA 2CH4A 4I65A 2VUMH 4HCSA 1LT4D 1K0RA 1CK1A 1ZEQX 2OQ0A 1QWYA 1J9OA 2OT2A 2AUJD 1WTWA 2RHQB 4QJFA 5I9OA 2ES2A 1HH2P 2FHTA 1L1OC 4JOIC 4BITA 1RODA 3ULPA 4LF6L 3C1FA 4K5XA 2JXMB 1I94Q 4R4CA 2QNFA 2Z1CA 1B2TA 3NSWA 3HOZH 2G5DA 5DAUA 1QCBD 2R61A 1IBLL 5E4XA 1MHWC 2UUAQ 3U58A 3FDTA 2UUCL 5IYBG 4DKAC 2EOTA 3L0OA 2G9DA 1CA6A 4DV0L 3RR5A 5GADC 4RGMA 2IY5B 4QIWB 4DUYL 1NUCA 1BXTA 2B2TC 3CAMA 3S9WA 1HZBA 2E2IH 4C56C 1A8VA 4RAUC 5JAVA 3NE5B 3BZDB 2VQFL 4PMCA 3P75A 2ZJPA 2DY8A 4CDFC 2F0LA 1E3PA 4B3RQ 1VQLA 3G48A 4OELB 5NUCA 2WP8J 3KF6A 4S3SA 1AE3A 2YTYA 5I6YA 2RDFA 4X3UA 4IJHA 1GUGA 3VR5A 1TWAB 2KJXA 1VMCA 3V2TA 1I6HB 1E7DA 2FINB 1HZCA 4A3LH 2ZTCA 2XSCA 3BJUA 4DGZA 1EOTA 2NYZD 2ZXRA 2Z4IA 1CKOA 1KDAA 4FO2A 1LYLA 1TU2B 2L11A 1WCMH 3HOYB 2OF1A 3I4LA 3J81E 4I7AA 1NJIC 2CFMA 5CV9A 4IURA 3H0GG 4DV6L 2AQ3B 3J7ZC 1RL2A 4X3SA 2JA5G 1V1QA 2QF7A 3TBIB 3FPPA 3I4NG 3M4QA 2NBFA 2F3VA 1CI3M 4OO1H 3I70A 3K5MA 2B63G 3STBC 4JI0L 2B39A 3PIP3 4F8MA 2P5ZX 3ICEA 2EY2A 3HFZB 1SEBD 4RHSA 1LTID 1R9TB 4FXDA 3A7AB 5AFWA 4EGVA 5IP9H 1LLRD 2R92H 4IPHA 4LF7Q 2I5LX 3U9SA 2BE5C 4CBVA 3PIPA 2A8VA 3A5ZB 3VYUA 1SROA 2F3WA 4OIJA 1JMCA 3S1QH 3J81j 4LMQD 1I94L 4BXXG 3KDFB 4H0LC 1GVPA 3NENA 1EU4A 1HFNA 1F9SA 2UUAL 5IIFA 5JJIA 3NP8A 5IGBA 4RGTA 1S5BD 4HR7B 4BA1I 3CF5A 2F0QA 2F1MA 4JBKA 2H1EA 4FP5D 1XWEA 3H0GB 2BCOA 3GTGB 2K14A 3I4NB 1B1ZA 1WTOA 2LXJA 4YWMA 4DAPA 2FJ2A 3K0XA 4GS3A 1G6ZA 4KMUC 5E1FA 4OO1I 1EIHA 5HGTA 1CT1D 4B3RL 2WKCA 1I4GA 1H9SB 1GUSA 5C4XH 2YTXA 2Z9HA 1SXTA 2MPHA 1WTHA 3C3LA 4C2MH 3D4DA 1LM0A 4RGOS 4F88A 2NB0A 2X6LA 3FPUB 4PMBA 4C3JH 4YCVA 1L2FA 3QR8A 4RHRA 3SR1A 4ZAIA 2ODCI 1MIUA 1TR5A 1AFPA 5G3LF 2EXDA 3G6JB 4JI1Q 1HNWQ 4JI8Q 2ATWA 4HEDA 2VL6A 3TP5A 4L5QA 1S3OA 4CKBA 3S16H 1WTXA 1I4RA 1PXUA 2VS1A 3HOWG 2L15A 4JCVE 3HOVH 1BOSA 4LW1A 1YEZA 1JT8A 1FGUA 4ME5A 1S5FD 2Z6KA 4A93H 4JI5Q 2L5TA 1ZKOA 3DWAA 3TP8A 4CKCA 2NVQH 5CYUA 4XYQA 1DYQA 4A3GG 3CRLC 3E0JA 3T51B 1NCVA 4JI7Q 3M4YA 3WDNA 4LF7L 1HQRD 1E24A 3EFXD 2QW7A 1SNMA 4B9XA 2DJGC 3VYTA 2JA6G 4YCWA 1WVLA 1Y1VH 2DJFC 3BG3A 1QVGA 4QL5A 1K0SA 1LTAD 3I3CA 4UAIA 1TY0A 3E9HA 3RZOB 1KTKA 1S4ZA 1TKWB 1X32A 1AZQA 1GUNA 1PTOD 2IT1A 1M4VA 2B2YA 2F0NA 2LY7A 3D0FA 5IGCA 3A8IE 4C3HG 1WD1A 3UE0A 3BVMA 1TQOA 4CDEC 1SE2A 4X3KA 1BO0A 1SJED 3FKIH 2EJGC 2Q2TA 3HOWB 5KYLA 4GOPB 4KN4C 1Z9FA 1GJJA 3HOZB 3CMAA 5JOBA 4GN3B 1ESRA 1P16A 2R7FA 5L37A 3LWEA 3BU2A 2CW0C 2D0PA 4DNTB 2WAQG 2B2VC 3FHWA 3OPOA 3CCUA 5E3FA 1PH1A 4A3GB 1IKLA 4BS9A 3PUYA 3BYYB 4TVAB 1XNRQ 5FO8B 1J5EQ 2RCFA 2CWPA 3F8TA 3GP7A 5DM73 2JA6B 1BVSA 3J81L 3T16A 4JI1L 1QVCA 1HNWL 1JJRA 2JJQA 4JI8L 3G4SA 3PCOB 4IUTA 4JPBW 2EYOA 4MTNA 1II3A 4OWTB 1SRUA 3Q22A 5IP9G 3KJOA 1QILA 3I4MG 5D3IB 4POGA 4FF3A 2K5NA 4DXGA 1E22A 1XJVA 3MXNA 1NY4A 1Y8PB 1Q82C 2PI2A 2NVXH 4BA2I 2KEEA 3GD7A 4JI5L 1EFWA 1YHBA 1YNND 1U4LA 4LUVA 3HOUG 1CSPA 3N52A 1EWIA 1PH4A 2WAQB 4OGQC 1WTPA 1YNNC 4H02A 4PZ7A 4JI7L 3ER0A 3HOXG 2K01A 4A3KH 1CZGA 2KOLA 1VQOA 2J4XA 1I6VC 2JYOA 1PRTD 4IUPA 4J8QA 2N3SA 5M3MG 5M5WH 2QILA 4P2CB 3CQZH 5HY6A 1PRTC 3DMUA 1OXUA 4PZ8A 4ZKCB 1YJWA 1K83H 1N36L 4L5RC 1UAPA 3M9BA 3MFYA 2M00A 4C1NI 3CPWA 5C3EG 2Z4HA 3PSIA 2H5XA 1YNXA 1ZYRD 3KF8B 2A6HC 5D14A 4P75A 2A69C 5JPNC 3J80c 2EZVA 4UHVA 5HURA 2QGQA 2JA9A 3TSSA 5DEHA 2RF4A 1AW7A 1RCVD 1STBA 4YIJA 3H3VC 2YV5A 3HOUB 3DWQA 1SNCA 3OYYA 3Q24A 2JEAI 2RVLA 3HOXB 1S72A 4IOCA 2KCNA 3PUVA 1RD9D 5ELEA 1XNRL 3HOVG 1JEQA 1A3VA 1J5EL 3JC66 3MEHA 1Q1EA 3EQLC 3HKZG 1SE4A 1JCKB 4WJWA 1SYBA 1YZ6A 4UDUC 4P73A 1F9QA 2IWHA 2KW9A 2WV6D 3R2IA 1K8GA 1B70B 1PTOH 4JBWA 1STAA 3OMCA 2K28A 5JEAG 3JAMc 4K0KQ 3E5SA 1PYWD 4Q5VA 1Y1VG 1C48A 4QUCA 1HTLD 2DNCA 1Y1WG 4U68A 1M1KC 1N33L 2R93G 2BDOA 3K7AB 3S1MH 5GROA 3R3OA 1VQMA 1FNUA 5JJKA 3BVGA 5M5XH 5KRUA 2AUKA 3S16B 2OQKA 1JJCB 1F2LA 1F2MA 2K03A 1SAPA 3Q6SA 1RJTA 5BN5A 4BBSG 1JWSD 2F0IA 4KY6A 4DAYB 1EY4A 1EZ8A 1PHJA 3HOVB 5C5LA 2IHEA 3CHBD 2PNHA 3FEWX 3MHBA 3CCRA 4UZWA 3J80i 2NVQB 3FP9A 4AYBE 3B6YA 2R6GA 3I55A 5IWAQ 4F87A 4KK7A 1FJGQ 1C4QA 2BDNA 3GTLH 3EIVA 2PO4A 2QEXA 4GOPC 2JA7H 1JWUD 5C3XA 4NB3A 5K36H 2K4KA 4JBMA 2ODGC 2IX0A 4B08A 4DV5Q 2VNUD 5JEAJ 1TXYA 1Y1VB 1QE6A 1RF2D 4FF2A 3IAYA 3QOLA 2XN9C 3FRPB 2R93B 1PYBA 1XPRA 2I5MX 2K05A 2LXKA 1SNDA 1Y8NB 1ICFB 4G57A 1N34Q 2Q2UA 1W2BA 1TS2A 3PUZA 4BBSB 5J1ZA 1KNAA 1L0YB 1ESFA 3TS0A 1SYCA 1LT6D 1PTOF 3JAMi 1TS3A 3E9IA 4NDXA 4NMZA 3DLLA 4BBRG 3VYRA 1BUVT 4GLVB 3IL8A 4B3SL 4RCOA 5I2XA 2KHIA 2JEBI 2EYMA 4OHJA 1VQFA 4AQYL 1VQHA 1VDZA 5CV6A 1O7YA 3U9OA 3UE1A 5JPMC 2VXWA 1P8LA 3DM1A 1DCZA 1A62A 1GHKA 4A3CG 1X3GA 4KKUA 1FNVA 4JI2Q 3GTJB 3RN5A 2DN8A 2G9HD 2JQOA 3CCMA 2F0FA 2I07B 3A54A 3G71A 1UE7A 3D6WA 5ELOA 5IYDH 1EY0A 2EXZA 1QUQB 1E1TA 1I3QH 5KIXA 2B3GA 3OMGA 1H9MA 4P71A 3AYHB 1HQMC 2Y0SE 2WINB 2ENBA 4KLKA 5JVG3 1WOCA 4QB4A 4CHTB 2ZT9C 2F0KA 5C5MA 1I4QA 1GL9B 1Z47A 2F0VA 4M1UB 1E2WA 4BBRB 4WFN3 3OHXC 4O0AA 3GDEA 1GHJA 1JEIA 3LGJA 4IUUA 5IWAL 4A3EG 1HA6A 3W1BA 1FJGL 1SMXA 4JYAQ 4A3KB 1HZ9A 3GTPH 4ZUIA 4DV5L 1KC8C 3V96A 2W51A 1JOQA 4KD3A 4AIMA 2A68D 1U4RA 4Z9CB 1SR3A 1CZWA 2A68C 4HSVA 2EJMA 2CVRA 2C5CA 2VZAA 4FF1A 1ONLA 4HMJA 1N34L 1DJRD 1MBYA 2NVYB 3CU7A 4OL7A 1HNXQ 3X3MA 4KHZA 4M8AA 1L0WA 4B3ML 3J7AF 5KNCA 2CQAA 1IBMQ 2PCFB 1JJ2A 2SDFA 3CPFA 1ENCA 5EKKA 5LHY1 2YU9B 1EY7A 2XNAC 1UE5A 2N55A 4JI3Q 4K5VA 1EYCA 1B44D 1Q3LA 4RA8A 5CV4A 3PO3G 1PH7A 1CKNB 1BQQT 1BBXC 3BYTB 3BZKA 5FLMH 1DOMA 4IZ8A 1B7YB 1YHQA 2NN6G 3AFQA 4K6LA 3PF5A 1HR0W 1QJOA 3PUWA 4A3EB 4DK0A 1YIJA 4KN7C 4IPGA 1XPUA 1TWCH 2SNMA 3HOYG 4LAAA 5F2DA 3MXPA 1ML0D 1G2TA 2RCNA 4PQXA 1BKBA 4QQBX 5CV8A 4KKSA 1X6OA 2BA1A 4JI2L 3T56B 5J22A 2EYHA 1PFNA 3OSOA 4R4IA 1EL0A 5IT9c 3PQIA 1OXTA 5C0XH 2ICIA 1XXGA 2IX1A 1O78A 2PW7A 3RZDH 5K5PA 4N9TA 2VY3A 4DK1A 2WB1E 2V1CC 1EIYB 2ZM6Q 1HCZA 5FLXc 4DPGA 2PZWA 3F1ZA 3S1MB 3PO3B 1EN7A 3SK8A 3A8JE 4GLAC 1WTRA 3K5OA 3M4PA 2EDGA 5M5XB 4UY8C 4JYAL 2DK4A 4DR7Q 2RNNA 2IJ0A 4PMWA 4UP8A 3EROA 1PH8A 1G2SA 3Q0AA 3BDCA 3E0EA 4V190 2SOBA 2HHHQ 3P20A 1LACA 1Q81C 4FVMA 3LLRA 2UXBL 1S5DD 1SMYD 2PQEA 4X64Q 4K14A 4DV7Q 3UDIA 4IPCA 3CKIB 1H9SA 4HMIA 1RTOA 2Q8TA 2PQAA 4GLXA 1SMYC 4ALPA 5C0XI 4DR5Q 4X65Q 1HNXL 1FR3A 1TS5A 1NMGA 5BR8Q 4DR4L 4IFDG 1IBML 1VCIA 3S2DH 4Y7NH 1SFOB 3X3NA 1C9OA 1EIFA 2I0QA 4LF8Q 3DEPA 3SK4A 2NVTH 4QIWE 1C8CA 3AU7A 4IUQA 1FVIA 2L0CA 4BY1G 2L12A 3I4OA 1PH6A 1GUWA 1I50H 4ZQ3A 3QOJA 5BN3A 5IYDG 3G6EA 5H1SE 4A3IG 2EIFA 3IFTA 2F0OA 5IP7H 1STGA 1O7ZA 1UE6A 1KNEA 1PYSB 1TWHB 3P1HA 4XTCS 3RN2A 3TQYA 3QG1A 2QCPX 4MZ9A 4ZUJA 3SGIA 1PRTB 1WYDA 1H9JA 3I91A 1TVXA 4UP9A 2N8NA 1K8AC 5J39A 4KHVA 1G291 3KF6B 4N8X1 5HGQA 1SYFA 2VB2X 3MZ5A 4OX9Q 2K6AA 1IW7D 1LTSD 5FO9B 1DXMA 3S2HH 3J80E 2F0GA 4L63B 1B9MA 1DOKA 2TSSA 4MNOA 4LFBQ 1IHZA 4KD4A 2OWOA 5TSSA 3VR3A 3UI2A 1NE3A 2F52A 2UUBQ 1MD2D 2ZM6L 1VQAA 1E1OA 3C1EA 4IFDJ 1G91A 5I4DA 1TWFH 4IUVA 1SNOA 3NBHA 1PDQA 1VQ8A 4BY1B 1EEFD 3W1GA 2H4OA 3W2DA 1KIXA 4A3IB 1H9KA 3ERQA 3SE0A 4DR7L 1I3QB 4RKBA 4JK1C 3PGZA 1B53A 1H1JS 1HUMA 1Q8IA 4ZK9B 2LSSA 3CC7A 2VUMG 3CW2C 3S1NH 2A6ED 3L9AX 3NQIA 2HHHL 2KCMA 2FXQA 2IW3A 2AWNA 4X64L 1JE5A 4DV7L 3WWVA 1YNSA 2HUGA 2KCCA 2R3ZA 3JAME 1D2BA 4LK1C 1EQTA 2E74C 4DR5L 2LFNA 4X65L 1CQFA 2K5WA 3HOZG 3M7GA 1ET9A 1KQSA 4RFBA 2KVUA 5BR8L 2IHFA 3GTPB 3GO5A 1WI5A 1A0IA 2WACA 4QUFA 5CBAE 5IOCA 1Q7YC 5JVH3 4ZRZA 4OWWB 2EY6A 3QIAA 3NTIA 3TZDA 5I6WA 3H09A 5KEEA 1ET6A 3CD6A 1MGSA 2SEBD 4WORA 5T1GA 3NTKA 3KLRA 5LMNQ 1U9RA 5M9OA 4YWLA 1AH9A 1F2ZA 1W6KA 3MVVA 4DV1Q 1BCPF 3TS2A 4K8IA 2NZOA 2R7ZH 4JC0A 1E2ZA 1H9EA 3K0YA 2L55A 2E5LQ 5EBDA 2VUMB 3M3YH 1HA5A 5C3WA 1VS0A 1VQ4A 3BDLA 1JOOA 4HJ9A 2C35B 4RGNA 1ZBHA 1GD7A 2WKDA 1PTOC 