1A63A

The nmr structure of the rna binding domain of e.coli rho factor suggests possible rna-protein interactions, 10 structures
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
130
structure length
130
Chain Sequence
MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVNFDKPENARNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHO
publication title The NMR structure of the RNA binding domain of E. coli rho factor suggests possible RNA-protein interactions.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Transcription termination
total genus 26
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 1998-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07497 Rho_RNA_bind Rho termination factor, RNA-binding domain
A PF07498 Rho_N Rho termination factor, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.10 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 1a63A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1a63A02
2R7ZH 1RIPA 4OWTB 4JI5L 3WWVA 2UUCQ 1K3RA 2PMZE 4DR6L 1Z9FA 1VQPA 2KHIA 3GD7A 2ES2A 4UP7A 1CSPA 3PIOA 4HJ7A 1PH7A 4UPAA 4LFBQ 3F8TA 5E7NA 1OXUA 1SE8A 1WI5A 2PI2A 3W1BA 3U58A 3M7NA 3S17H 2KCMA 1HNWQ 1HNXQ 1WOCA 1JE5A 1XNRL 2GVAA 3I4NG 2UUCL 4X6AH 1Q46A 2VY3A 1Q12A 5IYDG 1YBYA 4TQUS 4C3JH 1MJEA 1X3GA 2R6GA 4JC0A 2ID0A 4FDBA 5ELOA 1XMQQ 4LFBL 1PH9A 3I4NH 1VCIA 3S1QH 4A93G 2RHSB 1C7YA 5IYDH 1BBUA 3EIVA 1RL2A 4YY3Q 3BJUA 5LMUQ 2Y0SG 4LUZA 3S16H 4QJFA 1TXYA 1K73C 2C35B 1I50H 2VQFQ 5IYBG 1J5EQ 4IOAA 4Y52H 1L0WA 4DV3L 1XMQL 2NZOA 3HOWG 3PO2G 2ZJQA 1FVIA 1CKMA 4P73A 4YY3L 2AWNA 4POGA 5LMUL 3PO3H 4JV5L 5GAHC 4GN3B 3L7ZC 3NBHB 4JI0Q 2KENA 2N78A 5K36G 2WB1E 3D31A 2CQOA 2K5VA 3A74A 2VQFL 4DV2Q 1V43A 1XMOQ 2YV5A 2UUAQ 3A0JA 4KHPQ 1N32L 2ATWA 1UE1A 5M5YH 4B3MQ 2I5MX 4JG2A 4PZ7A 3S24A 1EFWA 4LF7Q 1KIXA 1QVGA 1TWCH 4LWCA 3K0XA 4IFDJ 1DGSA 3KDFA 4WJ3M 4IPGA 4YHHQ 4DV6Q 4DV2L 1XMOL 2VW9A 3HOUG 1LTLA 3J81j 2UUAL 2AKWB 1EIFA 1GKHA 1J6QA 4GOPC 1VQ6A 1K9MC 5IP9H 4RMFA 3HOUH 2QNFA 1L1OA 2KHJA 4JBKA 1E7ZA 2JA5G 2K50A 2VS1A 4X65Q 1HR0W 4O0AA 2UXDQ 3PUZA 4C2MH 5M5WH 4DKAC 3CW2C 4YHHL 4A3LH 2ALYB 4JI4Q 4IPHA 3CCEA 2JA5H 4LFCL 1GVPA 2K52A 1VQJA 4GKJQ 2MO1A 3H0GG 1PH1A 1X9NA 1A0IA 1TWFH 4AH6A 1PH3A 1OXSC 3ZJYC 3HOVG 3TS2A 4BY7H 5GQOA 4JOIA 2F4VQ 1EQRA 3KJOA 3GTMH 2E2JH 5M3MG 3CAMA 4X65L 2BA0A 4MZ9A 3U4ZA 3H0GH 4PG3A 3U50C 2DUDA 5JEAJ 2HHHQ 1PYSB 1XJVA 3HOVH 3PV0A 5IE8A 3E9HA 1N9WA 3H3VH 5M3MH 2AHOB 1JJCB 1KL9A 4JI2Q 4GKJL 1CKOA 2ZJRA 1X3FA 3S1NH 1XTDA 3KFUA 2Q2TA 4QQBX 4YCVA 4HIOA 4NXMQ 1WJJA 4AYBG 3AQQA 2E8GA 4P72A 4R4QA 2QEXA 5LMNW 4DAMA 1Q82C 1OTCA 2HHHL 2QNCA 4YCWA 4BY1G 1VQNA 4GKKQ 2PQAB 3RZDH 1Q7YC 4QGUA 4JCVE 1GO3E 1UWVA 1FGUA 2NVYH 4C3IH 4DR5Q 1Q1EA 3ERSX 1V1QA 4BY1H 4P75A 4OWXB 3MXNB 1YEZA 3UDFA 1QZHA 2AMCB 2CCZA 4NXML 1FL0A 1KHIA 3F2CA 1SROA 1JJ2A 4B3RQ 1EIYB 4DUYQ 4GKKL 5EAYA 1PH5A 1HJPA 2L15A 4LUVA 1VQFA 4DR5L 2DGYA 4LUOA 2Y0SE 3KF6A 1NMGA 4P74A 2I0QA 3CCVA 1EUJA 3TREA 5FLMH 2UXCL 1PA6A 3STBD 2JA8G 2F52A 4P71A 4JI5Q 1HNZL 4B3RL 3RR5A 4DR6Q 4YWMA 3I2ZA 2OWOA 4GNXA 3HKZE 1UE6A 2JA8H 3TS0A 1UE5A 3J80c 1UE7A 5IT9c 1C0AA 4TVAB 1G51A 3M4QA 5IYCG 3CCRA 4GOPB 3S14H 3CMAA 1XNRQ 3CP0A 2XTIA 1KRSA 4JI1Q 1JB7A 1XPRA 2K5NA 1I5FA 5IYCH 1PFSA 4QL5A 4LNQA 4C3HH 3KF8B 1YHAA 4BBSH 4GN5A 2JA7G 2NVQH 1HZBA 1X3EA 2Z6KA 3CC4A 3S1MH 1CKNB 5M3FG 3ULPA 2Q2UA 3CCQA 1EN7A 1N33Q 1KAWA 2JA7H 4JI1L 3U4VA 1PH4A 4JYAL 2IHEA 1D8LA 2H5XA 4UP8A 3OTOL 4X64L 5M3FH 1IXRA 2OQ0A 2VQEQ 1VQ7A 4DV3Q 4DR7Q 5JEAG 3Q8DA 4L5TA 3H15A 5HGQA 1XNQQ 4HIMA 4JV5Q 1N33L 3PF5A 3AEVA 4AQYQ 3EN2A 3SGIA 1SN8A 3CCMA 4L5RC 2NVTH 3MEFA 5IWAQ 4OO1G 3PO3G 1N36L 2VQEL 4DR7L 2AWOA 1N32Q 1AE3A 4YCUA 3BU2A 1TWHH 1VQKA 2JE6I 1XNQL 3OYYA 1WCMG 1Z47A 2GN5A 3HFZB 2BH8A 2XGTA 3I7FA 4AQYL 4ME3A 1QUQA 3S2DH 1LUZA 2ZM6L 2WP8J 4QIWE 1HR0Q 4DR1Q 5IWAL 1WCMH 1X65A 4A3IG 1NBWA 4LF6L 4DPGA 3GTOH 1EOVA 1IYJB 3KJPA 4DV5Q 1VQIA 2KCTA 3KLWA 4GLAC 1KRTA 1VQMA 4LF5Q 1W2BA 1L1OC 4IPCA 5JJKA 2JJQA 4DV4Q 2UUBQ 4A3IH 1NJIC 4L5SA 2N3SA 1YVCA 3T1YL 3F2DA 2D0OA 1YZ6A 4DR1L 3A5UA 1HR0L 3STBC 5IP9G 4X66L 3L0OA 3EBEA 2BA1A 3FKIH 1FJGQ 4LFCQ 3UE1A 4DV5L 3F2BA 1G291 4LF5L 1G6PA 3GTPH 4A3LG 4BBRG 1KQSA 4HJ9A 3UDGA 3S1RH 2GVBA 4JOIC 1VQGA 4DV4L 2UUBL 1E3PA 3E9IA 4R4CA 4EQ5A 3K80C 4UP9A 5IY0A 4A4IA 4JBWA 3OW2A 3AYHB 2IX1A 5GADC 4LF8Q 3PIPA 1W3SA 1VS0A 3T1HL 4BBRH 1M90C 3CC2A 4LF4Q 3H3VI 3RZOH 3RLFA 5LMNQ 4BY7G 3RN5A 4YWLA 4DV0L 1FJGL 2YTYA 3AFQA 3B6YA 4PMWA 1I94L 1R9TH 3GTQH 5C0XG 2WFWA 1VQ8A 1YJ9A 4PZ6A 1Q86C 2Q2HA 5C44G 4LF4L 4LF8L 3ICEA 2HIVA 5LMNL 3G71A 1PYBA 4DUZL 3FHWA 1O7IA 2R93H 3CC7A 4KLKA 4DV7Q 1KC8C 2JK8A 5C44H 1CSQA 2JEBI 4X62Q 1WYDA 1QVCA 4HIDA 2R7FA 3ULJA 3G6EA 1K8AC 3CCLA 4IOCA 1N8RC 4KHZA 2R92G 4OX9Q 4JI7Q 3DLLA 4DV7L 1EWIA 3CXCA 2YTVA 3RLNA 2ZTEA 1VQDA 3W1GA 4X62L 4NB3A 2OCEA 2R92H 1HZCA 3CQZH 3LGJA 4LFAL 2UXCQ 1Q1BA 2KBNA 1HNZQ 5C3EG 2V1CC 5JJLA 4GNXC 1S40A 4ALPA 3J81c 3KDFB 4IJLA 3S15H 5FLMG 4OX9L 4JI7L 3CPWA 3HKSA 3GTJH 3BZCA 2NVXH 5C3EH 1ASZA 1E7DA 1AE2A 3HOZG 1D7QA 3PUYA 3DM3A 1GD7A 3L2PA 1VQOA 2Z0SA 3KOJA 1L1OB 3J81i 1NY4A 1VQEA 3UDIA 4DAYB 3F1ZA 4L5QA 4B3TQ 3J7ZC 3CCJA 3HOZH 1I3QH 4B3SL 3RN2A 2ZTDA 3ER0A 4JI8Q 2Z6KC 3W5OA 2VZAA 2N8NA 4LW1A 3VDYA 1VQ9A 1C9OA 1EQQA 1Y14B 2CKZB 2MO0A 2E2IH 3M85A 4BBSG 1HZ9A 1B8AA 1QVFA 2VNUD 2R7DA 2RCNA 1PHJA 4B3TL 4JYAQ 4J15A 4MTNA 3OTOQ 4MNOA 1VQCA 3A5ZB 3J80i 4X64Q 4DR3L 1YJWA 4A3CG 2CFMA 3NELA 5C0XJ 5AJ3Q 5J3BA 1OXXK 4JI8L 3G4SA 1IBLQ 1K8GA 4R1JA 4A3CH 4A3KH 4OONA 2VUMH 1X55A 1K0RA 3GDEA 1IBKQ 5JJIA 4DR2Q 2I5HA 1VQ5A 3PUVA 1MKHA 1V9PA 1SLJA 1NMFA 3M9BA 1X56A 4JBJA 4RG1A 4JI4L 3M3YH 2WAQG 3NEMA 2MFIA 5AJ3L 1N36Q 1N34Q 1PVOA 1BVSA 4BA1I 3BZKA 4DK3C 1IBLL 5C4XH 4K0KL 4OO1I 1H95A 4Y7NH 3PUXA 1A63A 1KD1C 1IBMQ 1A62A 1ASYA 1IBKL 2E5LL 5IP7G 4DR2L 5M5XH 1K83H 1YI2A 2ZM6Q 1X54A 1PV4A 3ULLA 5C4JH 1AH9A 1Q8KA 2A1AA 5DLQE 4A3DG 1N34L 5IP7H 5GAEC 4LF6Q 3K81C 3I56A 4NXNQ 2ZJPA 2D0PA 4R4TA 1IBML 2JA6G 1E22A 1CUKA 1X6OA 4HJ8A 3KF6B 3IRBA 4BA2I 4A3DH 4JI3Q 3T1YQ 3RLOA 3CMEA 1P8LA 3PCOB 3CD6A 4OXPA 2JA6H 2JA9A 1MIUA 1U5KA 3K8AA 4X66Q 3K7AH 4GNXB 1HNXL 1HNWL 4NXNL 2K75A 4AYBE 4A3BG 4GLVB 4IJHA 5HY6A 2MNAA 4A93H 1S72A 1OXVA 3FKIG 1SRUA 1YNXA 2NZHA 2VL6A 3CPFA 4JI3L 4A3BH 1TWAH 3T1HQ 3M4PA 3K7UC 3HKZG 5ELNA 3UE0A 4DV0Q 3TEHB 5IYBH 2N49A 1L2FA 2IY5B 4OWWB 2PNHA 1U0LA 1I94Q 3HOWH 3PO2H 4BXXG 1VQLA 1YIJA 1JT8A 2PQAA 3CCUA 1VQBA 1J5EL 4JBMA 1Y1WG 1IL2A 5C0XI 2HIXA 4WJ4A 4BXXH 2HQLA 3PF4A 1E7LA 3KYHC 4DUZQ 1NTGA 2IHFA 2I5LX 1Y1WH 2JEAI 4JI0L 1PH8A 3M4OH 1P16A 2UU9Q 4IPDA 2R93G 1S3OA 2FXQA 4EX5A 4UY8C 4HJ5A 3I4OA 3NENA 2UXBQ 1SFOH 4KHPL 3I4MG 4B3ML 3GTGH 1B7YB 1LM0A 5H1SE 4LF9Q 4DNIA 3E0EA 2ZTCA 1VQHA 1HZAA 2K14A 4LF7L 4A3FG 4HIKA 1UEBA 1YHBA 3I4MH 4A3JG 2IT1A 4O2DA 1HH2P 2UU9L 1IZ6A 2QGQA 4QY7A 4LFAQ 4DV6L 1VQ4A 1PH2A 2HJQA 2EXDA 1KXLA 2K4KA 4A3FH 2UXBL 4A76A 3HOXG 1B70B 1QUQB 2K5HA 4A3JH 1YITA 4LF9L 1OXTA 4KI0A 2F3IA 4GOPA 2B29A 4APVA 2LXJA 3AFPA 3J7A5 1XPUA 3PUWA 3UDXA 3HOXH 2UXDL 4NPSA 1E24A 1E1TA 4AIMA 1BBWA 2WAQE 4DR4Q 2WB1G 3S2HH 1T9HA 2YU9H 1CKNA 4GS3A 2JQOA 4B3SQ 2EIFA 2EQSA 2LXKA 1BKBA 3GTLH 2IX0A 3G48A 2F4VL 3HOYG 4GN4B 4XIGS 1JMCA 2BH2A 3PSIA 4HJAA 1Y1VG 2LSSA 2ASBA 3CCSA 2RHQB 2QA4A 4JI6Q 1NE3A 2NN6I 3GTKH 3JAMc 2OQKA 1GM5A 2RF4A 2CWAA 2OTLA 3HOYH 3TRZA 3JC66 4JI2L 4DR4L 1SR3A 1JJGA 1Y1VH 2HT1A 4A75A 1VQAA 4DR3Q 3D0FA 4POFA 1TWGH 4DV1Q 5GAGC 2NN6G 2YYZA 3FP9A 4PZ8A 1EYGA 2D62A 3JAMi 4A3MG 2A8VA 5BR8Q 1YHQA 4JI6L 1PH6A 2B63G 2A19A 1YJNA 1LYLA 4DK6C 1QZGA 2Q2IA 3PGZA 4A3MH 1I6HH 4A3KG 2VUMG 4YWKA 4GLXA 2YTXA 2B63H 4DV1L 2MQHA 4A3GG 4IFDI 1SMXA 1MJCA 3I55A 5FJ8G 2B3GA 4K0KQ 3RNUA 5BR8L 5FLXc 4A3EG 1WFQA 4H02A 1XPOA 4DUYL 1M1KC 1A8VA 5GROA 2CWPA 2E5LQ 4A3GH 3CF5A 2E2HH 2R7ZG 4IFDG 1E1OA 3GO5A 5FJ8H 4IO9A 5C4XG 4R4IA 4R4OA 3TQYA 4A3EH 2OTJA 2PI2E 1Q81C 4XTCS
chains in the Genus database with same CATH superfamily
4MTKA 4OWTB 2E75C 4K6LA 3WWVA 2KHIA 3NHHA 1VF5C 1FGBD 1XXGA 1CSPA 1SNMA 1DCZA 3W1BA 5E7NA 1WI5A 3NTKA 3MZ5A 3S17H 1GUWA 4DF7A 1HNXQ 1WOCA 3I73A 1XNRL 3I4NG 1KTKA 1RKNA 5IYDG 1I4GA 1SE4A 2DJFC 3S1QB 1MJEA 5F2DA 1EQTA 5IGDA 1VCIA 1PTOH 1TVXA 3OW7A 3WDNA 4YY3Q 2Y0SG 4QJFA 1I50H 4IOAA 3VYUA 3OHXC 1L0WA 4DV3L 1WD1A 2AWNA 4POGA 5CV5A 2F0MA 2KENA 2WB1E 5D65A 1SYGA 2YV5A 1N32L 1ET9A 1HTPA 2TMPA 2XWJB 2J4XA 4F88A 1KDCA 1TWCH 3KDFA 4DK1A 1CQFA 1LTLA 3A8IE 1B3AA 4I65A 1V1OA 3KLSA 4GOPC 1VQ6A 4RMFA 2KHJA 2WINB 3FRPB 3PUZA 4DKAC 2MUYA 4KN4C 2WIIB 1ONLA 1TWFB 2WKCA 2QDLA 4IPHA 4I7AA 4EQPA 2JA5H 1GVPA 2K52A 1VQJA 2KA7A 1PH1A 1EFID 1X9NA 3HOVG 1OXSC 4KD4A 3VR2A 3HG9A 4JOIA 5CV8A 2F4VQ 2B2VA 3H91A 3HOVB 4K2KA 3CAMA 4X65L 1GUGA 2BE5C 4PG3A 5JEAJ 3PV0A 5IE8A 1N9WA 1VDZA 4ZUJA 1DYQA 1T5EA 1DZ1A 1X3FA 3S1NH 2Q2TA 4QQBX 1WJJA 3AQQA 4I7ZC 3RZDB 4P72A 4DAMA 2E2DC 1Q7YC 4C1NK 4QGUA 2DN8A 2NVYH 4DR5Q 5EPJA 2EE1A 4P2CB 1FL0A 1GL9B 2K05A 4KV6A 1I6VC 5EQ0A 1G6ZA 4LUOA 5A35A 3KF6A 4XQQA 3MEHA 5FLMH 2UXCL 1HNZL 3EFXD 4YWMA 3I2ZA 1RTNA 1UE6A 2DY8A 5CV7A 5IYCG 3CCRA 1ET6A 3OSOA 3CMAA 4G7OC 1GJXA 4QL5A 3DEPA 5I2XA 4C3HH 3S1MB 1RF2D 3KF8B 1FR3A 1OO9B 2NVQH 1SDFA 4J8QA 1X3EA 2B39A 1U4LA 2A68D 1LLRD 2JA7H 4JI1L 4JYAL 1D8LA 2H5XA 4X64L 2PYKA 1IXRA 4R8NA 1O7ZA 2WAQB 1VQ7A 1D2BA 3Q8DA 4H44C 2XN9C 1NNXA 5HGQA 2NVTB 5E4XA 1N33L 3AEVA 3K57A 1IHZA 1V8QA 1WTPA 3PO3G 2F0WA 4OIJA 3SR1A 2VQEL 2AWOA 2L12A 1BCPB 4FF2A 3BU2A 1VQKA 1QCBD 3AMUA 4OO1H 1XNQL 5JPNC 3OYYA 4Q0FA 3HFZB 1ZYRC 4JW0A 1PRTF 1LUZA 1WVLA 4IUTA 4XQNA 3GTOH 5C5LA 1VQIA 