1A64A

Engineering a misfolded form of rat cd2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
94
structure length
94
Chain Sequence
b'GTVWGALGHGINLNIPNFQMTDDIDEVRWERGSTLVAEFKRKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILDKALDLRILE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2
publication title Engineering an intertwined form of CD2 for stability and assembly.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Domain swapping
total genus 8
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a64A00
3ZKQD 1T1ZA 4JPKH 3OXRB 5HDBE 3T77B 4HC1L 5F8RC 4U1KB 2HT4C 3B2VL 3ZT5A 1BQHG 4I1NB 4BH8A 2GSIB 2ADGB 3DURB 4I4WB 5C3TA 1KJVB 3V5DA 1VKXA 4JDZA 4LCWE 1FPTL 4K3EH 1ZHLA 1KC5L 5E6YA 3NA4A 2XXCB 4FXKB 3ULSA 4MX7B 4TSCH 5F1KC 4EI5A 5KS9F 4JFZL 1B88A 1CG9B 4A2MA 1BGXH 3O3DA 1T1XB 5FYJH 1CF8L 5KS9A 1YMHB 2QJDA 3HC3L 4ODWA 3CDGA 1F4WH 5DMGD 3AVEA 5C0RL 3QRFM 1RVFH 1I3UA 2H9GB 4M9OA 1HQRA 1WBYB 3IU4H 2YD3A 4MCZA 4OLUH 2B7DT 4LVEA 3D85B 4PJ5E 2CLRB 2GK2A 1GIGH 3BKMH 3PWNB 4X7CC 2VZUA 4OFVA 2EYSA 1IAKB 2DM3A 2DQHL 1MRFL 4KROD 4ZD3L 2OXHA 3KGRA 4G8FA 5FCUH 1FBIH 1HHIB 2J4WL 3QXTA 4YHIB 4DWHA 1LEGB 1O5DT 1ZHKB 5K9QI 1U8PB 3RL2B 1FFNB 1U95B 1U6AL 3C2AH 3BOVA 3NIFE 5I1JL 3ZDZF 1ZVHA 3PHOA 5HD8C 3REVA 4NNPL 1UXSA 4DTGH 2DQFA 2JJSC 4QHNB 2QQNL 5A2LH 4N5UA 4NJAL 3AM8C 1JGVH 1WEJH 1U8QB 5FCSH 3SKMB 1C5DA 2ZCKL 1XIWC 3AROA 4WVRA 4OT1L 1AFVL 2AI0L 4KQ4H 1TZIB 4YHMH 5I1KL 3RWFB 5IJVB 4HD9A 1RFDL 2E6PA 1WWBX 4GRWE 4UB0H 5E9DA 1DSFH 1AGBA 1OD9A 3DVNB 3WFEH 3PWPE 2UWEE 1OD7A 2VIRA 1IGCH 2IANA 1GAFH 4P4RB 1GGIL 1T66D 1XIWB 5HHOA 1Y6MR 1S9VA 1G7QA 3WXWL 2ZUUA 3WDIA 1FZKB 3HZVA 5KAQF 4GSDL 1QUNA 2WW8A 4DZ8B 3H9SA 1KT2B 5CZVH 1H3VA 2BFVH 4K3GA 5TQ0L 3L95B 2EH8H 3I6GA 3VGDA 2YUZA 2IFGA 2DIBA 2BOCA 2V2TA 3F7RA 5A1AA 1A1NA 3BHBA 5C07A 2J8OA 5GRJH 2DLGA 4Z78A 1T0MB 1P4LB 1RU9H 4Y1AB 4L29A 1CFTB 2QHRL 2IAMC 2XQBH 4I3GA 5IG7B 5CBAA 5GJSH 4LVNC 3S8WA 2Z92B 4TULL 3JWDC 