1A64A

Engineering a misfolded form of rat cd2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
94
structure length
94
Chain Sequence
GTVWGALGHGINLNIPNFQMTDDIDEVRWERGSTLVAEFKRKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILDKALDLRILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2
publication title Engineering an intertwined form of CD2 for stability and assembly.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Domain swapping
total genus 8
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a64A00
1H15A 5J9PA 4P3CH 1FPTL 5D2LF 2KQNA 3PGDB 4U1MB 2CR6A 3OX8B 4ZUVA 2M26A 2VZVA 5C0AE 3HMWH 4K07A 1A7RL 4GQ9H 4QF1A 2AEWA 1TVHB 4MS8C 1SJEA 3QISA 2DF3A 3L95A 3L9RB 1P4IL 5I16A 4EN3D 3ARRA 3MRLA 1TZHA 4Q2ZB 1YEIH 3S4SA 2VXUL 3AM8C 4S2SA 3TH3T 1BIIA 2HH0H 3BKCH 1OSPL 1TTUA 4GUPA 3LH2H 3MBEC 1CE6A 4KFZC 3Q6GL 2J8HA 5FM5M 5JPNA 4IRJD 5BMFL 3F6LA 1K8DB 4ZO8A 3D0LA 4X4ZA 5EZJA 4H5SB 3SQOL 3VH8A 5IB5A 3TNNA 4IS6A 5FYJL 5F1NB 3BXNB 1AO7A 5FV1L 2P5WA 2OJEA 2BNQA 3MOAH 4I3RL 1NC4B 43CAA 3MRHB 4GXVH 4ACPA 3RPKA 3FT3A 4R97B 2FDBP 4ZPTB 5TQ2L 5ID1B 4Z7NF 3KPPB 2ATPA 4JFQA 3SKJL 1YN6A 2UYLB 1UM6L 4UAOC 4ZTPL 4GH7B 5D1ZB 2X4PA 4OLUL 4P2RD 2HMIC 1BFTA 2GUOA 5EU3B 5LGHL 1AIFB 4KKCC 1IM3A 4PJFE 4XHQA 3GZKA 1N59A 2EE3A 2CRIA 1YEEL 5JR1L 1MFAL 5GISH 1TDQA 3PP4L 4R7DA 1I3RB 3ZT5A 5GIRB 5CIPB 3S37L 3S36X 3RGVD 1NFIA 1FN4B 1SJHA 3ES6B 4FMKA 2IPTL 3H9SE 1K8IB 4FQCH 4Q6IC 1Y0LB 3MTRA 4KQ3H 2FLRT 2XI9A 4P9HC 1UEMA 3AS0A 5JPMB 4PV8A 4NBYB 1OTTD 3AXLB 5HHPB 4OFYA 5GPRA 4XMLL 2P8MA 4MYWB 4GFTB 3SDXA 3W9DA 3KPLA 4HT1L 3VWKD 2XTLA 3D5OF 1W0WA 2JCCB 4N8PA 1OP3K 2ZOLA 4XI5D 5C70A 4HMCA 4YE4H 1HE7A 3NPSB 3VGFA 3S8WA 4OLVL 1E4XI 1FIGH 2Q76A 1KOAA 5FYLE 3HNVL 5T3XH 3TYFA 1U58B 3Q1SL 2UZXB 2FHCA 4WFHE 1H15B 4E42A 3HPJA 3BEVA 3BEWA 4XP5L 4LBEB 4KAQH 2OJZL 3FZUD 1R5VA 3F7YB 1ES0A 4O2FB 1N5AB 2EXYD 5F8RC 1MCJA 4M7LH 2KL6A 1PZUB 1YEGH 4XAWL 3QO1A 4E0RA 1QP1A 3O3AA 3V6ZA 4QF1B 2A9ML 1HSBA 1QBML 1SJEB 1KXVC 1JYNA 2VITA 3IFOB 3JBG7 5HYJA 2Q1EA 3KHQA 5I8CA 4X99B 3S4SB 1CBVL 4S2SB 2QLVB 3F7PC 1BIIB 4ZSOE 5CD5D 1T22B 3DV4A 3OHXA 4U4BA 4OIBA 5HDLA 5IJKA 4GUPB 3T2NH 1XGTA 2HYMA 1CE1L 1CE6B 1YJDH 2NZIA 4L4VD 1ONQB 5A2KH 2JE8A 4Y4HB 5JPNB 4F33B 2HTLC 5GJSL 5EZJB 2R23A 3U7WL 3VH8B 5D1XC 3BIBX 5IB5B 3TNNB 4YXLL 3QDGA 2MPAH 1OAKH 4JQVC 3RTQC 3MRDA 4HC1L 1AO7B 2P5WB 4UDTA 4KRMB 2E9JA 1B88A 4LSVH 3VFRB 3MCKB 2OK0H 4GAJH 2VN4A 43CAB 3WIIL 3OB8A 5I76A 4X0KB 5C09A 1I9RH 1PY9A 4OZHF 5DDHA 4QCIB 2EDDA 4JFQB 1YN6B 4Y19D 3CVHL 4KGLA 3CGTA 4HUUA 4NUGH 3JV5A 3H3KA 3QR2A 5GGTH 1S7WB 3GO1L 4CN4A 3RVXD 2GUOB 3OAUL 2AJVL 3E8UH 4YHYC 1IM3B 4LSSL 4K8RC 1N59B 1ULVA 1RZ7H 1JCKA 2XT1B 2FB4L 1JZ5A 1Z9MA 1EV2E 4R7DB 1D6EA 5HI4C 5HDQH 1QKZL 2IALB 1HKFA 1EFQA 1VPOL 1ZT7B 1ZLWH 1G6VK 1NFIB 2D31A 1S7TA 3GSQA 2JCCE 4LVHB 4X6CA 1T1YA 4QRUB 4HJ0D 5JOFA 5C0FA 3SKUD 4ODXA 4DFIA 4PV8B 3LEYH 3BFOA 1A4JB 1IGYB 5L8JB 3V9FA 2BHUA 4LSRL 3KPLB 3SDXB 3DMMC 3W9DB 1W0WB 4U2ZA 4P48A 4GRWF 4RAVA 3L3OA 1XGUA 2PTUA 1OD7A 4M1CD 4OCMC 3NTCH 3RNQA 4E42B 4ZG1A 3HPJB 2YD4A 3BEVB 3BEWB 3GMRB 3GRWL 4OLYH 2DQEL 1T04B 3VD4A 2J3SA 2DKUA 3RWDA 4HAFA 2ZUQB 4Z76A 3CH1A 5LG1A 4PJHA 3NZHL 5LWYL 3ELAT 4E0RB 3OWEA 1OM3L 1L6ZA 3V6ZB 5IB3A 3U9PH 4GMSH 2IANA 1HSBB 4RFNC 3FO2A 1Q72L 3RWFA 1RUQL 1RMFL 4Z7OE 3MLYH 2H1PH 1GVIA 3D9AL 3LD8B 5I8CB 4HKXA 1BGXH 2MQCA 4WUUA 1KCSH 2Z4QA 3CXDL 2Z9TA 2DDQL 5E70A 3IDIB 3OHXB 2P1YA 3BN3B 2ARJQ 4DTGH 2E9IA 4LHUG 3DO3A 5F8QC 1FJ1B 3WDHA 5I1LA 5IB4B 4UB0H 3KGRA 5HGGS 3I6LE 2WM0A 1AO7E 2P5WE 3VG0H 2BNQE 3NIGE 2JTDA 3GSUB 2B1HL 4KUCD 3NABL 4RMUA 4Z7WF 4IMKC 4JM4L 5IGXL 5IEKB 3KNBA 3QDGB 3MZTA 2W9EL 5CBEB 1N6UA 3MRDB 3CFJB 1BAFH 4DK3A 4KUZH 4XVSL 2D03H 4S1QH 3SE8H 5C0BA 3MBXL 3WV0A 3K0WA 2BMKB 1AXSA 2ATKA 1KB5H 5FO8A 5C09B 1CTNA 5DDHB 2OZ4L 1DQMH 2XZQL 4U6YA 3V6BR 2D9QB 1ORQA 1FAIH 3RY5A 2IF7A 3F5WB 5CLTA 2HVJB 1JZ2A 2HT4C 5EH1A 5E4EC 1K5NA 3SKOA 3QI9B 1EHNA 2C4FT 5JMRA 2GJZB 5BO1H 2EH8L 4Y5YA 2XPGA 3IKKA 4Z7UA 1IAII 4P9MH 4JO3H 1HZHH 2JLLA 3JWDH 2DJUA 2X44D 5C92A 5D7KD 2YPVH 5IFHL 1BBDH 2D31B 3SDXE 1S7TB 3RWCA 4S1SH 5JOFB 3VG9B 5C0FB 3ISWA 1KEMH 2ZUVA 4ZAKB 5HVHB 2ID5A 1I8KB 2VRAA 5J57B 4KXZH 2XTJB 4JKPH 3DVNA 1FSKB 1F4YH 4CAGA 1JL8A 5C3TA 1HKLL 1A6AB 4FXLA 4RAVB 3L3OB 3LS5H 5ICZB 1XGUB 4XPFH 5D7IA 3EFDH 1V7NL 2J88L 1LWRA 4KTEH 4OCSL 4R0LA 3MV01 5DD0L 3AMLA 4DWHA 1CD8A 1JNLL 3RNQB 1BJ8A 4HGMA 3MV7A 5DVKA 1MCFA 2F58H 2PXYA 3BVNA 3NACL 3BT2H 3RWDB 5CJQL 3DO7B 4Z76B 2DQDH 4YO0A 1WVZA 1U92B 5HYJE 3DGGA 1JFQH 4AEFA 5AYUL 1I7UB 1I4FA 4QRSA 4KPHL 2IANB 1JGUL 3KWWA 3OKDA 4LQFH 5F7EL 2DL9A 5F9AC 4JQXA 5DJ0A 1Q0XH 4PJFF 5EOCH 1CXLA 5CILH 5I6XC 1XCTA 5D7JD 2ERJC 3GFUA 2EICA 3UAJD 4HKXB 5FA4A 4PRIA 4ALAL 1HH9A 1RJZA 4UV4L 3BQUB 4K3DL 1PEWA 4GAYB 2JKXA 4WI3A 4FRWA 2HN7A 2ADJA 4WNQA 1IC1A 4UBDD 1RUML 2JB5L 3C8HA 3PQYD 1EUUA 3QDGE 4CGTA 4JPWL 2B4CL 4LLYA 1FFQA 3RWHA 1W8OA 3D69A 4LEXH 2A74A 5DQDH 2ZUWA 4GAGL 2GTWA 5EO9A 4U3CA 4GKZA 2G9HB 3KNBB 4POZC 5C09E 5E8EB 4NNXA 1ZT4B 2BVPA 2FZ3A 4FABL 4K55A 4OCYH 5C0BB 