4GNXA 2DY7A 4K2LA 2AWOA 2CCZA 4A3LG 2RBMA 4OX9L 4OWXB 4OIKA 3GQBA 3HS0C 4NP5A 1OTCA 4ID6A 1TWGH 1WCMG 1STEA 1TWCB 4LFBL 1K8OA 1A63A 1NAPA 1CQVA 3PMFA 4PG3A 4TSSA 4GKKQ 4ZLTF 2B2WA 2UUBL 1V66A 5M3FH 3BVZA 1XYIA 2KA7A 3HGBA 3H6MA 3K80C 3FMCA 4RKLA 1D7QA 3GTQH 1YBYA 2HCIA 4HIOA 4BY7H 2E2IB 4DAMA 4WJ4A 3Q8DA 4C3IH 4DK6C 2G80A 5I9PA 3RZDB 4OO1G 2RQXA 1LTTD 4YY3Q 2F4IA 3TZUA 2Z0SA 3VR2A 1EY8A 5EKIA 3KF8A 1ZXTA 2RHSB 1VQ6A 2KBNA 3IFDA 2MJ8A 3A74A 3R93A 2R92G 2GVBA 2MFIA 3HP3A 2MGSA 1MSGA 2MNAA 4RWSC 3RNUA 1GUTA 3MC0B 4JW0A 3G7LA 4MN3A 5LL6S 4OONA 4A3DH 1X55A 1EZ6A 3PO2H 4GKJQ 3T53B 1D1KA 1B3QA 1RIPA 1XPOA 1NSNS 4R8IA 3AMUA 1T9HA 4LJZC 4X66Q 3ZJYC 2PNRC 1WCMB 2DGYA 3S24A 1STHA 5ELFA 1Z7TA 4H13C 4XDXA 1PH2A 4R4TA 3NQTA 1QB5D 1X3FA 2N88A 4NW2A 2OXPA 4X3TA 5E7NA 2VW9A 1Y8OB 2M9VA 3SVMA 5LMNL 1H9FA 1LTGD 3K6OA 4XT1B 4A3BH 5IGEA 1V8QA 4DV1L 3TREA 1L1OA 4DU9A 5C4XG 3S2DB 4Y7NB 2E5LL 1IBKQ 3FVQA 5CV5A 3C2PA 1D8LA 1WTVA 2VQEQ 5D65A 2R92B 4C3JG 1HFGA 2E8GA 4ILWA 2XVSA 1SNPA 1AE2A 2KVMA 1I50B 3S1QB 5I2YA 2OCEA 1W6JA 2KUMA 3J80L 4DXFA 1ZYRC 5AJ3Q 2PMZB 3A8KE 3QB3A 2XTIA 4DNIA 2E2JH 1U5KA 1CSQA 2I5HA 3WOFA 3GTOH 3DHQA 4KKTA 1CFMA 1J6QA 1OXXK 1NBWA 4NKLA 4MIUA 4R4QA 2V4DA
chains in the Genus database with same CATH topology
4JI2Q 4A3LH 2ZTCA 3RN5A 1VQNA 2ALYB 5C44H 3BJUA 4A3MH 3S14H 2K52A 1CKOA 2JQOA 5GAEC 1LYLA 3IRBA 3CCMA 1WCMH 2DUDA 1UE7A 3G71A 1MKHA 3HKSA 4YY3L 5ELOA 1YJ9A 5IYDH 4LFCQ 4A93G 1NJIC 2CFMA 3L7ZC 1QUQB 1E1TA 1I3QH 1KAWA 2A19A 2B3GA 5JJLA 1E7ZA 3PV0A 3H0GG 3OTOL 4DV6L 4P71A 4Y52H 2WAQE 3AYHB 3MXNB 2Y0SE 1NMFA 1RL2A 3J7ZC 1Y1WH 2JA5G 4KLKA 1V1QA 4JI4Q 3I4NG 2R93H 3M4QA 2XGTA 1WOCA 3NBHB 1K9MC 4XIGS 1N36Q 3S17H 1GL9B 1Z47A 4A75A 2GN5A 4R1JA 4GKJL 3J7A5 2B63G 3STBC 4JI0L 4DR6Q 5IYCH 3NEMA 4O0AA 3ICEA 3GDEA 2K75A 3A5UA 1JEIA 3LGJA 5IWAL 5J3BA 3HFZB 4A3EG 4X66L 4BBSH 3W1BA 1FJGL 1SMXA 3EN2A 4JYAQ 4DK3C 3VDYA 3S1RH 5IP9H 4DR1L 2R92H 1HZ9A 4IPHA 4LF7Q 2I5LX 3GTPH 1XMQQ 3CMEA 5C0XJ 3PIPA 2A8VA 2A1AA 3A5ZB 4DV5L 1SROA 4HJ8A 1EQRA 4B3TL 1JMCA 3S1QH 1KC8C 2KFVA 1N32Q 2W51A 3J81j 4AIMA 1I94L 1NTGA 2CKZB 3FKIG 3KDFB 2Y0SG 4BXXG 1YI2A 1GVPA 3NENA 1SR3A 4LF9Q 1XTDA 2UUAL 5JJIA 2VZAA 4TQUS 2HJQA 4X62Q 1M90C 1OXVA 2NZHA 3I7FA 4PZ6A 5DLQE 1N34L 4BA1I 3CCSA 3CF5A 1HNXQ 4KHZA 1L0WA 3CCLA 1I6HH 4JBKA 1MJEA 4B3ML 5IP7G 1IBMQ 3GTMH 3GTJH 1JJ2A 1ASZA 3CPFA 1B8AA 2VQEL 3J81c 2UXCQ 2K14A 1K73C 3T1YL 2LXJA 4YHHQ 4YWMA 1UE5A 4JBJA 3ERSX 3CC4A 2D0OA 1EOVA 1WFQA 3K0XA 4GS3A 4HIKA 4JI3Q 3PO3G 1PH7A 1CKNB 2N78A 4OO1I 1MJCA 5IYBH 4IPDA 3BZKA 5FLMH 4HJ5A 4B3RL 1YHQA 1B7YB 2NN6G 4FDBA 3AFQA 3TRZA 1YVCA 5C4XH 2YTXA 5AJ3L 3PF5A 5IY0A 4QGUA 1HR0W 1VQ5A 3PUWA 4JI6Q 1YIJA 2MPHA 2F3IA 4C2MH 4IPGA 2MO1A 4IO9A 1XPUA 1TWCH 1IXRA 1LM0A 3HOYG 1WJJA 1N33Q 2RCNA 4AH6A 4C3JH 1BKBA 4YCVA 4KHPQ 1FL0A 1L2FA 1K3RA 3KFUA 4QQBX 2QNCA 3UDXA 4JOIA 2N49A 1X6OA 4BBRH 2BA1A 4GNXB 2E2HH 4JI2L 2ODCI 1MIUA 2HIXA 3U4ZA 5GAHC 5C4JH 4AYBG 4R4IA 2EXDA 5IT9c 4ME3A 1OXTA 4JI1Q 1R9TH 1HNWQ 4EQ5A 4JI8Q 2ATWA 2HIVA 4UP7A 4LFCL 2IX1A 1EQQA 3RZDH 2VL6A 2Z6KC 4L5QA 1S3OA 3U4VA 3ULLA 4A3CH 3S16H 1YJNA 4JI4L 2VY3A 2WB1E 1GO3E 2V1CC 1EIYB 4YCUA 1BBUA 2VS1A 2ZM6Q 3HOWG 2L15A 4JCVE 2ZJRA 4A3KG 5FLXc 1YITA 4DPGA 3HOVH 4LW1A 4GKKL 1YEZA 4K0KL 1SE8A 3F1ZA 3CXCA 1C7YA 1JT8A 1FGUA 1VQEA 4JG2A 1EN7A 3M7NA 2Z6KA 4DR6L 4GLAC 4A93H 2NVYH 4HIMA 4JI5Q 2ZJQA 4LUOA 3M4PA 1IL2A 3HKZE 4UY8C 3H0GH 2NVQH 2DK4A 1ASYA 4DR7Q 4JYAL 2JA8H 4A3GG 4PMWA 3U50C 4UP8A 3GTGH 2JA5H 4JI7Q 3I4NH 1Y14B 4LF7L 3MEFA 1PH8A 1XMQL 2YU9H 3E0EA 1E7LA 1E24A 1KD1C 4HJ7A 2HHHQ 3KOJA 1IYJB 1G6PA 1N32L 3KYHC 1Q81C 5FJ8H 4NXMQ 4A76A 1S40A 4YCWA 2JA6G 2B63H 2UXBL 1Y1VH 4DV2Q 4X64Q 2BH8A 4DV7Q 1Y02A 4QL5A 3UDIA 4IPCA 3J81i 1QVGA 4JV5Q 2WB1G 2BA0A 4A3EH 1X65A 2R7DA 3E9HA 4DR2Q 2PQAA 4X6AH 4GLXA 4LF9L 4ALPA 5C0XI 1KRSA 4DR5Q 4A3FH 2ZTDA 4IOAA 4X62L 4X65Q 2IT1A 4IJLA 1VQBA 1HNXL 3D0FA 4GN5A 4LWCA 1NMGA 5BR8Q 4DR4L 4IFDG 1IBML 1VCIA 2YYZA 3K81C 4KI0A 2R7ZG 4Y7NH 3UE0A 3S2DH 4POFA 1O7IA 2UXCL 1C9OA 1EIFA 3FKIH 2I0QA 4LF8Q 4BXXH 5C44G 2Q2TA 4B3SQ 4YHHL 4YWKA 2NVTH 4QIWE 2MQHA 4GOPB 1FVIA 1Z9FA 1GJJA 1PFSA 4BY1G 4AQYQ 3CMAA 4GN3B 1P16A 3I4OA 2R7FA 5LMNW 1PH6A 1Q1BA 1I50H 5IYDG 3BU2A 3G6EA 1L1OB 2D0PA 5H1SE 1VQIA 4A3IG 2EIFA 2WAQG 4JI6L 5IP7H 3FHWA 3CCVA 1UE6A 3CCUA 1PH1A 1HR0Q 3PIOA 1PYSB 2KHJA 1OXSC 2PMZE 1UWVA 4XTCS 3PUYA 4EX5A 4KHPL 3RN2A 1N9WA 4TVAB 3TQYA 4MZ9A 1XNRQ 3SGIA 2ID0A 1J5EQ 1TWAH 1WYDA 3PO3H 1IZ6A 2CWPA 3F8TA 4DUZQ 4L5SA 2Q2HA 3A0JA 4UP9A 1BVSA 2AMCB 1XMOQ 5M3FG 1IBKL 2N8NA 3BZCA 3K7UC 4RG1A 5LMUQ 1K8AC 2JK8A 4JI1L 1QZGA 3AQQA 1G291 1QVCA 3KF6B 2YTVA 5IE8A 1HNWL 5HGQA 2JJQA 4JI8L 3G4SA 3M4OH 3PCOB 4OX9Q 3AEVA 4MTNA 4OWTB 1SRUA 3F2BA 3HOYH 4BY7G 5IP9G 3KJOA 3S2HH 3F2DA 1PH5A 3I4MG 3H3VI 4MNOA 4LFBQ 1Q8KA 2OWOA 3I2ZA 1N8RC 1QUQA 1EYGA 4POGA 1NE3A 2F52A 2K5NA 2UUBQ 1E22A 2ZM6L 4DV3Q 1XJVA 1VQAA 1E1OA 4IFDJ 1NY4A 4QY7A 1KL9A 1YHAA 1Q82C 2UU9Q 1TWFH 2PI2E 2PI2A 3UDFA 4A3JH 2NVXH 4BA2I 1VQ8A 1CUKA 3GD7A 4JI5L 1EFWA 4LF5Q 3W1GA 1YHBA 4LUVA 3HOUG 1CSPA 4NPSA 2QA4A 1KIXA 1EWIA 4A3DG 3PO2G 2EQSA 4DR7L 1PH4A 1SFOH 4PZ7A 3PGZA 4H02A 4JI7L 3ER0A 3HOXG 2OTLA 2K50A 3S1NH 3CC7A 2LSSA 2VUMG 3CW2C 3HOWH 1X54A 2AKWB 4A3KH 2ZTEA 1VQOA 2HHHL 2KCMA 2JA7G 2FXQA 2N3SA 1KHIA 5K36G 4NXML 5M3MG 2UXDQ 2AWNA 5M5WH 4DV2L 4X64L 1JE5A 4DV7L 3CQZH 2KENA 5HY6A 3WWVA 4JV5L 1YNSA 3L2PA 2NN6I 1OXUA 4DR2L 2MO0A 1QVFA 4PZ8A 1YJWA 1N36L 1K83H 1VQKA 3KDFA 1SLJA 3M9BA 4DR5L 3T1HQ 3PUXA 3CC2A 4B3MQ 4L5RC 1TWHH 4X65L 3HOZG 3M85A 2D62A 1BBWA 1KQSA 4A3BG 5BR8L 2IHFA 3CPWA 1C0AA 3GO5A 5C3EG 2HT1A 1GM5A 1WI5A 4DR3Q 1A0IA 2H5XA 3PSIA 1YNXA 1PV4A 4LF4Q 2JA6H 1Q7YC 4OWWB 1PH9A 3KF8B 5GQOA 4L5TA 1H95A 4P75A 4LF6Q 3J80c 3CD6A 4APVA 1KXLA 2QGQA 2JA9A 1Q12A 2RF4A 4UPAA 4LUZA 1VQDA 2OTJA 5LMNQ 1IBLQ 1U0LA 1CKNA 2Q2IA 2YV5A 4YWLA 4C3HH 1AH9A 4A3GH 2UUCQ 3OYYA 2AHOB 4DV1Q 1HR0L 1CKMA 3CCQA 4GNXC 1XNQQ 2R7ZH 2NZOA 3TS2A 4HIDA 4JC0A 3CCJA 2JEAI 1H9EA 1Q46A 1S72A 1X3EA 4DV0Q 4IOCA 4NXNQ 2E5LQ 3PUVA 3M3YH 1XNRL 3HOVG 3TEHB 1J5EL 4LNQA 2F4VQ 1VS0A 4DUYQ 1VQ4A 4BY1H 3UDGA 3JC66 4DUZL 3F2CA 3H3VH 1GKUB 1V9PA 2C35B 4HJ9A 3CP0A 1UE1A 1XMOL 1GD7A 1Q1EA 5LMUL 3HKZG 1V43A 4GNXA 4A3IH 2VQFQ 2AWOA 2CCZA 3NELA 4A3LG 4A4IA 4LFAQ 4A3MG 4OX9L 5M5YH 4OWXB 4OXPA 2JA8G 4JI3L 1LTLA 1YZ6A 4DV4Q 1X56A 1VQJA 2K5HA 4P73A 1HNZQ 1OTCA 1TWGH 1WCMG 4P72A 1K8GA 5ELNA 1B70B 3STBD 4LFBL 1A63A 4JBWA 5JEAG 3JAMc 4PG3A 4K0KQ 4GKKQ 2GVAA 1EUJA 3S15H 2HQLA 5EAYA 5FJ8G 2UUBL 2WFWA 1VQGA 4DV3L 1Y1VG 5M3FH 1VQ7A 2UU9L 1DGSA 3K80C 1Y1WG 1M1KC 1N33L 2R93G 4WJ3M 5GAGC 3GTKH 1D7QA 3GTQH 1YBYA 3RLOA 3ULJA 3OW2A 1Q86C 4LF5L 3S1MH 4HIOA 5GROA 4A3FG 2CQOA 4DAMA 4BY7H 4WJ4A 3Q8DA 4C3IH 4DK6C 2G80A 1VQMA 3I4MH 4OO1G 5JJKA 3W5OA 4YY3Q 1G51A 5M5XH 1JB7A 5IYCG 4IFDI 2Z0SA 1GKHA 2ASBA 2OQKA 1JJCB 4BBSG 2UXBQ 3OTOQ 2RHSB 1VQ6A 4DV6Q 2KBNA 1VQ9A 3A74A 1HJPA 2JE6I 4DAYB 1PHJA 1JJGA 2R92G 2GVBA 2MFIA 3AFPA 3D31A 1W3SA 2UXDL 2IHEA 3PF4A 4R4OA 2MNAA 4J15A 3RNUA 2PNHA 1PH3A 3H15A 1ZS9A 3CCRA 1QZHA 1KRTA 3HOUH 4OONA 4A3DH 1X55A 2BH2A 3PO2H 4GKJQ 3EBEA 1HZAA 3T1HL 4JI0Q 3J80i 1PA6A 1RIPA 3RZOH 4DR4Q 3FP9A 1XPOA 1I5FA 1LUZA 3K8AA 4AYBE 3B6YA 2R6GA 3I55A 3HOXH 5IWAQ 4RMFA 2VUMH 1T9HA 4X66Q 3ZJYC 1VQPA 1FJGQ 3GTLH 1K0RA 3EIVA 2OQ0A 2QEXA 4GOPC 2JA7H 2DGYA 3S24A 4DR3L 4NB3A 4DR1Q 2RHQB 2K4KA 4LF4L 5M3MH 4GN4B 4QJFA 4JBMA 2ODGC 2IX0A 1PH2A 4R4TA 2ES2A 1X9NA 4DV5Q 1HH2P 1L1OC 5JEAJ 1TXYA 4JOIC 1X3FA 4B3TQ 2KCTA 3ULPA 4LF6L 1PVOA 2PQAB 5E7NA 2VW9A 4R4CA 1I94Q 2QNFA 3RLFA 1PYBA 1XPRA 3HOZH 4GOPA 3I56A 5LMNL 1IBLL 2I5MX 1H9FA 2LXKA 3CCEA 4A3BH 