2BDNH 2V5TA 5IVXB 1OTUC 5EC1B 1A6ZA 5C0AB 5B8CC 4YWGH 3H7LA 4ODBD 1IC5L 3DUUA 1XT5A 1WIOA 2ARJQ 5BRZE 1JGEB 1TETH 2VAAB 3BKYH 2IAMB 3QDGB 1GXEA 4LVNB 3PWPD 2A0LD 4YDLC 3Q6FA 3UTTE 1J8HD 2CH8A 4Y5XB 2YD1A 5B8CB 4JKPL 3M45A 4R3SA 4LCIH 3INUH 4C83B 1U8IA 2Q7YA 4E0RA 2V9QA 3ET9F 3I2CH 3S88L 4JRYD 5F7HA 5E8EB 3C09C 1BPVA 4G6JL 1BAFL 2MKLC 5C0CE 2YD5A 3K1KC 3QUZA 1YYLL 1CU4L 5ITFA 3VE0A 1ZGLB 1ACZA 3AMKA 3N06B 5DA4A 4KK6D 4KJPC 4HWUA 3I50L 5EFIA 1IEHA 2R4RL 5IW1A 1RZFL 3QCTL 3EFFA 2G75A 1FLRL 1V7MH 2ZSVA 1N2RA 5HGHA 5BS0A 1PSKH 4RA3A 1KLUB 3REWA 3MA7B 1ZVYA 4PGDB 5ICYB 1MCDA 5F97E 5JQHC 1GC1L 3RI5F 4U1HA 1OF2A 5B4MC 5DVKA 2VRAA 5BRZD 1IAIH 4KFZC 3SDXF 2NY3C 5HHME 5L2JA 2NY4D 4FOMA 1A1MB 4X6BB 4M1GL 1DQMH 1N0XH 3QZWG 1K6QH 1KJ2H 1GL4B 4KTEH 3ARSA 4OIAA 4PGBB 1IAIM 2ITCA 4N8VG 4JCLA 4Z7NF 1JPTH 4FZEH 1FL6A 2BC4B 3W0WE 4L8CA 3VFSA 3DGCR 5F7MC 2OSLB 1OTTC 2P24A 2XIDA 1YA5A 1YEJL 4N8VA 4UQ3A 5HJ3B 2NY3B 3GSVA 3G6JF 2I60L 2EECA 5C0CD 4RWHA 1RULL 1DBKH 5E56A 2D9CA 3BZFA 1I3RB 3HZKB 1S7WB 4H0IA 3MUJA 3W39B 5BMFL 2VITA 4HBCL 4Q9RL 1DN0B 3IU3A 3FFDA 4LKCA 4PJHA 5F21B 7FABH 3FL7A 3VWKC 3TBWA 1MCRA 4N0UA 2P8LA 3AREB 2IPKB 3ZDYF 3DETC 4PRAA 1AR1D 1D5IH 2UY6A 2AEQH 4ZUVA 3ZMRA 3DARA 5AWNL 1RZJH 3WUWA 5GXBB 5LWYL 1UZ6F 4UILL 1C5CL 3L3IB 1MHPL 2B2XL 1RZ8B 3KR3L 3T3PE 1QLEL 3IDXL 4KH2A 3GRWL 3G5ZB 1FGVH 4LIQL 1KCSH 3QEHA 4UUJB 5HHMD 1ORQA 3VWKB 3D5OF 4R26L 5D71H 2FO1A 5IBTL 5F1NA 4NWTL 3KPPA 4PJFF 3QDMA 1AY1H 4O00A 5DHXB 4HG4J 1LGVA 3KPMA 2OL3L 2F53D 4O2EB 3MR9B 1KJ2A 1KEML 5ISZA 1WZ1H 2BMKA 1FLTX 1MIEH 5D9SB 1MEXL 4C56A 1NFKA 1B4JH 4MJ4A 1UG9A 4NNYB 5IR1B 5E7BA 4AQ1B 4PRBA 5KVEL 5LQBL 3MRNB 4WW1A 4NC0B 3Q1SL 2HKFH 1OSZB 4P23D 3RAJL 2V7NB 5CD5D 4OD2A 5FGCE 4QOKE 2EC8A 4K3DL 4QHLB 5ETUA 4PYGA 3DHMA 4LLUA 1PZ5A 4LMQI 5CEXA 3MV9B 2GYSA 1P1ZA 4PIRF 1FH5H 3V5KA 5J6GB 4HJGB 4Q6IC 3TIDB 4LLYA 5CZXC 4HPOH 1H8NA 1XGTA 2EXYD 5CLWA 4CDGC 2Z31B 4BK5A 3KHOA 1OQOA 1JJUA 2VDMH 3GJEA 1JNNL 