2OMNA 1AXSB 1C08B 5F9WB 1I75A 2ATKB 4P0DA 5E9DD 5FO8B 3WLWD 5I1KH 4HC1A 5D96B 3HPLB 3UYRL 2HJKB 3S35L 1KACB 3MBEA 1XCQA 1K5NB 5D71H 1DSFH 1NLBH 4DVRH 5LQBL 4YHZH 4X6CE 5DJZA 4ZNCD 4Y5YB 2XPGB 3CCHB 4Z7UB 3DIFA 3HG1A 5DMGD 3AREA 2XTJE 4ZXBC 4XP4L 2D0GA 3RWCB 1ADQA 1KBGL 5BS0D 1LP9A 25C8H 2DD8H 4W68A 3F62A 2ADFL 3WLBA 2DI8A 3WIFA 1AD0B 5T1DH 5EFIB 1U3HC 2YXMA 3THML 4V2BA 1TMCB 4YQXL 3H42L 4R8WH 5D7IB 4FQLL 2CR3A 5GGVH 4R0LB 4K3EL 3NCYS 2N56A 1I7RA 2EDHA 2O26U 5MP6L 4PB9H 4PJHE 3QG7L 4HQQH 4C57C 1IQDA 4WCYH 2OSLA 1F3DH 3T08A 2IANE 2PXYB 3QDMD 2H9GB 3T0EC 1DBKL 1XMWA 3K3QA 2NY7L 2EDEA 3SY0B 3VJ6A 1BOGA 2LABA 3ABZA 5F6IC 1I4FB 4WUUE 3OKDB 3O6LL 4M02A 5DC4B 2AEQL 3B5GA 1FORL 1NCNA 1LEIA 2V17H 2EECA 1XCTB 4PJEA 4HSQA 3INUH 3FHQA 5FA4B 3C5ZC 5CLWA 5C71A 1HH9B 1RJZB 4OI7A 4NM4H 4G43A 5IV2A 3O2VL 2ZSWA 1L0YA 4Z77A 4DGYL 2ADJB 4LPTA 2X89D 5F9OH 2JCCF 1VEPA 2WLZA 5GSVA 2W1NA 5HD8D 1LEKA 3RNKB 2XWBB 4MQ7A 4NZRL 3UTPE 4LLYB 3CSBA 4F8TA 3NPSC 2VR9A 4TNWK 1WTLA 2QSVA 5C0BE 4Y1AD 3RWEA 3LN5A 5EO9B 4GKZB 2XRAL 1QNZH 1F4XL 4MXVF 4N0RA 3PV7A 1QHOA 4FFVD 4NNXB 1ZE3C 4WI5A 3KXFD 2FZ3B 4MDIA 2A73B 2W07A 4ENEC 3BPCB 3S36H 3WKMH 2VDLL 1HILB 4DKEL 1ZANH 2ESVA 4HW6A 2NY5H 5CHNA 2CDFA 4TVSa 3GJEA 4Z7UE 1LILA 3P73B 3T0DA 2UY6A 1OGAD 5T1KB 3I2CH 4MQSB 4RGND 1Q9OA 1XCQB 3R8QA 3IDGB 2ZWLT 3K46A 4X9HA 4XXCC 5E0QA 3V6OC 5GS1A 3PWUB 4X5LA 1TTGA 4HJJL 4Z7OF 1UM4L 3EOTL 2HLAB 5DJZB 2IBGA 3K8LA 3HZKA 3KYNA 3DIFB 3HG1B 3AREB 4N0CD 4Y4HC 3ZDZF 1SVZA 3DSNA 3T3ME 4YHML 3O6FA 1HIML 1AE6L 4PJBB 5C9JB 1LP9B 5ICXA 1JBJA 4LGPB 5D7IE 3WLBB 3WIFB 1A8JH 2PR4H 4QKXB 4LKXA 4X9GA 1J87A 5FUCE 3NIGF 5FUZL 4LCUA 4O58H 2I25N 3MV7E 5JDSA 4EQ2A 2QR0A 1CT8A 1T5XA 2BY1A 3ARWA 4QHKI 2X41A 3OKLA 4C56A 5EIQA 3V0WH 1I9IH 3QUZD 1C5CH 3P2TA 3RZCC 1MWAL 2XXMB 5I1IH 1FV1A 4K9EH 2YMXH 1CN4A 2OSLB 4XP9L 4KK8D 2DQUH 2ED8A 1B0GA 2IBZX 1EXUA 5JZ7C 2XA3A 4CRPA 1FP5A 2B7DT 3PWPA 3EBAA 1BOGB 4P23A 4AIZA 4WGWB 4PRIE 3L3KA 4W4NA 4ZODA 4XWGL 2CQVA 1XF5B 1QFUL 1LEIB 4NNPL 4PRHA 4PJEB 3FFDA 3SGJA 4R7NB 4J3SA 4LVHC 1SJXA 1X5AA 2L0DA 2KZWA 1KTLA 3EDDA 3RUGB 3UBXA 3G08B 2ZSWB 1J0YA 1U36A 5IWLA 2NXZB 3GSRA 5F7FA 4Z77B 5JOPE 1WLHA 2E7BA 1U8OB 3SDXF 1SY6H 2CLVA 1K4CA 4MSWA 1LEKB 3O3BA 1IKFH 4KDVA 1M1SA 3X13A 4U6HA 3BRFA 3RVUD 3O9WC 1JNHA 2DIAA 2H32A 5CS7A 3UO1H 4WEBH 4LPUA 5E99L 3PWJA 4PJGB 5I1EH 3FB5A 1OSZA 1ZOXA 3LQMA 1RAMA 4TUKH 2EXWD 4RWHA 4Z95H 3S3SA 1S5HA 4MDIB 4X7TA 1NSNH 3FMGL 1GIGL 1EMTH 3GUTA 1GGYA 2ITDB 4ISVB 3HI6L 3E6FB 4JDTH 2ESVB 3GSVA 4R4FH 1S9YA 3DRQA 2CDFB 2MCPH 5ALCL 5GZOC 5JW4R 3GJEB 3LD8C 3HG1E 4ONFL 5C6WH 4FQJL 3O11A 3TT3H 4NGHH 2VDRL 3RVTD 3KAAA 5JIIA 1DANT 1OAUL 1RVFL 5D8JH 4YBQD 2VLLA 4XNXH 3GI8L 4PGBA 1DVFD 1LP9E 1BJ1J 2XOTA 3HZKB 3O4LA 3UTSB 1CL7L 2XQBH 4KZEL 2G60H 5DR5H 5IHLB 5BQ7A 3KJ6H 3O6FB 2EYTA 1UA6H 4CN1A 4FFWD 4WFFE 5DWUH 5ICXB 2I26N 1F6AA 1MCPH 4LKXB 3VFPA 1MRFL 2DS4A 3ARBC 2AABH 3SJVB 2JJTC 3WD5L 2R69L 5C0EB 4ESKA 2QR0B 3FT2A 2YPLD 2ZUXA 2DYPB 4C56B 4Q9RH 1KTDA 3GIVA 3LIZH 1RIUH 4O5LH 5EORH 1FV1B 3CLEL 5D2NB 2VB5A 1FH5H 2IMNA 5FGCB 2ZP0T 3Q6FA 3ARTA 4LIQL 2FECI 3WXWH 2ZCKL 1A7BA 2DN7A 3QI9C 4PJEE 4EI6A 3PWPB 4O00A 4ZS6D 1FRGH 4NO5A 4AIZB 2QSQA 3VW3H 3GGWA 3RUGE 4HIEA 1OAYL 3AB0B 1Q9LA 4JRXA 1MH5A 1FYTA 4P3CL 4PRHB 2PKDA 1DUYA 1LHZA 3FFDB 1A14H 2D0FA 3V79C 5H2BA 1E4KA 4YHNA 1NAMB 4PLJC 3ULUE 5KVDH 4OCWL 3K4DA 2F8VA 4LSPH 4ZAKC 5HVHC 4HFWA 1CGVA 3GSRB 4P46C 2J8UB 2ADIA 5I8EB 4Q58C 2CGRH 1IT9H 5IMOA 2W38A 5CGYD 3IU4H 2CLVB 1FSKC 5E8NA 3VI4E 5AG8A 5E2UL 1K4CB 3M45A 2AKRB 5HHOD 1TQBC 4U6HB 4FP8H 3UDWA 3X13B 3HZVA 2C3XA 2H32B 4XCNA 4F9PC 3HE6D 3T3PE 2CLRA 1ZV5A 3FB5B 2DRUA 2V5RA 3LH2L 3MZGB 3OQ3B 4L8SA 1YEJH 2DBLH 1QSED 2A6DA 2ESVE 5DJAB 4HMEA 1DTUA 1S5HB 4X7TB 2BOBB 5EU7E 3V0VA 5E6ID 1T2XA 3FQUB 3EDFA 4LMQE 5KVFL 3U0PA 2LU7A 3GUTB 4EJ1C 4OUUA 5ANMA 4J2XA 1BFOA 3GSVB 4N90D 4RNRA 1S9YB 3DRQB 4P5TD 5EB9A 3I6GA 1ORSA 3AAZA 3MOAL 3W5NA 3O11B 4WWKA 1HQRB 1N3NB 5DUPH 2Z31D 3BQUC 1KCLA 3MXVH 4GXVL 5IM7A 3D25A 3F7QA 3FOLB 2VLLB 2IPKA 3ULSA 1IVLA 1MQ8A 4UOJA 3O4LB 4Z5RB 3VWJD 3LRGA 5C0IA 1IL1A 3QNZA 3I02A 4ONOA 5SX5H 4XCFH 1QR1A 2EYTB 1X44A 1IGFH 4Q9QH 3F58H 3T0AA 1Z9OA 3MJ7A 5GISL 1F6AB 1ND0A 4C56E 3KPNB 1C1EL 4KROC 3VFPB 1OAQL 1TITA 3KJ4B 3QEQA 3GJFK 2P24A 4OZIA 5FGCE 1ZHNA 2VTFA 2NYYC 4KQ3L 1KTDB 1SJVA 2BXYA 3GIVB 3B3IA 3OR6A 2MHAA 3PWPE 1MAKA 5D96C 5EC1B 2VQ1A 3PJSA 4IM8A 3Q6FB 4X4YB 4QHUA 1XF1A 2K7QA 3GMQA 4JFHD 4NPYA 4Y5XB 1WFOA 5MENB 1H3WM 4PRHE 4EI6B 4N1HB 5EU6A 1MWAA 2BNRA 4NO5B 1CTOA 1FIGL 4ZFGH 3G5XB 4Z7UF 2M1KA 3GGWB 1Q9LB 4OFVA 1MIML 4KC3B 4Y8DC 1S7QA 1FYTB 4CMMB 3DBXB 4LVEA 4M1DH 5JHLH 4KAQL 2YK1H 1BMGA 4XBPA 5KSAD 4ZNEA 1UJTA 2DWDA 2A1WH 2CD0A 2FIKA 4M7LT 3VXSD 4YHNB 1WIOA 1QSZA 1WQVT 4M7LL 1YEGL 4HFWB 4WO4D 3T3MF 1Z6JT 1LD9B 2APBA 5IMOB 1NUDA 1QTYT 3O0RH 2C3GA 4OLWH 3MA9L 1I1RA 3OXSA 3VFOB 1T7WA 4YXHH 5D7IF 2IPUG 4G8FA 5EOTA 1P7KA 5EBWA 3HZVB 3OZ9H 4XCNB 1N5YL 3RKDD 4IOSD 2FLBT 4GW4A 4M5YH 1G9NH 3OJMB 2CLRB 2RJMA 4Y16A 4L8SB 3DVIA 2AV1A 1WBYB 3IETB 1I8MA 1YMMA 2YPKA 3M8OH 