4O2DA 2UUAQ 2LC3A 3U58A 2UUCL 5C3EH 1UEBA 3TREA 4DV1L 5IYBG 1XNQL 4DKAC 5FLMG 1L1OA 1N34Q 2Q2UA 3L0OA 5C4XG 4DV0L 4NXNL 1W2BA 2K5VA 3RR5A 5GADC 2E5LL 3PUZA 2IY5B 1IBKQ 1VQCA 2F4VL 4DUYL 3TS0A 1D8LA 2VQEQ 3CAMA 3K7AH 3JAMi 4A3JG 1SN8A 1HZBA 2E2IH 1A8VA 2LD7A 3T1YQ 2E8GA 3DM3A 3E9IA 3RLNA 1AE2A 2VQFL 3DLLA 4BBRG 2ZJPA 4LF8L 4P74A 4GLVB 2OCEA 3KLWA 4B3SL 4LFAL 1E3PA 2B29A 2JEBI 2KHIA 4DV4L 4B3RQ 1VQLA 3G48A 4HJAA 1HNZL 1VQFA 2WP8J 4AQYL 3KF6A 5AJ3Q 1VQHA 2E2JH 1AE3A 2VNUD 2XTIA 2YTYA 4DNIA 5C0XG 1U5KA 1CSQA 2I5HA 4IJHA 3UE1A 3GTOH 1P8LA 1A62A 1J6QA 2CWAA 1OXXK 1E7DA 4A3CG 3KJPA 1NBWA 1X3GA 4R4QA 1HZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 Q;  4A3L H;  2ZTC A;  3RN5 A;  1VQN A;  2ALY B;  5C44 H;  3BJU A;  4A3M H;  3S14 H;  2K52 A;  1CKO A;  2JQO A;  5GAE C;  1LYL A;  3IRB A;  3CCM A;  1WCM H;  2DUD A;  1UE7 A;  3G71 A;  1MKH A;  3HKS A;  4YY3 L;  5ELO A;  1YJ9 A;  5IYD H;  4LFC Q;  4A93 G;  1NJI C;  2CFM A;  3L7Z C;  1QUQ B;  1E1T A;  1I3Q H;  1KAW A;  2A19 A;  2B3G A;  5JJL A;  1E7Z A;  3PV0 A;  3H0G G;  3OTO L;  4DV6 L;  4P71 A;  4Y52 H;  2WAQ E;  3AYH B;  3MXN B;  2Y0S E;  1NMF A;  1RL2 A;  3J7Z C;  1Y1W H;  2JA5 G;  4KLK A;  1V1Q A;  4JI4 Q;  3I4N G;  2R93 H;  3M4Q A;  2XGT A;  1WOC A;  3NBH B;  1K9M C;  4XIG S;  1N36 Q;  3S17 H;  1Z47 A;  4A75 A;  2GN5 A;  4R1J A;  4GKJ L;  3J7A 5;  2B63 G;  3STB C;  4JI0 L;  4DR6 Q;  5IYC H;  3NEM A;  4O0A A;  3ICE A;  3GDE A;  2K75 A;  3A5U A;  3LGJ A;  5IWA L;  4A3E G;  5J3B A;  3HFZ B;  4X66 L;  4BBS H;  3W1B A;  1FJG L;  1SMX A;  3EN2 A;  4JYA Q;  4DK3 C;  3VDY A;  3S1R H;  5IP9 H;  4DR1 L;  2R92 H;  1HZ9 A;  4IPH A;  4LF7 Q;  2I5L X;  3GTP H;  1XMQ Q;  3CME A;  5C0X J;  3PIP A;  2A8V A;  2A1A A;  3A5Z B;  4DV5 L;  1SRO A;  4HJ8 A;  1EQR A;  4B3T L;  1JMC A;  3S1Q H;  1KC8 C;  1N32 Q;  3J81 j;  4AIM A;  1I94 L;  1NTG A;  2CKZ B;  3FKI G;  3KDF B;  2Y0S G;  4BXX G;  1YI2 A;  1GVP A;  3NEN A;  1SR3 A;  4LF9 Q;  1XTD A;  2UUA L;  5JJI A;  2VZA A;  4TQU S;  2HJQ A;  4X62 Q;  1M90 C;  1OXV A;  2NZH A;  3I7F A;  4PZ6 A;  5DLQ E;  1N34 L;  4BA1 I;  3CCS A;  3CF5 A;  1HNX Q;  4KHZ A;  1L0W A;  3CCL A;  1I6H H;  4JBK A;  1MJE A;  4B3M L;  5IP7 G;  1IBM Q;  3GTM H;  3GTJ H;  1JJ2 A;  1ASZ A;  3CPF A;  1B8A A;  2VQE L;  3J81 c;  2UXC Q;  2K14 A;  1K73 C;  3T1Y L;  2LXJ A;  4YHH Q;  4YWM A;  1UE5 A;  4JBJ A;  3ERS X;  3CC4 A;  2D0O A;  1EOV A;  1WFQ A;  3K0X A;  4GS3 A;  4HIK A;  4JI3 Q;  3PO3 G;  1PH7 A;  1CKN B;  2N78 A;  4OO1 I;  1MJC A;  5IYB H;  4IPD A;  3BZK A;  5FLM H;  4HJ5 A;  4B3R L;  1YHQ A;  1B7Y B;  2NN6 G;  4FDB A;  3AFQ A;  3TRZ A;  1YVC A;  5C4X H;  2YTX A;  5AJ3 L;  3PF5 A;  5IY0 A;  4QGU A;  1HR0 W;  1VQ5 A;  3PUW A;  4JI6 Q;  1YIJ A;  2F3I A;  4C2M H;  4IPG A;  2MO1 A;  4IO9 A;  1XPU A;  1TWC H;  1IXR A;  1LM0 A;  3HOY G;  1WJJ A;  1N33 Q;  2RCN A;  4AH6 A;  4C3J H;  1BKB A;  4YCV A;  4KHP Q;  1FL0 A;  1L2F A;  1K3R A;  3KFU A;  4QQB X;  2QNC A;  3UDX A;  4JOI A;  2N49 A;  1X6O A;  4BBR H;  2BA1 A;  4GNX B;  2E2H H;  4JI2 L;  1MIU A;  2HIX A;  3U4Z A;  5GAH C;  5C4J H;  4AYB G;  4R4I A;  2EXD A;  5IT9 c;  4ME3 A;  1OXT A;  4JI1 Q;  1R9T H;  1HNW Q;  4EQ5 A;  4JI8 Q;  2ATW A;  2HIV A;  4UP7 A;  4LFC L;  2IX1 A;  1EQQ A;  3RZD H;  2VL6 A;  2Z6K C;  4L5Q A;  1S3O A;  3U4V A;  3ULL A;  4A3C H;  3S16 H;  1YJN A;  4JI4 L;  2VY3 A;  2WB1 E;  1GO3 E;  2V1C C;  1EIY B;  4YCU A;  1BBU A;  2VS1 A;  2ZM6 Q;  3HOW G;  2L15 A;  4JCV E;  2ZJR A;  4A3K G;  5FLX c;  1YIT A;  4DPG A;  3HOV H;  4LW1 A;  4GKK L;  1YEZ A;  4K0K L;  1SE8 A;  3F1Z A;  3CXC A;  1C7Y A;  1JT8 A;  1FGU A;  1VQE A;  4JG2 A;  1EN7 A;  3M7N A;  2Z6K A;  4DR6 L;  4GLA C;  4A93 H;  2NVY H;  4HIM A;  4JI5 Q;  2ZJQ A;  4LUO A;  3M4P A;  1IL2 A;  3HKZ E;  4UY8 C;  3H0G H;  2NVQ H;  1ASY A;  4JYA L;  4DR7 Q;  2JA8 H;  4A3G G;  4PMW A;  3U50 C;  4UP8 A;  3GTG H;  2JA5 H;  4JI7 Q;  3I4N H;  1Y14 B;  4LF7 L;  3MEF A;  1PH8 A;  1XMQ L;  2YU9 H;  3E0E A;  1E7L A;  1E24 A;  1KD1 C;  4HJ7 A;  2HHH Q;  3KOJ A;  1IYJ B;  1G6P A;  1N32 L;  3KYH C;  1Q81 C;  5FJ8 H;  4NXM Q;  4A76 A;  1S40 A;  4YCW A;  2JA6 G;  2B63 H;  2UXB L;  1Y1V H;  4DV2 Q;  4X64 Q;  2BH8 A;  4DV7 Q;  1QVG A;  4QL5 A;  3UDI A;  4IPC A;  3J81 i;  4JV5 Q;  2WB1 G;  2BA0 A;  4A3E H;  1X65 A;  2R7D A;  3E9H A;  4DR2 Q;  2PQA A;  4X6A H;  4GLX A;  4LF9 L;  4ALP A;  5C0X I;  1KRS A;  4DR5 Q;  4A3F H;  2ZTD A;  4IOA A;  4X62 L;  4X65 Q;  2IT1 A;  4IJL A;  1VQB A;  1HNX L;  3D0F A;  4GN5 A;  4LWC A;  1NMG A;  5BR8 Q;  4DR4 L;  4IFD G;  1IBM L;  1VCI A;  2YYZ A;  3K81 C;  4KI0 A;  2R7Z G;  4Y7N H;  3UE0 A;  3S2D H;  4POF A;  1O7I A;  2UXC L;  1C9O A;  1EIF A;  3FKI H;  2I0Q A;  4LF8 Q;  4BXX H;  5C44 G;  2Q2T A;  4B3S Q;  4YHH L;  4YWK A;  2NVT H;  4QIW E;  2MQH A;  4GOP B;  1FVI A;  1Z9F A;  1PFS A;  4BY1 G;  4AQY Q;  3CMA A;  4GN3 B;  1P16 A;  3I4O A;  2R7F A;  5LMN W;  1PH6 A;  1Q1B A;  1I50 H;  5IYD G;  3BU2 A;  3G6E A;  1L1O B;  2D0P A;  5H1S E;  1VQI A;  4A3I G;  2EIF A;  2WAQ G;  4JI6 L;  5IP7 H;  3FHW A;  3CCV A;  1UE6 A;  3CCU A;  1PH1 A;  1HR0 Q;  3PIO A;  1PYS B;  2KHJ A;  1OXS C;  2PMZ E;  1UWV A;  4XTC S;  3PUY A;  4EX5 A;  4KHP L;  3RN2 A;  1N9W A;  4TVA B;  3TQY A;  4MZ9 A;  1XNR Q;  3SGI A;  2ID0 A;  1J5E Q;  1TWA H;  1WYD A;  3PO3 H;  1IZ6 A;  2CWP A;  3F8T A;  4DUZ Q;  4L5S A;  2Q2H A;  3A0J A;  4UP9 A;  1BVS A;  2AMC B;  1XMO Q;  5M3F G;  1IBK L;  2N8N A;  3BZC A;  3K7U C;  4RG1 A;  5LMU Q;  1K8A C;  2JK8 A;  4JI1 L;  1QZG A;  3AQQ A;  1G29 1;  1QVC A;  3KF6 B;  2YTV A;  5IE8 A;  1HNW L;  5HGQ A;  2JJQ A;  4JI8 L;  3G4S A;  3M4O H;  3PCO B;  4OX9 Q;  3AEV A;  4MTN A;  4OWT B;  1SRU A;  3F2B A;  3HOY H;  4BY7 G;  5IP9 G;  3KJO A;  3S2H H;  3F2D A;  1PH5 A;  3I4M G;  3H3V I;  4MNO A;  4LFB Q;  1Q8K A;  2OWO A;  3I2Z A;  1N8R C;  1QUQ A;  1EYG A;  4POG A;  1NE3 A;  2F52 A;  2K5N A;  2UUB Q;  1E22 A;  2ZM6 L;  4DV3 Q;  1XJV A;  1VQA A;  1E1O A;  4IFD J;  1NY4 A;  4QY7 A;  1KL9 A;  1YHA A;  1Q82 C;  2UU9 Q;  1TWF H;  2PI2 E;  2PI2 A;  3UDF A;  4A3J H;  2NVX H;  4BA2 I;  1VQ8 A;  1CUK A;  3GD7 A;  4JI5 L;  1EFW A;  4LF5 Q;  3W1G A;  1YHB A;  4LUV A;  3HOU G;  1CSP A;  4NPS A;  2QA4 A;  1KIX A;  1EWI A;  4A3D G;  3PO2 G;  2EQS A;  4DR7 L;  1PH4 A;  1SFO H;  4PZ7 A;  3PGZ A;  4H02 A;  4JI7 L;  3ER0 A;  3HOX G;  2OTL A;  2K50 A;  3S1N H;  3CC7 A;  2LSS A;  2VUM G;  3CW2 C;  3HOW H;  1X54 A;  2AKW B;  4A3K H;  2ZTE A;  1VQO A;  2HHH L;  2KCM A;  2JA7 G;  2FXQ A;  2N3S A;  1KHI A;  5K36 G;  4NXM L;  5M3M G;  2UXD Q;  2AWN A;  5M5W H;  4DV2 L;  4X64 L;  1JE5 A;  4DV7 L;  3CQZ H;  2KEN A;  5HY6 A;  3WWV A;  4JV5 L;  3L2P A;  2NN6 I;  1OXU A;  4DR2 L;  2MO0 A;  1QVF A;  4PZ8 A;  1YJW A;  1N36 L;  1K83 H;  1VQK A;  3KDF A;  1SLJ A;  3M9B A;  4DR5 L;  3T1H Q;  3PUX A;  3CC2 A;  4B3M Q;  4L5R C;  1TWH H;  4X65 L;  3HOZ G;  3M85 A;  2D62 A;  1BBW A;  1KQS A;  4A3B G;  5BR8 L;  2IHF A;  3CPW A;  1C0A A;  3GO5 A;  5C3E G;  2HT1 A;  1GM5 A;  1WI5 A;  4DR3 Q;  1A0I A;  2H5X A;  3PSI A;  1YNX A;  1PV4 A;  4LF4 Q;  2JA6 H;  1Q7Y C;  4OWW B;  1PH9 A;  3KF8 B;  5GQO A;  4L5T A;  1H95 A;  4P75 A;  4LF6 Q;  3J80 c;  3CD6 A;  4APV A;  1KXL A;  2QGQ A;  2JA9 A;  1Q12 A;  2RF4 A;  4UPA A;  4LUZ A;  1VQD A;  2OTJ A;  5LMN Q;  1IBL Q;  1U0L A;  1CKN A;  2Q2I A;  2YV5 A;  4YWL A;  4C3H H;  1AH9 A;  4A3G H;  2UUC Q;  3OYY A;  2AHO B;  4DV1 Q;  1HR0 L;  1CKM A;  3CCQ A;  4GNX C;  1XNQ Q;  2R7Z H;  2NZO A;  3TS2 A;  4HID A;  4JC0 A;  3CCJ A;  2JEA I;  