4GLAC 1VQMA 1SBBB 3DHQA 4IPCA 1H9SB 1K3BC 4EQNA 3T1YL 4K5XA 2CW0C 3DEOA 1HRJA 1V66A 2EYFA 2IW3A 3EBEA 4LFCQ 1W6JA 3UE1A 4DV5L 1STHA 4LF5L 2Z9HA 4BBRG 1KQSA 4HJ9A 3S1RH 2GVBA 4JOIC 1VQGA 4BBRB 4DV4L 1NR4A 2UUBL 3OW2A 3U58A 3RZOB 3K80C 2EY5A 4UP9A 2IJ0A 1M90C 1ZKOA 3H3VI 1JC7A 2L4NA 4BY7G 2KECA 4R8IA 3MWYW 1HHVA 1DOMA 1I94L 5C0XG 3MHBA 1I4RA 1VQ8A 1YJ9A 4KY6A 1UEAB 4LF4L 2R93H 3FHWA 1O7IA 1Z6HA 4FXDA 2KUMA 3VYSA 4DV7Q 5EBCA 1KC8C 5C4HA 1B44D 5C44H 3NTIA 1WYDA 5L37A 5I6YA 2K6AA 4HIDA 2R7FA 2XWBB 1EYDA 5BN4A 1X3PA 4KHZA 2IX3A 1W6KA 4KD3A 2MP1A 4DXFA 4JI7Q 1IW7D 1LV9A 2DJGC 2X69A 4WRDA 3RLNA 4CDEC 4X62L 1VQDA 2OCEA 1C4QA 3CQZH 5KGUA 3S15B 1Q1BA 2FJ2A 2KBNA 1II3A 3Q24A 5FK9C 2ICEC 4CHTB 1BQQT 4OX9L 2RKSA 3CPWA 2HQEA 2NVXH 5JVG3 1E7DA 1MBYA 1AE2A 3HOZG 3K5NA 1CFMA 1PMRA 4ZK9B 1D7QA 3DM3A 3HOZB 3BYTB 3J81i 3J81E 4DAYB 3C3LA 2F0DA 3F1ZA 3CCJA 2LY7A 1QWYA 4HSPA 2Z6BA 4LW1A 3VDYA 2K28A 1C9OA 4HCEA 1U4RA 1ZXTA 3NTHA 4X3UA 3K58A 4BBSG 1HZ9A 1QVFA 1S5BD 3AB9A 2RCNA 1SNPA 2DNEA 3OTOQ 4A3CG 3J80i 1YNSA 3J80E 1H9KA 5AJ3Q 5J3BA 3NP8A 1ENCA 4OONA 2VUMH 3PUVA 2KW9A 1SLJA 5D3IB 1X56A 2EXZA 2MFIA 5C4XB 1H9SA 1EQVA 1FNVA 3PIP3 4BA1I 5IGBA 3BZKA 4G57A 1K83B 4Y7NH 1KD1C 1JCKB 5C4JB 4DR2L 5DM73 1PV4A 1HA6A 1AH9A 2A1AA 2FMCA 4HR7B 3K81C 2JA6G 1IBML 1O7LA 2B2UC 2JA6B 4L6TB 1XYIA 3CD6A 1LTID 4ZUIA 3K8AA 4A93B 3S9WA 4A3BG 4AYBE 3QKJA 4GLVB 3NWTA 1TWAB 2R3ZA 3OMGA 1S72A 1SYCA 1SRUA 2JN4A 2VL6A 3CPFA 3KBGA 3K7UC 3HKZG 5ELNA 3T16A 3HKZB 4DV0Q 1JJRA 2OT2A 4OWWB 1EWCA 1CZGA 2QCPX 3FPUB 1J5EL 1IL2A 4WJ4A 2RBMA 3D4WA 5E4WC 3MXNA 4B08A 1F2YA 4DXGA 1NTGA 2I5LX 4ILWA 1Y1WH 2M00A 1SFOB 5I4DA 2FXQA 2K33A 1B7YB 1K8MA 1HZAA 1VQHA 4ZLTF 5KYIA 4A3FG 4HIKA 4U673 2IT1A 2JA5B 2UU9L 1IZ6A 2K4KA 4A76A 3HOXG 1B70B 2K5HA 4FXGC 1YITA 2MPHA 3HOXB 2F3IA 4KKUA 1U4PA 3J7A5 1CZWA 3SK4A 3DWPA 2UXDL 2CQAA 4NPSA 3BVGA 1SJHD 4XQJA 4KN7C 1FD7D 3S2HH 5ELDA 2YU9H 4K14A 5EKLA 1BKBA 3G48A 4XIGS 2F0KA 4KKSA 2SNSA 3VR3A 2NVYB 1BCPC 2CWAA 3TP5A 3Q6SA 3TRZA 1PZKD 1TWGB 4DR4L 1JJGA 1SR3A 4ZCKA 2HT1A 1VQAA 2I07B 2NN6G 5GAGC 1TKWB 5BR8Q 2NB0A 5FO9B 3GP7A 1PH6A 2A19A 3C1EA 4DK6C 1QZGA 4GLXA 2G5DA 2B63H 4DV1L 4IFDI 2HUGA 5FJ8G 4K0KQ 2DY7A 3RNUA 4CJ1B 4H02A 3OMCA 1A8VA 2E5LQ 1EEID 2CWPA 3C1FA 3ERQA 4A3GH 2E2HH 4Q5VA 4NW2A 1EU3A 4A3EH 2EY2A 1KHCA 1WTXA 5E1FA 1S5FD 1SYDA 1RIPA 2R7ZH 4IFDH 4JI5L 1VQPA 4H7BA 4UP7A 2ES2A 1RDPD 3C2PA 4HJ7A 1RODA 4UPAA 5KRUA 3F8TA 2PI2A 3M7NA 4KTAA 2JA7B 1HNWQ 5J22A 1JE5A 2GVAA 4X6AH 5C3WA 2AUKA 1C48A 1YBYA 1B53A 1TS2A 4C3JH 5DM63 1X3GA 3K0YA 4JC0A 2FHTA 4FDBA 5ELOA 4LFBL 4IUUA 1C7YA 3S16B 1BBUA 2XVSA 1ICFB 3P1HA 1EY6A 2D5DA 3LNNA 2RDFA 3E0JA 3H09A 2OEOA 1K73C 5IYBG 1XMQL 1LTGD 2F0IA 3HOWG 3PO2G 1FVIA 1PLFA 1JWUD 1T5XD 5LMUL 3BZDB 3PO3H 4X3TA 3L7ZC 3HS0C 3BVMA 4L63B 5KIXA 2CQOA 1AW7A 4CJ0B 1A2TA 1UE1A 5M5YH 2QDBA 2EY1A 4B3MQ 3IFTA 4JG2A 2L9HA 1KIXA 2F0QA 4IFDJ 1DGSA 5NUCA 5CBEE 1WD0A 3R3OA 3QO2A 2ZXPA 1XMOL 4QCLA 1EY8A 2XNAC 1GKHA 1J6QA 1F2ZA 1F9PA 3HOUH 4C2MB 2VS1A 4X65Q 3DWAA 5M5WH 4YHHL 3D8GA 1AN8A 3CCEA 2R61A 3GTMB 1JEQA 2A69C 4TKOB 4BY7H 2F4IA 5GQOA 1F2LA 2E2JH 4ABNA 5M3MG 2F0JA 3H0GH 3A56A 5IODA 1PYSB 1XJVA 2QKIC 2AHOB 3A54A 3D4RA 1IYUA 2KEDA 4B9WA 4QIWB 2ZJRA 1SYFA 3FEWX 3MVVA 4JVZA 3I4LA 2WQGA 5LHY1 1IKMA 2HHHL 4C3IG 1Q82C 4RGMA 1VQNA 4C3IB 1IL8A 1GUSA 2PCFB 4BY1H 1QB5D 4OWXB 1QZHA 2LD7A 1YEZA 1C8CA 1BDOA 1JJ2A 4X3SA 5M9OA 1EIYB 4DUYQ 5CV9A 4GKKL 1PH5A 3P75A 1GHKA 2L15A 4DAPA 4ME5A 2DGYA 2Y0SE 1NAPA 2PNRC 2I0QA 3TREA 1TIID 1PA6A 2F52A 1Y8OB 2L55A 4DR6Q 1CM9A 1D1IA 1K28A 1CI3M 1D1KA 2JA8H 3TS0A 1U9RA 2GA4B 2QF7A 1WTOA 3S14B 1C0AA 4TVAB 3M4QA 1PRTC 1STYA 1LT3D 3CP0A 4JI1Q 1XPRA 1SNCA 1EWHA 2A6EC 1PFSA 4LNQA 4BBSH 1BCPF 3VA5A 1HZBA 1LO5D 2Z6KA 1NR2A 2L5TA 2BE5D 2O5JC 1N33Q 1KAWA 1QE6A 1QG7A 4Z9CB 3U4VA 2IHEA 1CQVA 5M3FH 2BCOA 1MHWC 2OQ0A 2O5IC 4ZYSA 2VQEQ 3Q22A 4L5TA 4DU9A 2CVRA 1XNQQ 4HIMA 4JV5Q 2ENBA 5JEAH 3P7JA 2IPKD 3EN2A 4L5RC 3LX0A 1LTRD 1N36L 4YCUA 1TWHH 3G6JB 2JE6I 2A6HC 2BH8A 2XGTA 4AQYL 4ME3A 1QUQA 3S2DH 1DJRD 3OPOA 5IWAL 2DK4A 1WCMH 3URYA 5I9PA 1KLUD 2JVWA 4LF6L 4DPGA 4DV5Q 2KCTA 3WOFA 4LF5Q 4FF1A 5CYUA 1W2BA 4DV4Q 3EVQA 2UUBQ 4A3IH 1NJIC 1YVCA 1H9EA 1J9OA 3FKIB 5C4ZA 4DR1L 3A5UA 1A3TA 3KK7A 3L0OA 2BA1A 3Q0AA 2B2YA 3F2BA 4M1UB 4V190 3GTPH 1XTCD 4R4CA 3E9IA 5IY0A 2IX1A 4A4IA 4JBWA 1BUVT 3MXUA 4ODGA 1W3SA 3T1HL 3CC2A 4LF4Q 3RLFA 1R9TB 1EZ6A 3FDTA 3RN5A 1FJGL 2QW7A 3AFQA 3B6YA 3M4YA 4V0BA 3GTQH 1ESRA 2MGSA 4CDFC 3VYRA 2HDMA 1Q86C 2Q2HA 4LF8L 3ICEA 3MTSA 3CC7A 3TP7A 1GHJA 3R93A 2JEBI 4X62Q 4XYQA 3G6EA 1K8AC 3G7LA 3CCLA 1N8RC 5JOBA 1GXDC 2MJ8A 3VYTA 3TZUA 2Q8TA 2R92G 3OWEB 4OX9Q 1UAPA 3DLLA 2R92B 1R4QB 3NPPA 1ILPA 2ZT9C 1ZYRD 1KNEA 3CXCA 5KNDA 2V4DA 1U4MA 3W1GA 1AEXA 2F0NA 2KVMA 3LGJA 1BF4A 3A7LA 1H1JS 3GTJB 2V1CC 4LMQD 4ALPA 2KVEA 5I9OA 3NQIA 4MHEA 5C3EH 3SVMA 5D14A 2CW0D 4EVOA 5KNCA 5IT9L 1I3QB 1EIHA 2Z0SA 1L1OB 4RKBA 2I46A 5EGTA 4B3SL 2ZTDA 1Q3LA 3ER0A 2E2IB 2Z6KC 3H6MA 1SXTA 1SMYC 3GV3A 1EY0A 1IKLA 5J1ZA 1BXTA 1HUMA 2R7DA 1PHJA 4J15A 4MTNA 4MNOA 5EBDA 3A5ZB 1CHPD 1PFNA 5T1IA 2CFMA 4A3KB 1OXXK 3G4SA 4A3GB 3LWEA 4WFN3 3GDEA 4PMCA 1M4VA 3EROA 4DR2Q 4O42A 1NMFA 3M9BA 4JI4L 3M3YH 2WAQG 3N6RA 3NEMA 3TBIB 1BVSA 4OO1I 5M5XB 1IBMQ 3PUXA 1IBKL 1NCVA 3HGBA 3QR8A 5IP7G 1YI2A 2ZM6Q 1X54A 2F0SA 1E2WA 2RNOA 4A3DG 4IURA 2RA4A 2FINB 4A3DB 5GAEC 1YNNC 1CT1D 4R4TA 4RH6A 3J7AF 4IQZA 1Q90A 3K7AB 3RLOA 4OXPA 2HDLA 1KDBA 2JA9A 1MIUA 1U5KA 2EYJA 4X66Q 4GNXB 1HNXL 2B2YC 4R9WA 2K75A 5HY6A 1OXVA 2B2UA 3D6CA 1YNXA 1HA5A 2Z4IA 4HSVA 3M4PA 4LJZC 3K5MA 3UE0A 2F0TA 3TEHB 2G9HD 5IYBH 1L2FA 4XT3B 1U0LA 4BXXG 3HOWH 3PO2H 1JT8A 3CCUA 1X3QA 2HIXA 1JORA 1I4XA 2PMZB 1BR9A 2HQLA 1AZQA 4DUZQ 2JEAI 2C9OA 1PH8A 1HFGA 1B9MA 3M4OH 2UU9Q 1S3OA 2LKVA 3R8BA 4HJ5A 3I4OA 3NENA 3I4MG 2RNNA 1LM0A 3GTGH 1RCVD 3I4MB 4DNIA 1AFPA 2ZTCA 1I4HA 4A3JG 4OHJA 2JYOA 4QY7A 4A3JB 5CV4A 4LFAQ 2NBFA 2UXBL 1SNDA 1OXTA 2IWHA 2LMCB 4APVA 4IUPA 1HFNA 1E1TA 3KF8A 2KEEA 4DR4Q 2CH4A 2G9DA 4UAIA 4GS3A 1PDQA 3L9AX 1RD9D 2IX0A 3NBIA 2F4VL 2KCCA 3GTKB 4KY5A 3HOYG 2AQ3B 1JOKA 3HOYB 1HTLD 3UI2A 2RHQB 3OIPA 5IIFA 2OQKA 5ELBA 2ODCI 2RF4A 3JC66 2SNMA 1Y1VH 3I91A 2K7VA 4DR3Q 3SHLA 1XX8A 3T53B 4POFA 1A3VA 4DV1Q 1EYGA 2YYZA 3VR4A 2D62A 3ND9A 4DGZA 5AFWA 2OXPA 4CBVA 4JI6L 2MPMA 1VF7A 4A3MH 3PGZA 1I6HH 2M9VA 1JEIA 1Y02A 4YWKA 2RDGA 1VMPA 1Z7TA 2B3GA 5FLXc 2EVBA 3BS1A 4IN3A 1M1KC 1LTBD 3HZXA 4IO9A 5C4XG 4R4IA 1L0YB 1S5DD 2PI2E 1CA6A 1EZ8A 4XTCS 5EKIA 3PQIA 5DEHA 1Z9FA 4F87A 1X32A 3GD7A 2C5CA 5CMDA 3S17B 3PIOA 3WOEA 4ID6A 4LFBQ 4IUQA 4K8JA 1OXUA 4QB4A 1LABA 5M3FB 1LT4D 2UUCL 1WTHA 5A2QL 4TQUS 1PTOB 1TR5A 3KUPA 3SK6A 1K8OA 1V1PB 2R6GA 5EPLA 1XMQQ 1PH9A 3I4NH 3J7AV 1TQOA 3S1QH 4A93G 5IYDH 2Z8LA 3EIVA 1RL2A 4HAEA 3BJUA 5LMUQ 1YNJC 1TT2A 1I50B 1SE3A 4LUZA 1BCPD 4MN3A 4OEMB 2SDFA 2C35B 4Y52H 2ZJQA 1CKMA 4RCOA 3S2DB 4IZ8A 1S5CD 3KLSX 2K5QA 1EYCA 5GAHC 5IGCA 2ZXOA 4GN3B 1JOQA 3NBHB 4JI0Q 2N78A 5K36G 1HCZA 3A74A 2SOBA 2VQFL 1XMOQ 2HD3A 3A0JA 4KHPQ 2ATWA 4DN4M 1TWCB 2F0OA 4ZRZA 3X3NA 4PZ7A 3S24A 2F0EA 4LF7Q 4WJWA 4YHHQ 4WJ3M 3MA2B 4DV6Q 4DV2L 3J81j 2UUAL 2AKWB 1EIFA 1JQYD 2KHSA 3U9SA 5C3XA 3RUZA 4DAYA 1E7ZA 1XWEA 2JA5G 4JBKA 2K50A 4ZAIA 3ONAB 4K6DA 4O0AA 1SYEA 4KY7A 4LFCL 3X3MA 1A0IA 1TWFH 3TS2A 4MZ9A 2EYOA 3U4ZA 2HHHQ 3U50C 3QJYA 3HOVH 2A74C 1JE4A 3E9HA 3S1NB 1WTWA 1Y8PB 1JJCB 1KL9A 3E6ZX 4JK1C 1CKOA 2EJGC 4JI2Q 4FXKC 3JAML 4GKJL 1XTDA 4YCVA 2B2TC 4HIOA 4AYBG 2LS01 2F0FA 3MC0B 3MXPA 1KNAA 4R4QA 4AYBB 5HGTA 2QNCA 4YCWA 3IKJA 4GKKQ 2PQAB 3RZDH 4JCVE 1UWVA 3ERSX 1V1QA 1I4QA 3UDFA 4NXML 2AMCB 1FNWA 2XRSD 3F2CA 1SROA 3FPPA 5EAYA 4LUVA 1NMGA 2F3WA 4P74A 3CCVA 2XRQD 2RCFA 4U68A 4P71A 3T51B 1H9JA 4B3RL 2K32A 2OWOA 4ULLA 2EOTA 4O1NA 1D5XC 1MD2D 1NUCA 1ZBHA 1MSGA 5EKKA 1UE5A 1DOLA 3J80c 2L0CA 5IT9c 4GOPB 4C3HG 1XNRQ 3J7YW 1KRSA 2Z4HA 4C3HB 2NVQB 5IYCH 3ZYYX 2A69D 4GN5A 2JA7G 1UUPA 4FNFA 3P20A 3CC4A 3S1MH 1CKNB 2B8GA 2W51A 3I70A 5EPKA 5BN5A 1PH4A 4UP8A 3OTOL 3QOJA 3LLRA 4MIUA 4DV3Q 5CC4A 2HCCA 3H15A 3TP6A 4N9PA 1SE2A 4AQYQ 5COYA 2N55A 1QILA 3TMEA 2K03A 3CCMA 2NVTH 3I72A 5IWAQ 4OO1G 1EEFD 3CKIB 4DR7L 2SEBD 2JP1A 1N32Q 3CRKC 1DOKA 4XYOA 1Z47A 2GN5A 3I7FA 5JPMC 1DD2A 2WP8J 4QIWE 3GTOB 4DR1Q 4RA8A 1X65A 1IYJB 3KJPA 1KRTA 3KLWA 3VA7A 4OL7A 2N3SA 1J8IA 3F2DA 3L3OC 2D0OA 1HR0L 5IP9G 5JAVA 2NWGA 3D3RA 3GQBA 1FJGQ 3FLGA 3S1RB 1PRTD 1H9RA 3A8KE 4A3LG 2KOLA 3VR6A 1DXMA 2EJMA 1SNQA 1BO0A 1E3PA 4EQ5A 2A6ED 3VR5A 3AYHB 5GADC 4LF8Q 4QUCA 1F9RA 5E3FA 4BBRH 5IGFA 3RZOH 5K5PA 2BDNA 4DV0L 3EA6A 3O13A 2WFWA 1EL0A 4JPBW 2R93B 3BDLA 5C44G 5C0XH 5LMNL 5C44B 1PYBA 2RVLA 1STNA 4FF4A 2JK8A 4EGVA 2X6LA 1CA5A 3W2DA 2FFKB 1A3UA 4IOCA 3I8ZA 1GOZA 1QJOA 2JSOA 4FYDA 3CQZB 2KFVA 3PMFA 2A6HD 1EWIA 1PTOC 4NB3A 1LACA 3HRZC 2UXCQ 4KJOA 2JXMB 1HUNA 1HNZQ 1DONA 5JJLA 2NVXB 1S40A 3S15H 3KDFB 4IJLA 5FLXL 3BZCA 4BS9A 1ASZA 2PZTA 1ICWA 1K0SA 1VQOA 1NY4A 1VQEA 1AZPA 4L5QA 1GUTA 3HOZH 3T56B 4RHRA 5I6WA 3W5OA 5HURA 4HMIA 2N8NA 5DAUA 1EQQA 2CKZB 2G80A 3CU7A 1JICA 3M85A 1EOTA 1CK1A 4JYAQ 4B3TL 4JI4Q 1VQCA 1YJWA 4X64Q 5C0XJ 3NELA 5CORA 2VUMB 4JI8L 4GZYC 1G2TA 1K8GA 1E2VA 4J6HA 3D6WA 4R1JA 4A3CH 1KABA 1IBKQ 2NTSA 1SEBD 4KMUC 2I5HA 4JBJA 1I4PA 1V9PA 2PW7A 3I3CA 4F8MA 1NSNS 2PPBC 4Y7NB 3RMHA 3HEJA 1IBLL 5C4XH 1EY9A 4K0KL 3F2UA 1ZS9A 3TP8A 2E5LL 3MXGA 4CDCC 1EYAA 1K83H 2AQ1B 4LAAA 5C4JH 1LT6D 3H94A 2N88A 1N34L 4LK1C 2L1BA 3I56A 2D0PA 3LWUA 3I4NB 4BA2I 3KF6B 4L8JA 3T1YQ 3BYYB 3PCOB 2JA6H 1DM0B 3OWFA 1TY0A 1HNWL 5I2YA 4NXNL 3NXWA 4IJHA 4A93H 1JB3A 2Y0SB 