3C6LA 1HCFX 4LCWB 3V0VB 1X5GA 4WY7L 1BQLH 4JPVH 5C3LD 3U0PB 3SOBH 3L3HB 2XG5A 1Z3GH 1BX2A 4OUUB 3C08H 3IDUA 1BM3H 5ANMB 5C0CB 3RY6C 5IW6B 4RNRB 1FCGA 1MY5A 2MPAL 1OAKL 4MVBC 2Z93A 1ORSB 1MCDA 2VLME 3O4LE 3AAZB 4YDKL 4LSVL 2OK0L 1C5BH 3IU3A 2X1OA 2NY0C 4G6MH 3JWDC 3ILQC 5IM7B 3D25B 4HZLA 3IAGC 3QJFB 3ARFB 1I9RL 2IWGA 4P57A 2IPKB 4K94C 3ULSB 4PTUB 3GMLA 3KPRD 3TVMD 1ZSDB 3WDJA 1VESA 1IGCH 5C0IB 4NUGL 1QG3A 2VLRA 3QUXD 3PABA 5GGTL 1QR1B 2DQGH 2JJVA 1KJMA 1RZ7L 2C3VA 1B4JH 3LB6C 1IGTA 2YA2A 1ND0B 3WFDH 1OLLA 5E7BA 5HHMD 1JPTH 4ZUTA 4FMFA 5AZEH 5F1KC 4AL8L 3QEQB 2N4IA 4Q7DA 2P24B 5FV2A 1ZHNB 4EUPH 4R3SB 1S7UA 1U91B 2R1WA 2H45A 1CDBA 4QOKD 1AXTH 3QXAB 2IGFH 5B3NA 5JXEA 3B3IB 3LKSA 5DMIH 1NBZA 3LEYL 2MHAB 3S98A 3PJSB 3WCYA 5E5RB 4CW1A 4NKIH 4NRYA 4JRXE 3L6FA 4NPYB 4OIAA 1FYTE 5T5NG 5FKAA 2FJGB 3N9GL 4WTWA 4L4TD 1E6OH 3BUTA 2YA0A 5EU6B 4RCAA 4DUWA 4JRYD 1VFAA 3QEUA 5C8JB 1K85A 3NTCL 1K6QH 4UINH 4OLYL 3HN3A 5TDPA 4G9FB 5BV7B 2OL3H 3OXRB 5MEPA 4XBPB 1A6UH 4PJBF 2CKBB 1LP9F 2DWDB 4HMDA 2FIKB 5A16A 3UTTA 4MQTB 1ZLVH 4X7DC 4KJYA 1FE8H 1DBAH 3D39A 3HC4H 3U9PL 4GMSL 4YXKL 4AJ0A 2O93L 5FAAA 4RDQF 5MI0B 1MAJA 2H1PL 3OXSB 1BZ9B 3D1MC 1J5OH 2BRRH 4G8FB 5EOTB 3FQTA 1P7KB 1BGXL 4X8JB 3V5KA 4PJ5D 4U1LA 4HS6B 2P8PA 1KCSL 3WL9B 2E6JA 1LNUA 5DZLA 4IRJC 3FTGA 4GW4B 1DFBH 4Y16B 1ERNA 3G6AA 5L88L 2AV1B 3BP6A 5F7HA 5ANME 1I8MB 2VLJA 1YMMB 5I8OH 2YPKB 4DTGL 4RX4D 5C0CE 3VXNA 2NXYB 3C6LB 4G7VH 4UB0L 1YUHB 2DLIA 3TJEH 2L7JA 3VG0L 3IAQA 4RFOL 3TLRA 1ZAGA 2RFXA 5ICYA 5GS0C 3TA3A 4PJEF 1N0XH 4FQIH 2Z93B 1NCDH 1RJLB 3P0YH 1BAFL 2AJ3B 5E2VH 4KUZL 2D03L 2XACC 3RUGF 4S1QL 5D70H 4JANA 2BY0A 1KIQA 4P2OA 3IU3B 2BSSB 3ARDD 1EEYA 2B2XH 4Y5VA 2V9RA 1KB5L 4HZLB 4OT1H 3HC3H 4Y8AA 4O2CA 4JM2D 3GMLB 1DQML 3TZVD 5KS9A 3U79A 4OF0A 3ULUF 1FAIL 1DQDH 1WTGT 4WU5A 5D6CB 2R1XA 1H8NA 1V5JA 3CDFA 3QEQE 1ZT1A 2GKIA 3FB6B 2C3VB 4OZIE 3VI4F 4PJGF 3PHQA 2IAMA 5BO1L 4YNYA 4ZUTB 4P9ML 5C07B 4JO3L 1HZHL 3JWDL 4QY8A 3ZE2E 1YNKH 4I1NB 1BBDL 3T3PF 3BZDA 1S7UB 2R1WB 1TETH 5CCKH 1UXWA 1KEML 3VWKC 3F12A 3LKSB 4M5ZH 1NBZB 5EU6E 1P1ZA 2BNRE 4M6OH 3GHEH 2E5EA 4N0FA 2NY6D 4JKPL 4Z7QE 1Z5LA 3I75B 3X3FH 1Z9LA 1F4YL 3L6FB 4JO4L 5FKAB 4PLNC 3WFHA 1UADC 3OKMB 4XPFL 3EFDL 4ZNEE 5D72H 1KN4H 4KTEL 4BSVA 4AIXA 1PSKL 1C12B 1KIRA 1ZK9A 3FZUC 3QUMH 3NVQA 1IEHA 2FO4A 1LGVA 2ZG1A 1VFAB 4HXBH 1LK2B 4BQ9A 2BSTA 2NY2B 4GAFB 1N0LA 3P9WB 2F58L 5B22A 3BT2L 5A16B 1GL4B 3K8KA 5IT2L 3UTTB 4H1LB 3SDDD 1EGJL 3DJ9A 3LKOA 4PJ9B 4LQFL 3FN3A 2ZNXA 2RBLA 3VXUD 3B2UC 4L29A 1Q0XL 4NM8H 4KKAD 1PYWA 5CD5C 5CILL 1C7TA 3CFKA 4L3CA 5HGAB 3KLHD 3P4MA 3FQTB 1YMME 3MYJA 3V5KB 4O51B 1ZHLA 4U1LB 4MHHG 2DLEA 3P77A 1QLFB 1PQZA 3FTGB 3S34H 5JLZA 1S78D 3QIBD 5D2NC 5JXAL 3BP6B 2R2CA 3R8BB 2VLJB 1KGCE 4XVUC 4U05A 1G9MH 3BOVA 1AD9B 5KZCD 3GK8H 2RB8A 4N8VA 3RP1A 4LEXL 4PJXA 4HS8H 1ZTXH 5F7LB 1NGYA 4I2XA 2CO7B 1NKOA 2QADD 3U4EA 3TA3B 4F7PA 4V1DD 5JHDA 1XF2A 4U1JA 2LTQC 1T0NA 3LEXB 1FVDB 4P2CG 5BOPA 1IGMH 4P4KD 1GGTA 1MLBA 1LO2H 1UKTA 5K9JH 3EYVA 4OCYL 1ITCA 4JANB 2PCPA 3FT4A 2XXCB 2VLRE 2D7QA 4Y5VB 3VFNA 4JLRA 2J8UF 2LVEA 5E8PB 3GSXB 1EBAA 5HVWA 2E8ZA 5I1JH 5D7SH 4TRPL 3RVXC 1WZKA 5I1KL 4O2CB 1UB6B 5KS9B 1LVEA 4ZUWB 4JFFD 1G7LB 2HKHH 3QYCA 5EBGA 3BP5B 4MJ6A 2GW5A 5HGHA 2Q6WB 4OD3H 4WU5B 3BJ91 1QFWH 2GFBA 1ZT1B 2VABB 4QTIH 1DSFL 1NLBL 1P4BL 2EE2A 3QSKB 4DVRL 4J3UA 2IAMB 1T1XB 2GJ6B 2FEDD 4XMPH 4HJ0C 5J1TC 3ZKMC 2I9LA 3NBNA 1I9JH 4MJ4A 1A6ZA 5CEZD 1JP5A 1UXWB 5LXGH 25C8L 2DD8L 3ARGC 4D0BA 3SGDH 1P1ZB 3DTXA 3KYOB 1PZ5A 2PYFA 3DETC 1YPZA 4LIQE 3WNLA 3TJHD 3FAXA 1U8HA 3WFHB 1MRDH 3HAEH 4XHJD 2R2EB 4R8WL 2VC2H 5HI3D 5L2JA 1KIRB 3UTTE 4GBXD 4ZFZA 2GEEA 2J12B 4C59B 3TN0D 4HQQL 3D39E 4WCYL 5GRJH 4Q9CA 4HFUH 2A38A 3TM6A 4NKDA 5LJYH 4AH2B 3PL6D 4JFPA 4I0KA 3NCFB 3FKUS 5E7FA 4YZFE 2H8PA 4MZ2A 4PV9A 1T0MA 2N1KA 4GLRH 3TO4A 5BCAA 3CVIL 3DX6B 3T4AB 3FONA 2EO1A 3LKOB 2W92A 1JK8A 1D5ZB 4KMLB 4L29B 4ODHH 4PGDA 5DGQA 3UJTH 2V17L 1LEGA 4HGWA 4L3CB 3INUL 3P4MB 2GTZA 2VLJE 3MYJB 2W60A 3MV8D 2Z91A 2YA1A 4NM4L 4J4PA 5L2KB 4Q6YA 5GS3A 1GH7A 1VSCA 3P77B 1PQZB 1XIWD 2APWA 4BFBD 4ETQA 2VISB 1CDUA 2YD3A 5F9OL 2F9BT 4HLZH 2BVTA 4EEEA 4JAMA 3HB3C 3UBXG 4Y5XC 4D8PA 5DMKA 4N8VB 1NUFA 4PJXB 3QRGH 1HHJA 1NGYB 1DLFH 1M6OA 3ZSTA 3U4EB 1QNZL 4OZGA 1JGEB 1AGDA 5T1LB 4F7PB 5JHDB 1XF2B 1U8KA 4U1JB 5HGDA 1F6LL 1T0NB 1JF5A 2HT2D 5KS9E 4IDLA 5H37G 1UACH 1FNGA 1OP9A 1U2CA 5AD0B 3FT4B 3H7BB 5HHXL 3QQ9C 5INCA 3S36L 3WKML 4QXWA 5GRUH 4YHIA 3QXVA 1SHMA 3IDNA 1I1AC 1TNMA 1ZANL 4MZ3A 5DJXA 2NY5L 5GGSY 3CJJA 1OAXH 1EO7A 2BSRB 3VA6A 5J7CC 3CD4A 5HGHB 2W59A 3I2CL 1KB5A 4WU7A 2GFBB 3ZL4L 4RAUA 3VXRA 1JWMA 3S6CA 5L7XH 5F9JA 5EC2A 4I0PD 3QXTA 1D5IH 1T66D 4KDWA 1F42A 4KRPB 1FLTX 4RMVA 4KI5F 1REIA 1A6ZB 5I74B 4KI5C 1KXTB 3V2AR 3B8SA 3UJJL 1FFPA 2WIIA 3GB7A 4P59L 3X14A 3I9GH 3DTXB 2PR4L 5KJRH 3UTZA 1F02I 1PZ5B 4L8DA 5TGBB 5IVXA 2PYFB 4CVWA 1G7PB 4GKSA 1VADB 1U8HB 1AFVH 3MRNB 3QP3A 4IHOA 4PD4K 2Q20A 5L2JB 1CZ8H 1FDLH 1MI5A 1IRAY 3V0WL 1I9IL 1C5CL 3ARFC 5T3XE 1XGYH 5I1IL 5DT1H 4GW5B 4MA8H 2YMXL 3C87A 3EFFA 