1Q46 A;  1S72 A;  1X3E A;  4DV0 Q;  4IOC A;  4NXN Q;  2E5L Q;  3PUV A;  3M3Y H;  1XNR L;  3HOV G;  3TEH B;  1J5E L;  4LNQ A;  2F4V Q;  1VS0 A;  4DUY Q;  1VQ4 A;  4BY1 H;  3UDG A;  3JC6 6;  4DUZ L;  3F2C A;  3H3V H;  4HJ9 A;  1V9P A;  2C35 B;  1XMO L;  3CP0 A;  1UE1 A;  1GD7 A;  1Q1E A;  5LMU L;  3HKZ G;  1V43 A;  4GNX A;  4A3I H;  2VQF Q;  2AWO A;  2CCZ A;  3NEL A;  4A3L G;  4A4I A;  4LFA Q;  4A3M G;  4OX9 L;  5M5Y H;  4OWX B;  4OXP A;  2JA8 G;  4JI3 L;  1LTL A;  1YZ6 A;  4DV4 Q;  1X56 A;  1VQJ A;  2K5H A;  4P73 A;  1HNZ Q;  1OTC A;  1TWG H;  1WCM G;  4P72 A;  1K8G A;  5ELN A;  1B70 B;  3STB D;  4LFB L;  1A63 A;  4JBW A;  5JEA G;  3JAM c;  4PG3 A;  4K0K Q;  4GKK Q;  2GVA A;  1EUJ A;  3S15 H;  2HQL A;  5EAY A;  5FJ8 G;  2UUB L;  2WFW A;  1VQG A;  4DV3 L;  1Y1V G;  5M3F H;  1VQ7 A;  2UU9 L;  1DGS A;  3K80 C;  1Y1W G;  1M1K C;  1N33 L;  2R93 G;  4WJ3 M;  5GAG C;  3GTK H;  1D7Q A;  3GTQ H;  1YBY A;  3RLO A;  3ULJ A;  3OW2 A;  1Q86 C;  4LF5 L;  3S1M H;  4HIO A;  5GRO A;  4A3F G;  2CQO A;  4DAM A;  4BY7 H;  4WJ4 A;  3Q8D A;  4C3I H;  4DK6 C;  1VQM A;  3I4M H;  4OO1 G;  5JJK A;  3W5O A;  4YY3 Q;  1G51 A;  5M5X H;  1JB7 A;  5IYC G;  4IFD I;  2Z0S A;  1GKH A;  2ASB A;  2OQK A;  1JJC B;  4BBS G;  2UXB Q;  3OTO Q;  2RHS B;  1VQ6 A;  4DV6 Q;  2KBN A;  1VQ9 A;  3A74 A;  1HJP A;  2JE6 I;  4DAY B;  1PHJ A;  1JJG A;  2R92 G;  2GVB A;  2MFI A;  3AFP A;  3D31 A;  1W3S A;  2UXD L;  2IHE A;  3PF4 A;  4R4O A;  2MNA A;  4J15 A;  3RNU A;  2PNH A;  1PH3 A;  3H15 A;  3CCR A;  1QZH A;  1KRT A;  3HOU H;  4OON A;  4A3D H;  1X55 A;  2BH2 A;  3PO2 H;  4GKJ Q;  3EBE A;  1HZA A;  3T1H L;  4JI0 Q;  3J80 i;  1PA6 A;  1RIP A;  3RZO H;  4DR4 Q;  3FP9 A;  1XPO A;  1I5F A;  1LUZ A;  3K8A A;  4AYB E;  3B6Y A;  2R6G A;  3I55 A;  3HOX H;  5IWA Q;  4RMF A;  2VUM H;  1T9H A;  4X66 Q;  3ZJY C;  1VQP A;  1FJG Q;  3GTL H;  1K0R A;  3EIV A;  2OQ0 A;  2QEX A;  4GOP C;  2JA7 H;  2DGY A;  3S24 A;  4DR3 L;  4NB3 A;  4DR1 Q;  2RHQ B;  2K4K A;  4LF4 L;  5M3M H;  4GN4 B;  4QJF A;  4JBM A;  2IX0 A;  1PH2 A;  4R4T A;  2ES2 A;  1X9N A;  4DV5 Q;  1HH2 P;  1L1O C;  5JEA J;  1TXY A;  4JOI C;  1X3F A;  4B3T Q;  2KCT A;  3ULP A;  4LF6 L;  1PVO A;  2PQA B;  5E7N A;  2VW9 A;  4R4C A;  1I94 Q;  2QNF A;  3RLF A;  1PYB A;  1XPR A;  3HOZ H;  4GOP A;  3I56 A;  5LMN L;  1IBL L;  2I5M X;  2LXK A;  3CCE A;  4A3B H;  4O2D A;  2UUA Q;  3U58 A;  2UUC L;  5C3E H;  1UEB A;  3TRE A;  4DV1 L;  5IYB G;  1XNQ L;  4DKA C;  5FLM G;  1L1O A;  1N34 Q;  2Q2U A;  3L0O A;  5C4X G;  4DV0 L;  4NXN L;  1W2B A;  2K5V A;  3RR5 A;  5GAD C;  2E5L L;  3PUZ A;  2IY5 B;  1IBK Q;  1VQC A;  2F4V L;  4DUY L;  3TS0 A;  1D8L A;  2VQE Q;  3CAM A;  3K7A H;  3JAM i;  4A3J G;  1SN8 A;  1HZB A;  2E2I H;  1A8V A;  3T1Y Q;  2E8G A;  3DM3 A;  3E9I A;  3RLN A;  1AE2 A;  2VQF L;  3DLL A;  4BBR G;  2ZJP A;  4LF8 L;  4P74 A;  4GLV B;  2OCE A;  3KLW A;  4B3S L;  4LFA L;  1E3P A;  2B29 A;  2JEB I;  2KHI A;  4DV4 L;  4B3R Q;  1VQL A;  3G48 A;  4HJA A;  1HNZ L;  2WP8 J;  1VQF A;  4AQY L;  3KF6 A;  5AJ3 Q;  1VQH A;  2E2J H;  1AE3 A;  2VNU D;  2XTI A;  2YTY A;  4DNI A;  5C0X G;  1U5K A;  1CSQ A;  2I5H A;  4IJH A;  3UE1 A;  3GTO H;  1P8L A;  1A62 A;  1J6Q A;  2CWA A;  1OXX K;  1E7D A;  4A3C G;  3KJP A;  1NBW A;  1X3G A;  4R4Q A;  1HZC A; 
#chains in the Genus database with same CATH topology
 3NXW A;  1VQN A;  4A3M H;  4ZKB B;  3S14 H;  2K52 A;  1LTB D;  3IRB A;  2DUD A;  3RMH A;  1HTP A;  3HKS A;  3T4A C;  4YY3 L;  1QNU A;  3S2H B;  1YJ9 A;  4LFC Q;  4A93 G;  3L7Z C;  4IN3 A;  4MTK A;  3PV0 A;  5C4X B;  3D4R A;  2WAQ E;  3MXN B;  4QMG A;  2L9H A;  3SXH A;  4AYB B;  4JI4 Q;  4C2M B;  2XGT A;  3JAM L;  1QNK A;  1TWF B;  4XIG S;  3OWF A;  4C3J B;  5A35 A;  1V1P B;  4GKJ L;  3Q23 A;  4DR6 Q;  5IYC H;  1SYE A;  4ULL A;  2K75 A;  3A5U A;  1UNS A;  4FXK C;  4XQN A;  4X66 L;  3EN2 A;  3S1N B;  1X3Q A;  2LKV A;  2D9U A;  5IT9 E;  4KV6 A;  3QWN A;  1XMQ Q;  4DNR B;  3K5N A;  4HJ8 A;  4QF4 A;  2OEO A;  1EU3 A;  3FKI G;  2CKZ B;  3D3R A;  2Y0S G;  1PMR A;  4J1M A;  1BF4 A;  2F0U A;  3R2T A;  5CMD A;  4ZCK A;  5EBC A;  4TQU S;  5DM6 3;  1R4P B;  5FLX E;  1OXV A;  2CH4 W;  5DLQ E;  5DNF A;  4A93 B;  3CCS A;  3CCL A;  1I6H H;  1MJE A;  4CDC C;  2E2D C;  3GTM H;  1ASZ A;  2VQE L;  2QDB A;  3MFG A;  1RTN A;  2KED A;  4PNY A;  1S5E D;  1K73 C;  2XWJ B;  3ERS X;  3CC4 A;  2D0O A;  1WFQ A;  2B2U A;  3QO2 A;  2NWG A;  5IGG A;  4C3I G;  2N78 A;  5CV7 A;  1MJC A;  5IYB H;  1A2U A;  4IPD A;  1FGB D;  2Q8I B;  3TRZ A;  1YVC A;  5FKA C;  5AJ3 L;  1CHQ D;  5IY0 A;  4QGU A;  1VQ5 A;  2A5H A;  2TMP A;  4JI6 Q;  2MO1 A;  4IO9 A;  3M3Y B;  1IXR A;  1WJJ A;  2F0W A;  4AH6 A;  4KHP Q;  1FL0 A;  1K3R A;  3EVQ A;  3KFU A;  2QNC A;  1D5Z C;  3SK5 A;  2E2H H;  3HG9 A;  3LNN A;  3U4Z A;  5C4J H;  3FKI B;  2Y0S B;  3ONA B;  3SEB A;  1R9T H;  4EQ5 A;  2HIV A;  4UP7 A;  4LFC L;  1EQQ A;  1ICW A;  2Z6K C;  1TII D;  1YJN A;  4JI4 L;  1T5E A;  2MHV A;  1GO3 E;  5FO7 B;  3KBX A;  3ND9 A;  1BBU A;  1BNZ A;  4A3K G;  1YIT A;  4K0K L;  2K5Q A;  2HD3 A;  3K58 A;  1KLU D;  1SE8 A;  2IL8 A;  3CXC A;  1YNJ D;  1A2T A;  1FD7 D;  1VQE A;  4JG2 A;  5E4W C;  4DR6 L;  4C3I B;  4HIM A;  2ZJQ A;  4LUO A;  3HKZ E;  3NBI A;  3H0G H;  2HDL A;  2CHB D;  5FOB B;  1ASY A;  2JA8 H;  3URY A;  3U50 C;  3GTG H;  2JA5 H;  3I4N H;  1Y14 B;  3MEF A;  1XMQ L;  3HRZ C;  1KD1 C;  5CIU A;  4KJO A;  3ND8 A;  2B2Y C;  3KYH C;  1TS4 A;  2EYP A;  4NXM Q;  1KLG D;  4DA2 A;  1S40 A;  2B63 H;  4DV2 Q;  2JVW A;  4A3D B;  3PO2 B;  1Y02 A;  1K3B C;  2WB1 G;  2MP1 A;  5KND A;  1X65 A;  2R7D A;  4L6T B;  1HUN A;  1OO9 B;  1KRS A;  2NVX B;  4A3F H;  2ZTD A;  4IOA A;  4BWG B;  3E6Z X;  1LT5 D;  4LWC A;  2Z8L A;  1TT2 A;  4FF4 A;  2F0E A;  5EGT A;  4POF A;  1CHP D;  4FYD A;  4G4K A;  5KNB A;  1AN8 A;  4BXX H;  2X6G A;  4YWK A;  1SDF A;  2MQH A;  1KAA A;  1HXY D;  5M5W B;  3A56 A;  1VQI A;  3CQZ B;  1BCP D;  1Q90 A;  4C1N K;  4JI6 L;  3SK6 A;  2GA4 B;  4IQZ A;  1K83 B;  3PIO A;  2KHJ A;  2RNO A;  1BCP C;  1OXS C;  1SNQ A;  1B3A A;  1O80 A;  3HZX A;  3HEJ A;  4EX5 A;  4KHP L;  1KDB A;  1PLF A;  2ID0 A;  1IZ6 A;  1XTC D;  3RD4 A;  4L5S A;  2Q2H A;  3A0J A;  2AMC B;  1WD0 A;  3BZC A;  2B2V A;  3K7U C;  4O42 A;  4RG1 A;  5LMU Q;  5CC4 A;  2WB1 B;  1F9P A;  1KDC A;  3M4O H;  4HSP A;  2AQ1 B;  3AB9 A;  3F2B A;  2A74 C;  4DN4 M;  3F2D A;  1JB3 A;  2Q8R E;  3H3V I;  3GTO B;  1X3P A;  1HRJ A;  1Q8K A;  1MSH A;  3D6C A;  4H44 C;  3I72 A;  4DV3 Q;  1A6X A;  4QY7 A;  1KL9 A;  4A3M B;  5A2Q E;  1YHA A;  4CGY B;  3S14 B;  2UU9 Q;  3C46 A;  4A3J H;  3TME A;  4HCE A;  1BR9 A;  3MA2 B;  1CUK A;  4LF5 Q;  1F77 A;  4NPS A;  3GV6 A;  2QA4 A;  1ILQ A;  5IT9 L;  4JVZ A;  2OTL A;  2K50 A;  3L3O C;  1FYC A;  3HOW H;  4F7X A;  2ZTE A;  3MXU A;  3I90 A;  2JA7 G;  1PTO B;  2RA4 A;  1KHI A;  5K36 G;  4NXM L;  2UXD Q;  1XX8 A;  4DV2 L;  3VR4 A;  2NZ1 D;  2KEN A;  2MO0 A;  5FLX L;  2MUY A;  1JC7 A;  1LAB A;  1VQK A;  4A3G H;  3KDF A;  2KQ3 A;  2EYF A;  3PUX A;  3V05 A;  2WII B;  2PZT A;  3LX0 A;  4DFA A;  1C0A A;  4DR3 Q;  4LF4 Q;  2JA6 H;  3MTS A;  5GQO A;  4L5T A;  1KAB A;  2J7Z A;  4APV A;  1KXL A;  1AP0 A;  1JWM D;  2XRS D;  4UPA A;  2OTJ A;  2HQE A;  1U0L A;  4CJ2 C;  4GZY C;  1PZK D;  2Q2I A;  4C3H H;  2AHO B;  3CCQ A;  1XNQ Q;  1CA5 A;  2KVD A;  4HID A;  3GTM B;  1E0B A;  1Q46 A;  4NXN Q;  4EVO A;  3A55 A;  1JOR A;  4LNQ A;  3GTL B;  2F4V Q;  2JA7 B;  3K57 A;  1CM9 A;  3CP0 A;  2BOS A;  5LMU L;  1V43 A;  1SYD A;  4G7H C;  4A4I