4NDXA 3FKIG 4JI3L 4A3BH 1TWAH 2WACA 1SSOA 4KJNA 2LC3A 4DA2A 4DFAA 3C46A 1WTQA 1B3QA 1SMYD 2N49A 4N9TA 4PV1C 2PNHA 1I94Q 3TDQA 1Y1WG 1EY7A 1MI2A 1Y1WB 3DXJC 5K36H 3PF4A 4N8X1 2IHFA 1ZEQX 4G7HC 1KLGD 1P16A 3BVZA 2UXBQ 1SFOH 4B3ML 4OGQC 4PQXA 2QEJC 3FMCA 4H13C 2K14A 4WORA 1UEBA 1YHBA 5G3LF 3TSSA 1Y69U 1HH2P 1VQ4A 4CKEA 2HJQA 2EXDA 4A3FH 4UHVA 1RJTA 4LF9L 1YNND 4KI0A 2LXJA 3EQLC 3AFPA 1XPUA 3J81L 3UDXA 3HOXH 3AU7A 4OELB 3S2HB 1E24A 5D3DA 2YU9B 3A55A 2WAQE 5J39A 1QNKA 2WB1G 3NSWA 2WB1B 2JQOA 2EIFA 2EQSA 3GTLH 4ZKCB 4RCNA 1EY4A 2BH2A 2ASBA 3J80L 1PZID 3CCSA 2QA4A 4FVMA 1NE3A 2NN6I 4JI6Q 3JAMc 1HXYD 2P5ZX 4G7ZC 5IGEA 2B8FA 2PW5A 3V05A 2NUCA 1TWGH 3FP9A 3IL8A 2A8VA 1YHQA 2B2WC 2B63G 1B4OA 2NN6H 3IFDA 1YJNA 4DAVA 2B63B 1LYLA 4A3KG 3T4AC 1ILQA 2MQHA 4A3GG 2EZVA 4RAUC 4BITA 2E2HB 5EJWA 4A3EG 1XPOA 1PTOF 4UDUC 4DUYL 4IUNA 4A3EB 2R7ZG 4IFDG 1M8AA 3GO5A 5FJ8H 2R7ZB 3CHBD 4R4OA 3TQYA 2J7ZA 2OTJA 1HQRD 4KHVA 3QIAA 4CKBA 5FLXE 1B50A 1HPCA 2UUCQ 1K3RA 2PMZE 4DR6L 2IL8A 5C5MA 5FKAC 3MFYA 4QUFA 2VXWA 1PH7A 1G2SA 3OIQA 1SE8A 2KCMA 4C3JG 1Y8NB 3H3VC 5DNFA 1AP0A 4C3JB 5CBAE 1D5MC 3SDZA 1Q46A 2VY3A 1Q12A 4C1NI 2ID0A 1JWSD 5LL6S 2RHSB 1LTAD 3S16H 1TXYA 2VQFQ 1O80A 1J5EQ 3PO3B 1BBXC 2NZOA 1GKUB 2ODGC 4P73A 4YY3L 2VB3X 1D6EC 4JV5L 2HCIA 3K5LA 4X3KA 1F2MA 1STEA 3D31A 5M5YB 2K5VA 2K5DA 1V43A 4DV2Q 4XDXA 4M8AA 2UUAQ 1PYWD 1JOOA 2TSSA 3BDOA 2I5MX 2FMMA 4UZWA 2F0VA 1EFWA 1QVGA 4LWCA 3K0XA 3HP3A 4IPGA 3HOUG 2VW9A 3HOUB 1GUOA 3K5OA 1K9MC 2EJFC 5IP9H 2QNFA 1L1OA 2B2VC 5CIUA 2F0LA 2CH4W 3Q23A 5M5WB 1QOHA 1HR0W 2UXDQ 4C2MH 5KEEA 4A3LH 3CW2C 2ICIA 2J0TD 2ALYB 3T13A 3M7GA 4BY7B 4GKJQ 2MO1A 3H0GG 2E2JB 4AH6A 1PH3A 1KAAA 3ZJYC 3H0GB 4B9XA 2M2LA 1EQRA 3KJOA 3GTMH 3CRLC 3R2TA 2BA0A 1MSHA 2A68C 2DUDA 2EYHA 2EPBA 4C56C 3V2TA 3H3VH 4ZQ3A 5M3MH 1YNJD 3PIO3 3KFUA 4YIJA 2NYZD 4NXMQ 2H4OA 2E8GA 2QEXA 1OTCA 5LMNW 4TRDA 4BY1G 4DNRB 4BY1B 1GO3E 2BOSA 1FGUA 4C3IH 2WV6D 1Q1EA 4P75A 3MXNB 2CCZA 2B2TA 1KHIA 2H1EA 4B3RQ 2RSNA 1FNUA 1HJPA 1B2TA 1VQFA 4DR5L 1EUJA 5IGGA 4S3SA 3STBD 2JA8G 4JI5Q 3RR5A 2JA8B 4HEDA 4GNXA 4CGYB 3HKZE 1HQMC 1UE7A 5JJZA 1PZJD 1G51A 1O7YA 5ELEA 3S14H 1A15A 5ISRA 2XTIA 5CV6A 1JB7A 4BBSB 2K5NA 1I5FA 4OIKA 4CJ2C 4F7XA 1G91A 1ESFA 4K8IA 5IT9E 4N8FA 2K01A 1YHAA 1JWMD 1ML0D 4RGNA 2F3VA 3QWNA 5M3FG 3ULPA 2Q2UA 3CCQA 1EN7A 1CHQD 2QILA 5JVH3 4DK0A 4DR7Q 5JEAG 3NWSA 1BNZA 4FF3A 1TY2A 1TS5A 3IAYA 2LFNA 3PF5A 5ELCA 3E3XA 3SGIA 1SN8A 1RTOA 3MEFA 1TWHB 2PZWA 1AE3A 2F0UA 1IW7C 1SAPA 1WCMG 1B1ZA 1WCMB 2ZM6L 1HR0Q 3BDCA 2VB2X 1SYBA 2X6GA 4A3IG 4RHSA 1NBWA 1E0BA 1EOVA 4A3IB 2EYPA 1EIGA 2Z1CA 4A3BB 1L1OC 1SJED 2MHVA 2JJQA 5JJKA 4K5WA 4L5SA 1KDAA 2CHBD 2Q8IB 1YZ6A 2F0GA 3STBC 1TS4A 5LL6X 3GTPB 4X66L 3FKIH 3SK8A 1G291 1G6PA 3UDGA 1PRTB 3PIPA 2K04A 1VS0A 5LMNQ 3GTQB 4YWLA 1STAA 2YTYA 3QB3A 4ZKBB 4PMWA 2EY6A 1R9TH 1F9QA 2RDHA 5BN3A 5KYLA 4PZ6A 2A5HA 2OF1A 3I90A 2HIVA 3G71A 4DUZL 3QG1A 4KLKA 2K1BA 3DUZA 1CSQA 4A3FB 1QVCA 4XXEA 2RSOA 2WKDA 3ULJA 1S5ED 3N52A 4DV7L 1TS3A 2YTVA 1EU4A 2ZTEA 3U9OA 2KJXA 2R92H 1HZCA 5FO7B 4LFAL 4KK7A 3GTLB 5C3EG 2E76C 5G3LD 4GNXC 1F9SA 2D2CC 3J81c 1B9NA 5C3EB 5FLMG 4JI7L 5FOBB 3HKSA 3GTJH 1A6XA 1Q8IA 4IUVA 2F1MA 4XT1B 1MGSA 1V1PA 3PUYA 1ENFA 1GD7A 2A73B 2ZXRA 3BG3A 5T1GA 3KOJA 3L2PA 1WTRA 3UDIA 1UNSA 2L11A 4B3TQ 3J7ZC 1I3QH 3R2IA 2O4XA 3RN2A 3SEBA 4RGOS 4G4KA 4JI8Q 1L0XB 3NUCA 2VZAA 1F77A 1VQ9A 1Y14B 2MO0A 2E2IH 3SE0A 2F03A 1LTSD 1B8AA 2VNUD 1H9FA 4DR3L 3V96A 5IOCA 2PQEA 3NBHA 3NK9A 4RWSC 1IBLQ 4HCSA 3TN2A 4A3KH 4HN7A 1GJJA 1X55A 1K0RA 3M3YB 2Q8RE 3KBXA 1WTVA 3DMUA 5JJIA 1E2ZA 2RQXA 5C6AA 1MKHA 4RG1A 1VQ5A 2KCNA 2KVDA 2PZUA 5AJ3L 1N36Q 1N34Q 3K6OA 4DK3C 1PVOA 4H0LC 1A2UA 1QNUA 1PFMA 1H95A 5CR3A 1A63A 1A62A 1ASYA 5M5XH 3ND8A 4KKTA 5CGKA 4RGTA 3ULLA 1Q8KA 5DLQE 1PTOD 5IP7H 1SNOA 4LF6Q 4NXNQ 2ZJPA 5ELFA 1E22A 1CUKA 1X6OA 4HJ8A 4A3DH 3IRBA 1LTTD 4JI3Q 3CMEA 1P8LA 4FP5D 3KLRA 3GV6A 3K7AH 1BOSA 2MNAA 3NE5B 3SK5A 2E74C 2AUJD 2NZHA 3T1HQ 3HOWB 3PO2B 5A2QE 2IY5B 1VQLA 1STBA 1LT5D 1YIJA 2PQAA 1VQBA 1H9MA 1FYCA 4JBMA 2XSCA 2EYMA 4DNTB 5C0XI 3NQTA 4RFBA 4BXXH 4TSSA 1E7LA 3KYHC 3QOLA 4IALA 3SXHA 3M4OB 1O78A 1CTMA 5FO8B 1PXUA 4JI0L 4EQOA 2BDOA 2XIWA 4IPDA 3GTGB 4E6IA 4EX5A 2F0HA 4UY8C 2EYLA 2R93G 3ITPA 3K59A 4CDDC 4KHPL 4LF9Q 5H1SE 1GUNA 1STGA 3E0EA 4LF7L 4RKLA 4HMJA 3I4MH 5KNBA 4O2DA 4BWGB 3DM1A 2QGQA 3EJIA 4DV6L 1PH2A 4K2LA 2O2LD 1KXLA 1JR0D 1QUQB 3E5SA 1D5ZC 4A3JH 4HTHA 4PNYA 2KQ3A 4GOPA 5TSSA 2B29A 3PUWA 3DWQA 2D9UA 4K5VA 4NMZA 5M3MB 3MAQA 4AIMA 1BBWA 1PFBA 1S4ZA 2NZ1D 3MFGA 4QMGA 1T9HA 2NTTA 3A8JE 1CKNA 4J1MA 4B3SQ 3D4DA 2LXKA 1IYVA 4GN4B 1JMCA 3PSIA 4HJAA 1Y1VG 2LSSA 4CKCA 1R4PB 1Y1VB 3GTKH 2AQ2B 1GM5A 3W3AA 2OTLA 3HOYH 4JI2L 1ENAA 4A75A 3RD4A 3D0FA 4PMBA 1RHPA 4NKLA 2KVUA 2EDGA 4PZ8A 3FVQA 4FO2A 3JAMi 3JAME 4A3MG 1VMCA 2DNCA 4A3MB 1I6HB 2PO4A 2Q2IA 2VUMG 3TZDA 2YTXA 1G8ZD 1SMXA 2F0PA 3OOCA 1MJCA 4QF4A 3I55A 5BR8L 1EY5A 1WFQA 2B2WA 2K5WA 4NP5A 5GROA 3CF5A 1E1OA 3A7AB 1TU2B 1Q81C
chains in the Genus database with same CATH topology
2R7ZH 1RIPA 4OWTB 4JI5L 3WWVA 2UUCQ 1K3RA 2PMZE 4DR6L 1Z9FA 1VQPA 2KHIA 3GD7A 2ES2A 4UP7A 1CSPA 3PIOA 4HJ7A 1PH7A 4UPAA 4LFBQ 3F8TA 5E7NA 1OXUA 1SE8A 1WI5A 2PI2A 3W1BA 3U58A 3M7NA 3S17H 2KCMA 1HNWQ 1HNXQ 1WOCA 1JE5A 1XNRL 2GVAA 3I4NG 2UUCL 4X6AH 1Q46A 2VY3A 1Q12A 5IYDG 1YBYA 4TQUS 4C3JH 1MJEA 1X3GA 2R6GA 4JC0A 2ID0A 4FDBA 5ELOA 1XMQQ 4LFBL 1PH9A 3I4NH 1VCIA 3S1QH 4A93G 2RHSB 1C7YA 5IYDH 1BBUA 3EIVA 1RL2A 4YY3Q 3BJUA 5LMUQ 2Y0SG 4LUZA 3S16H 4QJFA 1TXYA 1K73C 2C35B 1I50H 2VQFQ 5IYBG 1J5EQ 4IOAA 4Y52H 1L0WA 4DV3L 1XMQL 2NZOA 1GKUB 3HOWG 2ODGC 2ZJQA 1FVIA 1CKMA 3PO2G 4P73A 4YY3L 2AWNA 4POGA 5LMUL 3PO3H 4JV5L 5GAHC 4GN3B 3L7ZC 3NBHB 4JI0Q 2KENA 2N78A 5K36G 2WB1E 3D31A 2CQOA 2K5VA 3A74A 2VQFL 4DV2Q 1V43A 1XMOQ 2YV5A 2UUAQ 3A0JA 4KHPQ 1N32L 2ATWA 1UE1A 5M5YH 4B3MQ 2I5MX 4JG2A 4PZ7A 3S24A 1EFWA 4LF7Q 1KIXA 1QVGA 1TWCH 4LWCA 3K0XA 4IFDJ 1DGSA 3KDFA 4WJ3M 4IPGA 4YHHQ 4DV6Q 4DV2L 1XMOL 2VW9A 3HOUG 1LTLA 3J81j 2UUAL 2AKWB 1EIFA 1GKHA 1J6QA 4GOPC 1VQ6A 1K9MC 5IP9H 4RMFA 3HOUH 2QNFA 1L1OA 2KHJA 4JBKA 1E7ZA 2JA5G 2K50A 2VS1A 4X65Q 1HR0W 4O0AA 2UXDQ 3PUZA 4C2MH 5M5WH 4DKAC 3CW2C 4YHHL 4A3LH 2ALYB 4JI4Q 4IPHA 3CCEA 2JA5H 4LFCL 1GVPA 2K52A 1VQJA 4GKJQ 2MO1A 3H0GG 1PH1A 1X9NA 1A0IA 1TWFH 4AH6A 1PH3A 1OXSC 3ZJYC 3HOVG 3TS2A 4BY7H 5GQOA 4JOIA 2F4VQ 1EQRA 3KJOA 3GTMH 2E2JH 5M3MG 3CAMA 4X65L 2BA0A 4MZ9A 3U4ZA 3H0GH 4PG3A 3U50C 2DUDA 5JEAJ 2HHHQ 1PYSB 1XJVA 3HOVH 3PV0A 5IE8A 3E9HA 1N9WA 3H3VH 5M3MH 2AHOB 1JJCB 1KL9A 4JI2Q 4GKJL 1CKOA 2ZJRA 1X3FA 3S1NH 1XTDA 3KFUA 2Q2TA 4QQBX 4YCVA 4HIOA 4NXMQ 1WJJA 4AYBG 3AQQA 2E8GA 4P72A 4R4QA 2QEXA 5LMNW 4DAMA 1Q82C 1OTCA 2HHHL 2QNCA 4YCWA 4BY1G 1VQNA 4GKKQ 2PQAB 3RZDH 1Q7YC 4QGUA 4JCVE 1GO3E 1UWVA 4A3CG 1FGUA 2NVYH 4C3IH 4DR5Q 1Q1EA 3ERSX 1V1QA 4BY1H 4P75A 4OWXB 3MXNB 2LD7A 1YEZA 3UDFA 2AMCB 1QZHA 2CCZA 4NXML 1FL0A 1KHIA 3F2CA 1SROA 1JJ2A 1GL9B 4B3RQ 1EIYB 4DUYQ 4GKKL 5EAYA 1PH5A 1HJPA 2L15A 4LUVA 1VQFA 4DR5L 2DGYA 4LUOA 2Y0SE 3KF6A 1NMGA 4P74A 2I0QA 3CCVA 1EUJA 3TREA 5FLMH 2UXCL 1PA6A 3STBD 2JA8G 2F52A 4P71A 4JI5Q 1HNZL 4B3RL 3RR5A 4DR6Q 4YWMA 3I2ZA 2OWOA 4GNXA 3HKZE 1UE6A 2JA8H 3TS0A 1UE5A 3J80c 1UE7A 5IT9c 1C0AA 4TVAB 1G51A 3M4QA 5IYCG 3CCRA 4GOPB 3S14H 3CMAA 1XNRQ 3CP0A 2XTIA 1KRSA 4JI1Q 1JB7A 1XPRA 2K5NA 1I5FA 5IYCH 1PFSA 4QL5A 4LNQA 4C3HH 3KF8B 1YHAA 4BBSH 4GN5A 2JA7G 2NVQH 1HZBA 1X3EA 2Z6KA 3CC4A 3S1MH 1CKNB 5M3FG 3ULPA 2W51A 2Q2UA 3CCQA 1EN7A 1N33Q 1KAWA 2JA7H 4JI1L 3U4VA 1PH4A 4JYAL 2IHEA 1D8LA 2H5XA 4UP8A 3OTOL 4X64L 5M3FH 1IXRA 2OQ0A 2VQEQ 1VQ7A 4DV3Q 4DR7Q 5JEAG 3Q8DA 4L5TA 3H15A 5HGQA 1XNQQ 4HIMA 4JV5Q 1N33L 3PF5A 3AEVA 4AQYQ 3EN2A 3SGIA 1SN8A 3CCMA 4L5RC 2NVTH 3MEFA 5IWAQ 4OO1G 3PO3G 1N36L 2VQEL 4DR7L 2AWOA 1N32Q 1AE3A 4YCUA 3BU2A 1TWHH 1VQKA 2JE6I 1XNQL 3OYYA 1WCMG 1Z47A 2GN5A 3HFZB 2BH8A 2XGTA 3I7FA 4AQYL 4ME3A 1QUQA 3S2DH 1LUZA 2ZM6L 2WP8J 4QIWE 1HR0Q 4DR1Q 5IWAL 2DK4A 1WCMH 1X65A 4A3IG 1NBWA 4LF6L 4DPGA 3GTOH 1EOVA 1IYJB 3KJPA 4DV5Q 1VQIA 2KCTA 3KLWA 4GLAC 1KRTA 1VQMA 4LF5Q 1W2BA 1L1OC 4IPCA 5JJKA 2JJQA 4DV4Q 2UUBQ 4A3IH 1NJIC 4L5SA 2N3SA 1YVCA 1H9EA 3T1YL 3F2DA 2D0OA 1YZ6A 4DR1L 3A5UA 1HR0L 3STBC 5IP9G 4X66L 3L0OA 3EBEA 2BA1A 3FKIH 1FJGQ 4LFCQ 3UE1A 4DV5L 3F2BA 1G291 4LF5L 1G6PA 3GTPH 4A3LG 4BBRG 1KQSA 4HJ9A 3UDGA 3S1RH 2GVBA 4JOIC 1VQGA 4DV4L 2UUBL 1E3PA 3E9IA 4R4CA 4EQ5A 3K80C 4UP9A 5IY0A 4A4IA 4JBWA 3OW2A 3AYHB 2IX1A 5GADC 4LF8Q 3PIPA 1W3SA 1VS0A 3T1HL 4BBRH 1M90C 3CC2A 4LF4Q 3H3VI 3RZOH 3RLFA 5LMNQ 4BY7G 3RN5A 4YWLA 4DV0L 1FJGL 2YTYA 3AFQA 3B6YA 4PMWA 1I94L 1R9TH 3GTQH 5C0XG 2WFWA 1VQ8A 1YJ9A 4PZ6A 1Q86C 2Q2HA 5C44G 4LF4L 4LF8L 3ICEA 2HIVA 5LMNL 3G71A 1PYBA 4DUZL 3FHWA 1O7IA 2R93H 3CC7A 4KLKA 4DV7Q 1KC8C 2JK8A 5C44H 1CSQA 2JEBI 4X62Q 1WYDA 1QVCA 4HIDA 2R7FA 3ULJA 3G6EA 1K8AC 3CCLA 4IOCA 1N8RC 4KHZA 2R92G 4OX9Q 4JI7Q 3DLLA 4DV7L 2KFVA 1EWIA 3CXCA 2YTVA 3RLNA 2ZTEA 1VQDA 3W1GA 4X62L 4NB3A 2OCEA 2R92H 1HZCA 3CQZH 3LGJA 4LFAL 2UXCQ 1Q1BA 2KBNA 1HNZQ 5C3EG 2V1CC 5JJLA 4GNXC 1S40A 4ALPA 3J81c 3KDFB 4IJLA 3S15H 5FLMG 4OX9L 4JI7L 3CPWA 3HKSA 3GTJH 3BZCA 2NVXH 5C3EH 1ASZA 1E7DA 1AE2A 3HOZG 1D7QA 3PUYA 3DM3A 1GD7A 3L2PA 1VQOA 2Z0SA 3KOJA 1L1OB 3J81i 1NY4A 1VQEA 3UDIA 4DAYB 3F1ZA 4L5QA 4B3TQ 3J7ZC 3CCJA 3HOZH 1I3QH 4B3SL 3RN2A 2ZTDA 3ER0A 4JI8Q 2Z6KC 3W5OA 2VZAA 2N8NA 4LW1A 3VDYA 1VQ9A 1C9OA 1EQQA 1Y14B 2CKZB 2G80A 2MO0A 2E2IH 3M85A 4BBSG 1HZ9A 1B8AA 1QVFA 2VNUD 1H9FA 2R7DA 2RCNA 1PHJA 4B3TL 4J15A 4MTNA 3OTOQ 4MNOA 1VQCA 3A5ZB 3J80i 1YNSA 4X64Q 4DR3L 