3VXQA 5I1CH 1J1OH 5IR1A 4NKDB 3IF1B 4JFPB 4PRNA 3ARPA 4PV9B 1T0MB 3VFTA 2XNAA 1V3LA 1F4HA 4MX7A 1RZGA 5D7JC 4QRTA 2BZDA 3OG4B 1S7SB 1DBBH 3Q5OA 1JK8B 3P3YA 4Z0XA 5CBAB 4FOMA 1JPSH 5SWZA 3SDCA 1LEGB 3OJ2C 3IGAA 3LPWA 3CFCH 4XNYH 1FHGA 4QRRA 1KJ3H 2GTZB 1UZ8A 1IM9A 4CVXB 2P45B 2W60B 2Z91B 3BKYH 2VDQH 3ZE2F 3CFEA 4JHBA 1C5DA 3MLSH 4ETQB 3A0OA 3MRBA 3P9LA 1BVLA 4PJXE 4LNRA 4UTBL 4I2XE 3BH8A 1SY6L 5HHVH 4JN1L 4K71B 2HA1A 4XTRD 4RAHA 5JHDE 4Y4KA 1IKFL 3RZWA 5DMKB 4B7IA 3W11C 1CIDA 1HHJB 1NCTA 4N9GB 1CU4H 1M6OB 5HTSA 3SDAD 3UO1L 2QL1A 2Z35A 3BP7A 5EU5B 1AGDB 4WI6A 4EN3A 3GDBA 5I1EL 1U8KB 1FL5A 5HGDB 2MNUA 5BV7C 3NMEA 4F9LC 4TUKL 4Z95L 1FNGB 1JYWA 3HHRB 4TUJA 3VRIA 1NEZA 2XKUA 5INCB 4YHIB 5IIEB 3O2WH 4OTXH 1YY9C 5A2IH 3MGTA 3B43A 1VDGA 4G5ZH 4WTZA 4JDTL 2PO6C 4PD4J 4R96A 4R4FL 3HKFA 5T33H 2MCPL 4MS8D 1VACA 3PG2A 2VE6B 1U3ZA 1FYHB 2AEPH 1B2WH 2EDYA 3TT3L 1QLEH 2P4AB 4UILH 4ZOEA 3O41A 3B2VH 1E4JA 1NDGA 3F7VA 3VXRB 5I1DB 1I1FB 2NMSA 5D8JL 4XNXL 1FIEA 3B9EA 5F9JB 4NQDA 4NN5C 2VKWA 2G60L 2NXYC 5DR5L 3DVFA 3KJ6L 3N1MC 5JW4Q 4CADA 4DUVA 1HYSC 1UA6L 1YPZE 1QFPA 4KDTC 5DWUL 1G7HB 2WIIB 3GB7B 4JJ5A 1CF8H 3X14B 1MCPL 2DQFA 3MR9B 4L8DB 4P2RA 4Y88A 5IVXB 2MFNA 2AABL 5IFAH 3ARZA 4QEGA 4NNYA 1XR8A 2Y06H 3BDXA 4LDOB 1FGNH 1QR4A 4FN0A 4IHOB 3SGKA 3MYZA 2VOTA 3TFKC 1MI5B 5DFVC 5DSCA 3LIZL 1RIUL 4GRLA 1VEOA 5D93C 4O5LL 1CI5A 2X4OA 5EORL 3NH7H 4F7EB 5AAWA 3SCMD 5JNYA 3VXQB 1NMBH 1FH5L 3EFFB 5IR1B 4I9WE 3RGVA 4KGJA 4X98A 3GSNA 2K7PA 4G6JH 4QXGH 3WXWL 2XNAB 2HMID 1T20A 4KV5E 2LU4A 4MX7B 1RZGB 4PJIB 2BJMH 4KKCD 4LSDA 4QRTB 3QCUH 2AJSH 4CMHB 3VW3L 4OFDA 2DM2A 4I18A 1KCVH 4Z0XB 3KPTA 1IE5A 4N0UB 3SDCB 3T77B 3OL2A 3IGAB 1S7VA 3LV3A 1A14L 1AXIB 3BGFB 1G9NC 1UZ8B 1IM9B 4BFEA 1AGCA 4JJHA 2E7LA 3BRDA 5KVDL 1K3IA 5IMLA 3VGHA 4LSPL 5I19H 3CFEB 5L6YH 2P5EB 3U7YH 1BVLB 4MMZC 1VERA 1GGCH 2FWOB 4LNRB 2CGRL 1IT9L 3IU4L 1W2KT 1YQVH 4QXUL 4OZGE 4FXGA 1WUNT 3CUPA 3U48A 1FFOA 4XAKD 4Y4KB 1HINH 5HI5C 2EO9A 4XT1C 1HWGB 4FP8L 2AQ1A 2OQJA 5I75C 4LCIL 3DURA 3BP7B 1MJUH 1T6VN 3DXAD 1FL5B 1YEJL 2B20A 5GGRY 1RZ8B 2YSSB 5JUEH 3T04D 2SEBA 3G5ZB 2AP2A 4PG2A 3IDMB 1NEZB 5H8DA 3L7EA 2DQHH 3MGTB 4L4VA 2HRPH 1MCEA 1MPAH 1CK0H 3VXRE 4KQ4L 4R96B 2FEEI 2VH5H 1J0ZA 3LAFA 1VACB 4YPGA 4J23A 1BD2D 1OB1A 4MJID 1EA9C 3OF6D 3WO4B 4M3KB 1HH6A 1OHQA 3O41B 1NGWA 3SGEI 5DUPL 1OPGH 1W0VB 1NDGB 1KN2H 3F7VB 4JG1H 1KNOA 3MXVL 1F97A 3VFVA 4LLQA 4YPJA 4Z78B 2ZUSA 3K8MA 1IGIL 1VGEH 4U6VH 4JFEA 4UIMA 4NQDB 4X4XB 3RPIB 3BSZH 3L3IA 3L7FB 3CIQA 3MROA 4LK4A 3J8F7 3V6FA 5IVXE 5TDOA 1E0OB 1J1PH 1IGFL 4Q9QL 1ED3A 3F58L 3ME0A 1WAAA 2IQ9L 3SE3C 3ARVA 1JHKH 1QSVA 4Y19A 3DPBA 4NP4H 4OFIA 4PG9A 2KBGA 4U6TA 1MI5E 2DQFB 3A6CH 5IHZA 3HR5B 3JTTA 43C9A 1UWXK 1A02N 4LRNH 1PJ9A 5D1XD 4NNYB 1XR8B 3TBVA 4YJZL 3QIUD 4WHYH 5CEZH 5C08D 1DL7H 1WEJL 4KK8C 5BJTA 5KS9F 4GRLB 4RZCA 2X4OB 1Q94A 4DEPC 4KVCH 3QRFM 1WT5A 3RGVB 1G0DA 3JTSA 4APQD 3Q0HA 4YGVA 3GSNB 5SWZE 5IROC 3BMVA 4N0UE 3PDOA 4QRRE 8FABA 3MGAA 4ZFGL 3D3VD 1IZKA 4K8RD 4I18B 5F3HA 4EZMA 2P5EE 5C7XH 4K7FA 2CRYA 4MA1B 5I2IA 4M1DL 1S7VB 1U8MA 3WXVH 5JHLL 5HI4D 3VXPA 1E27A 2YK1L 1DJSA 2J2ZA 3QHZH 4WFGD 3HE7C 2A1WL 1AGCB 3BYTA 2C3WA 1L0QA 2AAVA 1KTKE 3T2QA 5KSBA 1I85A 4HULB 2QQQA 3O3DA 4OLWL 5T5FH 1UJ3B 3CUPB 1FFOB 3VFGL 3WS6C 4YXHL 3TBSB 2ZUUA 4YHLH 5IF0A 2OQJB 3AROA 5D5MA 3RWIB 3DURB 1FPTH 4M5YL 4IJ3C 1G9NL 2Q7YB 3D0VA 1KLUA 2DKMA 2F5BH 1MAMH 3WJLA 2VXTH 2W0FB 4ODTH 3WUWB 1ETZB 3BKMH 2VDNH 2SEBB 4AEIH 5JIHA 3VFMB 1CICB 3QJHB 1A7RH 2E7CA 3L7EB 1BQLL 4JPVL 1I3GH 3SOBL 1Z3GL 1JJUA 3C08L 1X4YA 4DK6A 1W0YT 2NTFA 5KVGH 4TYUA 3RVWC 4QT5B 2LVCA 1T1ZA 5EIVA 2GAZA 4YPGB 4NN6B 4NQDE 3TBYB 5DZNA 1HH6B 2UV3A 1KJ2H 3G5VA 1CFQA 1C5BL 2ICEB 1F4AA 4G6ML 1KNOB 5IKCA 3HCVA 1OW0C 4TULH 4JFEB 1KENH 4LLVA 1MIEL 3FL7A 3OAZK 2O5ZH 1IGCL 3L3IB 3PGFH 2QHRH 5J56B 5SV4A 4Y2DD 3MROB 3U4BH 5HXMA 5E03A 4L8BA 4P2RE 3HI5L 4PJXF 3U30B 2DQGL 3VD5A 4NCC1 3UC0H 1ED3B 3CLFL 1NL0H 1IC4H 35C8H 4GG8B 2B8OT 1B4JL 4Y19B 2AGJL 4PG9B 1NCCH 3WFDL 5IHZB 4TTDC 1JPTL 1TTFA 3JTTB 4GSDL 5AZEL 2XN9D 3C60D 2WINB 1UCBH 4YFDB 4UI2A 2MQ0A 1YDPA 5TQ2H 4NQTA 2IGFL 4KHTH 5FOBB 2QEJA 3RWJB 3ZYOA 3JTSB 1HXMA 4X6FB 3HUJA 1QACA 1S7RA 4NKIL 3H2WA 4ZS6C 5FO9A 5LGHH 1FLRH 5E1AB 3PDOB 2D4DA 3BISA 1QUNA 2HT4D 3PP4H 1INQA 2FCBA 1HEZA 3PXJA 1QRND 1F13A 1CCZA 5KW9H 3PDGA 3VFSA 3V5DB 2FBJH 1T83C 3NIFE 2EIBA 1K6QL 4UINL 3S37H 3K2MC 3MRJA 1U8MB 2OL3L 4KRPC 3BZEB 1E27B 4L3EB 1A6UL 5KAQF 1J8HB 4K7PX 1MCCA 2W9LA 5TE4H 1P7QD 3L3DA 4EDXA 3KPQA 1JV5A 5J1AB 5SX4H 3V0AC 5KSBB 4CU6A 1A6WH 3PP3H 1WFNA 4ODUA 4R2GD 1X6LA 2AK1H 4M93C 1YN7B 4H8WC 3HE6C 1J5OL 1RV6X 2BRRL 4TNVF 2VZSA 3HNVH 1RZKC 5MHSD 4UT7H 3BJLA 4QTHA 2WBJC 3PV6A 1D9KA 4L4VE 4HWNA 1TXKA 4NKOB 4QRPA 2NX5D 5I8OL 2NZ9C 3WSQH 1LE9B 1CG9A 3K4ZA 3TJEL 4P5TC 3FQRA 3P4NA 5A1AA 2D2OA 3WN5A 4HBQA 4NCC2 2NTFB 4NFDA 3JVGA 5TE7L 1X5LA 1N0XL 1T1ZB 4JFEE 5FK9A 2GAZB 3O2DH 1NCDL 1CBVH 3P0YL 5E2VL 3EDEA 5D70L 4OSUH 3LDBB 1BJ1H 3G5VB 2COQA 3VWJC 2DB8A 2B2XL 4FTVA 3DYOA 2HJLA 4OT1L 4X7FC 5IKCB 1FO0B 4YX2H 1EK3A 1WAAE 