2ZUQC 1D6VL 4QHKJ 3MNZA 2PUQT 1F11B 4GW1A 1BBJA 5E8OA 5K9JH 4O5LL 4HQQH 5ESAB 5T3XE 3W11D 4Q6IB 5ACZB 1QO3B 2XKSA 4XPFH 2EIBA 4GG6A 4KJYA 4WI7A 4OFPA 3TBYB 1OB1A 3SOBH 4TSAH 5DRWB 1V3KA 2WMPA 3V7AG 5IMMA 2CXKA 1E27A 1RJZB 2BRQA 4CNIB 3SKNB 1CK0L 2GJZB 4MXQD 1M7DA 1QBLL 1LWRA 4JLRA 1FORL 4Q2ZB 1JWMB 4LEXL 1KBGH 4UDUA 5CILH 3SE3C 3S37L 3DRQA 1W2KT 1L7IH 3ILPB 4HIHB 4XRCB 3KJ4C 4MS8D 4NQVA 4NHUA 1UQSB 4LP4A 2OS7A 3THML 3W5MA 3E6HB 1OAZH 2YD7A 1P4BH 5FF6A 3E6FA 5T1MA 3MCG1 4WI6A 4XTRD 3QBTB 3SN6N 5IVZA 5CMAA 1I7ZA 5IM7B 2YPVH 4G3YL 3KJ4B 1R3KB 4BFEA 2EDEA 2D4FA 4JVUA 5C09E 4R90H 2D7MA 1T2XA 4PJCB 1Z6JT 5K9KA 2HJFB 4MNQA 3WHE1 3HI6L 3DSFL 4M7JH 4O58L 4MD4B 5C6PB 1QVOB 1QR4A 2W92A 4CW1A 4KJQC 5T3XD 1MCWM 4FTVA 5F9JB 1I7UB 2FYYB 4BK4A 4NDMB 1KN2L 3PQYE 1RHHB 3UZQA 2VLKA 4F37F 5FYKL 5J56B 5C71A 5I1AB 1JZ2A 1KXVC 4H88H 3GJFH 2CDEB 3NCCB 3FJTA 1WC7A 1MH5A 3FOLA 4PJGB 3PG2A 3RBSA 2DJSA 2Z4QB 5DRZB 3MRQB 5D1QA 2DWEB 1AHWA 2VC2H 3MOQA 1HHGA 1QRNB 4XZUB 1CFNA 3C6LC 3O2VH 1JTOA 3VMPA 4QY8B 2H3NB 1RZIA 5HHQB 2R23A 1P6FA 4OLVL 4AIZB 2P8MA 2J8UE 5EC2A 5BV7B 4JQXC 1RK1B 5A40E 2V9RA 1RQ5A 3MMEB 1C12A 3DYPA 1QQDB 4NRZA 4LQFH 4ZFZB 5HYQB 1I7RA 1KENL 4W4OA 2EDFA 3SCMA 1AJ7H 2R29H 2FD6L 5T3ZL 4PRHB 3C6LB 3ZHDA 1MCOL 2IMMA 3RTQD 3SGDI 5KANI 4OBRA 2AGJH 3ARGD 1DEEA 1A6UL 1AIFA 1U8OB 2XI9A 4U1SA 4BM7A 3QISA 2EDHA 3Q5YA 3MLSH 4M02A 4CDHA 2EDYA 3QUYD 4O4YL 5BOZG 3JTSB 4HC1H 4X5WA 4RWYL 4DN3H 2ZUVA 2V2WA 4QHMA 3S36L 2HWZL 2EE6A 3V8OA 3B2VH 4WW2B 3OKLA 1KTRL 1G7IA 2E7LC 1F4AA 5E03A 4FQLH 3GI9L 5IBUG 1CXFA 1MJJB 5IQ9A 3BAEL 1HSBA 3SBWA 5FM4A 1G9MC 3R06A 1BJ1J 2A9NL 4TVPH 1KJ3L 1CF8H 3G6AB 3MJ6A 1TQBC 3D39B 3GJFA 5EOTB 3RUGE 3QWQB 4MQSB 2AXHA 1UM5H 2DQEL 1X7QA 3ES6A 4K9EL 1LMKA 3LN4B 2I9TA 1MCEA 1I8LA 4JFEA 1H3PH 1BD2E 5EU3A 4D2NA 5DQDL 1BP3B 5DJ2A 3Q5TA 5ID0B 2OJZL 4G7VH 3WDHA 1Q9OA 4ONOA 5FKAA 1TQBB 1IC7L 5B39G 1UCBL 1MRFH 4NM4L 4ZD3H 4MGXA 5DMKB 1ADQL 2J4WH 5BJTA 4HMCA 1QACA 5T5NG 