A;  4LFA Q;  5M5Y H;  4DF7 A;  4OXP A;  2JA8 G;  4JI3 L;  1LTL A;  4DV4 Q;  1HNZ Q;  2K5H A;  4MHE A;  5ELN A;  3STB D;  2L1B A;  3LWU A;  2EYL A;  2GVA A;  1EUJ A;  3OWE B;  4CKE A;  3S15 H;  2HQL A;  2M2L A;  5EAY A;  1VQG A;  4DV3 L;  2E2H B;  2ZXP A;  2FMM A;  1SE3 A;  3ZYY X;  3I8Z A;  1VQ7 A;  5C4J B;  3D8G A;  2UU9 L;  2BE5 D;  1DZ1 A;  1KHC A;  1E2V A;  5GAG C;  3GTK H;  1DD2 A;  3RLO A;  3OW2 A;  1Q86 C;  4LF5 L;  4A3F G;  2CQO A;  3I4M H;  2B8F A;  5ELC A;  1G51 A;  1JB7 A;  2K5D A;  1LV9 A;  3D4W A;  1D5M C;  2EY5 A;  3OTO Q;  2JE6 I;  5ELD A;  3AFP A;  1RDP D;  3D31 A;  2UXD L;  2KHS A;  3PF4 A;  4R4O A;  1PH3 A;  1IW7 C;  3H15 A;  2B2U C;  3I73 A;  3H94 A;  3HOU H;  1EY9 A;  1HZA A;  1PA6 A;  3W3A A;  1QOH A;  1LUZ A;  1UUP A;  3IKJ A;  3HOX H;  2JA8 B;  4RMF A;  1O7L A;  2JA5 B;  1VQP A;  4ZYS A;  1Z6H A;  3BDO A;  4DR3 L;  1U4M A;  4DR1 Q;  2EYJ A;  4LF4 L;  5M3M H;  4GN4 B;  2EJF C;  3SHL A;  1X9N A;  4R8N A;  3WOE A;  2B63 B;  1PVO A;  4B3T Q;  4HN7 A;  1GXD C;  2KCT A;  3TP7 A;  2PQA B;  1CTM A;  3RLF A;  4GOP A;  3I56 A;  4FNF A;  5FK9 C;  4A3F B;  3CCE A;  4O2D A;  1K8M A;  2A6E C;  2LC3 A;  1A15 A;  5C3E H;  1UEB A;  1XNQ L;  5FLM G;  2IX3 A;  1I4P A;  5CBE E;  1MI2 A;  4NXN L;  2K5V A;  3TDQ A;  2FFK B;  1VQC A;  1EFI D;  2PZU A;  2F4V L;  3K7A H;  4A3J G;  1SN8 A;  2LD7 A;  3T1Y Q;  3K5L A;  3DM3 A;  1STN A;  3RLN A;  3NWT A;  4LFA L;  4LF8 L;  4P74 A;  3KLW A;  5IGF A;  1Y69 U;  2B29 A;  4DV4 L;  4HJA A;  1HNZ L;  1A3T A;  5C0X G;  1B9N A;  1TY2 A;  2A73 B;  2L4N A;  3VA7 A;  5A2Q L;  1LT3 D;  1L0X B;  1IYV A;  2CWA A;  1NR2 A;  3KJP A;  4GN5 A;  2K1B A;  4K5W A;  5EQ0 A;  2ALY B;  5C44 H;  3M4O B;  2KVE A;  5IGD A;  5GAE C;  1JOK A;  2EPB A;  1MKH A;  4L8J A;  1D5X C;  5ELB A;  2K7V A;  5JEA H;  1RHP A;  5BN4 A;  2A19 A;  5JJL A;  4XQQ A;  1KAW A;  1E7Z A;  3OTO L;  4Y52 H;  3MXG A;  1R4Q B;  4I7Z C;  4TRD A;  1NMF A;  1Y1W H;  2R93 H;  3NBH B;  1K9M C;  1N36 Q;  3QKJ A;  4A3J B;  3S17 H;  1A3U A;  4A75 A;  2GN5 A;  5COY A;  4R1J A;  3J7A 5;  5KYI A;  3NEM A;  3NUC A;  5EJW A;  5J3B A;  1QG7 A;  4BBS H;  1SSO A;  1VF7 A;  4DK3 C;  3VDY A;  3RUZ A;  1SJH D;  1D1I A;  2CW0 D;  3S1R H;  4DR1 L;  4OEM B;  3CME A;  5C0X J;  2A1A A;  1EQR A;  4B3T L;  2KFV A;  2RDH A;  4K2K A;  4E6I A;  1N32 Q;  1B50 A;  1GUO A;  2QDL A;  1NTG A;  2PYK A;  1YI2 A;  2F0S A;  4KJN A;  2K04 A;  4CJ0 B;  4LF9 Q;  1XTD A;  4K8J A;  3NPP A;  2HJQ A;  4X62 Q;  1M90 C;  4PZ6 A;  2NZH A;  3I7F A;  2QKI C;  3QJY A;  5EKL A;  2F0J A;  1H9R A;  5IP7 G;  3GTJ H;  1ENA A;  2O2L D;  3NHH A;  1B8A A;  4ABN A;  3J81 c;  2Z6B A;  2UXC Q;  3T1Y L;  1DM0 B;  4YHH Q;  4JBJ A;  1M8A A;  3KLS X;  1EOV A;  4HIK A;  3OOC A;  2C9O A;  2F0D A;  4HJ5 A;  4C3H B;  2FMC A;  4FDB A;  1I4H A;  5EPK A;  5C4Z A;  2F3I A;  2IPK D;  4O1N A;  1N33 Q;  5EPJ A;  4EQO A;  3UDX A;  4JOI A;  2N49 A;  4GNX B;  4BBR H;  5JJZ A;  1V1P A;  1JQY D;  2HIX A;  3OIP A;  2F0M A;  2AQ2 B;  5GAH C;  4AYB G;  4ME3 A;  2NVT B;  5M5Y B;  2F0T A;  1EWH A;  3DUZ A;  5LL6 X;  4U67 3;  4Q0F A;  2I46 A;  3S15 B;  3T13 A;  4FXG C;  3U4V A;  3ULL A;  4A3C H;  2B2T A;  1LTR D;  1LO5 D;  4YCU A;  2JP1 A;  2E76 C;  2ZJR A;  4GKK L;  3P7J A;  3R8B A;  3GTK B;  4DAY A;  2NUC A;  1C7Y A;  1EY5 A;  2ICE C;  3M7N A;  3FLG A;  3I4M B;  2A6H D;  2NVY H;  5CR3 A;  1IL2 A;  4WRD A;  1EYA A;  2A69 D;  4K6D A;  1EYD A;  1K28 A;  1BCP B;  1NR4 A;  3VYS A;  2LMC B;  4H7B A;  3N6R A;  2YU9 H;  2F0H A;  1E7L A;  3F2U A;  4HJ7 A;  3KOJ A;  1IYJ B;  1F9R A;  2ZXO A;  2D2C C;  1N32 L;  1G6P A;  5FJ8 H;  4A76 A;  4XXE A;  2BH8 A;  4JV5 Q;  3J81 i;  2BA0 A;  4A3E H;  2PW5 A;  4DR2 Q;  4X6A H;  4LF9 L;  1HHV A;  1ILP A;  4X62 L;  4V0B A;  4IJL A;  3GV3 A;  4IUN A;  5COR A;  1VQB A;  5M3M B;  2YYZ A;  4QCL A;  3K81 C;  4KI0 A;  2R7Z G;  3TP6 A;  1O7I A;  2UXC L;  2HCC A;  5C44 G;  4B3S Q;  2O5I C;  4YHH L;  4HTH A;  1PFS A;  4AQY Q;  1V1O A;  2EE1 A;  2HDM A;  1RKN A;  5LMN W;  1IL8 A;  1Q1B A;  3KK7 A;  1L1O B;  5KGU A;  5C3E B;  1PFB A;  2EY1 A;  2XIW A;  1I4X A;  2RSO A;  2QEJ C;  1SYG A;  3NTH A;  3CCV A;  1HR0 Q;  4G7O C;  1JIC A;  4PV1 C;  2O5J C;  2PMZ E;  1ENF A;  1UWV A;  2VB3 X;  3EA6 A;  4EQN A;  1N9W A;  1VF5 C;  4XT3 B;  1TWA H;  3PO3 H;  3KBG A;  4G7Z C;  4DUZ Q;  1XMO Q;  4CDD C;  1IBK L;  5M3F G;  1GJX A;  1GOZ A;  2NN6 H;  2JK8 A;  1QZG A;  3DEO A;  3AQQ A;  4B9W A;  5D3D A;  5IE8 A;  2YTV A;  3J7A V;  2K33 A;  4EQP A;  3AEV A;  1DOL A;  4BY7 G;  3HOY H;  4DAV A;  1EWC A;  1PH5 A;  3VR6 A;  2NTS A;  1NNX A;  1F2Y A;  3I2Z A;  1N8R C;  2X69 A;  3HKZ B;  1QUQ A;  1EYG A;  2R7Z B;  5C44 B;  1DON A;  2PI2 E;  3UDF A;  2K32 A;  3KLS A;  1PZJ D;  2O4X A;  1D6E C;  3MAQ A;  1EQV A;  5ISR A;  4A3D G;  3PO2 G;  2EQS A;  2LS0 1;  1SFO H;  2SNS A;  3J7Y W;  3K59 A;  1S5C D;  2RDG A;  1Y1W B;  3CRK C;  1X54 A;  2AKW B;  4XYO A;  5EPL A;  1TWG B;  3E3X A;  2E75 C;  1B4O A;  3S17 B;  1UEA B;  3MWY W;  4XQJ A;  3OW7 A;  1STY A;  4JV5 L;  5M3F B;  3L2P A;  2NN6 I;  4DR2 L;  1QVF A;  3CC2 A;  1SLJ A;  4B3M Q;  3T1H Q;  4RH6 A;  1TWH H;  2XWB B;  3GTQ B;  3M85 A;  2D62 A;  4BY7 B;  1BBW A;  1IYU A;  3S1R B;  4A3B G;  3O13 A;  4KY5 A;  2B8G A;  1FNW A;  3DXJ C;  2HT1 A;  1GM5 A;  1PV4 A;  1YNJ C;  4RCN A;  1EIG A;  1PH9 A;  2KEC A;  5T1I A;  1H95 A;  4LF6 Q;  3OIQ A;  1Q12 A;  4R9W A;  4LUZ A;  1VQD A;  1WTQ A;  1IBL Q;  1CKN A;  1U4P A;  2EVB A;  4IFD H;  1T5X D;  3VA5 A;  2UUC Q;  3TN2 A;  1HR0 L;  1EEI D;  1CKM A;  4GNX C;  5CGK A;  1HPC A;  1PZI D;  5G3L D;  3CCJ A;  1X3E A;  4DV0 Q;  4ODG A;  3TEH B;  4HAE A;  4DUY Q;  4BY1 H;  2MPM A;  3UDG A;  3H3V H;  4KY7 A;  3F2C A;  3NK9 A;  4DUZ L;  3NWS A;  1GKU B;  1V9P A;  3A7L A;  1XMO L;  1UE1 A;  2NTT A;  2DNE A;  1IKM A;  2B2W C;  1JE4 A;  4CJ1 B;  4A3I H;  2JSO A;  2F03 A;  2VQF Q;  5IOD A;  3NEL A;  4IAL A;  4N8F A;  2JN4 A;  2F0P A;  4A3M G;  3BS1 A;  3PIO 3;  1X56 A;  1VQJ A;  2WQG A;  4P72 A;  4A3B B;  1G8Z D;  5FJ8 G;  2WFW A;  1PFM A;  1DGS A;  4WJ3 M;  3ULJ A;  4TKO B;  1AZP A;  2PPB C;  3SDZ A;  1JR0 D;  4J6H A;  3KUP A;  4N9P A;  3H91 A;  3W5O A;  4IFD I;  5IYC G;  2J0T D;  1GKH A;  2D5D A;  2ASB A;  2UXB Q;  4DV6 Q;  2XRQ D;  2E2J B;  3DWP A;  1VQ9 A;  1HJP A;  2RSN A;  1J8I A;  1JJG A;  1W3S A;  1BDO A;  1PRT F;  1SBB B;  4J15 A;  5C4H A;  1ZS9 A;  2RKS A;  1QZH A;  1KRT A;  1EY6 A;  3EJI A;  2BH2 A;  3EBE A;  3ITP A;  3T1H L;  1AEX A;  4JI0 Q;  4DR4 Q;  3RZO H;  1I5F A;  1VMP A;  3K8A A;  5C6A A;  4KTA A;  2CH4 A;  4I65 A;  2VUM H;  4HCS A;  1LT4 D;  1K0R A;  1CK1 A;  1ZEQ X;  2OQ0 A;  1QWY A;  1J9O A;  2OT2 A;  2AUJ D;  1WTW A;  2RHQ B;  4QJF A;  5I9O A;  2ES2 A;  1HH2 P;  2FHT A;  1L1O C;  4JOI C;  4BIT A;  1ROD A;  3ULP A;  4LF6 L;  3C1F A;  4K5X A;  2JXM B;  1I94 Q;  4R4C A;  2QNF A;  2Z1C A;  1B2T A;  3NSW A;  3HOZ H;  2G5D A;  5DAU A;  1QCB D;  2R61 A;  1IBL L;  5E4X A;  1MHW C;  2UUA Q;  3U58 A;  3FDT A;  2UUC L;  5IYB G;  4DKA C;  2EOT A;  3L0O A;  2G9D A;  1CA6 A;  4DV0 L;  3RR5 A;  5GAD C;  4RGM A;  2IY5 B;  4QIW B;  4DUY L;  1NUC A;  1BXT A;  2B2T C;  3CAM A;  3S9W A;  1HZB A;  2E2I H;  4C56 C;  1A8V A;  4RAU C;  5JAV A;  3NE5 B;  3BZD B;  2VQF L;  4PMC A;  3P75 A;  2ZJP A;  2DY8 A;  4CDF C;  2F0L A;  1E3P A;  4B3R Q;  1VQL A;  3G48 A;  4OEL B;  5NUC A;  2WP8 J;  3KF6 A;  4S3S A;  1AE3 A;  2YTY A;  5I6Y A;  2RDF A;  4X3U A;  4IJH A;  1GUG A;  3VR5 A;  1TWA B;  2KJX A;  1VMC A;  3V2T A;  1I6H B;  1E7D A;  