1YJWA 2CFMA 3NELA 5C0XJ 5AJ3Q 5J3BA 1OXXK 4JI8L 3G4SA 1IBLQ 1K8GA 4R1JA 4A3CH 4A3KH 4OONA 2VUMH 1GJJA 1X55A 1K0RA 3GDEA 1IBKQ 5JJIA 4DR2Q 2I5HA 1VQ5A 3PUVA 1MKHA 1V9PA 1SLJA 1NMFA 3M9BA 1X56A 4JBJA 4RG1A 4JI4L 3M3YH 2WAQG 3NEMA 2MFIA 5AJ3L 1N36Q 1N34Q 1PVOA 1BVSA 4BA1I 3BZKA 4DK3C 1IBLL 5C4XH 4K0KL 4OO1I 1H95A 4Y7NH 3PUXA 1A63A 1KD1C 1ZS9A 1IBMQ 1A62A 1ASYA 1IBKL 2E5LL 5IP7G 4DR2L 5M5XH 1K83H 1YI2A 2ZM6Q 1X54A 1PV4A 3ULLA 5C4JH 1AH9A 1Q8KA 2A1AA 5DLQE 4A3DG 1N34L 5IP7H 5GAEC 4LF6Q 3K81C 3I56A 4NXNQ 2ZJPA 2D0PA 4R4TA 1IBML 2JA6G 1E22A 1CUKA 1X6OA 4HJ8A 3KF6B 3IRBA 4BA2I 4A3DH 4JI3Q 3T1YQ 3RLOA 3CMEA 1P8LA 3PCOB 3CD6A 4OXPA 2JA6H 2JA9A 1MIUA 1U5KA 3K8AA 4X66Q 3K7AH 4GNXB 1HNXL 1HNWL 4NXNL 2K75A 4AYBE 4A3BG 4GLVB 4IJHA 5HY6A 2MNAA 4A93H 1S72A 1OXVA 3FKIG 1SRUA 1YNXA 2NZHA 2VL6A 3CPFA 4JI3L 4A3BH 1TWAH 3T1HQ 3M4PA 2LC3A 3K7UC 3HKZG 5ELNA 3UE0A 4DV0Q 3TEHB 5IYBH 2N49A 1L2FA 2IY5B 4OWWB 2PNHA 1U0LA 1I94Q 3HOWH 3PO2H 4BXXG 1VQLA 1YIJA 1JT8A 2PQAA 3CCUA 1VQBA 1J5EL 4JBMA 1Y1WG 1IL2A 5C0XI 2HIXA 4WJ4A 4BXXH 2HQLA 3PF4A 1E7LA 3KYHC 4DUZQ 1NTGA 2IHFA 2I5LX 1Y1WH 2JEAI 4JI0L 1PH8A 3M4OH 1P16A 2UU9Q 4IPDA 2R93G 1S3OA 2FXQA 4EX5A 4UY8C 4HJ5A 3I4OA 3NENA 2UXBQ 1SFOH 4KHPL 3I4MG 4B3ML 3GTGH 1B7YB 1LM0A 5H1SE 4LF9Q 4DNIA 3E0EA 2ZTCA 1VQHA 1HZAA 2K14A 4LF7L 4A3FG 4HIKA 1UEBA 1YHBA 3I4MH 4A3JG 2IT1A 4O2DA 1HH2P 2UU9L 1IZ6A 2QGQA 4QY7A 4LFAQ 4DV6L 1VQ4A 1PH2A 2HJQA 2EXDA 1KXLA 2K4KA 4A3FH 2UXBL 4A76A 3HOXG 1B70B 1QUQB 2K5HA 4A3JH 1YITA 4LF9L 1OXTA 2MPHA 4KI0A 2F3IA 4GOPA 2B29A 4APVA 2LXJA 3AFPA 3J7A5 1XPUA 3PUWA 3UDXA 3HOXH 2UXDL 4NPSA 1E24A 1E1TA 4AIMA 1BBWA 2WAQE 4DR4Q 2WB1G 3S2HH 1T9HA 2YU9H 1CKNA 4GS3A 2JQOA 4B3SQ 2EIFA 2EQSA 2LXKA 1BKBA 3GTLH 2IX0A 3G48A 2F4VL 3HOYG 4GN4B 4XIGS 1JMCA 2BH2A 3PSIA 4HJAA 1Y1VG 2LSSA 2ASBA 3CCSA 4JYAQ 2RHQB 2QA4A 4JI6Q 1NE3A 2NN6I 3GTKH 3JAMc 2OQKA 1GM5A 2ODCI 2CWAA 2RF4A 2OTLA 3HOYH 3TRZA 3JC66 4JI2L 4DR4L 1SR3A 1JJGA 1Y1VH 2HT1A 4A75A 1VQAA 4DR3Q 3D0FA 4POFA 1TWGH 4DV1Q 5GAGC 2NN6G 2YYZA 3FP9A 4PZ8A 1EYGA 2D62A 3JAMi 4A3MG 2A8VA 5BR8Q 1YHQA 4JI6L 1PH6A 2B63G 2A19A 1YJNA 1LYLA 4DK6C 1QZGA 2Q2IA 3PGZA 4A3MH 1I6HH 4A3KG 2VUMG 1JEIA 1Y02A 4YWKA 2YTXA 4GLXA 2B63H 4DV1L 2MQHA 4A3GG 4IFDI 1SMXA 1MJCA 3I55A 5FJ8G 2B3GA 4K0KQ 3RNUA 5BR8L 5FLXc 4A3EG 1WFQA 4H02A 1XPOA 4DUYL 1M1KC 1A8VA 5GROA 2CWPA 2E5LQ 4A3GH 3CF5A 2E2HH 2R7ZG 4IFDG 1E1OA 3GO5A 5FJ8H 4IO9A 5C4XG 4R4IA 4R4OA 3TQYA 4A3EH 2OTJA 2PI2E 1Q81C 4XTCS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7Z H;  1RIP A;  4OWT B;  4JI5 L;  3WWV A;  2UUC Q;  1K3R A;  2PMZ E;  4DR6 L;  1Z9F A;  1VQP A;  2KHI A;  3GD7 A;  2ES2 A;  4UP7 A;  1CSP A;  3PIO A;  4HJ7 A;  1PH7 A;  4UPA A;  4LFB Q;  3F8T A;  5E7N A;  1OXU A;  1SE8 A;  1WI5 A;  2PI2 A;  3W1B A;  3U58 A;  3M7N A;  3S17 H;  2KCM A;  1HNW Q;  1HNX Q;  1WOC A;  1JE5 A;  1XNR L;  2GVA A;  3I4N G;  2UUC L;  4X6A H;  1Q46 A;  2VY3 A;  1Q12 A;  5IYD G;  1YBY A;  4TQU S;  4C3J H;  1MJE A;  1X3G A;  2R6G A;  4JC0 A;  2ID0 A;  4FDB A;  5ELO A;  1XMQ Q;  4LFB L;  1PH9 A;  3I4N H;  1VCI A;  3S1Q H;  4A93 G;  2RHS B;  1C7Y A;  5IYD H;  1BBU A;  3EIV A;  1RL2 A;  4YY3 Q;  3BJU A;  5LMU Q;  2Y0S G;  4LUZ A;  3S16 H;  4QJF A;  1TXY A;  1K73 C;  2C35 B;  1I50 H;  2VQF Q;  5IYB G;  1J5E Q;  4IOA A;  4Y52 H;  1L0W A;  4DV3 L;  1XMQ L;  2NZO A;  3HOW G;  3PO2 G;  2ZJQ A;  1FVI A;  1CKM A;  4P73 A;  4YY3 L;  2AWN A;  4POG A;  5LMU L;  3PO3 H;  4JV5 L;  5GAH C;  4GN3 B;  3L7Z C;  3NBH B;  4JI0 Q;  2KEN A;  2N78 A;  5K36 G;  2WB1 E;  3D31 A;  2CQO A;  2K5V A;  3A74 A;  2VQF L;  4DV2 Q;  1V43 A;  1XMO Q;  2YV5 A;  2UUA Q;  3A0J A;  4KHP Q;  1N32 L;  2ATW A;  1UE1 A;  5M5Y H;  4B3M Q;  2I5M X;  4JG2 A;  4PZ7 A;  3S24 A;  1EFW A;  4LF7 Q;  1KIX A;  1QVG A;  1TWC H;  4LWC A;  3K0X A;  4IFD J;  1DGS A;  3KDF A;  4WJ3 M;  4IPG A;  4YHH Q;  4DV6 Q;  4DV2 L;  1XMO L;  2VW9 A;  3HOU G;  1LTL A;  3J81 j;  2UUA L;  2AKW B;  1EIF A;  1GKH A;  1J6Q A;  4GOP C;  1VQ6 A;  1K9M C;  5IP9 H;  4RMF A;  3HOU H;  2QNF A;  1L1O A;  2KHJ A;  4JBK A;  1E7Z A;  2JA5 G;  2K50 A;  2VS1 A;  4X65 Q;  1HR0 W;  4O0A A;  2UXD Q;  3PUZ A;  4C2M H;  5M5W H;  4DKA C;  3CW2 C;  4YHH L;  4A3L H;  2ALY B;  4JI4 Q;  4IPH A;  3CCE A;  2JA5 H;  4LFC L;  1GVP A;  2K52 A;  1VQJ A;  4GKJ Q;  2MO1 A;  3H0G G;  1PH1 A;  1X9N A;  1A0I A;  1TWF H;  4AH6 A;  1PH3 A;  1OXS C;  3ZJY C;  3HOV G;  3TS2 A;  4BY7 H;  5GQO A;  4JOI A;  2F4V Q;  1EQR A;  3KJO A;  3GTM H;  2E2J H;  5M3M G;  3CAM A;  4X65 L;  2BA0 A;  4MZ9 A;  3U4Z A;  3H0G H;  4PG3 A;  3U50 C;  2DUD A;  5JEA J;  2HHH Q;  1PYS B;  1XJV A;  3HOV H;  3PV0 A;  5IE8 A;  3E9H A;  1N9W A;  3H3V H;  5M3M H;  2AHO B;  1JJC B;  1KL9 A;  4JI2 Q;  4GKJ L;  1CKO A;  2ZJR A;  1X3F A;  3S1N H;  1XTD A;  3KFU A;  2Q2T A;  4QQB X;  4YCV A;  4HIO A;  4NXM Q;  1WJJ A;  4AYB G;  3AQQ A;  2E8G A;  4P72 A;  4R4Q A;  2QEX A;  5LMN W;  4DAM A;  1Q82 C;  1OTC A;  2HHH L;  2QNC A;  4YCW A;  4BY1 G;  1VQN A;  4GKK Q;  2PQA B;  3RZD H;  1Q7Y C;  4QGU A;  4JCV E;  1GO3 E;  1UWV A;  1FGU A;  2NVY H;  4C3I H;  4DR5 Q;  1Q1E A;  3ERS X;  1V1Q A;  4BY1 H;  4P75 A;  4OWX B;  3MXN B;  1YEZ A;  3UDF A;  1QZH A;  2AMC B;  2CCZ A;  4NXM L;  1FL0 A;  1KHI A;  3F2C A;  1SRO A;  1JJ2 A;  4B3R Q;  1EIY B;  4DUY Q;  4GKK L;  5EAY A;  1PH5 A;  1HJP A;  2L15 A;  4LUV A;  1VQF A;  4DR5 L;  2DGY A;  4LUO A;  2Y0S E;  3KF6 A;  1NMG A;  4P74 A;  2I0Q A;  3CCV A;  1EUJ A;  3TRE A;  5FLM H;  2UXC L;  1PA6 A;  3STB D;  2JA8 G;  2F52 A;  4P71 A;  4JI5 Q;  1HNZ L;  4B3R L;  3RR5 A;  4DR6 Q;  4YWM A;  3I2Z A;  2OWO A;  4GNX A;  3HKZ E;  1UE6 A;  2JA8 H;  3TS0 A;  1UE5 A;  3J80 c;  1UE7 A;  5IT9 c;  1C0A A;  4TVA B;  1G51 A;  3M4Q A;  5IYC G;  3CCR A;  4GOP B;  3S14 H;  3CMA A;  1XNR Q;  3CP0 A;  2XTI A;  1KRS A;  4JI1 Q;  1JB7 A;  1XPR A;  2K5N A;  1I5F A;  5IYC H;  1PFS A;  4QL5 A;  4LNQ A;  4C3H H;  3KF8 B;  1YHA A;  4BBS H;  4GN5 A;  2JA7 G;  2NVQ H;  1HZB A;  1X3E A;  2Z6K A;  3CC4 A;  3S1M H;  1CKN B;  5M3F G;  3ULP A;  2Q2U A;  3CCQ A;  1EN7 A;  1N33 Q;  1KAW A;  2JA7 H;  4JI1 L;  3U4V A;  1PH4 A;  4JYA L;  2IHE A;  1D8L A;  2H5X A;  4UP8 A;  3OTO L;  4X64 L;  5M3F H;  1IXR A;  2OQ0 A;  2VQE Q;  1VQ7 A;  4DV3 Q;  4DR7 Q;  5JEA G;  3Q8D A;  4L5T A;  3H15 A;  5HGQ A;  1XNQ Q;  4HIM A;  4JV5 Q;  1N33 L;  3PF5 A;  3AEV A;  4AQY Q;  3EN2 A;  3SGI A;  1SN8 A;  3CCM A;  4L5R C;  2NVT H;  3MEF A;  5IWA Q;  4OO1 G;  3PO3 G;  1N36 L;  2VQE L;  4DR7 L;  2AWO A;  1N32 Q;  1AE3 A;  4YCU A;  3BU2 A;  1TWH H;  1VQK A;  2JE6 I;  1XNQ L;  3OYY A;  1WCM G;  1Z47 A;  2GN5 A;  3HFZ B;  2BH8 A;  2XGT A;  3I7F A;  4AQY L;  4ME3 A;  1QUQ A;  3S2D H;  1LUZ A;  2ZM6 L;  2WP8 J;  4QIW E;  1HR0 Q;  4DR1 Q;  5IWA L;  1WCM H;  1X65 A;  4A3I G;  1NBW A;  4LF6 L;  4DPG A;  3GTO H;  1EOV A;  1IYJ B;  3KJP A;  4DV5 Q;  1VQI A;  2KCT A;  3KLW A;  4GLA C;  1KRT A;  1VQM A;  4LF5 Q;  1W2B A;  1L1O C;  4IPC A;  5JJK A;  2JJQ A;  4DV4 Q;  2UUB Q;  4A3I H;  1NJI C;  4L5S A;  2N3S A;  1YVC A;  3T1Y L;  3F2D A;  2D0O A;  1YZ6 A;  4DR1 L;  3A5U A;  1HR0 L;  3STB C;  5IP9 G;  4X66 L;  3L0O A;  3EBE A;  2BA1 A;  3FKI H;  1FJG Q;  4LFC Q;  3UE1 A;  4DV5 L;  3F2B A;  1G29 1;  4LF5 L;  1G6P A;  3GTP H;  4A3L G;  4BBR G;  1KQS A;  4HJ9 A;  3UDG A;  3S1R H;  2GVB A;  4JOI C;  1VQG A;  4DV4 L;  2UUB L;  1E3P A;  3E9I A;  4R4C A;  4EQ5 A;  3K80 C;  4UP9 A;  5IY0 A;  4A4I A;  4JBW A;  3OW2 A;  3AYH B;  2IX1 A;  5GAD C;  4LF8 Q;  3PIP A;  1W3S A;  1VS0 A;  3T1H L;  4BBR H;  1M90 C;  3CC2 A;  4LF4 Q;  3H3V I;  3RZO H;  3RLF A;  5LMN Q;  4BY7 G;  3RN5 A;  4YWL A;  4DV0 L;  1FJG L;  2YTY A;  3AFQ A;  3B6Y A;  4PMW A;  1I94 L;  1R9T H;  3GTQ H;  5C0X G;  2WFW A;  1VQ8 A;  1YJ9 A;  4PZ6 A;  1Q86 C;  2Q2H A;  5C44 G;  4LF4 L;  4LF8 L;  3ICE A;  2HIV A;  5LMN L;  3G71 A;  1PYB A;  4DUZ L;  3FHW A;  1O7I A;  2R93 H;  3CC7 A;  4KLK A;  4DV7 Q;  1KC8 C;  2JK8 A;  5C44 H;  1CSQ A;  2JEB I;  4X62 Q;  1WYD A;  1QVC A;  4HID A;  2R7F A;  3ULJ A;  3G6E A;  1K8A C;  3CCL A;  4IOC A;  1N8R C;  4KHZ A;  2R92 G;  4OX9 Q;  4JI7 Q;  3DLL A;  4DV7 L;  1EWI A;  3CXC A;  2YTV A;  3RLN A;  2ZTE A;  1VQD A;  3W1G A;  4X62 L;  4NB3 A;  2OCE A;  2R92 H;  1HZC A;  3CQZ H;  3LGJ A;  4LFA L;  2UXC Q;  1Q1B A;  2KBN A;  1HNZ Q;  5C3E G;  2V1C C;  5JJL A;  4GNX C;  1S40 A;  4ALP A;  3J81 c;  3KDF B;  4IJL A;  3S15 H;  5FLM G;  4OX9 L;  4JI7 L;  3CPW A;  3HKS A;  3GTJ H;  3BZC A;  2NVX H;  5C3E H;  1ASZ A;  1E7D A;  1AE2 A;  3HOZ G;  1D7Q A;  3PUY A;  3DM3 A;  1GD7 A;  3L2P A;  1VQO A;  2Z0S A;  3KOJ A;  1L1O B;  3J81 i;  1NY4 A;  1VQE A;  3UDI A;  4DAY B;  3F1Z A;  4L5Q A;  4B3T Q;  3J7Z C;  3CCJ A;  3HOZ H;  1I3Q H;  4B3S L;  3RN2 A;  2ZTD A;  3ER0 A;  4JI8 Q;  2Z6K C;  3W5O A;  2VZA A;  2N8N A;  4LW1 A;  3VDY A;  1VQ9 A;  1C9O A;  1EQQ A;  1Y14 B;  2CKZ B;  2MO0 A;  2E2I H;  3M85 A;  4BBS G;  1HZ9 A;  1B8A A;  1QVF A;  2VNU D;  2R7D A;  2RCN A;  1PHJ A;  4B3T L;  4JYA Q;  4J15 A;  4MTN A;  3OTO Q;  4MNO A;  1VQC A;  3A5Z B;  3J80 i;  4X64 Q;  4DR3 L;  1YJW A;  4A3C G;  2CFM A;  3NEL A;  5C0X J;  5AJ3 Q;  5J3B A;  1OXX K;  4JI8 L;  3G4S A;  1IBL Q;  1K8G A;  4R1J A;  4A3C H;  4A3K H;  4OON A;  2VUM H;  1X55 A;  1K0R A;  3GDE A;  1IBK Q;  5JJI A;  4DR2 Q;  2I5H A;  1VQ5 A;  3PUV A;  1MKH A;  1V9P A;  1SLJ A;  1NMF A;  3M9B A;  1X56 A;  4JBJ A;  4RG1 A;  4JI4 L;  3M3Y H;  2WAQ G;  3NEM