2JJSA 5SWSD 4Y19E 2DQIL 1F11B 2VWEC 1JVKA 1NFKA 4L9LA 2PYEB 5GJSH 4L8BB 1B0RA 1NGXB 3H9SD 5E9DA 12E8H 2BVYA 3MA7A 1ZLUH 3V4UL 1E6JH 2G2RB 5EUKB 5FOJA 4YXLH 5J6GA 1VKXB 3C8KA 3KDMA 3NFNA 4DW2L 4FQPA 1YNKL 5DVLA 4AZ8A 4POZD 3WFBH 1DE4A 4WIQA 2MTPA 3QUYB 2DIBA 5CCKL 3GNMH 1VFUA 4JHZA 3CMOL 4WFHD 4CVUA 2DI7A 5JIPA 4M6OL 3UXFA 3GO1H 1U93B 1J12A 3SPVB 3X3FL 3HUJB 1S7RB 3QG6A 2AJVH 4JO2H 4HUWA 5FO9B 2FR4B 3E3QC 3VMPA 3HRZB 2H2SD 5BS0A 4WV1B 1KCKA 4L3EE 5K59E 5D72L 1KN4L 1HEZB 2DJSA 4OGYH 1QFOA 2F53B 3QUML 3VFSB 1ZGLA 4HXBL 5B4MC 5AG9A 1X6NA 1N4XL 4MAYA 5KSBE 3MRJB 4ORZC 3B9AA 1CDJA 5DUMH 4U6XB 4JKWA 1YNTA 2CDEA 4ODBD 4WO4C 4CDGC 4ZFOL 1SQ2N 1MCRA 4U1GC 3WO3B 4EDXB 3KPQB 3F8UB 2F74A 1FG2A 3CMGA 1H5BC 5DFWH 1P84J 5D5ME 4M8QA 3PDDA 5IVXF 3QDMA 2ICWA 4HKJA 3RKDC 4NM8L 2HG5A 1U3HD 3CFDA 4NSKA 4LFHG 15C8H 5E5UB 4UDUA 4QTHB 1BFSA 3L3GA 1F58H 1HHHA 3VXMD 3S34L 1JWSB 1NC4D 3GRWH 4OV6F 4P9HH 2DQEH 4PJCB 3PV6B 1D9KB 4QRPB 2NW3B 5KN5A 2O61A 1NC2B 1LK3H 5ISZB 4F37K 3F7RA 1CG9B 5D1ZD 4YDIH 5D6DA 3GK8L 1A6PA 4PJIF 3FQRB 4KJQC 1ZTXL 5C2BL 3P4NB 1JGDA 4JG0L 4CMHC 2X89A 2XICA 5DI8A 5FK9B 1U8JB 1GC1C 2Y6SC 4OCRH 1LO2L 1AJ7H 5K9JL 4D9RD 4BK5A 1JI1A 4BH7B 4FTVB 4XC1H 2HFEB 2HJLB 4R9HA 5EOQH 3C6SA 3QUXC 5I1JL 1JMXA 4O9HH 3DX8A 3U9UA 3KXFA 3TYGL 3BN9C 2XIDA 2HKHL 5DMYA 1S8DA 1MCLA 4KJPC 3LQZA 1M7IA 4OD3L 4XX1G 4JPIB 1QFWL 2B1HH 2UWEB 1DQTA 3MA7B 4QTIL 4F15B 2NNAA 5J6GB 2W9EH 2NY3B 4PJ8C 3CC5A 1ZEAH 2D7MA 3IKCA 4IOIA 2P8LB 1GZQA 2X70B 1MVFA 4XMPL 1S9XA 3H9HA 1WZMA 3RAJH 1I9JL 5EBLA 3HUJE 5J4MA 5FO7A 2CMRH 3BPNB 5LXGL 1A7OH 3W82A 4ENED 5I30H 1QPXA 4U1NA 3OKNA 4LDEB 3MJ9H 3QG6B 4RRPG 5IW1B 5DK2A 4EUPA 4HUWB 2HFTA 1HHKB 4E9LA 5BS0B 1MRDL 4X4MA 3BAEH 1X4ZA 2VC2L 4XNZC 1DEEA 3MUZ1 2EDKA 1ZGLB 5MERA 1R24B 4MAYB 5SWQA 4FXKB 4TUOA 3QA3A 4HFUL 5E56A 4LARH 2CDEB 4JGJA 3RDTC 2MJWA 3MV9D 1YEHH 4XPBH 2X10A 1KF9B 3QUZA 4Y4HD 5C6TH 4M8VA 1WC7B 2WLYA 4K8RH 4RISH 2FSEA 4D2NA 2OL3A 3QDMB 2ICWB 2XG4A 4ODHL 3P0GB 5ESQA 4ZUSB 2HG5B 2ADGB 3MMEA 2X05A 1V7NH 4QRPE 1G7JA 2ICES 1AO7D 2P5WD 4UDUB 5M94B 3L3GB 4IRSA 3UJIH 1B4RA 1HHHB 4EI5C 1VFBA 1LO0H 3QULA 5GJTH 4ZO7A 1RD6A 2VZTA 3NACH 2O61B 3RZCD 1A6VH 1P2CA 3U1SH 2IG2H 4JO1H 5K93A 5HYEA 1JGUH 5JZ7D 1JGDB 1JTTA 5F7EH 3REWA 4AEEA 4GRWH 4LRIC 3JSSA 4FTVE 5DI8B 4EOWL 3GMMA 2HLFD 4PBVC 5I0DA 1EEQA 4W6YB 4L8CA 5M7QA 1QHPA 5CJBA 2X4SA 5HYFA 3QO0A 4ALAH 3B9KC 4QHMA 3NCYP 1UACL 5DFTA 1I8LA 4LHUA 4NQUA 4JM2C 4JFXA 5DHYB 3JZ7A 3NIFF 4YHKH 3QH3A 1R3HA 4LKCA 2J4WH 5GRUL 2UWEE 3C6SB 5E9DE 2FL5B 3EKCA 3DX8B 3U9UB 2JB5H 5K9QG 1GOGA 1OAXL 5EZLB 4DN3L 4GG6A 1UJ3C 2LV4A 1S8DB 3LQZB 1M7IB 2BC4A 2IADB 1OWWA 4GAGH 3GKZA 3L5XH 4I48A 1Q38A 1IC5H 4IIQC 3O9WD 5L7XL 3CC5B 4TN9A 3UROR 3NOIA 1T21A 3IKCB 3EYOA 1GZQB 4FABH 5F1IB 1C16B 5IVZA 1S9XB 3FRPA 4IRZH 3H9HB 1CICC 5EBLB 1A1MA 3H7LA 2CLZA 2MKLC 3X12A 1CGWA 3C2SA 5BS0E 1DVFA 1S9WA 1KCUH 3BGMA 3KYMA 3JWOC 3RJDA 2H3NA 4OGAD 2XQYG 3T0BA 5ESVA 3CZFA 2H6PA 5DK2B 3ALXA 4HLJA 1T3FA 4F58H 1AFVL 2JELH 1F5WA 1DEEB 1CZ8L 1FDLL 1Q0YH 2APVA 5B8CA 5MERB 3WKNA 4MHHI 4KK9C 3BPOC 5CZVH 5DT1L 4DGVH 3IS1X 1HNFA 4OBRA 3OJVC 1CFVH 5I1CL 1U8NA 1YC7A 3QA3B 4NN7C 3QDME 2YPLA 2EE6A 3QFDB 1IC7H 5D1QB 4XWOC 1UWGH 3QUZB 4HX1B 3QUMA 4U7SA 5IOPB 3TPUA 3D85D 4KKAC 1MHEB 1DBBL 1S7XA 3THMH 5IB2B 1MHHA 1ZHKA 3FB8B 4HCRH 5E2JA 1NANH 5ESQB 4L5FH 3MMEB 3CFCL 4XNYL 5E2WH 3QDGD 1KJ3L 2P7TA 4OKVA 4P2QA 2VR5A 3BKYL 2C5DC 2VDQL 3QG7H 4IRSB 4OAWA 4YBLB 4X8XA 2FHFA 3MLSL 1RY7B 4U0RC 4MB3A 2CXGA 4JZJC 3QULB 5C09D 1VHPA 4F7MA 1T1WA 1P2CB 4JFDB 3VA2C 3P11H 3RX7A 4QHNA 2AJYH 1A6TA 3DX7A 5F7YC 3REWB 1BVZA 1CU4L 1FORH 3QI9D 4P4KC 1U3JA 3GMMB 3E6HA 5CEYA 1Z0NA 2B1AH 4L8CB 5HHOA 5K59F 2APTA 3QO0B 1G0YR 2KH2B 4G8IA 4QHMB 3KXFE 4WUKH 5JDJA 4LHUB 4DUXA 4YC2B 3TIDA 4JFXB 3QH3B 1EVTC 2AJZA 4NDMA 1F2QA 1R3HB 3MFFB 4OZFH 5KSBF 4KK5C 4NC1E 3NN8B 4LKCB 5F71A 5HY9A 4W4OA 1H0DA 2X7LA 2OTUA 4OTXL 1Q9KB 2EH7H 4PLJD 1QSEA 2C26A 1AP2A 1IKNC 3SE4C 4ZAKD 1J0KA 2F54B 5EPMB 3MRGB 4P46D 2QTEA 4GG6B 4NZRH 5T33L 3B6SA 5E6IA 2Y36H 2AEPL 3OKOB 4RGNE 3S96A 1B2WL 3AS3A 1X5IA 4HHAA 1QLEL 5LBSH 4I48B 4WHDA 1QA9A 4G3YL 3B2VL 2WWKT 3REVA 1NGZA 1GGBL 3MODH 4OF5A 1T21B 5DRZA 1FNFA 4G42A 5IVZB 3CXHK 5A2JH 1NLDH 2Z31A 3BGAA 4DKEH 4NZJA 4RGMB 3X12B 5I9QC 4X4ME 3B9DA 5FDWA 3BGMB 5DURB 3KYMB 3TEUA 1Z0MA 1CF8L 3JV6B 2H3NB 1G6RH 1R3KA 1CGUA 5ESVB 2A77H 2Z92A 3VFUA 2H6PB 4JB9H 5IFAL 2R29H 5DYOA 2Y06L 3PWLA 1T3FB 3DX9A 1OTSC 1ZLVK 4B7LA 1FGNL 4M61A 2EYSA 2DQJH 2KPNA 1JHTA 1EJ6A 4BQ6A 4FNLH 1TPXB 3PL6C 4UIKH 5B3JE 5B8CB 1HNGA 5CMAA 3BQUD 3CSPA 3NH7L 3TP4A 1NMBL 2RCSH 1AE6H 1U8NB 3HAEA 1U42A 4G6JL 4QXGL 1GGIH 3ZTNH 3QUMB 4JDZA 5IBUG 3UBXI 1TJGL 4MJ5B 1T89C 4X83A 4LCYA 2BJML 3QCUL 2AJSL 3EJJX 2HVKA 1DBJL 5B39A 5K9KB 2GI7A 2IBZY 1S7XB 1BZQK 1MHHB 1ZHKB 1YMHB 2DWEA 1XT5A 1XIWC 2P7TB 3DGCR 3QUKA 2D9CA 4OKVB 1CVSC 1A9BB 1A2YA 3QUYC 4P2QB 5C0BD 4OAWB 5I19L 5L6YL 2MMXA 1S9KC 1GGCL 2NYYD 3D48R 1VB9A 3HUJF 4ODWA 5KSAA 1X3DA 4F7MB 5L9DH 2G5RA 3MACH 3VXSA 1HINL 1RHHA 4WV1C 3ULVC 3MRIA 2BOCA 5IG7A 1A6TB 