2FIN B;  1HZC A;  4A3L H;  2ZTC A;  2XSC A;  3BJU A;  4DGZ A;  1EOT A;  2NYZ D;  2ZXR A;  2Z4I A;  1CKO A;  1KDA A;  4FO2 A;  1LYL A;  1TU2 B;  2L11 A;  1WCM H;  3HOY B;  2OF1 A;  3I4L A;  3J81 E;  4I7A A;  1NJI C;  2CFM A;  5CV9 A;  4IUR A;  3H0G G;  4DV6 L;  2AQ3 B;  3J7Z C;  1RL2 A;  4X3S A;  2JA5 G;  1V1Q A;  2QF7 A;  3TBI B;  3FPP A;  3I4N G;  3M4Q A;  2NBF A;  2F3V A;  1CI3 M;  4OO1 H;  3I70 A;  3K5M A;  2B63 G;  3STB C;  4JI0 L;  2B39 A;  3PIP 3;  4F8M A;  2P5Z X;  3ICE A;  2EY2 A;  3HFZ B;  1SEB D;  4RHS A;  1LTI D;  1R9T B;  4FXD A;  3A7A B;  5AFW A;  4EGV A;  5IP9 H;  1LLR D;  2R92 H;  4IPH A;  4LF7 Q;  2I5L X;  3U9S A;  2BE5 C;  4CBV A;  3PIP A;  2A8V A;  3A5Z B;  3VYU A;  1SRO A;  2F3W A;  4OIJ A;  1JMC A;  3S1Q H;  3J81 j;  4LMQ D;  1I94 L;  4BXX G;  3KDF B;  4H0L C;  1GVP A;  3NEN A;  1EU4 A;  1HFN A;  1F9S A;  2UUA L;  5IIF A;  5JJI A;  3NP8 A;  5IGB A;  4RGT A;  1S5B D;  4HR7 B;  4BA1 I;  3CF5 A;  2F0Q A;  2F1M A;  4JBK A;  2H1E A;  4FP5 D;  1XWE A;  3H0G B;  2BCO A;  3GTG B;  2K14 A;  3I4N B;  1B1Z A;  1WTO A;  2LXJ A;  4YWM A;  4DAP A;  2FJ2 A;  3K0X A;  4GS3 A;  1G6Z A;  4KMU C;  5E1F A;  4OO1 I;  1EIH A;  5HGT A;  1CT1 D;  4B3R L;  2WKC A;  1I4G A;  1H9S B;  1GUS A;  5C4X H;  2YTX A;  2Z9H A;  1SXT A;  2MPH A;  1WTH A;  3C3L A;  4C2M H;  3D4D A;  1LM0 A;  4RGO S;  4F88 A;  2NB0 A;  2X6L A;  3FPU B;  4PMB A;  4C3J H;  4YCV A;  1L2F A;  3QR8 A;  4RHR A;  3SR1 A;  4ZAI A;  2ODC I;  1MIU A;  1TR5 A;  1AFP A;  5G3L F;  2EXD A;  3G6J B;  4JI1 Q;  1HNW Q;  4JI8 Q;  2ATW A;  4HED A;  2VL6 A;  3TP5 A;  4L5Q A;  1S3O A;  4CKB A;  3S16 H;  1WTX A;  1I4R A;  1PXU A;  2VS1 A;  3HOW G;  2L15 A;  4JCV E;  3HOV H;  1BOS A;  4LW1 A;  1YEZ A;  1JT8 A;  1FGU A;  4ME5 A;  1S5F D;  2Z6K A;  4A93 H;  4JI5 Q;  2L5T A;  1ZKO A;  3DWA A;  3TP8 A;  4CKC A;  2NVQ H;  5CYU A;  4XYQ A;  1DYQ A;  4A3G G;  3CRL C;  3E0J A;  3T51 B;  1NCV A;  4JI7 Q;  3M4Y A;  3WDN A;  4LF7 L;  1HQR D;  1E24 A;  3EFX D;  2QW7 A;  1SNM A;  4B9X A;  2DJG C;  3VYT A;  2JA6 G;  4YCW A;  1WVL A;  1Y1V H;  2DJF C;  3BG3 A;  1QVG A;  4QL5 A;  1K0S A;  1LTA D;  3I3C A;  4UAI A;  1TY0 A;  3E9H A;  3RZO B;  1KTK A;  1S4Z A;  1TKW B;  1X32 A;  1AZQ A;  1GUN A;  1PTO D;  2IT1 A;  1M4V A;  2B2Y A;  2F0N A;  2LY7 A;  3D0F A;  5IGC A;  3A8I E;  4C3H G;  1WD1 A;  3UE0 A;  3BVM A;  1TQO A;  4CDE C;  1SE2 A;  4X3K A;  1BO0 A;  1SJE D;  3FKI H;  2EJG C;  2Q2T A;  3HOW B;  5KYL A;  4GOP B;  4KN4 C;  1Z9F A;  1GJJ A;  3HOZ B;  3CMA A;  5JOB A;  4GN3 B;  1ESR A;  1P16 A;  2R7F A;  5L37 A;  3LWE A;  3BU2 A;  2CW0 C;  2D0P A;  4DNT B;  2WAQ G;  2B2V C;  3FHW A;  3OPO A;  3CCU A;  5E3F A;  1PH1 A;  4A3G B;  1IKL A;  4BS9 A;  3PUY A;  3BYY B;  4TVA B;  1XNR Q;  5FO8 B;  1J5E Q;  2RCF A;  2CWP A;  3F8T A;  3GP7 A;  5DM7 3;  2JA6 B;  1BVS A;  3J81 L;  3T16 A;  4JI1 L;  1QVC A;  1HNW L;  1JJR A;  2JJQ A;  4JI8 L;  3G4S A;  3PCO B;  4IUT A;  4JPB W;  2EYO A;  4MTN A;  1II3 A;  4OWT B;  1SRU A;  3Q22 A;  5IP9 G;  3KJO A;  1QIL A;  3I4M G;  5D3I B;  4POG A;  4FF3 A;  2K5N A;  4DXG A;  1E22 A;  1XJV A;  3MXN A;  1NY4 A;  1Y8P B;  1Q82 C;  2PI2 A;  2NVX H;  4BA2 I;  2KEE A;  3GD7 A;  4JI5 L;  1EFW A;  1YHB A;  1YNN D;  1U4L A;  4LUV A;  3HOU G;  1CSP A;  3N52 A;  1EWI A;  1PH4 A;  2WAQ B;  4OGQ C;  1WTP A;  1YNN C;  4H02 A;  4PZ7 A;  4JI7 L;  3ER0 A;  3HOX G;  2K01 A;  4A3K H;  1CZG A;  2KOL A;  1VQO A;  2J4X A;  1I6V C;  2JYO A;  1PRT D;  4IUP A;  4J8Q A;  2N3S A;  5M3M G;  5M5W H;  2QIL A;  4P2C B;  3CQZ H;  5HY6 A;  1PRT C;  3DMU A;  1OXU A;  4PZ8 A;  4ZKC B;  1YJW A;  1K83 H;  1N36 L;  4L5R C;  1UAP A;  3M9B A;  3MFY A;  2M00 A;  4C1N I;  3CPW A;  5C3E G;  2Z4H A;  3PSI A;  2H5X A;  1YNX A;  1ZYR D;  3KF8 B;  2A6H C;  5D14 A;  4P75 A;  2A69 C;  5JPN C;  3J80 c;  2EZV A;  4UHV A;  5HUR A;  2QGQ A;  2JA9 A;  3TSS A;  5DEH A;  2RF4 A;  1AW7 A;  1RCV D;  1STB A;  4YIJ A;  3H3V C;  2YV5 A;  3HOU B;  3DWQ A;  1SNC A;  3OYY A;  3Q24 A;  2JEA I;  2RVL A;  3HOX B;  1S72 A;  4IOC A;  2KCN A;  3PUV A;  1RD9 D;  5ELE A;  1XNR L;  3HOV G;  1JEQ A;  1A3V A;  1J5E L;  3JC6 6;  3MEH A;  1Q1E A;  3EQL C;  3HKZ G;  1SE4 A;  1JCK B;  4WJW A;  1SYB A;  1YZ6 A;  4UDU C;  4P73 A;  1F9Q A;  2IWH A;  2KW9 A;  2WV6 D;  3R2I A;  1K8G A;  1B70 B;  1PTO H;  4JBW A;  1STA A;  3OMC A;  2K28 A;  5JEA G;  3JAM c;  4K0K Q;  3E5S A;  1PYW D;  4Q5V A;  1Y1V G;  1C48 A;  4QUC A;  1HTL D;  2DNC A;  1Y1W G;  4U68 A;  1M1K C;  1N33 L;  2R93 G;  2BDO A;  3K7A B;  3S1M H;  5GRO A;  3R3O A;  1VQM A;  1FNU A;  5JJK A;  3BVG A;  5M5X H;  5KRU A;  2AUK A;  3S16 B;  2OQK A;  1JJC B;  1F2L A;  1F2M A;  2K03 A;  1SAP A;  3Q6S A;  1RJT A;  5BN5 A;  4BBS G;  1JWS D;  2F0I A;  4KY6 A;  4DAY B;  1EY4 A;  1EZ8 A;  1PHJ A;  3HOV B;  5C5L A;  2IHE A;  3CHB D;  2PNH A;  3FEW X;  3MHB A;  3CCR A;  4UZW A;  3J80 i;  2NVQ B;  3FP9 A;  4AYB E;  3B6Y A;  2R6G A;  3I55 A;  5IWA Q;  4F87 A;  4KK7 A;  1FJG Q;  1C4Q A;  2BDN A;  3GTL H;  3EIV A;  2PO4 A;  2QEX A;  4GOP C;  2JA7 H;  1JWU D;  5C3X A;  4NB3 A;  5K36 H;  2K4K A;  4JBM A;  2ODG C;  2IX0 A;  4B08 A;  4DV5 Q;  2VNU D;  5JEA J;  1TXY A;  1Y1V B;  1QE6 A;  1RF2 D;  4FF2 A;  3IAY A;  3QOL A;  2XN9 C;  3FRP B;  2R93 B;  1PYB A;  1XPR A;  2I5M X;  2K05 A;  2LXK A;  1SND A;  1Y8N B;  1ICF B;  4G57 A;  1N34 Q;  2Q2U A;  1W2B A;  1TS2 A;  3PUZ A;  4BBS B;  5J1Z A;  1KNA A;  1L0Y B;  1ESF A;  3TS0 A;  1SYC A;  1LT6 D;  1PTO F;  3JAM i;  1TS3 A;  3E9I A;  4NDX A;  4NMZ A;  3DLL A;  4BBR G;  3VYR A;  1BUV T;  4GLV B;  3IL8 A;  4B3S L;  4RCO A;  5I2X A;  2KHI A;  2JEB I;  2EYM A;  4OHJ A;  1VQF A;  4AQY L;  1VQH A;  1VDZ A;  5CV6 A;  1O7Y A;  3U9O A;  3UE1 A;  5JPM C;  2VXW A;  1P8L A;  3DM1 A;  1DCZ A;  1A62 A;  1GHK A;  4A3C G;  1X3G A;  4KKU A;  1FNV A;  4JI2 Q;  3GTJ B;  3RN5 A;  2DN8 A;  2G9H D;  2JQO A;  3CCM A;  2F0F A;  2I07 B;  3A54 A;  3G71 A;  1UE7 A;  3D6W A;  5ELO A;  5IYD H;  1EY0 A;  2EXZ A;  1QUQ B;  1E1T A;  1I3Q H;  5KIX A;  2B3G A;  3OMG A;  1H9M A;  4P71 A;  3AYH B;  1HQM C;  2Y0S E;  2WIN B;  2ENB A;  4KLK A;  5JVG 3;  1WOC A;  4QB4 A;  4CHT B;  2ZT9 C;  2F0K A;  5C5M A;  1I4Q A;  1GL9 B;  1Z47 A;  2F0V A;  4M1U B;  1E2W A;  4BBR B;  4WFN 3;  3OHX C;  4O0A A;  3GDE A;  1GHJ A;  1JEI A;  3LGJ A;  4IUU A;  5IWA L;  4A3E G;  1HA6 A;  3W1B A;  1FJG L;  1SMX A;  4JYA Q;  4A3K B;  1HZ9 A;  3GTP H;  4ZUI A;  4DV5 L;  1KC8 C;  3V96 A;  2W51 A;  1JOQ A;  4KD3 A;  4AIM A;  2A68 D;  1U4R A;  4Z9C B;  1SR3 A;  1CZW A;  2A68 C;  4HSV A;  2EJM A;  2CVR A;  2C5C A;  2VZA A;  4FF1 A;  1ONL A;  4HMJ A;  1N34 L;  1DJR D;  1MBY A;  2NVY B;  3CU7 A;  4OL7 A;  1HNX Q;  3X3M A;  4KHZ A;  4M8A A;  1L0W A;  4B3M L;  3J7A F;  5KNC A;  2CQA A;  1IBM Q;  2PCF B;  1JJ2 A;  2SDF A;  3CPF A;  1ENC A;  5EKK A;  5LHY 1;  2YU9 B;  1EY7 A;  2XNA C;  1UE5 A;  2N55 A;  4JI3 Q;  4K5V A;  1EYC A;  1B44 D;  1Q3L A;  4RA8 A;  5CV4 A;  3PO3 G;  1PH7 A;  1CKN B;  1BQQ T;  1BBX C;  3BYT B;  3BZK A;  5FLM H;  1DOM A;  4IZ8 A;  1B7Y B;  1YHQ A;  2NN6 G;  3AFQ A;  4K6L A;  3PF5 A;  1HR0 W;  1QJO A;  3PUW A;  4A3E B;  4DK0 A;  1YIJ A;  4KN7 C;  4IPG A;  1XPU A;  1TWC H;  2SNM A;  3HOY G;  4LAA A;  5F2D A;  3MXP A;  1ML0 D;  1G2T A;  2RCN A;  4PQX A;  1BKB A;  4QQB X;  5CV8 A;  4KKS A;  1X6O A;  2BA1 A;  4JI2 L;  3T56 B;  5J22 A;  2EYH A;  1PFN A;  3OSO A;  4R4I A;  1EL0 A;  5IT9 c;  3PQI A;  1OXT A;  5C0X H;  2ICI A;  1XXG A;  2IX1 A;  1O78 A;  2PW7 A;  3RZD H;  5K5P A;  4N9T A;  2VY3 A;  4DK1 