A;  2MFI A;  5AJ3 L;  1N36 Q;  1N34 Q;  1PVO A;  1BVS A;  4BA1 I;  3BZK A;  4DK3 C;  1IBL L;  5C4X H;  4K0K L;  4OO1 I;  1H95 A;  4Y7N H;  3PUX A;  1A63 A;  1KD1 C;  1IBM Q;  1A62 A;  1ASY A;  1IBK L;  2E5L L;  5IP7 G;  4DR2 L;  5M5X H;  1K83 H;  1YI2 A;  2ZM6 Q;  1X54 A;  1PV4 A;  3ULL A;  5C4J H;  1AH9 A;  1Q8K A;  2A1A A;  5DLQ E;  4A3D G;  1N34 L;  5IP7 H;  5GAE C;  4LF6 Q;  3K81 C;  3I56 A;  4NXN Q;  2ZJP A;  2D0P A;  4R4T A;  1IBM L;  2JA6 G;  1E22 A;  1CUK A;  1X6O A;  4HJ8 A;  3KF6 B;  3IRB A;  4BA2 I;  4A3D H;  4JI3 Q;  3T1Y Q;  3RLO A;  3CME A;  1P8L A;  3PCO B;  3CD6 A;  4OXP A;  2JA6 H;  2JA9 A;  1MIU A;  1U5K A;  3K8A A;  4X66 Q;  3K7A H;  4GNX B;  1HNX L;  1HNW L;  4NXN L;  2K75 A;  4AYB E;  4A3B G;  4GLV B;  4IJH A;  5HY6 A;  2MNA A;  4A93 H;  1S72 A;  1OXV A;  3FKI G;  1SRU A;  1YNX A;  2NZH A;  2VL6 A;  3CPF A;  4JI3 L;  4A3B H;  1TWA H;  3T1H Q;  3M4P A;  3K7U C;  3HKZ G;  5ELN A;  3UE0 A;  4DV0 Q;  3TEH B;  5IYB H;  2N49 A;  1L2F A;  2IY5 B;  4OWW B;  2PNH A;  1U0L A;  1I94 Q;  3HOW H;  3PO2 H;  4BXX G;  1VQL A;  1YIJ A;  1JT8 A;  2PQA A;  3CCU A;  1VQB A;  1J5E L;  4JBM A;  1Y1W G;  1IL2 A;  5C0X I;  2HIX A;  4WJ4 A;  4BXX H;  2HQL A;  3PF4 A;  1E7L A;  3KYH C;  4DUZ Q;  1NTG A;  2IHF A;  2I5L X;  1Y1W H;  2JEA I;  4JI0 L;  1PH8 A;  3M4O H;  1P16 A;  2UU9 Q;  4IPD A;  2R93 G;  1S3O A;  2FXQ A;  4EX5 A;  4UY8 C;  4HJ5 A;  3I4O A;  3NEN A;  2UXB Q;  1SFO H;  4KHP L;  3I4M G;  4B3M L;  3GTG H;  1B7Y B;  1LM0 A;  5H1S E;  4LF9 Q;  4DNI A;  3E0E A;  2ZTC A;  1VQH A;  1HZA A;  2K14 A;  4LF7 L;  4A3F G;  4HIK A;  1UEB A;  1YHB A;  3I4M H;  4A3J G;  2IT1 A;  4O2D A;  1HH2 P;  2UU9 L;  1IZ6 A;  2QGQ A;  4QY7 A;  4LFA Q;  4DV6 L;  1VQ4 A;  1PH2 A;  2HJQ A;  2EXD A;  1KXL A;  2K4K A;  4A3F H;  2UXB L;  4A76 A;  3HOX G;  1B70 B;  1QUQ B;  2K5H A;  4A3J H;  1YIT A;  4LF9 L;  1OXT A;  4KI0 A;  2F3I A;  4GOP A;  2B29 A;  4APV A;  2LXJ A;  3AFP A;  3J7A 5;  1XPU A;  3PUW A;  3UDX A;  3HOX H;  2UXD L;  4NPS A;  1E24 A;  1E1T A;  4AIM A;  1BBW A;  2WAQ E;  4DR4 Q;  2WB1 G;  3S2H H;  1T9H A;  2YU9 H;  1CKN A;  4GS3 A;  2JQO A;  4B3S Q;  2EIF A;  2EQS A;  2LXK A;  1BKB A;  3GTL H;  2IX0 A;  3G48 A;  2F4V L;  3HOY G;  4GN4 B;  4XIG S;  1JMC A;  2BH2 A;  3PSI A;  4HJA A;  1Y1V G;  2LSS A;  2ASB A;  3CCS A;  2RHQ B;  2QA4 A;  4JI6 Q;  1NE3 A;  2NN6 I;  3GTK H;  3JAM c;  2OQK A;  1GM5 A;  2RF4 A;  2CWA A;  2OTL A;  3HOY H;  3TRZ A;  3JC6 6;  4JI2 L;  4DR4 L;  1SR3 A;  1JJG A;  1Y1V H;  2HT1 A;  4A75 A;  1VQA A;  4DR3 Q;  3D0F A;  4POF A;  1TWG H;  4DV1 Q;  5GAG C;  2NN6 G;  2YYZ A;  3FP9 A;  4PZ8 A;  1EYG A;  2D62 A;  3JAM i;  4A3M G;  2A8V A;  5BR8 Q;  1YHQ A;  4JI6 L;  1PH6 A;  2B63 G;  2A19 A;  1YJN A;  1LYL A;  4DK6 C;  1QZG A;  2Q2I A;  3PGZ A;  4A3M H;  1I6H H;  4A3K G;  2VUM G;  4YWK A;  4GLX A;  2YTX A;  2B63 H;  4DV1 L;  2MQH A;  4A3G G;  4IFD I;  1SMX A;  1MJC A;  3I55 A;  5FJ8 G;  2B3G A;  4K0K Q;  3RNU A;  5BR8 L;  5FLX c;  4A3E G;  1WFQ A;  4H02 A;  1XPO A;  4DUY L;  1M1K C;  1A8V A;  5GRO A;  2CWP A;  2E5L Q;  4A3G H;  3CF5 A;  2E2H H;  2R7Z G;  4IFD G;  1E1O A;  3GO5 A;  5FJ8 H;  4IO9 A;  5C4X G;  4R4I A;  4R4O A;  3TQY A;  4A3E H;  2OTJ A;  2PI2 E;  1Q81 C;  4XTC S; 
#chains in the Genus database with same CATH topology
 4MTK A;  4OWT B;  2E75 C;  4K6L A;  3WWV A;  2KHI A;  3NHH A;  1VF5 C;  1FGB D;  1XXG A;  1CSP A;  1SNM A;  1DCZ A;  3W1B A;  5E7N A;  1WI5 A;  3NTK A;  3MZ5 A;  3S17 H;  1GUW A;  4DF7 A;  1HNX Q;  1WOC A;  3I73 A;  1XNR L;  3I4N G;  1KTK A;  1RKN A;  5IYD G;  1I4G A;  1SE4 A;  2DJF C;  3S1Q B;  1MJE A;  5F2D A;  1EQT A;  5IGD A;  1VCI A;  1PTO H;  1TVX A;  3OW7 A;  3WDN A;  4YY3 Q;  2Y0S G;  4QJF A;  1I50 H;  4IOA A;  3VYU A;  3OHX C;  1L0W A;  4DV3 L;  1WD1 A;  2AWN A;  4POG A;  5CV5 A;  2F0M A;  2KEN A;  2WB1 E;  5D65 A;  1SYG A;  2YV5 A;  1N32 L;  1ET9 A;  1HTP A;  2TMP A;  2XWJ B;  2J4X A;  4F88 A;  1KDC A;  1TWC H;  3KDF A;  4DK1 A;  1CQF A;  1LTL A;  3A8I E;  1B3A A;  4I65 A;  1V1O A;  3KLS A;  4GOP C;  1VQ6 A;  4RMF A;  2KHJ A;  2WIN B;  3FRP B;  3PUZ A;  4DKA C;  2MUY A;  4KN4 C;  2WII B;  1ONL A;  1TWF B;  2WKC A;  2QDL A;  4IPH A;  4I7A A;  4EQP A;  2JA5 H;  1GVP A;  2K52 A;  1VQJ A;  2KA7 A;  1PH1 A;  1EFI D;  1X9N A;  3HOV G;  1OXS C;  4KD4 A;  3VR2 A;  3HG9 A;  4JOI A;  5CV8 A;  2F4V Q;  2B2V A;  3H91 A;  3HOV B;  4K2K A;  3CAM A;  4X65 L;  1GUG A;  2BE5 C;  4PG3 A;  5JEA J;  3PV0 A;  5IE8 A;  1N9W A;  1VDZ A;  4ZUJ A;  1DYQ A;  1T5E A;  1DZ1 A;  1X3F A;  3S1N H;  2Q2T A;  4QQB X;  1WJJ A;  3AQQ A;  4I7Z C;  3RZD B;  4P72 A;  4DAM A;  2E2D C;  1Q7Y C;  4C1N K;  4QGU A;  2DN8 A;  2NVY H;  4DR5 Q;  5EPJ A;  2EE1 A;  4P2C B;  1FL0 A;  1GL9 B;  2K05 A;  4KV6 A;  1I6V C;  5EQ0 A;  1G6Z A;  4LUO A;  5A35 A;  3KF6 A;  4XQQ A;  3MEH A;  5FLM H;  2UXC L;  1HNZ L;  3EFX D;  4YWM A;  3I2Z A;  1RTN A;  1UE6 A;  2DY8 A;  5CV7 A;  5IYC G;  3CCR A;  1ET6 A;  3OSO A;  3CMA A;  4G7O C;  1GJX A;  4QL5 A;  3DEP A;  5I2X A;  4C3H H;  3S1M B;  1RF2 D;  3KF8 B;  1FR3 A;  1OO9 B;  2NVQ H;  1SDF A;  4J8Q A;  1X3E A;  2B39 A;  1U4L A;  2A68 D;  1LLR D;  2JA7 H;  4JI1 L;  4JYA L;  1D8L A;  2H5X A;  4X64 L;  2PYK A;  1IXR A;  4R8N A;  1O7Z A;  2WAQ B;  1VQ7 A;  1D2B A;  3Q8D A;  4H44 C;  2XN9 C;  1NNX A;  5HGQ A;  2NVT B;  5E4X A;  1N33 L;  3AEV A;  3K57 A;  1IHZ A;  1V8Q A;  1WTP A;  3PO3 G;  2F0W A;  4OIJ A;  3SR1 A;  2VQE L;  2AWO A;  2L12 A;  1BCP B;  4FF2 A;  3BU2 A;  1VQK A;  1QCB D;  3AMU A;  4OO1 H;  1XNQ L;  5JPN C;  3OYY A;  4Q0F A;  3HFZ B;  1ZYR C;  4JW0 A;  1PRT F;  1LUZ A;  1WVL A;  4IUT A;  4XQN A;  3GTO H;  5C5L A;  1VQI A;  4GLA C;  1VQM A;  1SBB B;  3DHQ A;  4IPC A;  1H9S B;  1K3B C;  4EQN A;  3T1Y L;  4K5X A;  2CW0 C;  3DEO A;  1HRJ A;  1V66 A;  2EYF A;  2IW3 A;  3EBE A;  4LFC Q;  1W6J A;  3UE1 A;  4DV5 L;  1STH A;  4LF5 L;  2Z9H A;  4BBR G;  1KQS A;  4HJ9 A;  3S1R H;  2GVB A;  4JOI C;  1VQG A;  4BBR B;  4DV4 L;  1NR4 A;  2UUB L;  3OW2 A;  3U58 A;  3RZO B;  3K80 C;  2EY5 A;  4UP9 A;  2IJ0 A;  1M90 C;  1ZKO A;  3H3V I;  1JC7 A;  2L4N A;  4BY7 G;  2KEC A;  4R8I A;  3MWY W;  1HHV A;  1DOM A;  1I94 L;  5C0X G;  3MHB A;  1I4R A;  1VQ8 A;  1YJ9 A;  4KY6 A;  1UEA B;  4LF4 L;  2R93 H;  3FHW A;  1O7I A;  1Z6H A;  4FXD A;  2KUM A;  3VYS A;  4DV7 Q;  5EBC A;  1KC8 C;  5C4H A;  1B44 D;  5C44 H;  3NTI A;  1WYD A;  5L37 A;  5I6Y A;  2K6A A;  4HID A;  2R7F A;  2XWB B;  1EYD A;  5BN4 A;  1X3P A;  4KHZ A;  2IX3 A;  1W6K A;  4KD3 A;  2MP1 A;  4DXF A;  4JI7 Q;  1IW7 D;  1LV9 A;  2DJG C;  2X69 A;  4WRD A;  3RLN A;  4CDE C;  4X62 L;  1VQD A;  2OCE A;  1C4Q A;  3CQZ H;  5KGU A;  3S15 B;  1Q1B A;  2FJ2 A;  2KBN A;  1II3 A;  3Q24 A;  5FK9 C;  2ICE C;  4CHT B;  1BQQ T;  4OX9 L;  2RKS A;  3CPW A;  2HQE A;  2NVX H;  5JVG 3;  1E7D A;  1MBY A;  1AE2 A;  3HOZ G;  3K5N A;  1CFM A;  1PMR A;  4ZK9 B;  1D7Q A;  3DM3 A;  3HOZ B;  3BYT B;  3J81 i;  3J81 E;  4DAY B;  3C3L A;  2F0D A;  3F1Z A;  3CCJ A;  2LY7 A;  1QWY A;  4HSP A;  2Z6B A;  4LW1 A;  3VDY A;  2K28 A;  1C9O A;  4HCE A;  1U4R A;  1ZXT A;  3NTH A;  4X3U A;  3K58 A;  4BBS G;  1HZ9 A;  1QVF A;  1S5B D;  3AB9 A;  2RCN A;  1SNP A;  2DNE A;  3OTO Q;  4A3C G;  3J80 i;  1YNS A;  3J80 E;  1H9K A;  5AJ3 Q;  5J3B A;  3NP8 A;  1ENC A;  4OON A;  2VUM H;  3PUV A;  2KW9 A;  1SLJ A;  5D3I B;  1X56 A;  2EXZ A;  2MFI A;  5C4X B;  1H9S A;  1EQV A;  1FNV A;  3PIP 3;  4BA1 I;  5IGB A;  3BZK A;  4G57 A;  1K83 B;  4Y7N H;  1KD1 C;  1JCK B;  5C4J B;  4DR2 L;  5DM7 3;  1PV4 A;  1HA6 A;  1AH9 A;  2A1A A;  2FMC A;  4HR7 B;  3K81 C;  2JA6 G;  1IBM L;  1O7L A;  2B2U C;  2JA6 B;  4L6T B;  1XYI A;  3CD6 A;  1LTI D;  4ZUI A;  3K8A A;  4A93 B;  3S9W A;  4A3B G;  4AYB E;  3QKJ A;  4GLV B;  3NWT A;  1TWA B;  2R3Z A;  3OMG A;  1S72 A;  1SYC A;  1SRU A;  2JN4 A;  2VL6 A;  3CPF A;  3KBG A;  3K7U C;  3HKZ G;  5ELN A;  3T16 A;  3HKZ B;  4DV0 Q;  1JJR A;  2OT2 A;  4OWW B;  1EWC A;  1CZG A;  2QCP X;  3FPU B;  1J5E L;  1IL2 A;  4WJ4 A;  2RBM A;  3D4W A;  5E4W C;  3MXN A;  4B08 A;  1F2Y A;  4DXG A;  1NTG A;  2I5L X;  4ILW A;  1Y1W H;  2M00 A;  1SFO B;  5I4D A;  2FXQ A;  2K33 A;  1B7Y B;  1K8M A;  1HZA A;  1VQH A;  4ZLT F;  5KYI A;  4A3F G;  4HIK A;  4U67 3;  2IT1 A;  2JA5 B;  2UU9 L;  1IZ6 A;  2K4K A;  4A76 A;  3HOX G;  1B70 B;  2K5H A;  4FXG C;  1YIT A;  2MPH A;  3HOX B;  2F3I A;  4KKU A;  1U4P A;  3J7A 5;  1CZW A;  3SK4 A;  3DWP A;  2UXD L;  2CQA A;  4NPS A;  3BVG A;  1SJH D;  4XQJ A;  4KN7 C;  1FD7 D;  3S2H H;  5ELD A;  2YU9 H;  4K14 A;  5EKL A;  1BKB A;  3G48 A;  4XIG S;  2F0K A;  4KKS A;  2SNS A;  3VR3 A;  2NVY B;  1BCP C;  2CWA A;  3TP5 A;  3Q6S A;  3TRZ A;  1PZK D;  1TWG B;  4DR4 L;  1JJG A;  1SR3 A;  4ZCK A;  2HT1 A;  1VQA A;  2I07 B;  2NN6 G;  5GAG C;  1TKW B;  5BR8 Q;  2NB0 A;  5FO9 B;  3GP7 A;  1PH6 A;  2A19 A;  3C1E A;  4DK6 C;  1QZG A;  4GLX A;  2G5D A;  2B63 H;  4DV1 L;  4IFD I;  2HUG A;  5FJ8 G;  4K0K Q;  2DY7 A;  3RNU A;  4CJ1 B;  4H02 A;  3OMC A;  1A8V A;  2E5L Q;  1EEI D;  2CWP A;  3C1F A;  3ERQ A;  4A3G H;  2E2H H;  4Q5V A;  4NW2 A;  1EU3 A;  4A3E H;  2EY2 A;  1KHC A;  1WTX A;  5E1F A;  1S5F D;  1SYD A;  1RIP A;  2R7Z H;  4IFD H;  4JI5 L;  1VQP A;  4H7B A;  4UP7 A;  2ES2 A;  1RDP D;  3C2P A;  4HJ7 A;  1ROD A;  4UPA A;  5KRU A;  3F8T A;  2PI2 A;  3M7N A;  4KTA A;  2JA7 B;  1HNW Q;  5J22 A;  1JE5 A;  2GVA A;  4X6A H;  5C3W A;  