3CXHJ 1V7MH 2HT2C 4XWGH 1VENA 1QFUH 1OD9A 1MJUL 3BZFA 3E6HB 1IILE 2BVOA 1IAOA 5HHOB 4G8IB 2AVGA 5JUEL 1RUPH 4GG6E 1A1OB 2AJZB 4NDMB 2YEZA 5IEHA 2ZOKA 1H0DB 1NAKH 2DQHL 3K4AA 2OTUB 3ZHLA 2HRPL 1AP2B 1CK0L 1KPRA 2VH5L 3IJSA 3B6SB 5E6IB 4E41A 3MRKA 5CIPH 1V8HA 3S96B 4I0PC 1IAKB 5FGSA 1T66C 3K80A 5CSZA 1OPGL 1H3XA 1KN2L 4I5BB 4JG1L 3REVB 1NGZB 4PJCF 2XKSA 1VGEL 4PJDA 4U6VL 3TNMA 1MHCB 3UPRB 1S5IH 1IAMA 2AK4D 5DRZB 3BSZL 4G42B 1RULH 4LOUD 1H3TA 1GIGH 2APFA 1N2RA 1RI8A 2Z31B 4F7TB 3GBNH 1MHPL 4F7CA 2PXYD 1J1PL 3MOQA 1Q9WA 3VE0B 5FDWB 3TVMA 1WWAX 1JHKL 5ID0B 4NP4L 4XCYA 1G1YA 5FDYA 5FYKE 4MCYA 3A6CL 1R3KB 2MKWA 1WFTA 3FQWA 1PW3A 4ONFH 3MLWL 2Z92B 1OARH 4LRNL 3NCJH 1DR9A 4FZ8H 5DYOB 5EU4A 3DX9B 4MVBD 1OAUH 2EYSB 2YPLE 5CEZL 1JHTB 3NCMA 4JVUA 3UYOD 2H26A 1PBYA 5CMAB 4NQXA 1EFXA 2NY0D 2VZ1A 1KC5H 4UU9A 4KVCL 4PREA 5DJ6B 3ILQD 2VJXA 4G6FD 4IOFC 4X5XA 3L5HA 2RHEA 4N5ED 5ERWB 3TC9A 2IH1B 2UWEF 1JUFA 4QOKA 3HNTL 3RHWF 4WDIA 4F15C 2BK8A 5IMKA 5FFLA 2JK5A 4P2QE 5JOPD 5KG9A 3GKWL 2X42A 3CDCA 2DWEB 3WXVL 4L4TA 5E5MA 2X9XA 4KZDL 3QHZL 1A2YB 4BUHA 4JRYA 1RK0B 3P9MA 1BWMA 3HLAA 3CLEH 2YRPA 3Q3GA 4XTRC 4OCLC 2ARJA 3MSPA 4ODWB 1MREH 4UNUA 5JA8B 3EO1B 1D5BB 5T5FL 2J6EA 3H6JA 3SDAC 5HHOE 2AXGA 3MRIB 2BOCB 4PRDB 5IG7B 4YHLL 4JPKH 5T1KD 3PGCA 1HWHB 5GHWH 3PHOA 2FX7H 2E27H 3STBA 5IP4A 2F5BL 1MAML 1IAOB 5DVNA 5A43C 2P46B 2VXTL 1QSEE 2Y25A 1M71B 1KSRA 4ODTL 1RK1A 5HVGB 4JFYA 3BKML 3BI9X 2VDNL 4PJ5A 4JKMA 4OCWH 3ARED 4AEIL 2ENYA 1P9MC 4J8RA 4S1DC 1UEYA 5HPOA 2YEZB 1I3GL 5IEHB 1N64L 5JW3H 4P49A 4AENB 1ACZA 3EO0A 5E2UH 4L1DA 4PYGA 3ULVL 5AUMB 1F3JA 4LASH 4N90E 3WYRA 5KVGL 3S3JA 4E41B 4XRCA 1MFNA 2G5BA 2BRQA 2ED7A 1KJ2L 4WFFD 2EEBA 3MLTA 2PNDA 4TQEL 3SBWC 2KUTA 4PJDB 3TNMB 5IJVA 4TULL 1KENL 1P5VA 2DIJA 1X5KA 2O5ZL 4ZSOB 1JPGA 3PGFL 2QHRL 3NAAH 1IARB 1P6FA 3ARDA 3U4BL 5KVFH 1N2RB 2EDFA 5FHBL 3UC0L 1NEUA 1NCBH 4Y4FC 4LLUB 1Q9WB 3S88H 1NL0L 1IC4L 35C8L 3O6ML 3TZVA 4M9OA 3TVMB 4AQOA 4XVTH 2V9TA 4GO6B 1NCCL 4MCYB 1Y6KR 4PLKD 5CEXA 5BZWA 1XGQB 4YHPA 5GS0D 1UCBL 5EU4B 3ZTJH 3QQ3A 3IDJB 2QSCH 5CP7A 1FZJB 2VMFA 4YWGH 3RIFF 3SCMC 3U7AA 5FKPA 3T09A 5MEOA 1CFSA 1J1XH 2B5IC 4KHTL 2H26B 1AGFA 1EFXB 4FG6C 4UU9B 4PREB 3GEWB 4X5XB 1JF1B 2EYRB 1MFEL 1FLRL 4JFHE 3RFZC 1OOAA 3HS0A 1JUFB 4QOKB 5T1MA 3O45B 1MCKA 3ULUD 2WNGA 4FZEL 1CR9H 1C1EH 4U1IB 5IMKB 1OAQH 4LSTH 2JK5B 2R39A 5KW9L 4PRAB 2FBJL 3L5IA 3LQAC 4HF5L 4R4BB 4L4TB 5E5MB 2QBWA 2CRZA 5TE4L 4JRYB 3VXSE 3KLAA 5LGJB 2ORBH 3A6OA 2YZ8A 3HLAB 3BRGC 3MUGA 3PF2A 3SO3C 4HPYL 4OB5H 4CUCA 1MJJA 1A6WL 1M05B 3QWRD 2NY4B 2AK1L 1YY8A 1DQQA 2WBKA 3EZ8A 2AXGB 2OTWA 2O5XH 3FO0L 1ZA3A 1MCWW 3SDDA 1PKQA 1CYGA 4UT7L 3PGCB 1LO5A 1MIMH 3KYKH 3PHOB 5J9PB 1ZVHA 3VXUA 3QNXA 3C5SA 4HWZA 1U8QA 2OXHA 4JFYB 4ZUVB 3UTSD 4W81A 4PJ5B 5D1QC 3WSQL 4B53A 5B3JF 5DO2C 3FO9A 5FGBC 4E41E 1N6VA 3O6FD 3QIBA 2GSIA 5TDNA 5T3ZE 5CKAA 3L95B 5I16B 3EO0B 3MA9H 5DHXB 1F3JB 3MRLB 1TZHB 3AUVA 3K81A 1MEXH 3JWNC 5KSVA 4PJDE 3O2DL 4XRCB 2XY1A 5D9SA 3B2UD 1YNLH 3AY4A 1N5YH 3SJVD 5IK3A 4OSUL 1XF4A 4ELMA 2V2XA 1ZLSL 4LU5L 4V1DA 1CL7I 4KWUA 2DYPD 4YX2L 5IJVB 3EUUA 2EIZA 2X4RA 3LN4A 3LSOA 1BF8A 3K1DA 4WY7H 5F89A 3ARDB 3D0LB 4XVUD 12E8L 1D7FA 5E24E 1NBVL 1E6JL 1LDPL 2YC1A 1DUZA 4IS6B 3PWPD 4PUBL 4JFFA 3QIUC 5HHME 2OJEB 1F00I 2BNQB 4YDKH 3RBGA 5CEXB 2NLJA 2YKLL 4LCCC 1I3UA 3UYPA 1FL3A 2W9DL 4XVJH 3WFBL 1T2QH 4YDLB 3FT3B 5FKPB 5MEOB 4APQC 1CFSB 4QOKE 3GNML 2ATPB 3NZ8A 4FQXA 4GG6F 3GI9H 2X4PB 3CPLA 1HOCA 3LOWA 5C0NC 1OTUD 4KTDH 4OCNC 4UUJA 1T6WA 1S3KL 4JO2L 5BVPH 3O4OB 3HS0B 4MXWH 5HPMA 4L4TE 3RI5K 2PTTA 4K3JL 4HV8A 1CGYA 2R2BA 4OGYL 2FIRT 2NY6B 4JRYE 4EUPG 4M1GH 5IHUH 4AL8H 3SQBA 1QD0A 2B0SH 4LPVA 1ZXQA 4GKNA 1SJHB 4DAGH 5DUML 4JY5L 3FB7A 2ED9A 3HA0A 1I9EA 3ZKMD 4J3WA 3FQNA 1H3GA 2G75A 3OTTA 2X4TA 4GBXA 3TN0A 2EDQA 1J18A 2P8MB 1QFWM 5ABDE 2GK0A 4NUJA 3ARGD 4LHJB 5ACLA 2ZOLB 3MPCA 3N9GH 4XBEH 1A22B 2DLHA 1KT2A 4OI8A 2DLFH 15C8L 2Q76B 3DETD 1PKQB 3LQAL 3N0PB 4PJ5E 3TYFB 5I73C 1F58L 1TPXC 3VXUB 4NCDA 5C0DA 1EX0A 4NQEA 1U8QB 3HC0A 4P9HL 3QIWC 1R5VB 4YEFA 1ES0B 1LK3L 3O8XC 3O4LD 2VLMD 4FFYH 3V7AG 3WJJC 4ZQKA 2J5LC 3FO9B 4YDIL 5J11B 4QNPE 1XIWA 3QO1B 3SEPA 3O3AB 2F5AH 2I07A 2GSIB 5J1SC 1SM3H 1NCWH 4YXKH 2VITB 1BPVA 4K2UH 3UMTA 1T2JA 5HYJB 5KSVB 1EZVX 5FCUH 2O5YH 5D9SB 4OCRL 5IK3B 1AJ7L 3OB0K 3DV4B 2QADB 3C09C 3A6BH 2R9HC 4IDJL 4ELMB 2V2XB 4XC1L 4Y2DC 5EOQL 1XGTB 4V1DB 2IMMA 5L88H 5BRZD 4O9HL 4IEFB 4MNQA 3AMKA 3LSOB 1RHFA 1QFHA 5F89B 1KJ2A 3P30L 5EBMA 1OCWH 2XWTA 1KG0A 4RFOH 3HB3D 2R23B 1CDIA 5MEND 2XZCL 3C60C 4X6EA 3TCLA 2YC1B 1DUZB 5DK3A 1ZEAL 4DOHB 4UDTB 2NLJB 3RQ3A 1VGKA 3BD3A 3EHBD 3MCLH 3RAJL 4RQQA 5I76B 1MVUA 2CMRL 1A7OL 3NZ8B 4FQXB 1PG7X 5I30L 3FRPG 3QQ9D 3RIAF 4HUUB 3CPLB 1I1AD 2X1WL 3WS3A 3MJ9L 2Q8BH 1I1CA 4UUJB 2NQCA 4X6DA 1RJCA 3NPZB 2BP3A 3BAEL 4DKAA 1D6EB 5EO0A 3MLVH 4LAQH 2WWKO 1JGVL 1NMCB 4P4RA 3U6RA 1FQ9C 4K94H 3GSQB 4LARL 3FB7B 3RA7L 4X6CB 1T1YB 1YEHL 5EZOH 4XPBL 5AZ2H 1A0QH 4ODXB 5C6TL 3FQNB 2G75B 4GBXB 4R2GC 4LCWD 4GKOA 4WW2F 1PKQE 4K8RL 2QKIA 4KI5D 4RISL 2GK0B 5E6ZA 