A;  2WB1 E;  2V1C C;  1EIY B;  2ZM6 Q;  1HCZ A;  5FLX c;  4DPG A;  2PZW A;  3F1Z A;  3S1M B;  3PO3 B;  1EN7 A;  3SK8 A;  3A8J E;  4GLA C;  1WTR A;  3K5O A;  3M4P A;  2EDG A;  5M5X B;  4UY8 C;  4JYA L;  2DK4 A;  4DR7 Q;  2RNN A;  2IJ0 A;  4PMW A;  4UP8 A;  3ERO A;  1PH8 A;  1G2S A;  3Q0A A;  3BDC A;  3E0E A;  4V19 0;  2SOB A;  2HHH Q;  3P20 A;  1LAC A;  1Q81 C;  4FVM A;  3LLR A;  2UXB L;  1S5D D;  1SMY D;  2PQE A;  4X64 Q;  4K14 A;  4DV7 Q;  3UDI A;  4IPC A;  3CKI B;  1H9S A;  4HMI A;  1RTO A;  2Q8T A;  2PQA A;  4GLX A;  1SMY C;  4ALP A;  5C0X I;  4DR5 Q;  4X65 Q;  1HNX L;  1FR3 A;  1TS5 A;  1NMG A;  5BR8 Q;  4DR4 L;  4IFD G;  1IBM L;  1VCI A;  3S2D H;  4Y7N H;  1SFO B;  3X3N A;  1C9O A;  1EIF A;  2I0Q A;  4LF8 Q;  3DEP A;  3SK4 A;  2NVT H;  4QIW E;  1C8C A;  3AU7 A;  4IUQ A;  1FVI A;  2L0C A;  4BY1 G;  2L12 A;  3I4O A;  1PH6 A;  1GUW A;  1I50 H;  4ZQ3 A;  3QOJ A;  5BN3 A;  5IYD G;  3G6E A;  5H1S E;  4A3I G;  2EIF A;  3IFT A;  2F0O A;  5IP7 H;  1STG A;  1O7Z A;  1UE6 A;  1KNE A;  1PYS B;  1TWH B;  3P1H A;  4XTC S;  3RN2 A;  3TQY A;  3QG1 A;  2QCP X;  4MZ9 A;  4ZUJ A;  3SGI A;  1PRT B;  1WYD A;  1H9J A;  3I91 A;  1TVX A;  4UP9 A;  2N8N A;  1K8A C;  5J39 A;  4KHV A;  1G29 1;  3KF6 B;  4N8X 1;  5HGQ A;  1SYF A;  2VB2 X;  3MZ5 A;  4OX9 Q;  2K6A A;  1IW7 D;  1LTS D;  5FO9 B;  1DXM A;  3S2H H;  3J80 E;  2F0G A;  4L63 B;  1B9M A;  1DOK A;  2TSS A;  4MNO A;  4LFB Q;  1IHZ A;  4KD4 A;  2OWO A;  5TSS A;  3VR3 A;  3UI2 A;  1NE3 A;  2F52 A;  2UUB Q;  1MD2 D;  2ZM6 L;  1VQA A;  1E1O A;  3C1E A;  4IFD J;  1G91 A;  5I4D A;  1TWF H;  4IUV A;  1SNO A;  3NBH A;  1PDQ A;  1VQ8 A;  4BY1 B;  1EEF D;  3W1G A;  2H4O A;  3W2D A;  1KIX A;  4A3I B;  1H9K A;  3ERQ A;  3SE0 A;  4DR7 L;  1I3Q B;  4RKB A;  4JK1 C;  3PGZ A;  1B53 A;  1H1J S;  1HUM A;  1Q8I A;  4ZK9 B;  2LSS A;  3CC7 A;  2VUM G;  3CW2 C;  3S1N H;  2A6E D;  3L9A X;  3NQI A;  2HHH L;  2KCM A;  2FXQ A;  2IW3 A;  2AWN A;  4X64 L;  1JE5 A;  4DV7 L;  3WWV A;  1YNS A;  2HUG A;  2KCC A;  2R3Z A;  3JAM E;  1D2B A;  4LK1 C;  1EQT A;  2E74 C;  4DR5 L;  2LFN A;  4X65 L;  1CQF A;  2K5W A;  3HOZ G;  3M7G A;  1ET9 A;  1KQS A;  4RFB A;  2KVU A;  5BR8 L;  2IHF A;  3GTP B;  3GO5 A;  1WI5 A;  1A0I A;  2WAC A;  4QUF A;  5CBA E;  5IOC A;  1Q7Y C;  5JVH 3;  4ZRZ A;  4OWW B;  2EY6 A;  3QIA A;  3NTI A;  3TZD A;  5I6W A;  3H09 A;  5KEE A;  1ET6 A;  3CD6 A;  1MGS A;  2SEB D;  4WOR A;  5T1G A;  3NTK A;  3KLR A;  5LMN Q;  1U9R A;  5M9O A;  4YWL A;  1AH9 A;  1F2Z A;  1W6K A;  3MVV A;  4DV1 Q;  1BCP F;  3TS2 A;  4K8I A;  2NZO A;  2R7Z H;  4JC0 A;  1E2Z A;  1H9E A;  3K0Y A;  2L55 A;  2E5L Q;  5EBD A;  2VUM B;  3M3Y H;  1HA5 A;  5C3W A;  1VS0 A;  1VQ4 A;  3BDL A;  1JOO A;  4HJ9 A;  2C35 B;  4RGN A;  1ZBH A;  1GD7 A;  2WKD A;  1PTO C;  4GNX A;  2DY7 A;  4K2L A;  2AWO A;  2CCZ A;  4A3L G;  2RBM A;  4OX9 L;  4OWX B;  4OIK A;  3GQB A;  3HS0 C;  4NP5 A;  1OTC A;  4ID6 A;  1TWG H;  1WCM G;  1STE A;  1TWC B;  4LFB L;  1K8O A;  1A63 A;  1NAP A;  1CQV A;  3PMF A;  4PG3 A;  4TSS A;  4GKK Q;  4ZLT F;  2B2W A;  2UUB L;  1V66 A;  5M3F H;  3BVZ A;  1XYI A;  2KA7 A;  3HGB A;  3H6M A;  3K80 C;  3FMC A;  4RKL A;  1D7Q A;  3GTQ H;  1YBY A;  2HCI A;  4HIO A;  4BY7 H;  2E2I B;  4DAM A;  4WJ4 A;  3Q8D A;  4C3I H;  4DK6 C;  2G80 A;  5I9P A;  3RZD B;  4OO1 G;  2RQX A;  1LTT D;  4YY3 Q;  2F4I A;  3TZU A;  2Z0S A;  3VR2 A;  1EY8 A;  5EKI A;  3KF8 A;  1ZXT A;  2RHS B;  1VQ6 A;  2KBN A;  3IFD A;  2MJ8 A;  3A74 A;  3R93 A;  2R92 G;  2GVB A;  2MFI A;  3HP3 A;  2MGS A;  1MSG A;  2MNA A;  4RWS C;  3RNU A;  1GUT A;  3MC0 B;  4JW0 A;  3G7L A;  4MN3 A;  5LL6 S;  4OON A;  4A3D H;  1X55 A;  1EZ6 A;  3PO2 H;  4GKJ Q;  3T53 B;  1D1K A;  1B3Q A;  1RIP A;  1XPO A;  1NSN S;  4R8I A;  3AMU A;  1T9H A;  4LJZ C;  4X66 Q;  3ZJY C;  2PNR C;  1WCM B;  2DGY A;  3S24 A;  1STH A;  5ELF A;  1Z7T A;  4H13 C;  4XDX A;  1PH2 A;  4R4T A;  3NQT A;  1QB5 D;  1X3F A;  2N88 A;  4NW2 A;  2OXP A;  4X3T A;  5E7N A;  2VW9 A;  1Y8O B;  2M9V A;  3SVM A;  5LMN L;  1H9F A;  1LTG D;  3K6O A;  4XT1 B;  4A3B H;  5IGE A;  1V8Q A;  4DV1 L;  3TRE A;  1L1O A;  4DU9 A;  5C4X G;  3S2D B;  4Y7N B;  2E5L L;  1IBK Q;  3FVQ A;  5CV5 A;  3C2P A;  1D8L A;  1WTV A;  2VQE Q;  5D65 A;  2R92 B;  4C3J G;  1HFG A;  2E8G A;  4ILW A;  2XVS A;  1SNP A;  1AE2 A;  2KVM A;  1I50 B;  3S1Q B;  5I2Y A;  2OCE A;  1W6J A;  2KUM A;  3J80 L;  4DXF A;  1ZYR C;  5AJ3 Q;  2PMZ B;  3A8K E;  3QB3 A;  2XTI A;  4DNI A;  2E2J H;  1U5K A;  1CSQ A;  2I5H A;  3WOF A;  3GTO H;  3DHQ A;  4KKT A;  1CFM A;  1J6Q A;  1OXX K;  1NBW A;  4NKL A;  4MIU A;  4R4Q A;  2V4D A; 
#chains in the Genus database with same CATH homology
 4JI2 Q;  4A3L H;  2ZTC A;  3RN5 A;  1VQN A;  2ALY B;  5C44 H;  3BJU A;  4A3M H;  3S14 H;  2K52 A;  1CKO A;  2JQO A;  5GAE C;  1LYL A;  3IRB A;  3CCM A;  1WCM H;  2DUD A;  1UE7 A;  3G71 A;  1MKH A;  3HKS A;  4YY3 L;  5ELO A;  1YJ9 A;  5IYD H;  4LFC Q;  4A93 G;  1NJI C;  2CFM A;  3L7Z C;  1QUQ B;  1E1T A;  1I3Q H;  1KAW A;  2A19 A;  2B3G A;  5JJL A;  1E7Z A;  3PV0 A;  3H0G G;  3OTO L;  4DV6 L;  4P71 A;  4Y52 H;  2WAQ E;  3AYH B;  3MXN B;  2Y0S E;  1NMF A;  1RL2 A;  3J7Z C;  1Y1W H;  2JA5 G;  4KLK A;  1V1Q A;  4JI4 Q;  3I4N G;  2R93 H;  3M4Q A;  2XGT A;  1WOC A;  3NBH B;  1K9M C;  4XIG S;  1N36 Q;  3S17 H;  1GL9 B;  1Z47 A;  4A75 A;  2GN5 A;  4R1J A;  4GKJ L;  3J7A 5;  2B63 G;  3STB C;  4JI0 L;  4DR6 Q;  5IYC H;  3NEM A;  4O0A A;  3ICE A;  3GDE A;  2K75 A;  3A5U A;  1JEI A;  3LGJ A;  5IWA L;  5J3B A;  3HFZ B;  4A3E G;  4X66 L;  4BBS H;  3W1B A;  1FJG L;  1SMX A;  3EN2 A;  4JYA Q;  4DK3 C;  3VDY A;  3S1R H;  5IP9 H;  4DR1 L;  2R92 H;  1HZ9 A;  4IPH A;  4LF7 Q;  2I5L X;  3GTP H;  1XMQ Q;  3CME A;  5C0X J;  3PIP A;  2A8V A;  2A1A A;  3A5Z B;  4DV5 L;  1SRO A;  4HJ8 A;  1EQR A;  4B3T L;  1JMC A;  3S1Q H;  1KC8 C;  2KFV A;  1N32 Q;  2W51 A;  3J81 j;  4AIM A;  1I94 L;  1NTG A;  2CKZ B;  3FKI G;  3KDF B;  2Y0S G;  4BXX G;  1YI2 A;  1GVP A;  3NEN A;  1SR3 A;  4LF9 Q;  1XTD A;  2UUA L;  5JJI A;  2VZA A;  4TQU S;  2HJQ A;  4X62 Q;  1M90 C;  1OXV A;  2NZH A;  3I7F A;  4PZ6 A;  5DLQ E;  1N34 L;  4BA1 I;  3CCS A;  3CF5 A;  1HNX Q;  4KHZ A;  1L0W A;  3CCL A;  1I6H H;  4JBK A;  1MJE A;  4B3M L;  5IP7 G;  1IBM Q;  3GTM H;  3GTJ H;  1JJ2 A;  1ASZ A;  3CPF A;  1B8A A;  2VQE L;  3J81 c;  2UXC Q;  2K14 A;  1K73 C;  3T1Y L;  2LXJ A;  4YHH Q;  4YWM A;  1UE5 A;  4JBJ A;  3ERS X;  3CC4 A;  2D0O A;  1EOV A;  1WFQ A;  3K0X A;  4GS3 A;  4HIK A;  4JI3 Q;  3PO3 G;  1PH7 A;  1CKN B;  2N78 A;  4OO1 I;  1MJC A;  5IYB H;  4IPD A;  3BZK A;  5FLM H;  4HJ5 A;  4B3R L;  1YHQ A;  1B7Y B;  2NN6 G;  4FDB A;  3AFQ A;  3TRZ A;  1YVC A;  5C4X H;  2YTX A;  5AJ3 L;  3PF5 A;  5IY0 A;  4QGU A;  1HR0 W;  1VQ5 A;  3PUW A;  4JI6 Q;  1YIJ A;  2MPH A;  2F3I A;  4C2M H;  4IPG A;  2MO1 A;  4IO9 A;  1XPU A;  1TWC H;  1IXR A;  1LM0 A;  3HOY G;  1WJJ A;  1N33 Q;  2RCN A;  4AH6 A;  4C3J H;  1BKB A;  4YCV A;  4KHP Q;  1FL0 A;  1L2F A;  1K3R A;  3KFU A;  4QQB X;  2QNC A;  3UDX A;  4JOI A;  2N49 A;  1X6O A;  4BBR H;  2BA1 A;  4GNX B;  2E2H H;  4JI2 L;  2ODC I;  1MIU A;  2HIX A;  3U4Z A;  5GAH C;  5C4J H;  4AYB G;  4R4I A;  2EXD A;  5IT9 c;  4ME3 A;  1OXT A;  4JI1 Q;  1R9T H;  1HNW Q;  4EQ5 A;  4JI8 Q;  2ATW A;  2HIV A;  4UP7 A;  4LFC L;  2IX1 A;  1EQQ A;  3RZD H;  2VL6 A;  2Z6K C;  4L5Q A;  1S3O A;  3U4V A;  3ULL A;  4A3C H;  3S16 H;  1YJN A;  4JI4 L;  2VY3 A;  2WB1 E;  1GO3 E;  2V1C C;  1EIY B;  4YCU A;  1BBU A;  2VS1 A;  2ZM6 Q;  3HOW G;  2L15 A;  