4M43L 5I1LA 1DUZA 4NZDA 9CGTA 2PXYA 3OR6A 1BIIA 1QSEE 4FFZL 4Q0XH 4MQTB 2VDLL 5I1JH 1B0RA 1DUYB 2A6DA 5GHWL 2BY3A 4NNPH 1WBZA 2ICWB 2VISB 1QRKA 1YMMB 5F7DB 1FYTB 2VLJA 4NJAH 3DTXB 4KY1L 1E28A 5MEPB 5DD5L 4MMZC 3NPSC 2ZCKH 4TPRL 1RK0B 4N9GB 3VFUA 1AFVH 5DJYB 3VGHA 1B90A 4XP5L 4IRSD 5I1KH 4FQ2L 3RKDD 4HC1A 1YQ2A 3K4DA 3PL6D 4X9GA 1RFDH 1HE7A 1MSPA 2JIXB 3BKCL 1RZKH 4KHXH 4ZAKC 3V52L 2WBJA 2YRZA 2R2HB 3OBAA 5JIKA 3TCLB 3HE6D 1XGQA 5E8DL 3VDCA 1G7PA 3NPSB 1MJ8L 3BDXA 4WUUA 2QLVB 4NNXB 3CX5K 4LDOB 4JRXA 2OR9H 3MOAL 4QXWA 1XF3B 3KPRE 1MJ7L 3DYOA 3GSOA 4YXKL 2ZSWA 3WXWH 5LGHH 1UC6A 3VA6A 4GSDH 1UWXH 1GOHA 1BD2D 4U1NA 4Y4HC 3PWLA 4ZAKB 4J3OC 4KJWC 3MA9L 2PTTA 4E42B 4HDIA 1YEDA 3SGEH 3FB6B 5IB3A 1K9TA 3HTLX 3L3OB 3V5HA 1JTTA 5J06A 4O2FA 1T3FA 3SDCD 4D9QE 5F1SA 2CDFB 3S4SA 1M6OA 1EUTA 3RWEA 4MYWB 4BKLB 4XB7A 1G7MA 3D48R 3ROOA 5CP7B 4JO4L 1U36A 4PLKC 1NCBH 1HYRC 4TULH 4M5ZL 1I9IH 2HJLB 1P4IH 4WGVB 5DS8B 5KS9E 1N3NB 1FVDA 5DGQA 2MCG1 3H9HA 1CGXA 2X44D 5FYLL 5A16B 1I1AC 1IC5H 2XQYG 3BP5B 1A0QL 2ICWJ 4LPUA 1LEIA 1P7KA 4XNZC 1F90H 4NJ9H 5EO0B 1MVFA 1ZS8A 3ESUF 5I15L 5KG9B 1SJEB 3PDDA 4RSVA 4YLQT 3S7GA 1A14L 5M95B 4Z8FL 4GKZA 1PJ9A 4I5BA 1ZT4B 3PXJA 1BJ8A 4R7NA 2ATPA 3ARFC 2XRAL 4HULB 1IGFL 1I1AB 4LPVA 1A7NH 2XFXA 3VFMA 4XWGL 4XNZB 3S88H 1H5BC 4X4YB 2F9BT 5EBGA 4B7IA 4A6YB 4QRPB 3C60D 4G6JH 3L7FA 1BAFH 5TDNB 5DGRA 2F74A 1FJ1A 1AGEA 4D9QD 4MJ6A 3TF7C 1YYLH 1CU4H 4HAGA 2JCCA 5IW3A 3ARFB 1CICC 1S5HA 2A83B 5F71A 3GDBA 3U4EA 2BNQA 1MFEL 2GJ6B 1RZFH 1QLFA 4J12A 3P4OA 1FLRH 1IILE 3MRBA 4R4ND 4W6WB 4DUVA 4F2MB 5E9DE 3DXAA 1X44A 5HVHC 5KSAA 4J3WA 4TUJB 4FQ1L 1HXYA 1JZ5A 4HIIA 5EZJA 1GC1H 5MEQA 2XN9A 1LQSR 3DV6B 3VFRB 4AIXA 2IJ0C 5BOPA 1CICB 1HXMB 1UKQA 2IANE 2FEDC 5HHOE 4MDIA 3QUXB 4HUUA 3VXNB 4PRDA 4FNLH 2P47B 3W9DB 3VI4E 2BSTB 1QYGL 3FT2A 4HLZG 4QHUB 5FYJE 4JAMB 2OTUA 5FV1L 3VXUB 4M1GH 1N7ML 5FHAH 4LVHB 3H9SE 3MRRB 2YBRB 1AGFB 4GXUN 3EW3B 4YHYC 3MLYL 4HX1A 3FFCA 2YEZB 5IBLD 