1AHWC 4WW2C 1RQ5A 2ZUTA 1EEUA 4JO4H 4WHTA 3VXUE 3DSFH 4LQ1A 5F7WC 3D6GA 5C0CD 3IRPX 2VNCA 5HJ3A 5CJXA 4PGCA 1TCRA 1PSKH 3WFZA 4CVZA 3BP4A 3UJIL 3ZYIA 1FNSH 3DWTA 5DXWA 32C2A 4NQEB 3MRPA 3HC0B 4OBSA 4OQTL 4EBQL 1LO0L 4N0YH 5GJTL 3ARFD 3UZQA 1UWXH 1MELA 4TSCH 1A6VL 1CXKA 3HRPA 5IT2H 3CH1B 3U1SL 2IG2L 3IJYA 4ZQKB 4PJHB 4JO1L 1EGJH 5IB3B 4JFZH 1CDCA 4LAJH 3FO2B 4WHCA 3QWQB 3QXDA 3RWFB 5FCSH 5I1GH 4ELME 2GJJA 4V1DE 1AGBA 4B0MM 3VMNA 1F8TH 4WW1A 4WUUB 2Z4QB 4HKBA 4YHKL 1MOEA 3NGBC 2D7NA 5L0QC 3VRLE 2J4WL 5JXAH 4NRXA 1ADQH 5F96H 1PVHA 3I50L 4MNQB 5I1LB 3ZDXE 4JCMA 4JFFE 3W0WA 3DROA 5GZNC 1BJMA 4R4NC 5EBMB 4DOHE 1QLRA 2XWTB 1RUKH 1KG0B 2VKXA 1UQSA 3FN9A 3L5XL 1IC5L 4H25A 1MJ7H 4X6EB 4JHWH 3TCLB 5DEFA 3W11D 1AQDA 5EU6D 5LGKA 2K9UA 2OX5A 2EIEA 4LPXA 1WCBA 3WHE1 1VGKB 1Q8MA 4IRZL 8CGTA 1WBXA 4XB8A 5DEGA 4G9FD 4OLZL 4RQQB 4LLWA 3AM8A 1OF2A 2C1OA 4TRPH 4CU7A 1FZMA 5BW7C 1HCVA 2XY2A 4U6YB 1KCUL 1ORQB 2H2SC 3TV3H 1N6QL 1YY9D 3G04A 4PRPD 1CS6A 2PO6D 3NFSL 5GS0H 4X6DB 1A3LH 3SKOB 3KG5A 1P4BH 4F58L 4X9FA 2JELL 3CVHA 3E2HB 5DK0A 1Q0YL 4PJDF 5CZVL 4DGVL 1CFVL 4XPTH 2P47B 1IC7L 3MUHL 4WI4A 5A2LH 2Q7NA 2QSTA 4JZNA 2NXYD 4WWID 1UWGL 3ULUH 4WVRA 3VXOA 3W9EA 1HYSD 3QZWA 3HAEG 3DVNB 5FIEA 2F8XC 1R5IA 4B41A 2NTSP 1QYGL 2M8XA 4WHTB 3OAZH 4HCRL 4NQEE 1KGCD 3L3JA 5HGBA 4L5FL 4DKFH 4LHQB 4EKXA 5E2WL 3LKQA 3OG6B 5HJ3B 3VFWA 4PGCB 3T4YA 4S11A 5DMJB 5B39G 4R97C 4CVZB 2OCFD 2BVQA 3BP4B 2NW2A 1X5HA 3IFNH 4QXTA 4NZUH 1P5UA 4HKZA 3ALWA 1EVUA 32C2B 2YN3A 3MV7B 3MRPB 4PS4H 5D1ZC 3TFKD 3BVNB 5DFVD 4NKQB 3P11L 1JZ3A 1T7YA 4YO0B 3DGGB 2AJYL 3CVIH 2V5YA 5M95B 1DBMH 3MRQA 4Q6IA 4AM0A 1E4WH 3GRWA 4QRSB 3KS0H 3KWWB 3EDKA 3QXDB 5DJ0B 1RU9L 2PF6A 1MFBH 4LDLB 4ONHA 1W72L 2B1AL 4MNQE 4PRIB 2R4SH 4WW1B 3UP1A 4WUKL 4RWYH 5C07D 5DQ9A 4HLZG 5DJDA 1JIBA 2HN7B 3DXAA 4WNQB 4NRXB 2EH7L 3JV0A 4HK3J 2A2QT 2NY4C 1F3RB 3W0WB 3DROB 4HK3N 3KPOA 3RWHB 5JORA 4H26A 2Y36L 3D69B 2A74B 1Q1JH 1UQSB 2GTWB 4M6AA 5LBSL 1T03H 2ZPKH 3VD7A 5HI5D 1HQ4A 4H25B 4OIIH 2UY7A 3BHBA 5DEFB 4C4KT 1AQDB 1AKJD 1NDMA 3MODL 5FYJE 2B39A 4WFED 5JA9A 2EZ0C 3TBWA 1KTRL 4EXKA 1WCBB 5CZXD 2BVPB 1BD2A 3OF6A 3FN0L 1UC6A 3ROOA 1WBXB 5HHXH 2Z8WC 2NY2D 1NLDL 1R3LA 5DEGB 1EO8L 4I4WA 5DEZA 4X6DE 4LLWB 2C1OB 4G7YH 1MNUL 4KXZI 1FZMB 3Q48A 3VGBA 3MRCA 3UTTD 3SKMA 4ZOBA 1G6RL 3MBEB 3G04B 4QNPF 4PJ9D 4N9OB 2A77L 4JB9L 1J0IA 3IJHA 3ZL4H 1AR1C 1UH4A 2R29L 4U0QB 3QFJA 2OZ4A 3TGXA 3OJDA 2DQJL 3CVHB 3RX5A 3V7MA 4FNLL 1U8IA 1NAMH 3PP3K 1BF2A 4UIKL 5F21B 4RGOH 3MJ9A 1MCNA 4X6BA 5D1XA 3FAWA 5CJOH 4YDVA 3U36A 2RCSL 3RTQA 4JQVA 1L9MA 4HIHA 3QCVH 5D4QA 4O4YH 1WICA 1D5XA 1GGIL 3UJJH 3ZTNL 4GOSA 4F2MA 5J89A 4P59H 1TVBA 2C7UA 3VXOB 3W9EB 4D9LH 4L9DA 4Z0BH 5A3IC 2H32H 4C54A 5HGBB 1QEWA 3TA3D 4D9QD 3GMNA 4S10A 1I7RB 3D3VA 5DC9B 3OKEA 1IQDB 4HKZB 3EYFA 3RRQA 3W39A 3QPXH 1OL0A 1UWEH 1CLOH 3D18A 4NT6A 1MRCL 5L9DL 4CL7A 3CDGA 3MACL 3OAYH 3VJ6B 2HLFC 5K9QI 4Q6IB 2DQTH 1V7ML 3IFLH 3EJYC 4QYOA 1EUTA 3PWNA 3GJFA 3DMMA 2GJ6D 1QBAA 1U95A 1Y18A 1KLFA 4G43B 1RUPL 3OR7A 5DQ9B 5H94A 1ZLUK 3W0WE 5IV2B 1KPVA 3KPMA 2D0HA 4UTBH 1CGSL 3DXAB 1AGEA 1NAKL 3HE7D 5IW3A 1PLGH 3ZT6A 4MQXC 5GSVB 4JN1H 4NC0B 3VDCA 1INDH 1IEAA 4MQ7B 3WUZA 3KPOB 3J7HA 5JORB 2AEIT 3IS0X 2WAHA 3ZYJA 3RWEB 3LN5B 3GIZH 3IRZA 1HQ4B 3N1QC 2CK0H 1I1YA 3BHBB 1JE6A 1NDMB 2NY1B 2I5YH 3WIHH 3TBWB 1S5IL 5LKNA 1FAKT 1BD2B 5ELIA 5TJWK 2ZUQC 1WBZA 1RULL 1KFAL 1LO4H 3GBNL 4I4WB 4OGAC 5J11C 2FD6H 4R6UA 1NJ9A 1MSPA 3MRCB 5CHNB 3SKMB 4I13B 4D94A 4Y2DA 3ZKSD 2DTMH 2YWYA 1Q9OB 4KI1A 1OARL 5GS1B 3NCJL 3IJHB 4FZ8L 5A2FA 3QFJB 3RVWD 3EYQC 4ELMF 4MCZA 1FZOA 5IJKC 1BVKA 4GQPH 4U2YA 2FBOJ 1CXEA 1U8IB 2IC2A 3KYNB 3H9ZA 5L2KD 4PP1D 4IMKA 5CUSL 1KC5L 4X6BB 1TJHL 4Z7WA 5D1XB 4NO3A 3LKPA 4YDVB 3U36B 2ZNWA 3RTQB 4HIHB 1IFHH 5I71B 2GK2A 3DI2B 1D5XB 1BEYH 4F2MB 3UZEA 2C7UB 5DJYA 2VXVH 3CSYA 4AIOA 4HH9A 1FVEA 1EH9A 4LCUB 4MD5A 5JDSB 5CP3H 1CT8B 5T1LD 1QEWB 1T5XB 3L1OH 5JHDD 4TTDD 3OKLB 2YD6A 3GMNB 2DM3A 1QRNA 2RQ8A 4YHYB 3LZFH 1H3PL 3ZYZA 4KKBD 3OKEB 1KCRH 4HCRA 4POUB 1MREL 1B0GB 1EXUB 4HUMB 2ZKHH 3LKRA 2BVEA 1P7QA 2R56H 3DUUA 3UCRA 4P23B 4WJ5A 3N06B 3NCEB 3P40A 4JPKL 4DN4H 1KJVA 3L3KB 4KRLB 5GHWL 2FX7L 3TO2A 1T7ZA 2E27L 3JV4A 4DZ8A 3PWNB 5GRVL 3DXAE 3GJFB 4ELKA 4G6KH 3V5HA 2CH8A 3DARA 4X6CF 2AXJA 3DMMB 3QEGH 5I1HH 4BQBA 2EDTA 1U95B 3VG9C 1KTLB 3UBXB 1XGRA 4KRPD 1KPVB 5EIIA 4NOBA 1GCFA 1UENA 5JW3L 1AGEB 2XTJC 1MLCA 1IGJA 1A9EA 3S7GA 4QXUH 4NWTL 2NX5A 1K2DA 1PG7H 4MSWB 4LASL 3O3BB 2WK2A 1IEAB 4L4JA 4YLQT 2AERT 4MLIA 1JNHB 1X5YA 2Y23A 1BD2E 4LCIH 2X4NA 3EYUL 3QB7C 3PWJB 1I1YB 1OSZB 4PY7A 3S5LA 4RFNB 4KMTL 5I66A 5E4IA 3D87B 2WBJD 4PJHF 2R0ZH 4QO1A 1WBZB 3NAAL 1WJ3A 3BDBA 5C0RL 2NZ9D 1NCBL 3S88L 1NJ9B 3QFJE 4KQ4H 5SWSA 2PW2A 5ADOL 4XVTL 5IBLC 5ETUA 2ZCLH 5ESAA 5KTEH 1NUNB 2VZUA 1OVZA 4JN2A 2IFGA 5BV7H 2QSCL 3QQ4A 4YWGL 4CKVX 2CKBH 1IGIH 4PGBB 1BVKB 1J1XL 1G6RA 4OFKA 2KZ1B 3W5MA 5BQ7B 3LKPB 5J8OA 4LSQL 3PGDA 1V05A 2BXZA 4PPTA 4MNHA 2IQ9H 3DV6A 3OX8A 1KEGH 5DVOA 1CR9L 5DJYB 2A6JA 3CSYB 4HIXH 2K1MA 1WF5A 3EYSH 4HH9B 4LSTL 1FVEB 3D3VE 