4JCV E;  2ZJR A;  4A3K G;  5FLX c;  1YIT A;  4DPG A;  3HOV H;  4LW1 A;  4GKK L;  1YEZ A;  4K0K L;  1SE8 A;  3F1Z A;  3CXC A;  1C7Y A;  1JT8 A;  1FGU A;  1VQE A;  4JG2 A;  1EN7 A;  3M7N A;  2Z6K A;  4DR6 L;  4GLA C;  4A93 H;  2NVY H;  4HIM A;  4JI5 Q;  2ZJQ A;  4LUO A;  3M4P A;  1IL2 A;  3HKZ E;  4UY8 C;  3H0G H;  2NVQ H;  2DK4 A;  1ASY A;  4DR7 Q;  4JYA L;  2JA8 H;  4A3G G;  4PMW A;  3U50 C;  4UP8 A;  3GTG H;  2JA5 H;  4JI7 Q;  3I4N H;  1Y14 B;  4LF7 L;  3MEF A;  1PH8 A;  1XMQ L;  2YU9 H;  3E0E A;  1E7L A;  1E24 A;  1KD1 C;  4HJ7 A;  2HHH Q;  3KOJ A;  1IYJ B;  1G6P A;  1N32 L;  3KYH C;  1Q81 C;  5FJ8 H;  4NXM Q;  4A76 A;  1S40 A;  4YCW A;  2JA6 G;  2B63 H;  2UXB L;  1Y1V H;  4DV2 Q;  4X64 Q;  2BH8 A;  4DV7 Q;  1Y02 A;  4QL5 A;  3UDI A;  4IPC A;  3J81 i;  1QVG A;  4JV5 Q;  2WB1 G;  2BA0 A;  4A3E H;  1X65 A;  2R7D A;  3E9H A;  4DR2 Q;  2PQA A;  4X6A H;  4GLX A;  4LF9 L;  4ALP A;  5C0X I;  1KRS A;  4DR5 Q;  4A3F H;  2ZTD A;  4IOA A;  4X62 L;  4X65 Q;  2IT1 A;  4IJL A;  1VQB A;  1HNX L;  3D0F A;  4GN5 A;  4LWC A;  1NMG A;  5BR8 Q;  4DR4 L;  4IFD G;  1IBM L;  1VCI A;  2YYZ A;  3K81 C;  4KI0 A;  2R7Z G;  4Y7N H;  3UE0 A;  3S2D H;  4POF A;  1O7I A;  2UXC L;  1C9O A;  1EIF A;  3FKI H;  2I0Q A;  4LF8 Q;  4BXX H;  5C44 G;  2Q2T A;  4B3S Q;  4YHH L;  4YWK A;  2NVT H;  4QIW E;  2MQH A;  4GOP B;  1FVI A;  1Z9F A;  1GJJ A;  1PFS A;  4BY1 G;  4AQY Q;  3CMA A;  4GN3 B;  1P16 A;  3I4O A;  2R7F A;  5LMN W;  1PH6 A;  1Q1B A;  1I50 H;  5IYD G;  3BU2 A;  3G6E A;  1L1O B;  2D0P A;  5H1S E;  1VQI A;  4A3I G;  2EIF A;  2WAQ G;  4JI6 L;  5IP7 H;  3FHW A;  3CCV A;  1UE6 A;  3CCU A;  1PH1 A;  1HR0 Q;  3PIO A;  1PYS B;  2KHJ A;  1OXS C;  2PMZ E;  1UWV A;  4XTC S;  3PUY A;  4EX5 A;  4KHP L;  3RN2 A;  1N9W A;  4TVA B;  3TQY A;  4MZ9 A;  1XNR Q;  3SGI A;  2ID0 A;  1J5E Q;  1TWA H;  1WYD A;  3PO3 H;  1IZ6 A;  2CWP A;  3F8T A;  4DUZ Q;  4L5S A;  2Q2H A;  3A0J A;  4UP9 A;  1BVS A;  2AMC B;  1XMO Q;  5M3F G;  1IBK L;  2N8N A;  3BZC A;  3K7U C;  4RG1 A;  5LMU Q;  1K8A C;  2JK8 A;  4JI1 L;  1QZG A;  3AQQ A;  1G29 1;  1QVC A;  3KF6 B;  2YTV A;  5IE8 A;  1HNW L;  5HGQ A;  2JJQ A;  4JI8 L;  3G4S A;  3M4O H;  3PCO B;  4OX9 Q;  3AEV A;  4MTN A;  4OWT B;  1SRU A;  3F2B A;  3HOY H;  4BY7 G;  5IP9 G;  3KJO A;  3S2H H;  3F2D A;  1PH5 A;  3I4M G;  3H3V I;  4MNO A;  4LFB Q;  1Q8K A;  2OWO A;  3I2Z A;  1N8R C;  1QUQ A;  1EYG A;  4POG A;  1NE3 A;  2F52 A;  2K5N A;  2UUB Q;  1E22 A;  2ZM6 L;  4DV3 Q;  1XJV A;  1VQA A;  1E1O A;  4IFD J;  1NY4 A;  4QY7 A;  1KL9 A;  1YHA A;  1Q82 C;  2UU9 Q;  1TWF H;  2PI2 E;  2PI2 A;  3UDF A;  4A3J H;  2NVX H;  4BA2 I;  1VQ8 A;  1CUK A;  3GD7 A;  4JI5 L;  1EFW A;  4LF5 Q;  3W1G A;  1YHB A;  4LUV A;  3HOU G;  1CSP A;  4NPS A;  2QA4 A;  1KIX A;  1EWI A;  4A3D G;  3PO2 G;  2EQS A;  4DR7 L;  1PH4 A;  1SFO H;  4PZ7 A;  3PGZ A;  4H02 A;  4JI7 L;  3ER0 A;  3HOX G;  2OTL A;  2K50 A;  3S1N H;  3CC7 A;  2LSS A;  2VUM G;  3CW2 C;  3HOW H;  1X54 A;  2AKW B;  4A3K H;  2ZTE A;  1VQO A;  2HHH L;  2KCM A;  2JA7 G;  2FXQ A;  2N3S A;  1KHI A;  5K36 G;  4NXM L;  5M3M G;  2UXD Q;  2AWN A;  5M5W H;  4DV2 L;  4X64 L;  1JE5 A;  4DV7 L;  3CQZ H;  2KEN A;  5HY6 A;  3WWV A;  4JV5 L;  1YNS A;  3L2P A;  2NN6 I;  1OXU A;  4DR2 L;  2MO0 A;  1QVF A;  4PZ8 A;  1YJW A;  1N36 L;  1K83 H;  1VQK A;  3KDF A;  1SLJ A;  3M9B A;  4DR5 L;  3T1H Q;  3PUX A;  3CC2 A;  4B3M Q;  4L5R C;  1TWH H;  4X65 L;  3HOZ G;  3M85 A;  2D62 A;  1BBW A;  1KQS A;  4A3B G;  5BR8 L;  2IHF A;  3CPW A;  1C0A A;  3GO5 A;  5C3E G;  2HT1 A;  1GM5 A;  1WI5 A;  4DR3 Q;  1A0I A;  2H5X A;  3PSI A;  1YNX A;  1PV4 A;  4LF4 Q;  2JA6 H;  1Q7Y C;  4OWW B;  1PH9 A;  3KF8 B;  5GQO A;  4L5T A;  1H95 A;  4P75 A;  4LF6 Q;  3J80 c;  3CD6 A;  4APV A;  1KXL A;  2QGQ A;  2JA9 A;  1Q12 A;  2RF4 A;  4UPA A;  4LUZ A;  1VQD A;  2OTJ A;  5LMN Q;  1IBL Q;  1U0L A;  1CKN A;  2Q2I A;  2YV5 A;  4YWL A;  4C3H H;  1AH9 A;  4A3G H;  2UUC Q;  3OYY A;  2AHO B;  4DV1 Q;  1HR0 L;  1CKM A;  3CCQ A;  4GNX C;  1XNQ Q;  2R7Z H;  2NZO A;  3TS2 A;  4HID A;  4JC0 A;  3CCJ A;  2JEA I;  1H9E A;  1Q46 A;  1S72 A;  1X3E A;  4DV0 Q;  4IOC A;  4NXN Q;  2E5L Q;  3PUV A;  3M3Y H;  1XNR L;  3HOV G;  3TEH B;  1J5E L;  4LNQ A;  2F4V Q;  1VS0 A;  4DUY Q;  1VQ4 A;  4BY1 H;  3UDG A;  3JC6 6;  4DUZ L;  3F2C A;  3H3V H;  1GKU B;  1V9P A;  2C35 B;  4HJ9 A;  3CP0 A;  1UE1 A;  1XMO L;  1GD7 A;  1Q1E A;  5LMU L;  3HKZ G;  1V43 A;  4GNX A;  4A3I H;  2VQF Q;  2AWO A;  2CCZ A;  3NEL A;  4A3L G;  4A4I A;  4LFA Q;  4A3M G;  4OX9 L;  5M5Y H;  4OWX B;  4OXP A;  2JA8 G;  4JI3 L;  1LTL A;  1YZ6 A;  4DV4 Q;  1X56 A;  1VQJ A;  2K5H A;  4P73 A;  1HNZ Q;  1OTC A;  1TWG H;  1WCM G;  4P72 A;  1K8G A;  5ELN A;  1B70 B;  3STB D;  4LFB L;  1A63 A;  4JBW A;  5JEA G;  3JAM c;  4PG3 A;  4K0K Q;  4GKK Q;  2GVA A;  1EUJ A;  3S15 H;  2HQL A;  5EAY A;  5FJ8 G;  2UUB L;  2WFW A;  1VQG A;  4DV3 L;  1Y1V G;  5M3F H;  1VQ7 A;  2UU9 L;  1DGS A;  3K80 C;  1Y1W G;  1M1K C;  1N33 L;  2R93 G;  4WJ3 M;  5GAG C;  3GTK H;  1D7Q A;  3GTQ H;  1YBY A;  3RLO A;  3ULJ A;  3OW2 A;  1Q86 C;  4LF5 L;  3S1M H;  4HIO A;  5GRO A;  4A3F G;  2CQO A;  4DAM A;  4BY7 H;  4WJ4 A;  3Q8D A;  4C3I H;  4DK6 C;  2G80 A;  1VQM A;  3I4M H;  4OO1 G;  5JJK A;  3W5O A;  4YY3 Q;  1G51 A;  5M5X H;  1JB7 A;  5IYC G;  4IFD I;  2Z0S A;  1GKH A;  2ASB A;  2OQK A;  1JJC B;  4BBS G;  2UXB Q;  3OTO Q;  2RHS B;  1VQ6 A;  4DV6 Q;  2KBN A;  1VQ9 A;  3A74 A;  1HJP A;  2JE6 I;  4DAY B;  1PHJ A;  1JJG A;  2R92 G;  2GVB A;  2MFI A;  3AFP A;  3D31 A;  1W3S A;  2UXD L;  2IHE A;  3PF4 A;  4R4O A;  2MNA A;  4J15 A;  3RNU A;  2PNH A;  1PH3 A;  3H15 A;  1ZS9 A;  3CCR A;  1QZH A;  1KRT A;  3HOU H;  4OON A;  4A3D H;  1X55 A;  2BH2 A;  3PO2 H;  4GKJ Q;  3EBE A;  1HZA A;  3T1H L;  4JI0 Q;  3J80 i;  1PA6 A;  1RIP A;  3RZO H;  4DR4 Q;  3FP9 A;  1XPO A;  1I5F A;  1LUZ A;  3K8A A;  4AYB E;  3B6Y A;  2R6G A;  3I55 A;  3HOX H;  5IWA Q;  4RMF A;  2VUM H;  1T9H A;  4X66 Q;  3ZJY C;  1VQP A;  1FJG Q;  3GTL H;  1K0R A;  3EIV A;  2OQ0 A;  2QEX A;  4GOP C;  2JA7 H;  2DGY A;  3S24 A;  4DR3 L;  4NB3 A;  4DR1 Q;  2RHQ B;  2K4K A;  4LF4 L;  5M3M H;  4GN4 B;  4QJF A;  4JBM A;  2ODG C;  2IX0 A;  1PH2 A;  4R4T A;  2ES2 A;  1X9N A;  4DV5 Q;  1HH2 P;  1L1O C;  5JEA J;  1TXY A;  4JOI C;  1X3F A;  4B3T Q;  2KCT A;  3ULP A;  4LF6 L;  1PVO A;  2PQA B;  5E7N A;  2VW9 A;  4R4C A;  1I94 Q;  2QNF A;  3RLF A;  1PYB A;  1XPR A;  3HOZ H;  4GOP A;  3I56 A;  5LMN L;  1IBL L;  2I5M X;  1H9F A;  2LXK A;  3CCE A;  4A3B H;  4O2D A;  2UUA Q;  2LC3 A;  3U58 A;  2UUC L;  5C3E H;  1UEB A;  3TRE A;  4DV1 L;  5IYB G;  1XNQ L;  4DKA C;  5FLM G;  1L1O A;  1N34 Q;  2Q2U A;  3L0O A;  5C4X G;  4DV0 L;  4NXN L;  1W2B A;  2K5V A;  3RR5 A;  5GAD C;  2E5L L;  3PUZ A;  2IY5 B;  1IBK Q;  1VQC A;  2F4V L;  4DUY L;  3TS0 A;  1D8L A;  2VQE Q;  3CAM A;  3K7A H;  3JAM i;  4A3J G;  1SN8 A;  1HZB A;  2E2I H;  1A8V A;  2LD7 A;  3T1Y Q;  2E8G A;  3DM3 A;  3E9I A;  3RLN A;  1AE2 A;  2VQF L;  3DLL A;  4BBR G;  2ZJP A;  4LF8 L;  4P74 A;  4GLV B;  2OCE A;  3KLW A;  4B3S L;  4LFA L;  1E3P A;  2B29 A;  2JEB I;  2KHI A;  4DV4 L;  4B3R Q;  1VQL A;  3G48 A;  4HJA A;  1HNZ L;  1VQF A;  2WP8 J;  4AQY L;  3KF6 A;  5AJ3 Q;  1VQH A;  2E2J H;  1AE3 A;  2VNU D;  2XTI A;  2YTY A;  4DNI A;  5C0X G;  1U5K A;  1CSQ A;  2I5H A;  4IJH A;  3UE1 A;  3GTO H;  1P8L A;  1A62 A;  1J6Q A;  2CWA A;  1OXX K;  1E7D A;  4A3C G;  3KJP A;  1NBW A;  1X3G A;  4R4Q A;  1HZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...