4IIQA 4JFYA 3HPLB 3SDAC 2OCFD 4N5ED 4FQXD 2WAHA 4KMLB 1YEJH 35C8L 4K71C 5GGVY 1DBAL 1FCCA 1HHKB 5ITBL 3VRLE 5C07E 3GIVA 3MCLH 1S9XB 1RULH 4RGND 5EUOF 1URLA 4K3JH 1MCQA 3BN9D 4RDQF 1EHNA 4NQDB 3LV3A 1DFBL 5D2NC 4HIEB 3P77B 5EUOA 3OKDA 1SJHA 3MV11 5J1AB 1J5OL 3EGSA 4PGCA 5BMFH 2XV6B 4WNQA 1NSNH 2LVEA 1MJUL 4Q9RH 4KV5E 3F7VA 4M00A 4WO4A 2F58L 3ARBC 1J87A 1NC2B 3DVGB 5I17A 3QYCA 1CDBA 5IKCA 1OLLA 1CFSA 1WCBA 5AWNH 3QXVA 4OZFB 3F12B 5LWYH 3GMOB 4GRLA 5EU6B 3KYOB 3UPRB 3VXRA 5D2NB 1RUML 1T20B 1DANT 3OGCA 4G80A 2XY2A 4G9FD 1QLEH 1MUJB 2HJKB 3C8KA 3IDXH 3KJ6L 3BP7B 5IFJB 4LIQH 2Y72A 3MTRA 4XGZB 5GJTH 3ARBB 2ZUXA 4R26H 3ZKNC 5JW3H 2GW5A 4M48L 3BH8A 3VCLB 3TO2A 4GT7A 3B5GA 4KVCL 3DMMD 3IF1A 1YQVH 1J05B 4N0FB 3HZMB 3LKRB 2Q86B 1NMBH 2OL3H 1QA9A 5BO1L 5I1IL 3V9FA 1YPZA 5I66A 5C07D 5T5FL 4QLRA 3HKFA 1CXIA 3QWOB 4YE4L 3RP1A 1IFHH 3UTSB 1MEXH 4ZFFA 2E27L 2AEWA 4Y89A 3QEQB 4XBEL 4ZO9A 1M7IA 3FB7B 2Y36H 4J3VA 3FB5A 1U3HD 4WFFD 4S2SA 5KVEH 3B5HA 5BS0E 3LQZA 2X70A 1QBBA 4HAFA 1XZ0B 3ALPA 4EBQL 1GZPB 3Q1SH 4K3DH 1RIVL 2DQDH 2FSEA 1X5YA 3RWIA 3UBXA 4X7TB 3UYRL 5T1LB 3QIUA 2F8VA 1HQ4A 1NKRA 3LSOB 1F3JB 4AZ8A 4F7EA 2IC2A 3ZSTA 1NDMB 5EIIB 3RVWC 4Z7NE 4M6OH 3SGKC 4L9LC 3MV01 1VFOA 3QR2A 3CUPB 1VB9A 4R8WL 3LKSB 3H8NA 1JNNH 2YUWA 1N59B 4RNRB 3C6SB 4PJIA 4Z7UB 5L0QC 3WNNA 2VLLA 1K2DA 3X13A 4O5LH 1HEZB 5ESVB 2NQCA 5TPWL 2C1PA 1U2CA 2VL5A 3C2SA 3QPQC 5FGBC 5IB1A 4YJZL 2Q20A 4L9LB 4RFOL 4P99A 1H8OA 5GS1A 1U8NB 1CK0H 4LOUC 1JFQL 1U8KB 2N7BA 2XA8H 4KROC 4PJHE 2C3XA 3B3IB 1QBLH 4ETQB 3QULA 2D03L 2HTLD 2OL3A 4LEXH 3N85L 5BS0D 1WISA 3KLAA 5F3BA 3MUZ1 4TN9A 4NRXA 3HCVA 4F3FA 4EQ2A 1UZ6E 5I8CB 1QLRA 4FRWA 4KROB 3QJFB 1YN7B 5E4IA 3GIZL 4N90D 4IRJA 2IMNA 1MF2H 4XNXL 4W70A 3BIBX 4F7PB 5HYIA 1LNUB 3QDME 2VQ1A 3WLBB 4Z7OE 1S78D 2M1KA 5I19H 3OX8B 5CIPB 3WEXA 4KTDH 3NTCL 4J3TA 2YD9A 3IT8D 3WJLA 4YDVB 1NCDL 3PHSA 2H45A 4QTHA 4ZUUA 1BFTA 3DSFH 3STZA 3P9WB 4O58H 5TE7L 5ISZE 1T66C 4LCWB 4X4MA 2RQ8A 