2AUK A;  1C48 A;  1YBY A;  1B53 A;  1TS2 A;  4C3J H;  5DM6 3;  1X3G A;  3K0Y A;  4JC0 A;  2FHT A;  4FDB A;  5ELO A;  4LFB L;  4IUU A;  1C7Y A;  3S16 B;  1BBU A;  2XVS A;  1ICF B;  3P1H A;  1EY6 A;  2D5D A;  3LNN A;  2RDF A;  3E0J A;  3H09 A;  2OEO A;  1K73 C;  5IYB G;  1XMQ L;  1LTG D;  2F0I A;  3HOW G;  3PO2 G;  1FVI A;  1PLF A;  1JWU D;  1T5X D;  5LMU L;  3BZD B;  3PO3 H;  4X3T A;  3L7Z C;  3HS0 C;  3BVM A;  4L63 B;  5KIX A;  2CQO A;  1AW7 A;  4CJ0 B;  1A2T A;  1UE1 A;  5M5Y H;  2QDB A;  2EY1 A;  4B3M Q;  3IFT A;  4JG2 A;  2L9H A;  1KIX A;  2F0Q A;  4IFD J;  1DGS A;  5NUC A;  5CBE E;  1WD0 A;  3R3O A;  3QO2 A;  2ZXP A;  1XMO L;  4QCL A;  1EY8 A;  2XNA C;  1GKH A;  1J6Q A;  1F2Z A;  1F9P A;  3HOU H;  4C2M B;  2VS1 A;  4X65 Q;  3DWA A;  5M5W H;  4YHH L;  3D8G A;  1AN8 A;  3CCE A;  2R61 A;  3GTM B;  1JEQ A;  2A69 C;  4TKO B;  4BY7 H;  2F4I A;  5GQO A;  1F2L A;  2E2J H;  4ABN A;  5M3M G;  2F0J A;  3H0G H;  3A56 A;  5IOD A;  1PYS B;  1XJV A;  2QKI C;  2AHO B;  3A54 A;  3D4R A;  1IYU A;  2KED A;  4B9W A;  4QIW B;  2ZJR A;  1SYF A;  3FEW X;  3MVV A;  4JVZ A;  3I4L A;  2WQG A;  5LHY 1;  1IKM A;  2HHH L;  4C3I G;  1Q82 C;  4RGM A;  1VQN A;  4C3I B;  1IL8 A;  1GUS A;  2PCF B;  4BY1 H;  1QB5 D;  4OWX B;  1QZH A;  2LD7 A;  1YEZ A;  1C8C A;  1BDO A;  1JJ2 A;  4X3S A;  5M9O A;  1EIY B;  4DUY Q;  5CV9 A;  4GKK L;  1PH5 A;  3P75 A;  1GHK A;  2L15 A;  4DAP A;  4ME5 A;  2DGY A;  2Y0S E;  1NAP A;  2PNR C;  2I0Q A;  3TRE A;  1TII D;  1PA6 A;  2F52 A;  1Y8O B;  2L55 A;  4DR6 Q;  1CM9 A;  1D1I A;  1K28 A;  1CI3 M;  1D1K A;  2JA8 H;  3TS0 A;  1U9R A;  2GA4 B;  2QF7 A;  1WTO A;  3S14 B;  1C0A A;  4TVA B;  3M4Q A;  1PRT C;  1STY A;  1LT3 D;  3CP0 A;  4JI1 Q;  1XPR A;  1SNC A;  1EWH A;  2A6E C;  1PFS A;  4LNQ A;  4BBS H;  1BCP F;  3VA5 A;  1HZB A;  1LO5 D;  2Z6K A;  1NR2 A;  2L5T A;  2BE5 D;  2O5J C;  1N33 Q;  1KAW A;  1QE6 A;  1QG7 A;  4Z9C B;  3U4V A;  2IHE A;  1CQV A;  5M3F H;  2BCO A;  1MHW C;  2OQ0 A;  2O5I C;  4ZYS A;  2VQE Q;  3Q22 A;  4L5T A;  4DU9 A;  2CVR A;  1XNQ Q;  4HIM A;  4JV5 Q;  2ENB A;  5JEA H;  3P7J A;  2IPK D;  3EN2 A;  4L5R C;  3LX0 A;  1LTR D;  1N36 L;  4YCU A;  1TWH H;  3G6J B;  2JE6 I;  2A6H C;  2BH8 A;  2XGT A;  4AQY L;  4ME3 A;  1QUQ A;  3S2D H;  1DJR D;  3OPO A;  5IWA L;  2DK4 A;  1WCM H;  3URY A;  5I9P A;  1KLU D;  2JVW A;  4LF6 L;  4DPG A;  4DV5 Q;  2KCT A;  3WOF A;  4LF5 Q;  4FF1 A;  5CYU A;  1W2B A;  4DV4 Q;  3EVQ A;  2UUB Q;  4A3I H;  1NJI C;  1YVC A;  1H9E A;  1J9O A;  3FKI B;  5C4Z A;  4DR1 L;  3A5U A;  1A3T A;  3KK7 A;  3L0O A;  2BA1 A;  3Q0A A;  2B2Y A;  3F2B A;  4M1U B;  4V19 0;  3GTP H;  1XTC D;  4R4C A;  3E9I A;  5IY0 A;  2IX1 A;  4A4I A;  4JBW A;  1BUV T;  3MXU A;  4ODG A;  1W3S A;  3T1H L;  3CC2 A;  4LF4 Q;  3RLF A;  1R9T B;  1EZ6 A;  3FDT A;  3RN5 A;  1FJG L;  2QW7 A;  3AFQ A;  3B6Y A;  3M4Y A;  4V0B A;  3GTQ H;  1ESR A;  2MGS A;  4CDF C;  3VYR A;  2HDM A;  1Q86 C;  2Q2H A;  4LF8 L;  3ICE A;  3MTS A;  3CC7 A;  3TP7 A;  1GHJ A;  3R93 A;  2JEB I;  4X62 Q;  4XYQ A;  3G6E A;  1K8A C;  3G7L A;  3CCL A;  1N8R C;  5JOB A;  1GXD C;  2MJ8 A;  3VYT A;  3TZU A;  2Q8T A;  2R92 G;  3OWE B;  4OX9 Q;  1UAP A;  3DLL A;  2R92 B;  1R4Q B;  3NPP A;  1ILP A;  2ZT9 C;  1ZYR D;  1KNE A;  3CXC A;  5KND A;  2V4D A;  1U4M A;  3W1G A;  1AEX A;  2F0N A;  2KVM A;  3LGJ A;  1BF4 A;  3A7L A;  1H1J S;  3GTJ B;  2V1C C;  4LMQ D;  4ALP A;  2KVE A;  5I9O A;  3NQI A;  4MHE A;  5C3E H;  3SVM A;  5D14 A;  2CW0 D;  4EVO A;  5KNC A;  5IT9 L;  1I3Q B;  1EIH A;  2Z0S A;  1L1O B;  4RKB A;  2I46 A;  5EGT A;  4B3S L;  2ZTD A;  1Q3L A;  3ER0 A;  2E2I B;  2Z6K C;  3H6M A;  1SXT A;  1SMY C;  3GV3 A;  1EY0 A;  1IKL A;  5J1Z A;  1BXT A;  1HUM A;  2R7D A;  1PHJ A;  4J15 A;  4MTN A;  4MNO A;  5EBD A;  3A5Z B;  1CHP D;  1PFN A;  5T1I A;  2CFM A;  4A3K B;  1OXX K;  3G4S A;  4A3G B;  3LWE A;  4WFN 3;  3GDE A;  4PMC A;  1M4V A;  3ERO A;  4DR2 Q;  4O42 A;  1NMF A;  3M9B A;  4JI4 L;  3M3Y H;  2WAQ G;  3N6R A;  3NEM A;  3TBI B;  1BVS A;  4OO1 I;  5M5X B;  1IBM Q;  3PUX A;  1IBK L;  1NCV A;  3HGB A;  3QR8 A;  5IP7 G;  1YI2 A;  2ZM6 Q;  1X54 A;  2F0S A;  1E2W A;  2RNO A;  4A3D G;  4IUR A;  2RA4 A;  2FIN B;  4A3D B;  5GAE C;  1YNN C;  1CT1 D;  4R4T A;  4RH6 A;  3J7A F;  4IQZ A;  1Q90 A;  3K7A B;  3RLO A;  4OXP A;  2HDL A;  1KDB A;  2JA9 A;  1MIU A;  1U5K A;  2EYJ A;  4X66 Q;  4GNX B;  1HNX L;  2B2Y C;  4R9W A;  2K75 A;  5HY6 A;  1OXV A;  2B2U A;  3D6C A;  1YNX A;  1HA5 A;  2Z4I A;  4HSV A;  3M4P A;  4LJZ C;  3K5M A;  3UE0 A;  2F0T A;  3TEH B;  2G9H D;  5IYB H;  1L2F A;  4XT3 B;  1U0L A;  4BXX G;  3HOW H;  3PO2 H;  1JT8 A;  3CCU A;  1X3Q A;  2HIX A;  1JOR A;  1I4X A;  2PMZ B;  1BR9 A;  2HQL A;  1AZQ A;  4DUZ Q;  2JEA I;  2C9O A;  1PH8 A;  1HFG A;  1B9M A;  3M4O H;  2UU9 Q;  1S3O A;  2LKV A;  3R8B A;  4HJ5 A;  3I4O A;  3NEN A;  3I4M G;  2RNN A;  1LM0 A;  3GTG H;  1RCV D;  3I4M B;  4DNI A;  1AFP A;  2ZTC A;  1I4H A;  4A3J G;  4OHJ A;  2JYO A;  4QY7 A;  4A3J B;  5CV4 A;  4LFA Q;  2NBF A;  2UXB L;  1SND A;  1OXT A;  2IWH A;  2LMC B;  4APV A;  4IUP A;  1HFN A;  1E1T A;  3KF8 A;  2KEE A;  4DR4 Q;  2CH4 A;  2G9D A;  4UAI A;  4GS3 A;  1PDQ A;  3L9A X;  1RD9 D;  2IX0 A;  3NBI A;  2F4V L;  2KCC A;  3GTK B;  4KY5 A;  3HOY G;  2AQ3 B;  1JOK A;  3HOY B;  1HTL D;  3UI2 A;  2RHQ B;  3OIP A;  5IIF A;  2OQK A;  5ELB A;  2ODC I;  2RF4 A;  3JC6 6;  2SNM A;  1Y1V H;  3I91 A;  2K7V A;  4DR3 Q;  3SHL A;  1XX8 A;  3T53 B;  4POF A;  1A3V A;  4DV1 Q;  1EYG A;  2YYZ A;  3VR4 A;  2D62 A;  3ND9 A;  4DGZ A;  5AFW A;  2OXP A;  4CBV A;  4JI6 L;  2MPM A;  1VF7 A;  4A3M H;  3PGZ A;  1I6H H;  2M9V A;  1JEI A;  1Y02 A;  4YWK A;  2RDG A;  1VMP A;  1Z7T A;  2B3G A;  5FLX c;  2EVB A;  3BS1 A;  4IN3 A;  1M1K C;  1LTB D;  3HZX A;  4IO9 A;  5C4X G;  4R4I A;  1L0Y B;  1S5D D;  2PI2 E;  1CA6 A;  1EZ8 A;  4XTC S;  5EKI A;  3PQI A;  5DEH A;  1Z9F A;  4F87 A;  1X32 A;  3GD7 A;  2C5C A;  5CMD A;  3S17 B;  3PIO A;  3WOE A;  4ID6 A;  4LFB Q;  4IUQ A;  4K8J A;  1OXU A;  4QB4 A;  1LAB A;  5M3F B;  1LT4 D;  2UUC L;  1WTH A;  5A2Q L;  4TQU S;  1PTO B;  1TR5 A;  3KUP A;  3SK6 A;  1K8O A;  1V1P B;  2R6G A;  5EPL A;  1XMQ Q;  1PH9 A;  3I4N H;  3J7A V;  1TQO A;  3S1Q H;  4A93 G;  5IYD H;  2Z8L A;  3EIV A;  1RL2 A;  4HAE A;  3BJU A;  5LMU Q;  1YNJ C;  1TT2 A;  1I50 B;  1SE3 A;  4LUZ A;  1BCP D;  4MN3 A;  4OEM B;  2SDF A;  2C35 B;  4Y52 H;  2ZJQ A;  1CKM A;  4RCO A;  3S2D B;  4IZ8 A;  1S5C D;  3KLS X;  2K5Q A;  1EYC A;  5GAH C;  5IGC A;  2ZXO A;  4GN3 B;  1JOQ A;  3NBH B;  4JI0 Q;  2N78 A;  5K36 G;  1HCZ A;  3A74 A;  2SOB A;  2VQF L;  1XMO Q;  2HD3 A;  3A0J A;  4KHP Q;  2ATW A;  4DN4 M;  1TWC B;  2F0O A;  4ZRZ A;  3X3N A;  4PZ7 A;  3S24 A;  2F0E A;  4LF7 Q;  4WJW A;  4YHH Q;  4WJ3 M;  3MA2 B;  4DV6 Q;  4DV2 L;  3J81 j;  2UUA L;  2AKW B;  1EIF A;  1JQY D;  2KHS A;  3U9S A;  5C3X A;  3RUZ A;  4DAY A;  1E7Z A;  1XWE A;  2JA5 G;  4JBK A;  2K50 A;  4ZAI A;  3ONA B;  4K6D A;  4O0A A;  1SYE A;  4KY7 A;  4LFC L;  3X3M A;  1A0I A;  1TWF H;  3TS2 A;  4MZ9 A;  2EYO A;  3U4Z A;  2HHH Q;  3U50 C;  3QJY A;  3HOV H;  2A74 C;  1JE4 A;  3E9H A;  3S1N B;  1WTW A;  1Y8P B;  1JJC B;  1KL9 A;  3E6Z X;  4JK1 C;  1CKO A;  2EJG C;  4JI2 Q;  4FXK C;  3JAM L;  4GKJ L;  1XTD A;  4YCV A;  2B2T C;  4HIO A;  4AYB G;  2LS0 1;  2F0F A;  3MC0 B;  3MXP A;  1KNA A;  4R4Q A;  4AYB B;  5HGT A;  2QNC A;  4YCW A;  3IKJ A;  4GKK Q;  2PQA B;  3RZD H;  4JCV E;  1UWV A;  3ERS X;  1V1Q A;  1I4Q A;  3UDF A;  4NXM L;  2AMC B;  1FNW A;  2XRS D;  3F2C A;  1SRO A;  3FPP A;  5EAY A;  4LUV A;  1NMG A;  2F3W A;  4P74 A;  3CCV A;  2XRQ D;  2RCF A;  4U68 A;  4P71 A;  3T51 B;  1H9J A;  4B3R L;  2K32 A;  2OWO A;  4ULL A;  2EOT A;  4O1N A;  1D5X C;  1MD2 D;  1NUC A;  1ZBH A;  1MSG A;  5EKK A;  1UE5 A;  1DOL A;  3J80 c;  2L0C A;  5IT9 c;  4GOP B;  4C3H G;  1XNR Q;  3J7Y W;  1KRS A;  2Z4H A;  4C3H B;  2NVQ B;  5IYC H;  3ZYY X;  2A69 D;  4GN5 A;  2JA7 G;  1UUP A;  4FNF A;  3P20 A;  3CC4 A;  3S1M H;  1CKN B;  2B8G A;  2W51 A;  3I70 A;  5EPK A;  5BN5 A;  1PH4 A;  4UP8 A;  3OTO L;  3QOJ A;  3LLR A;  4MIU A;  4DV3 Q;  5CC4 A;  2HCC A;  3H15 A;  3TP6 A;  4N9P A;  1SE2 A;  4AQY Q;  5COY A;  2N55 A;  1QIL A;  3TME A;  2K03 A;  3CCM A;  2NVT H;  3I72 A;  5IWA Q;  4OO1 G;  1EEF D;  3CKI B;  4DR7 L;  2SEB D;  2JP1 A;  1N32 Q;  3CRK C;  1DOK A;  4XYO A;  1Z47 A;  2GN5 A;  3I7F A;  5JPM C;  1DD2 A;  2WP8 J;  4QIW E;  3GTO B;  4DR1 Q;  4RA8 A;  1X65 A;  1IYJ B;  3KJP A;  1KRT A;  3KLW A;  3VA7 A;  4OL7 A;  2N3S A;  1J8I A;  3F2D A;  3L3O C;  2D0O A;  1HR0 L;  5IP9 G;  5JAV A;  2NWG A;  3D3R A;  3GQB A;  1FJG Q;  3FLG A;  3S1R B;  1PRT D;  1H9R A;  3A8K E;  4A3L G;  2KOL A;  3VR6 A;  1DXM A;  2EJM A;  1SNQ A;  1BO0 A;  1E3P A;  4EQ5 A;  2A6E D;  3VR5 A;  3AYH B;  5GAD C;  4LF8 Q;  4QUC A;  1F9R A;  5E3F A;  4BBR H;  5IGF A;  3RZO H;  5K5P A;  2BDN A;  4DV0 L;  3EA6 A;  3O13 A;  2WFW A;  1EL0 A;  4JPB W;  2R93 B;  3BDL A;  5C44 G;  5C0X H;  5LMN L;  5C44 B;  1PYB A;  2RVL A;  1STN A;  4FF4 A;  2JK8 A;  4EGV A;  2X6L A;  1CA5 A;  3W2D A;  2FFK B;  1A3U A;  4IOC A;  3I8Z A;  1GOZ A;  1QJO A;  2JSO A;  4FYD A;  3CQZ B;  2KFV A;  3PMF A;  2A6H D;  1EWI A;  1PTO C;  4NB3 A;  1LAC A;  3HRZ C;  2UXC Q;  4KJO A;  2JXM B;  1HUN A;  1HNZ Q;  1DON A;  5JJL A;  2NVX B;  1S40 A;  3S15 H;  3KDF B;  4IJL A;  5FLX L;  3BZC A;  4BS9 A;  1ASZ A;  