2GYSA 4WHYG 1TVHA 4MD5B 1RURH 4L3AA 5FM5O 3FT2B 2V9QA 1J0JA 4WFGE 5F9WC 1UVQA 1WEJH 5GRWA 3CK0H 5E4EB 3ZKXB 3NIDE 3EOYG 2ORBL 1E4XH 1RFDH 3DI3B 4HK0A 1PY4A 4G9DA 4OB5L 4X6DF 4TNWF 3K74B 3LEVH 1P7QB 3DUUB 4ZXBA 1XGPA 4WJ5B 1MFDL 3EO9H 3C2AL 2O5XL 1K4DA 3E2HC 4HIEB 2VDOH 3N50A 4JRXB 1MH5B 4Y5YC 3KYKL 4PJAA 2OM5A 4OJFH 4GRWE 4H5SA 1FBIH 1DUYB 4ELKB 4Q74A 3V5HB 4M4PA 5H2BB 1U3HA 1M4KA 2VDPH 5B4MD 3BXNA 2OR8A 3P0VL 5T5NF 1XGRB 3VXMA 4LP4A 5F9DC 1NC4A 1YEFH 2ADIB 3UX9B 1MLCB 1IGJB 1A9EB 1K9TA 3V4VH 3ZLQC 4ZPTA 5E8NB 3FFCA 3KPPA 3QHFH 2GIYA 3VFGH 3R4DA 1MEXL 1WGOA 3T0EA 4OLXH 1UZ6E 1YNLL 2X4NB 4R0LC 1YYMH 1UH2A 1AIFA 5FUCC 4XC3H 1A64A 1SMAA 4LOUC 4PY7B 4HS3A 2QJDA 3B4NA 2A6DB 4LGRB 3GBML 3GSOA 1LDSA 1MI5D 2PXYC 5GIRA 5CIPA 5AYQA 1SEBA 5CGTA 5I6XB 2ERJB 1B6UA 1WCQA 5CZKA 1FN4A 3ES6A 3C5ZA 1Y0LA 1BFOB 2E3VA 4LP5A 5JPMA 4JQXC 2WWMC 1QSFD 4KJQD 1CXIA 3I6GB 3AXLA 5ESAB 4AG4H 3MV11 4NC2B 4WWKB 4Z7WE 4QGYA 3SDCD 3RIAK 4XVJL 1T2QL 3QQ4B 3IDXH 2Y6SD 5E8DH 4N5EC 5DQJA 5AWNH 1MIEH 4H1LH 1IL1B 3GI9L 3QNZB 3I02B 2P5ED 2MSPA 4JVWA 3HI5H 4U1HA 2LFGA 4LBEA 4N8CH 4KTDL 5BVPL 1PAMA 3CLFH 3MJ7B 3F7YA 4MNHB 4MXWL 3BN9D 3F6IA 5TF1H 4O2FA 5E95B 3DV6B 1N5AA 4KJPD 4M62L 2AGJH 4Y4KD 2A6JB 3WNPA 1QRNE 4GSDH 4M1GL 4TVPD 5GGUA 5IHUL 1RIHH 3IFOA 2B0SL 1JRHH 4OZIB 4PJ8D 4CJ0A 4DAGL 5GS2D 1UVQB 4X99A 4XXCA 3V6OA 2HKFH 3MJ6A 3OR6B 4AY0A 2VQ1B 1T22A 2LAGB 4HK0B 5HHNA 4G9DB 5LVEA 4K7PY 1FNLA 4QHUB 1YC8A 3GMQB 3FO1A 3MV9A 1ONQA 1WZLA 4F3FA 1CDYA 4XBEL 4Y4HA 3UTQA 4BZ2H 4ZXBB 1XGPB 4F33A 1MWAB 2BNRB 2DLFL 1ITBB 3U46A 1ROWA 1K4DB 4H88H 3U0WH 5MHSE 3VI3E 3EJZD 5EZIH 4PJAB 2WUCH 1S7QB 3AREC 1OWRM 3I3EA 3PE9A 2APXA 4JGMA 4CNIA 2HWZH 3VDBA 1OGTA 1U3HB 2NX5E 1YECH 4FFYL 4NQDD 3VFRA 3MCKA 1WIPA 3VXMB 4DGIL 3RDTD 2F5AL 1CFNA 1DN0A 1SM3L 1NCWL 1JTPA 4X0KA 3RZCA 2GHWB 3FFCB 4QCIA 4K2UL 4OKDA 1A7QH 2AQ2A 5EBWB 5FCUL 3T0EB 2CDGA 1S7WA 2O5YL 4BM7A 3B5TA 4ETYA 2YD1A 3SHSA 2YUXA 3A6BL 4M48H 5F6IB 4HS3B 3D2UD 3CU7A 1JYVA 3GSOB 5SWSE 4EI5D 4GRLD 3T65A 1SEBB 3MC0A 2IALA 4OGXL 2PN5A 1OCWL 1OY3B 2XV6B 1ZT7A 4MD4A 5DD3H 3C5ZB 5MEQA 1BX2B 4XBGA 4PLKC 4QRUA 2I60H 3DUHA 4Y2OA 2R0LH 1HXYA 5TE7H 4Z8FH 1A4JA 1IGYA 3AU1A 1YEDA 3OGOE 3MO1A 3MCLL 1NCAL 2NXZC 3B9KD 3O9WA 5EUOA 4P57B 5DQJB 4ZTOL 4XPAH 2DQIH 3LCYA 3ULUC 2VLRB 1IAIH 3GMRA 3PABB 4U1HB 1IEBA 3HNSH 2NR6C 2Q8BL 5CFHA 1T04A 1EJOL 4MAUL 1KJMB 3V4UH 1IGTB 2EDNA 4NZDA 1QVOA 4DW2H 4LEOA 1MQKH 4NO0D 2NY1C 3MLVL 4LAQL 5GGUB 2ICWI 4C4KO 1INEH 4K94L 1YZZA 4NO2A 5EZOL 3RX8A 1A1NA 3DLQR 5AZ2L 1A0QL 3CMOH 4JVPA 2VIRA 1CICD 1ZHBA 1BFVH 5HHNB 3IDIA 4PP2A 5EU7C 4CW1B 5HDOA 4XPHH 4NRYB 2VLKD 4PJAE 3DSFL 3FO1B 3MV9B 2VL4A 3QCTH 5GS1C 4F3FB 1FJ1A 5IB4A 3UTQB 3MNVA 3QZWG 3D85A 5FECA 4YFLI 2JB6A 3U46B 1RUAL 5DGRA 3QEUB 3GSUA 2FYYA 3RVVC 1N4XH 3VXME 1FNSL 3CH8A 5TDPB 2Y9RT 4KK6C 5MEPB 4CNIB 5IEKA 2EDLA 4N0YL 3O6FC 4TSCL 1OGTB 3HFMH 3ARBA 5CBEA 3FFCE 2JJTA 4JFED 4KK9D 5I71C 3CFJA 3TH2T 3LS4H 4UQ2A 4KJYB 1KIUA 2BMKA 3D39B 4K3HA 3T0EE 1CFNB 4JFZL 1CGXA 1DN0B 4W6XB 4XWOD 4ZUUA 3EW3B 5HYSG 3RZCB 5I1GL 5TQ0L 5E08H 3F5WA 5GGSA 2QQLL 1F8TL 2A0LC 2CDGB 2HVJA 2P8PB 3MGOA 2CO6B 3U83A 4D9RE 1LNUB 1Z2KA 3QI9A 1UCTA 3QEHA 3G6AB 1ADQL 5F96L 2GJZA 3VXNB 2DMBA 4D0DA 5DRXA 3QHTC 3NIDF 4BKLA 3T65B 3KPSD 3MRRA 4MD4B 1OAZH 1RUKL 4P23C 3RGHA 5FXCH 3RU8L 3V95A 5C2BH 4JG0H 5MEQB 4XBGB 1MY7A 4H8WH 2RFXB 5ICYB 3AB0C 3VCLA 1MJ7L 4ZAKA 4JHWL 1I8KA 1RZKH 1A7PL 1HXYB 4P46A 5IQ9A 2IH3A 3AU1B 1YEDB 5E2TH 1JRHI 3SGJC 2FHBA 5HSFA 1KIQB 1VEMA 3GHBH 4P2OB 5CINL 1EEYB 3MO1B 1A6AA 4MXVE 2P44B 5ICZA 3QXWA 5IWLC 1CD1A 1OTUC 4L3ED 3O9WB 4XPGH 5EUOB 1J8HD 4FFZH 4ZMAT 4F9PA 5DJ8A 1DZBA 3TYGH 3WNMA 4KK5D 3TV3L 1XEDA 1HN1A 1IEBB 2R1XB 1FGVH 5GS0L 1A3LL 3V8OA 4JEGB 3DO7A 3N85H 2VERN 3PHQB 1U92A 1L7IH 1QVOB 4LEOB 4YNYB 1I7UA 3V6OE 5GGTA 1UZ6F 2B4CC 4QY8B 4XMKH 4C58B 4U7KA 2OYPA 5ADPH 4XPTL 4NO2B 1BIHA 4UNVA 3MV9E 2RR3A 1P53A 5J13B 1A1NB 4DQOH 3ULUL 3F12B 2H2PC 3BQUA 4HDIA 2VIRB 1CWVA 4NHUA 3ZDZE 5GRVK 4N0FB 1ZHBB 3RKPA 3BX7C 4HXAH 4GAYA 1Z5LB 4PP2B 4A6YH 4URTB 1UYWH 1WZ1H 3NCBB 2VR4A 2YXFA 1OQOA 4B50A 4DKFL 3MNVB 3D85B 4Y89A 5FECB 4BSVB 2XA8H 2JB6B 4Z6AT 5B21A 2FO4B 2CK2A 3IFNL 1OTSD 1TFHA 2FYYB 4XB7A 4NZUL 2BSTB 1U0QA 3G9AB 2G9HA 1LMKA 5GRXG 4PS4L 1WK0A 2LQRA 1P69B 5IBTH 3ARBB 4R26H 5E8EA 3GSWA 1ZT4A 4YUEL 4UQ2B 3CNKA 5DD6A 1DBML 2PYED 1C08A 1E4WL 4ZUUB 3DNKA 5FHAL 3OPZL 3KJ4C 3V8CA 1PYWB 1MFBL 3MUJA 3CFKB 3HPLA 4X9BA 2HJKA 5GGSB 1KPUA 2R4SL 1X7QA 1ZHLB 4RWYL 1BREA 3MGOB 4OD2A 2WQ8A 3ZKXC 5JLZB 4I3GA 1A3QA 5I1AA 3QEHB 2X2YA 3STZA 4DVBA 3HR6A 2WUBH 3QUYD 1KYOK 2CKNA 3L5WA 4MJ2A 4D0DB 3CCHA 5DRXB 1UXSA 4BKLB 4NFCA 3MRRB 3UZVB 1QOKA 3NFPA 3TESA 4KY1H 3W81A 4ZOAA 4I2XB 1Q1JL 4G6AC 1T03L 2ZPKL 3VCLB 4EOWH 3ULVD 4OIIL 3EHBC 4P46B 5EUOE 5IQ9B 1AD0A 5B38G 2IH3B 3M07A 2F53D 1MLBB 5EFIA 1E4KC 3VI3F 3EYVB 2PCPB 2YD9A 3VFNB 3G6DH 4JLRB 1TQBB 1CD1B 3GBLA 4G7YL 1OT1A 5DJ8B 4FS0A 2AK4A 4DN3H 2AS5M 4MJ6B 3I3BA 4KKLC 1JF6A 3VU2A 4DCQA 3R1GL 3SDYH 3UDWC 2H9GA 4NQVA 4AMKH 3MXWH 1YQ2A 2P43B 1FFNA 2ICCA 1GC1H 3SY0A 1P6AB