3LKNB 5CD3A 2R0WL 3OKKA 1H3GA 3FCTA 1RURL 1KN2H 1S7TA 1S7UA 3G08B 4C56E 5CEZL 2AJSH 4ONHB 1NUGA 4DOHE 5C0BD 1YEKL 3EDDA 3OJDB 4Z76A 2VKXA 4FFYL 5EORL 5FYKH 1OM3L 3MGOA 3MRCB 3CFDB 1IGYA 2YC1A 1Z3GH 1KGCE 4CN1A 4NO2B 4YFLI 3B6SA 5I1EL 2CMRL 1MLBB 4PREB 1TJGL 3PE9A 4LLQA 4LCCC 3KXFA 4ZMAT 4PJ5B 1OAUH 4L4VD 3Q6GL 3QIWA 2VLRA 5GSRB 2H8PB 5A43C 4H20L 5CJ5A 3B4NA 3EO9H 2NW2B 3SKOB 4OLVH 3GMMB 2VZTA 1ES0B 2A9ML 4YO0B 3K4AA 4HMDA 4LCCB 1C08A 4ELKB 1IM9B 1BLNA 3K8KA 2FD6H 3PV7A 5T3ZH 3O6FD 1MCOH 4UAOC 5C0FB 1TZHB 5F7EL 4AT6B 5C7XL 1A9EA 1WLHA 4NO0A 1K8IA 4X0KB 3VG9B 5I6XC 3QCUH 4ISVB 1UJTA 1F8TL 4JFDD 4OQTL 1A6UH 4XP4L 3S98A 4L8DA 2G60L 2IH3B 4LP5A 2OJEA 4O4YH 5E24E 2HLAA 3MRPB 4P2YA 4C56D 2AVGA 4P2QE 1IC4L 4HWZA 4RWYH 3I75A 5HGGS 3V7AE 3S36H 1N4XL 2Z35B 1Q9WA 2WWMC 5K9OA 2HWZH 1SVCP 4UAOB 3GO1H 4PJAF 4FQIL 2W9EL 4MJ2A 2MHAA 2NTFA 3HRZA 3PWPB 3ULUF 1KGCD 3SKUD 2UWEB 3GI9H 1CQYA 3QEUB 1MCNA 3IAPA 1KJMA 3RPIB 4LASL 2EDNA 4HS6B 5DD1L 3WSQL 3WUZA 1NFIA 3BAEH 3CFCH 3P11L 1IAOA 5A3IC 3WFHB 2A9NH 2GTZB 4Z6AT 4LLVA 3EFDL 1CS6A 4LK4A 3DGGA 1NPUA 2CO7B 1I9RL 5AD0B 2ATKA 3OKOA 4HGMA 3QG7L 3ZYJA 3WD5H 2ARJB 3LQAC 4B50A 1IKNA 2DQEH 3ME0A 3UJIL 3IJYB 4OI9A 1NQBA 5D7LD 4MNQE 3BYYA 4L8BA 2APBA 5DQDH 4K94H 2OJZH 1HH9B 1IC7H 1UCBH 4NM4H 2YK1H 4WFHE 1JN6A 3H42H 5IK3A 4M43H 3OR7B 5DVMA 4FFZH 5JPMA 5GGRY 1T83A 3QQ9C 4YK4B 4LCUA 2W0FB 4H1LH 4P2QD 3T2OA 2DS4A 5HYSA 4DKEH 3BGMB 3TN0A 3WKML 5BRZB 3IDIA 5DD5H 3EOAA 1CVSC 5KW9H 1F00I 4XP5H 4ZUTB 4ZPTB 3VGFA 3BKCH 2NW3B 3BKJL 4U6YA 1KSRA 1VEPA 3UX9B 1XCQB 1F6AB 5E8DH 1AGDB 2HT2D 4UDTB 1PY4A 1YZZA 2QR0A 3RHWK 7CGTA 3OSKA 3STLA 3CIQA 3HFML 3MOAH 5C0CB 4ZPVB 5KJRH 4IMLB 4YXKH 4Y2DC 4X7FC 4HW6A 2Y1VA 4X6EA 3MA9H 4M7LT 3GUTA 3P9LB 3AAZB 4MD5A 1ED3A 3OKMB 4E41D 1T7WA 4KRPD 3GSQA 4ENED 2V17H 1UACL 5J12B 4MLSA 2C3GA 1OW0C 3LZFL 4Y2DB 4IMKC 1P84J 2XZCL 4Y5YB 2P5WA 5DJ8B 1BF8A 2G5BA 4KXZI 3JTTB 3RWDA 3UROR 5JO5B 3P0VL 4H1LG 4P2OA 3VRIB 3KDMA 4L9DA 