2PZT A;  1ICW A;  1K0S A;  1VQO A;  1NY4 A;  1VQE A;  1AZP A;  4L5Q A;  1GUT A;  3HOZ H;  3T56 B;  4RHR A;  5I6W A;  3W5O A;  5HUR A;  4HMI A;  2N8N A;  5DAU A;  1EQQ A;  2CKZ B;  2G80 A;  3CU7 A;  1JIC A;  3M85 A;  1EOT A;  1CK1 A;  4JYA Q;  4B3T L;  4JI4 Q;  1VQC A;  1YJW A;  4X64 Q;  5C0X J;  3NEL A;  5COR A;  2VUM B;  4JI8 L;  4GZY C;  1G2T A;  1K8G A;  1E2V A;  4J6H A;  3D6W A;  4R1J A;  4A3C H;  1KAB A;  1IBK Q;  2NTS A;  1SEB D;  4KMU C;  2I5H A;  4JBJ A;  1I4P A;  1V9P A;  2PW7 A;  3I3C A;  4F8M A;  1NSN S;  2PPB C;  4Y7N B;  3RMH A;  3HEJ A;  1IBL L;  5C4X H;  1EY9 A;  4K0K L;  3F2U A;  1ZS9 A;  3TP8 A;  2E5L L;  3MXG A;  4CDC C;  1EYA A;  1K83 H;  2AQ1 B;  4LAA A;  5C4J H;  1LT6 D;  3H94 A;  2N88 A;  1N34 L;  4LK1 C;  2L1B A;  3I56 A;  2D0P A;  3LWU A;  3I4N B;  4BA2 I;  3KF6 B;  4L8J A;  3T1Y Q;  3BYY B;  3PCO B;  2JA6 H;  1DM0 B;  3OWF A;  1TY0 A;  1HNW L;  5I2Y A;  4NXN L;  3NXW A;  4IJH A;  4A93 H;  1JB3 A;  2Y0S B;  4NDX A;  3FKI G;  4JI3 L;  4A3B H;  1TWA H;  2WAC A;  1SSO A;  4KJN A;  2LC3 A;  4DA2 A;  4DFA A;  3C46 A;  1WTQ A;  1B3Q A;  1SMY D;  2N49 A;  4N9T A;  4PV1 C;  2PNH A;  1I94 Q;  3TDQ A;  1Y1W G;  1EY7 A;  1MI2 A;  1Y1W B;  3DXJ C;  5K36 H;  3PF4 A;  4N8X 1;  2IHF A;  1ZEQ X;  4G7H C;  1KLG D;  1P16 A;  3BVZ A;  2UXB Q;  1SFO H;  4B3M L;  4OGQ C;  4PQX A;  2QEJ C;  3FMC A;  4H13 C;  2K14 A;  4WOR A;  1UEB A;  1YHB A;  5G3L F;  3TSS A;  1Y69 U;  1HH2 P;  1VQ4 A;  4CKE A;  2HJQ A;  2EXD A;  4A3F H;  4UHV A;  1RJT A;  4LF9 L;  1YNN D;  4KI0 A;  2LXJ A;  3EQL C;  3AFP A;  1XPU A;  3J81 L;  3UDX A;  3HOX H;  3AU7 A;  4OEL B;  3S2H B;  1E24 A;  5D3D A;  2YU9 B;  3A55 A;  2WAQ E;  5J39 A;  1QNK A;  2WB1 G;  3NSW A;  2WB1 B;  2JQO A;  2EIF A;  2EQS A;  3GTL H;  4ZKC B;  4RCN A;  1EY4 A;  2BH2 A;  2ASB A;  3J80 L;  1PZI D;  3CCS A;  2QA4 A;  4FVM A;  1NE3 A;  2NN6 I;  4JI6 Q;  3JAM c;  1HXY D;  2P5Z X;  4G7Z C;  5IGE A;  2B8F A;  2PW5 A;  3V05 A;  2NUC A;  1TWG H;  3FP9 A;  3IL8 A;  2A8V A;  1YHQ A;  2B2W C;  2B63 G;  1B4O A;  2NN6 H;  3IFD A;  1YJN A;  4DAV A;  2B63 B;  1LYL A;  4A3K G;  3T4A C;  1ILQ A;  2MQH A;  4A3G G;  2EZV A;  4RAU C;  4BIT A;  2E2H B;  5EJW A;  4A3E G;  1XPO A;  1PTO F;  4UDU C;  4DUY L;  4IUN A;  4A3E B;  2R7Z G;  4IFD G;  1M8A A;  3GO5 A;  5FJ8 H;  2R7Z B;  3CHB D;  4R4O A;  3TQY A;  2J7Z A;  2OTJ A;  1HQR D;  4KHV A;  3QIA A;  4CKB A;  5FLX E;  1B50 A;  1HPC A;  2UUC Q;  1K3R A;  2PMZ E;  4DR6 L;  2IL8 A;  5C5M A;  5FKA C;  3MFY A;  4QUF A;  2VXW A;  1PH7 A;  1G2S A;  3OIQ A;  1SE8 A;  2KCM A;  4C3J G;  1Y8N B;  3H3V C;  5DNF A;  1AP0 A;  4C3J B;  5CBA E;  1D5M C;  3SDZ A;  1Q46 A;  2VY3 A;  1Q12 A;  4C1N I;  2ID0 A;  1JWS D;  5LL6 S;  2RHS B;  1LTA D;  3S16 H;  1TXY A;  2VQF Q;  1O80 A;  1J5E Q;  3PO3 B;  1BBX C;  2NZO A;  1GKU B;  2ODG C;  4P73 A;  4YY3 L;  2VB3 X;  1D6E C;  4JV5 L;  2HCI A;  3K5L A;  4X3K A;  1F2M A;  1STE A;  3D31 A;  5M5Y B;  2K5V A;  2K5D A;  1V43 A;  4DV2 Q;  4XDX A;  4M8A A;  2UUA Q;  1PYW D;  1JOO A;  2TSS A;  3BDO A;  2I5M X;  2FMM A;  4UZW A;  2F0V A;  1EFW A;  1QVG A;  4LWC A;  3K0X A;  3HP3 A;  4IPG A;  3HOU G;  2VW9 A;  3HOU B;  1GUO A;  3K5O A;  1K9M C;  2EJF C;  5IP9 H;  2QNF A;  1L1O A;  2B2V C;  5CIU A;  2F0L A;  2CH4 W;  3Q23 A;  5M5W B;  1QOH A;  1HR0 W;  2UXD Q;  4C2M H;  5KEE A;  4A3L H;  3CW2 C;  2ICI A;  2J0T D;  2ALY B;  3T13 A;  3M7G A;  4BY7 B;  4GKJ Q;  2MO1 A;  3H0G G;  2E2J B;  4AH6 A;  1PH3 A;  1KAA A;  3ZJY C;  3H0G B;  4B9X A;  2M2L A;  1EQR A;  3KJO A;  3GTM H;  3CRL C;  3R2T A;  2BA0 A;  1MSH A;  2A68 C;  2DUD A;  2EYH A;  2EPB A;  4C56 C;  3V2T A;  3H3V H;  4ZQ3 A;  5M3M H;  1YNJ D;  3PIO 3;  3KFU A;  4YIJ A;  2NYZ D;  4NXM Q;  2H4O A;  2E8G A;  2QEX A;  1OTC A;  5LMN W;  4TRD A;  4BY1 G;  4DNR B;  4BY1 B;  1GO3 E;  2BOS A;  1FGU A;  4C3I H;  2WV6 D;  1Q1E A;  4P75 A;  3MXN B;  2CCZ A;  2B2T A;  1KHI A;  2H1E A;  4B3R Q;  2RSN A;  1FNU A;  1HJP A;  1B2T A;  1VQF A;  4DR5 L;  1EUJ A;  5IGG A;  4S3S A;  3STB D;  2JA8 G;  4JI5 Q;  3RR5 A;  2JA8 B;  4HED A;  4GNX A;  4CGY B;  3HKZ E;  1HQM C;  1UE7 A;  5JJZ A;  1PZJ D;  1G51 A;  1O7Y A;  5ELE A;  3S14 H;  1A15 A;  5ISR A;  2XTI A;  5CV6 A;  1JB7 A;  4BBS B;  2K5N A;  1I5F A;  4OIK A;  4CJ2 C;  4F7X A;  1G91 A;  1ESF A;  4K8I A;  5IT9 E;  4N8F A;  2K01 A;  1YHA A;  1JWM D;  1ML0 D;  4RGN A;  2F3V A;  3QWN A;  5M3F G;  3ULP A;  2Q2U A;  3CCQ A;  1EN7 A;  1CHQ D;  2QIL A;  5JVH 3;  4DK0 A;  4DR7 Q;  5JEA G;  3NWS A;  1BNZ A;  4FF3 A;  1TY2 A;  1TS5 A;  3IAY A;  2LFN A;  3PF5 A;  5ELC A;  3E3X A;  3SGI A;  1SN8 A;  1RTO A;  3MEF A;  1TWH B;  2PZW A;  1AE3 A;  2F0U A;  1IW7 C;  1SAP A;  1WCM G;  1B1Z A;  1WCM B;  2ZM6 L;  1HR0 Q;  3BDC A;  2VB2 X;  1SYB A;  2X6G A;  4A3I G;  4RHS A;  1NBW A;  1E0B A;  1EOV A;  4A3I B;  2EYP A;  1EIG A;  2Z1C A;  4A3B B;  1L1O C;  1SJE D;  2MHV A;  2JJQ A;  5JJK A;  4K5W A;  4L5S A;  1KDA A;  2CHB D;  2Q8I B;  1YZ6 A;  2F0G A;  3STB C;  1TS4 A;  5LL6 X;  3GTP B;  4X66 L;  3FKI H;  3SK8 A;  1G29 1;  1G6P A;  3UDG A;  1PRT B;  3PIP A;  2K04 A;  1VS0 A;  5LMN Q;  3GTQ B;  4YWL A;  1STA A;  2YTY A;  3QB3 A;  4ZKB B;  4PMW A;  2EY6 A;  1R9T H;  1F9Q A;  2RDH A;  5BN3 A;  5KYL A;  4PZ6 A;  2A5H A;  2OF1 A;  3I90 A;  2HIV A;  3G71 A;  4DUZ L;  3QG1 A;  4KLK A;  2K1B A;  3DUZ A;  1CSQ A;  4A3F B;  1QVC A;  4XXE A;  2RSO A;  2WKD A;  3ULJ A;  1S5E D;  3N52 A;  4DV7 L;  1TS3 A;  2YTV A;  1EU4 A;  2ZTE A;  3U9O A;  2KJX A;  2R92 H;  1HZC A;  5FO7 B;  4LFA L;  4KK7 A;  3GTL B;  5C3E G;  2E76 C;  5G3L D;  4GNX C;  1F9S A;  2D2C C;  3J81 c;  1B9N A;  5C3E B;  5FLM G;  4JI7 L;  5FOB B;  3HKS A;  3GTJ H;  1A6X A;  1Q8I A;  4IUV A;  2F1M A;  4XT1 B;  1MGS A;  1V1P A;  3PUY A;  1ENF A;  1GD7 A;  2A73 B;  2ZXR A;  3BG3 A;  5T1G A;  3KOJ A;  3L2P A;  1WTR A;  3UDI A;  1UNS A;  2L11 A;  4B3T Q;  3J7Z C;  1I3Q H;  3R2I A;  2O4X A;  3RN2 A;  3SEB A;  4RGO S;  4G4K A;  4JI8 Q;  1L0X B;  3NUC A;  2VZA A;  1F77 A;  1VQ9 A;  1Y14 B;  2MO0 A;  2E2I H;  3SE0 A;  2F03 A;  1LTS D;  1B8A A;  2VNU D;  1H9F A;  4DR3 L;  3V96 A;  5IOC A;  2PQE A;  3NBH A;  3NK9 A;  4RWS C;  1IBL Q;  4HCS A;  3TN2 A;  4A3K H;  4HN7 A;  1GJJ A;  1X55 A;  1K0R A;  3M3Y B;  2Q8R E;  3KBX A;  1WTV A;  3DMU A;  5JJI A;  1E2Z A;  2RQX A;  5C6A A;  1MKH A;  4RG1 A;  1VQ5 A;  2KCN A;  2KVD A;  2PZU A;  5AJ3 L;  1N36 Q;  1N34 Q;  3K6O A;  4DK3 C;  1PVO A;  4H0L C;  1A2U A;  1QNU A;  1PFM A;  1H95 A;  5CR3 A;  1A63 A;  1A62 A;  1ASY A;  5M5X H;  3ND8 A;  4KKT A;  5CGK A;  4RGT A;  3ULL A;  1Q8K A;  5DLQ E;  1PTO D;  5IP7 H;  1SNO A;  4LF6 Q;  4NXN Q;  2ZJP A;  5ELF A;  1E22 A;  1CUK A;  1X6O A;  4HJ8 A;  4A3D H;  3IRB A;  1LTT D;  4JI3 Q;  3CME A;  1P8L A;  4FP5 D;  3KLR A;  3GV6 A;  3K7A H;  1BOS A;  2MNA A;  3NE5 B;  3SK5 A;  2E74 C;  2AUJ D;  2NZH A;  3T1H Q;  3HOW B;  3PO2 B;  5A2Q E;  2IY5 B;  1VQL A;  1STB A;  1LT5 D;  1YIJ A;  2PQA A;  1VQB A;  1H9M A;  1FYC A;  4JBM A;  2XSC A;  2EYM A;  4DNT B;  5C0X I;  3NQT A;  4RFB A;  4BXX H;  4TSS A;  1E7L A;  3KYH C;  3QOL A;  4IAL A;  3SXH A;  3M4O B;  1O78 A;  1CTM A;  5FO8 B;  1PXU A;  4JI0 L;  4EQO A;  2BDO A;  2XIW A;  4IPD A;  3GTG B;  4E6I A;  4EX5 A;  2F0H A;  4UY8 C;  2EYL A;  2R93 G;  3ITP A;  3K59 A;  4CDD C;  4KHP L;  4LF9 Q;  5H1S E;  1GUN A;  1STG A;  3E0E A;  4LF7 L;  4RKL A;  4HMJ A;  3I4M H;  5KNB A;  4O2D A;  4BWG B;  3DM1 A;  2QGQ A;  3EJI A;  4DV6 L;  1PH2 A;  4K2L A;  2O2L D;  1KXL A;  1JR0 D;  1QUQ B;  3E5S A;  1D5Z C;  4A3J H;  4HTH A;  4PNY A;  2KQ3 A;  4GOP A;  5TSS A;  2B29 A;  3PUW A;  3DWQ A;  2D9U A;  4K5V A;  4NMZ A;  5M3M B;  3MAQ A;  4AIM A;  1BBW A;  1PFB A;  1S4Z A;  2NZ1 D;  3MFG A;  4QMG A;  1T9H A;  2NTT A;  3A8J E;  1CKN A;  4J1M A;  4B3S Q;  3D4D A;  2LXK A;  1IYV A;  4GN4 B;  1JMC A;  3PSI A;  4HJA A;  1Y1V G;  2LSS A;  4CKC A;  1R4P B;  1Y1V B;  3GTK H;  2AQ2 B;  1GM5 A;  3W3A A;  2OTL A;  3HOY H;  4JI2 L;  1ENA A;  4A75 A;  3RD4 A;  3D0F A;  4PMB A;  1RHP A;  4NKL A;  2KVU A;  2EDG A;  4PZ8 A;  3FVQ A;  4FO2 A;  3JAM i;  3JAM E;  4A3M G;  1VMC A;  2DNC A;  4A3M B;  1I6H B;  2PO4 A;  2Q2I A;  2VUM G;  3TZD A;  2YTX A;  1G8Z D;  1SMX A;  2F0P A;  3OOC A;  1MJC A;  4QF4 A;  3I55 A;  5BR8 L;  1EY5 A;  1WFQ A;  2B2W A;  2K5W A;  4NP5 A;  5GRO A;  3CF5 A;  1E1O A;  3A7A B;  1TU2 B;  1Q81 C; 
#chains in the Genus database with same CATH homology