1X5LA 5HHMB 3RL1B 1T2JA 3IGAA 2R69H 3MJ9L 4H1LA 4JN2A 2A6KB 3L3HB 3K8LA 3RWCB 2K1MA 5DJ6B 2X4QA 4M1CC 5B3JF 1XF2B 3NIDE 3FONA 2AJ3B 1WFOA 1MOEA 4Z7QF 4POUB 4JFEE 3JWNC 4DZBB 3WS3A 1CI5A 3TZVC 3D0LA 3MGTA 1MRDL 2Z0BA 5CD5C 3MLWH 3BGFC 1JHLL 2XY1A 3VXTB 4Z8FH 4MVBD 1MY5A 3C9NA 1N6UA 1PKOA 5EOQL 3BEVB 3M1BB 1IGFH 1MHCB 5B38G 1MCCA 4XWGH 1BWWA 3S34L 1TTGA 1WIPA 5CEZD 2VDRH 4NSKA 2D0FA 3TZVB 5ALBL 4HUXA 2IQAB 4P23B 3C5ZD 3D18A 1AO7A 3BGFB 3GB7A 2UVEA 2C1OA 3ZKMD 2VLJE 5A2KH 3VXMA 4GQ9H 3GGWB 3IKKA 1T1YA 5IEKB 2VUOA 5IVXF 3QIBA 4AL8L 3QPXL 2XZAH 1TIUA 3D25B 5DK0B 2FH8A 1MFEH 2WSKA 1MRCL 3J8F7 1M4KA 2M8XA 1EUUA 2Y5TB 3NFPA 5HYFA 4YHLL 1KG0B 4FQ1H 4RRPG 2QQQA 5C8JB 1EK3A 3OF6D 4WUUE 2HMID 1R5WB 1T89A 2FZ3A 3KPSA 4JRXE 4H8WL 5H35B 5D1XC 2VDQL 1QYGH 1T22B 4TVPE 1IARB 4JFED 3MV8A 4NQCA 4HGKC 4YPJA 4OIIL 1HH6A 1SVZA 3LKOB 1FHGA 1N7MH 4MS8C 3U48A 2OTPA 2X4TB 5E5MB 3RJDA 1WT5C 3FQXB 4R96A 4G6FD 3CVHA 2OQJB 5DLML 1UYWH 1FNFA 1LO0H 3DIFB 3TYFA 4NQEA 5AUMA 3QUKA 35C8H 1VGEH 5D1XB 4CJ0A 1SYVA 3FRUA 1DBAH 1DQQB 4TRPH 3QO0A 5JORB 2PR4L 4L3AA 3B2UC 5L2KA 3WL9A 4WU7A 25C8L 4QOKB 5FGCB 5EO1A 1FNGB 3O8XD 1DFBH 3SY0A 1J5OH 2X09A 2ZKHL 3X12B 4OGXL 3BZEA 3UPCA 4PRPD 1MJUH 1RIHH 4XMPH 1KNOB 2JK5B 4MB4A 3OXSA 4RX4A 2PW2A 4K23L 3UP1A 3NPZB 2WBJD 3WHE0 4PRNA 4RIRB 4TUOA 1FG2B 2GFBA 1NL0L 1WGOA 1RUMH 1HINL 5CJOH 3V6ZB 2JB5L 2WQ8A 1YEIH 1ZHNB 5M94B 3KJ6H 4ELMA 3QUMH 4MA3B 1HWGB 4TVPD 5F3HA 3MLZL 3VFOB 1MFCH 3ARPA 4NGHL 4S1QH 1Q9KA 4P49A 4M48H 3GKWL 1UADC 4J3UA 3BW9A 1Q8MA 4JM2A 2X40A 2CJUL 2FGWL 5BW7A 1KPVB 1FVCA 1K8DB 2AK1L 1CCZA 3L1OH 2Y7QA 5EBWA 1OARL 2DLIA 2F5BH 3MLXH 5CCKL 4LSQL 1ERNA 5BQ7A 2GK0B 3IXAB 1S7QA 4Z7VA 1MCWW 5BO1H 5I1IH 3MRFA 2JCCE 3L3DA 4QNPE 4GKNA 4G6AD 5T5FH 1PLGH 1NLBL 3VI3F 3L5XL 5MEOB 2LTQC 2BNQE 3NZHL 1YEFL 3RGVC 1NBZB 2FL5A 4XBEH 5L8KB 1CLOH 2DN7A 1PKQA 5IJKA 1A6WL 3RWHA 3ZYOA 8FABB 4X6FA 4S1DD 2W65B 4EBQH 2Q76B 1QBAA 1JGUL 2XN9E 3HE7D 2LTQB 4JG1L 5C09B 2VDKH 