 2R7Z H;  1RIP A;  4OWT B;  4JI5 L;  3WWV A;  2UUC Q;  1K3R A;  2PMZ E;  4DR6 L;  1Z9F A;  1VQP A;  2KHI A;  3GD7 A;  2ES2 A;  4UP7 A;  1CSP A;  3PIO A;  4HJ7 A;  1PH7 A;  4UPA A;  4LFB Q;  3F8T A;  5E7N A;  1OXU A;  1SE8 A;  1WI5 A;  2PI2 A;  3W1B A;  3U58 A;  3M7N A;  3S17 H;  2KCM A;  1HNW Q;  1HNX Q;  1WOC A;  1JE5 A;  1XNR L;  2GVA A;  3I4N G;  2UUC L;  4X6A H;  1Q46 A;  2VY3 A;  1Q12 A;  5IYD G;  1YBY A;  4TQU S;  4C3J H;  1MJE A;  1X3G A;  2R6G A;  4JC0 A;  2ID0 A;  4FDB A;  5ELO A;  1XMQ Q;  4LFB L;  1PH9 A;  3I4N H;  1VCI A;  3S1Q H;  4A93 G;  2RHS B;  1C7Y A;  5IYD H;  1BBU A;  3EIV A;  1RL2 A;  4YY3 Q;  3BJU A;  5LMU Q;  2Y0S G;  4LUZ A;  3S16 H;  4QJF A;  1TXY A;  1K73 C;  2C35 B;  1I50 H;  2VQF Q;  5IYB G;  1J5E Q;  4IOA A;  4Y52 H;  1L0W A;  4DV3 L;  1XMQ L;  2NZO A;  1GKU B;  3HOW G;  2ODG C;  2ZJQ A;  1FVI A;  1CKM A;  3PO2 G;  4P73 A;  4YY3 L;  2AWN A;  4POG A;  5LMU L;  3PO3 H;  4JV5 L;  5GAH C;  4GN3 B;  3L7Z C;  3NBH B;  4JI0 Q;  2KEN A;  2N78 A;  5K36 G;  2WB1 E;  3D31 A;  2CQO A;  2K5V A;  3A74 A;  2VQF L;  4DV2 Q;  1V43 A;  1XMO Q;  2YV5 A;  2UUA Q;  3A0J A;  4KHP Q;  1N32 L;  2ATW A;  1UE1 A;  5M5Y H;  4B3M Q;  2I5M X;  4JG2 A;  4PZ7 A;  3S24 A;  1EFW A;  4LF7 Q;  1KIX A;  1QVG A;  1TWC H;  4LWC A;  3K0X A;  4IFD J;  1DGS A;  3KDF A;  4WJ3 M;  4IPG A;  4YHH Q;  4DV6 Q;  4DV2 L;  1XMO L;  2VW9 A;  3HOU G;  1LTL A;  3J81 j;  2UUA L;  2AKW B;  1EIF A;  1GKH A;  1J6Q A;  4GOP C;  1VQ6 A;  1K9M C;  5IP9 H;  4RMF A;  3HOU H;  2QNF A;  1L1O A;  2KHJ A;  4JBK A;  1E7Z A;  2JA5 G;  2K50 A;  2VS1 A;  4X65 Q;  1HR0 W;  4O0A A;  2UXD Q;  3PUZ A;  4C2M H;  5M5W H;  4DKA C;  3CW2 C;  4YHH L;  4A3L H;  2ALY B;  4JI4 Q;  4IPH A;  3CCE A;  2JA5 H;  4LFC L;  1GVP A;  2K52 A;  1VQJ A;  4GKJ Q;  2MO1 A;  3H0G G;  1PH1 A;  1X9N A;  1A0I A;  1TWF H;  4AH6 A;  1PH3 A;  1OXS C;  3ZJY C;  3HOV G;  3TS2 A;  4BY7 H;  5GQO A;  4JOI A;  2F4V Q;  1EQR A;  3KJO A;  3GTM H;  2E2J H;  5M3M G;  3CAM A;  4X65 L;  2BA0 A;  4MZ9 A;  3U4Z A;  3H0G H;  4PG3 A;  3U50 C;  2DUD A;  5JEA J;  2HHH Q;  1PYS B;  1XJV A;  3HOV H;  3PV0 A;  5IE8 A;  3E9H A;  1N9W A;  3H3V H;  5M3M H;  2AHO B;  1JJC B;  1KL9 A;  4JI2 Q;  4GKJ L;  1CKO A;  2ZJR A;  1X3F A;  3S1N H;  1XTD A;  3KFU A;  2Q2T A;  4QQB X;  4YCV A;  4HIO A;  4NXM Q;  1WJJ A;  4AYB G;  3AQQ A;  2E8G A;  4P72 A;  4R4Q A;  2QEX A;  5LMN W;  4DAM A;  1Q82 C;  1OTC A;  2HHH L;  2QNC A;  4YCW A;  4BY1 G;  1VQN A;  4GKK Q;  2PQA B;  3RZD H;  1Q7Y C;  4QGU A;  4JCV E;  1GO3 E;  1UWV A;  4A3C G;  1FGU A;  2NVY H;  4C3I H;  4DR5 Q;  1Q1E A;  3ERS X;  1V1Q A;  4BY1 H;  4P75 A;  4OWX B;  3MXN B;  2LD7 A;  1YEZ A;  3UDF A;  2AMC B;  1QZH A;  2CCZ A;  4NXM L;  1FL0 A;  1KHI A;  3F2C A;  1SRO A;  1JJ2 A;  1GL9 B;  4B3R Q;  1EIY B;  4DUY Q;  4GKK L;  5EAY A;  1PH5 A;  1HJP A;  2L15 A;  4LUV A;  1VQF A;  4DR5 L;  2DGY A;  4LUO A;  2Y0S E;  3KF6 A;  1NMG A;  4P74 A;  2I0Q A;  3CCV A;  1EUJ A;  3TRE A;  5FLM H;  2UXC L;  1PA6 A;  3STB D;  2JA8 G;  2F52 A;  4P71 A;  4JI5 Q;  1HNZ L;  4B3R L;  3RR5 A;  4DR6 Q;  4YWM A;  3I2Z A;  2OWO A;  4GNX A;  3HKZ E;  1UE6 A;  2JA8 H;  3TS0 A;  1UE5 A;  3J80 c;  1UE7 A;  5IT9 c;  1C0A A;  4TVA B;  1G51 A;  3M4Q A;  5IYC G;  3CCR A;  4GOP B;  3S14 H;  3CMA A;  1XNR Q;  3CP0 A;  2XTI A;  1KRS A;  4JI1 Q;  1JB7 A;  1XPR A;  2K5N A;  1I5F A;  5IYC H;  1PFS A;  4QL5 A;  4LNQ A;  4C3H H;  3KF8 B;  1YHA A;  4BBS H;  4GN5 A;  2JA7 G;  2NVQ H;  1HZB A;  1X3E A;  2Z6K A;  3CC4 A;  3S1M H;  1CKN B;  5M3F G;  3ULP A;  2W51 A;  2Q2U A;  3CCQ A;  1EN7 A;  1N33 Q;  1KAW A;  2JA7 H;  4JI1 L;  3U4V A;  1PH4 A;  4JYA L;  2IHE A;  1D8L A;  2H5X A;  4UP8 A;  3OTO L;  4X64 L;  5M3F H;  1IXR A;  2OQ0 A;  2VQE Q;  1VQ7 A;  4DV3 Q;  4DR7 Q;  5JEA G;  3Q8D A;  4L5T A;  3H15 A;  5HGQ A;  1XNQ Q;  4HIM A;  4JV5 Q;  1N33 L;  3PF5 A;  3AEV A;  4AQY Q;  3EN2 A;  3SGI A;  1SN8 A;  3CCM A;  4L5R C;  2NVT H;  3MEF A;  5IWA Q;  4OO1 G;  3PO3 G;  1N36 L;  2VQE L;  4DR7 L;  2AWO A;  1N32 Q;  1AE3 A;  4YCU A;  3BU2 A;  1TWH H;  1VQK A;  2JE6 I;  1XNQ L;  3OYY A;  1WCM G;  1Z47 A;  2GN5 A;  3HFZ B;  2BH8 A;  2XGT A;  3I7F A;  4AQY L;  4ME3 A;  1QUQ A;  3S2D H;  1LUZ A;  2ZM6 L;  2WP8 J;  4QIW E;  1HR0 Q;  4DR1 Q;  5IWA L;  2DK4 A;  1WCM H;  1X65 A;  4A3I G;  1NBW A;  4LF6 L;  4DPG A;  3GTO H;  1EOV A;  1IYJ B;  3KJP A;  4DV5 Q;  1VQI A;  2KCT A;  3KLW A;  4GLA C;  1KRT A;  1VQM A;  4LF5 Q;  1W2B A;  1L1O C;  4IPC A;  5JJK A;  2JJQ A;  4DV4 Q;  2UUB Q;  4A3I H;  1NJI C;  4L5S A;  2N3S A;  1YVC A;  1H9E A;  3T1Y L;  3F2D A;  2D0O A;  1YZ6 A;  4DR1 L;  3A5U A;  1HR0 L;  3STB C;  5IP9 G;  4X66 L;  3L0O A;  3EBE A;  2BA1 A;  3FKI H;  1FJG Q;  4LFC Q;  3UE1 A;  4DV5 L;  3F2B A;  1G29 1;  4LF5 L;  1G6P A;  3GTP H;  4A3L G;  4BBR G;  1KQS A;  4HJ9 A;  3UDG A;  3S1R H;  2GVB A;  4JOI C;  1VQG A;  4DV4 L;  2UUB L;  1E3P A;  3E9I A;  4R4C A;  4EQ5 A;  3K80 C;  4UP9 A;  5IY0 A;  4A4I A;  4JBW A;  3OW2 A;  3AYH B;  2IX1 A;  5GAD C;  4LF8 Q;  3PIP A;  1W3S A;  1VS0 A;  3T1H L;  4BBR H;  1M90 C;  3CC2 A;  4LF4 Q;  3H3V I;  3RZO H;  3RLF A;  5LMN Q;  4BY7 G;  3RN5 A;  4YWL A;  4DV0 L;  1FJG L;  2YTY A;  3AFQ A;  3B6Y A;  4PMW A;  1I94 L;  1R9T H;  3GTQ H;  5C0X G;  2WFW A;  1VQ8 A;  1YJ9 A;  4PZ6 A;  1Q86 C;  2Q2H A;  5C44 G;  4LF4 L;  4LF8 L;  3ICE A;  2HIV A;  5LMN L;  3G71 A;  1PYB A;  4DUZ L;  3FHW A;  1O7I A;  2R93 H;  3CC7 A;  4KLK A;  4DV7 Q;  1KC8 C;  2JK8 A;  5C44 H;  1CSQ A;  2JEB I;  4X62 Q;  1WYD A;  1QVC A;  4HID A;  2R7F A;  3ULJ A;  3G6E A;  1K8A C;  3CCL A;  4IOC A;  1N8R C;  4KHZ A;  2R92 G;  4OX9 Q;  4JI7 Q;  3DLL A;  4DV7 L;  2KFV A;  1EWI A;  3CXC A;  2YTV A;  3RLN A;  2ZTE A;  1VQD A;  3W1G A;  4X62 L;  4NB3 A;  2OCE A;  2R92 H;  1HZC A;  3CQZ H;  3LGJ A;  4LFA L;  2UXC Q;  1Q1B A;  2KBN A;  1HNZ Q;  5C3E G;  2V1C C;  5JJL A;  4GNX C;  1S40 A;  4ALP A;  3J81 c;  3KDF B;  4IJL A;  3S15 H;  5FLM G;  4OX9 L;  4JI7 L;  3CPW A;  3HKS A;  3GTJ H;  3BZC A;  2NVX H;  5C3E H;  1ASZ A;  1E7D A;  1AE2 A;  3HOZ G;  1D7Q A;  3PUY A;  3DM3 A;  1GD7 A;  3L2P A;  1VQO A;  2Z0S A;  3KOJ A;  1L1O B;  3J81 i;  1NY4 A;  1VQE A;  3UDI A;  4DAY B;  3F1Z A;  4L5Q A;  4B3T Q;  3J7Z C;  3CCJ A;  3HOZ H;  1I3Q H;  4B3S L;  3RN2 A;  2ZTD A;  3ER0 A;  4JI8 Q;  2Z6K C;  3W5O A;  2VZA A;  2N8N A;  4LW1 A;  3VDY A;  1VQ9 A;  1C9O A;  1EQQ A;  1Y14 B;  2CKZ B;  2G80 A;  2MO0 A;  2E2I H;  3M85 A;  4BBS G;  1HZ9 A;  1B8A A;  1QVF A;  2VNU D;  1H9F A;  2R7D A;  2RCN A;  1PHJ A;  4B3T L;  4J15 A;  4MTN A;  3OTO Q;  4MNO A;  1VQC A;  3A5Z B;  3J80 i;  1YNS A;  4X64 Q;  4DR3 L;  1YJW A;  2CFM A;  3NEL A;  5C0X J;  5AJ3 Q;  5J3B A;  1OXX K;  4JI8 L;  3G4S A;  1IBL Q;  1K8G A;  4R1J A;  4A3C H;  4A3K H;  4OON A;  2VUM H;  1GJJ A;  1X55 A;  1K0R A;  3GDE A;  1IBK Q;  5JJI A;  4DR2 Q;  2I5H A;  1VQ5 A;  3PUV A;  1MKH A;  1V9P A;  1SLJ A;  1NMF A;  3M9B A;  1X56 A;  4JBJ A;  4RG1 A;  4JI4 L;  3M3Y H;  2WAQ G;  3NEM A;  2MFI A;  5AJ3 L;  1N36 Q;  1N34 Q;  1PVO A;  1BVS A;  4BA1 I;  3BZK A;  4DK3 C;  1IBL L;  5C4X H;  4K0K L;  4OO1 I;  1H95 A;  4Y7N H;  3PUX A;  1A63 A;  1KD1 C;  1ZS9 A;  1IBM Q;  1A62 A;  1ASY A;  1IBK L;  2E5L L;  5IP7 G;  4DR2 L;  5M5X H;  1K83 H;  1YI2 A;  2ZM6 Q;  1X54 A;  1PV4 A;  3ULL A;  5C4J H;  1AH9 A;  1Q8K A;  2A1A A;  5DLQ E;  4A3D G;  1N34 L;  5IP7 H;  5GAE C;  4LF6 Q;  3K81 C;  3I56 A;  4NXN Q;  2ZJP A;  2D0P A;  4R4T A;  1IBM L;  2JA6 G;  1E22 A;  1CUK A;  1X6O A;  4HJ8 A;  3KF6 B;  3IRB A;  4BA2 I;  4A3D H;  4JI3 Q;  3T1Y Q;  3RLO A;  3CME A;  1P8L A;  3PCO B;  3CD6 A;  4OXP A;  2JA6 H;  2JA9 A;  1MIU A;  1U5K A;  3K8A A;  4X66 Q;  3K7A H;  4GNX B;  1HNX L;  1HNW L;  4NXN L;  2K75 A;  4AYB E;  4A3B G;  4GLV B;  4IJH A;  5HY6 A;  2MNA A;  4A93 H;  1S72 A;  1OXV A;  3FKI G;  1SRU A;  1YNX A;  2NZH A;  2VL6 A;  3CPF A;  4JI3 L;  4A3B H;  1TWA H;  3T1H Q;  3M4P A;  2LC3 A;  3K7U C;  3HKZ G;  5ELN A;  3UE0 A;  4DV0 Q;  3TEH B;  5IYB H;  2N49 A;  1L2F A;  2IY5 B;  4OWW B;  2PNH A;  1U0L A;  1I94 Q;  3HOW H;  3PO2 H;  4BXX G;  1VQL A;  1YIJ A;  1JT8 A;  2PQA A;  3CCU A;  1VQB A;  1J5E L;  4JBM A;  1Y1W G;  1IL2 A;  5C0X I;  2HIX A;  4WJ4 A;  4BXX H;  2HQL A;  3PF4 A;  1E7L A;  3KYH C;  4DUZ Q;  1NTG A;  2IHF A;  2I5L X;  1Y1W H;  2JEA I;  4JI0 L;  1PH8 A;  3M4O H;  1P16 A;  2UU9 Q;  4IPD A;  2R93 G;  1S3O A;  2FXQ A;  4EX5 A;  4UY8 C;  4HJ5 A;  3I4O A;  3NEN A;  2UXB Q;  1SFO H;  4KHP L;  3I4M G;  4B3M L;  3GTG H;  1B7Y B;  1LM0 A;  5H1S E;  4LF9 Q;  4DNI A;  3E0E A;  2ZTC A;  1VQH A;  1HZA A;  2K14 A;  4LF7 L;  4A3F G;  4HIK A;  1UEB A;  1YHB A;  3I4M H;  4A3J G;  2IT1 A;  4O2D A;  1HH2 P;  2UU9 L;  1IZ6 A;  2QGQ A;  4QY7 A;  4LFA Q;  4DV6 L;  1VQ4 A;  1PH2 A;  2HJQ A;  2EXD A;  1KXL A;  2K4K A;  4A3F H;  2UXB L;  4A76 A;  3HOX G;  1B70 B;  1QUQ B;  2K5H A;  4A3J H;  1YIT A;  4LF9 L;  1OXT A;  2MPH A;  4KI0 A;  2F3I A;  4GOP A;  2B29 A;  4APV A;  2LXJ A;  3AFP A;  3J7A 5;  1XPU A;  3PUW A;  3UDX A;  3HOX H;  2UXD L;  4NPS A;  1E24 A;  1E1T A;  4AIM A;  1BBW A;  2WAQ E;  4DR4 Q;  2WB1 G;  3S2H H;  1T9H A;  2YU9 H;  1CKN A;  4GS3 A;  2JQO A;  4B3S Q;  2EIF A;  2EQS A;  2LXK A;  1BKB A;  3GTL H;  2IX0 A;  3G48 A;  2F4V L;  3HOY G;  4GN4 B;  4XIG S;  1JMC A;  2BH2 A;  3PSI A;  4HJA A;  1Y1V G;  2LSS A;  2ASB A;  3CCS A;  4JYA Q;  2RHQ B;  2QA4 A;  4JI6 Q;  1NE3 A;  2NN6 I;  3GTK H;  3JAM c;  2OQK A;  1GM5 A;  2ODC I;  2CWA A;  2RF4 A;  2OTL A;  3HOY H;  3TRZ A;  3JC6 6;  4JI2 L;  4DR4 L;  1SR3 A;  1JJG A;  1Y1V H;  2HT1 A;  4A75 A;  1VQA A;  4DR3 Q;  3D0F A;  4POF A;  1TWG H;  4DV1 Q;  5GAG C;  2NN6 G;  2YYZ A;  3FP9 A;  4PZ8 A;  1EYG A;  2D62 A;  3JAM i;  4A3M G;  2A8V A;  5BR8 Q;  1YHQ A;  4JI6 L;  1PH6 A;  2B63 G;  2A19 A;  1YJN A;  1LYL A;  4DK6 C;  1QZG A;  2Q2I A;  3PGZ A;  4A3M H;  1I6H H;  4A3K G;  2VUM G;  1JEI A;  1Y02 A;  4YWK A;  2YTX A;  4GLX A;  2B63 H;  4DV1 L;  2MQH A;  4A3G G;  4IFD I;  1SMX A;  1MJC A;  3I55 A;  5FJ8 G;  2B3G A;  4K0K Q;  3RNU A;  5BR8 L;  5FLX c;  4A3E G;  1WFQ A;  4H02 A;  1XPO A;  4DUY L;  1M1K C;  1A8V A;  5GRO A;  2CWP A;  2E5L Q;  4A3G H;  3CF5 A;  2E2H H;  2R7Z G;  4IFD G;  1E1O A;  3GO5 A;  5FJ8 H;  4IO9 A;  5C4X G;  4R4I A;  4R4O A;  3TQY A;  4A3E H;  2OTJ A;  2PI2 E;  1Q81 C;  4XTC S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...