3U2SA 2L7JA 2NMSA 2R1XB 3K46A 4WEBH 5DUBB 3RGVB 4CGTA 1D5XB 4QRUA 3KYMA 4WUKL 1BZ7A 1FO0L 3SO5A 2F54A 2YHGA 3FZUC 3QUYB 3FFCE 3MLRL 4YDJB 3GBLA 3MRJA 4D8PA 4OZGB 4FQPA 3PQYB 3EAKA 1AQDA 2GUOB 3SDYL 3TNMA 1JUFA 4R8WH 4KU1A 4L5FL 1E4XL 4PS4L 3T0VA 3O41B 1MI5A 1YN6B 2WANA 3BZ4A 3IKCA 3QUMA 2MQ3A 5TPWH 4XXCC 5LBSL 5HI4D 4RAVA 1N8ZB 4B41A 5EUOE 4UNVA 5KSBA 5D1ZA 4RZCA 2JE8A 3FO2B 1JYWA 3C5JA 1IMHC 3VFVB 4RFOH 1M05A 4MDJA 1A2YA 1JFQH 4LPCA 3EJYC 2XICA 3MUGB 3FQRB 2D03H 2O61B 1QSZA 2H32H 3HMWL 2XWTB 4U6TA 2J8UB 5LCVH 4DGIL 3JVGC 5GIRA 5DMIL 4MAUL 4ZOAA 3VXRE 2KL6A 1V3MA 2XN9D 1TCMA 2E9IA 3VGGA 3DOSA 3LEVL 4MWFA 2AK4D 5KTEL 3NACL 4JY6A 5F1IA 2QQKH 5TF1H 3MODL 3EYSL 1Z0NA 3LRGA 3MRHA 4RAUB 1FYHB 5GGUA 4EKXA 5INCA 1MCJA 4H5SA 3TV3L 3FFCD 5BZWB 3EIFA 2QSTA 3P73A 2A73A 2BVQB 3NTCH 2E9WA 2LV4A 4J3SA 5GGRB 5HPMB 3TFKC 5JUEL 4XPAH 1YPZE 3LH2H 5TE7H 3EDFA 5E99H 5EU7E 3EDJA 2EKSA 2EKJA 4AEIL 3CPLB 4IRSB 4RQQA 1RURH 3HLAA 4MSWB 3X14A 4PBXA 4PJBF 4OCXL 5TQ2H 1YEKH 1ITBB 3WHXA 5JOPE 2OXGA 3RWJA 4FFYH 5I18H 5C0JA 1CDJA 3RUGB 3GZKA 4F80A 1XMWA 4LLDB 5I1EH 1VSCA 3QHZL 1P6AB 2CMRH 1GPOL 3UZEA 1TJGH 3WJJC 3VXRD 5C6TH 3Q6GH 1BD2B 4XC1H 3HG1D 3V4VL 4H20H 1RJLB 4YZFF 3LKQA 4NPYB 4D9LL 2H32A 1LK3H 5I8KL 4Z9KB 2HLFD 3PV6A 5FA4B 5DEGA 3IDNA 4GW4A 3LN5B 4PJCF 4XMKL 2CD0A 1REIA 2B0SL 1UWEL 1QSEB 4NKDA 4LSRL 4WI5A 5MENA 4Q7DA 1NGZB 4PJIE 3CVIH 4LIQE 3SGJA 5JIIA 1Z0MA 3V6FB 3MNWB 5I16B 1AXTL 5C7XH 3DX9A 4M61A 3SQOH 1L0XA 2ZG2A 4OQTH 5HI5C 1T21B 1UB6A 2IWGA 3B43A 2Y06L 5SWQB 3HI1A 5L8JB 1EHXA 2EEAA 2F19L 1NAKH 5CBEB 4NO3A 1IC4H 5E2TH 2ZOLA 5JOPD 2Z8VC 1UEMA 3GSUA 4LFHG 3VFWB 2W9EH 2X4NB 1CR9H 3FO1B 5BVJA 5HHPA 4BSWA 4PUBL 3TP4A 3OAZK 3EJZD 4LASH 4OV5B 3MOBH 4OM0H 1HZHH 4R7DA 2XZZA 3I84A 2R2BB 3P11H 4MCYA 3QXAB 3QIUD 1ORSA 1R3JB 2FJFB 1RUPL 3HR6A 5DMJB 1AGCA 1EO5A 2PO6A 5D8JH 3HAEH 3FO9A 5HDQL 3C60B 1T1ZB 4EI5C 3BWUC 4GMTL 3UJIH 4ALAH 3QDJD 4YHPA 4EOWL 4OLYL 1CGVA 1EAPA 4BH8B 5D7JD 4HF5L 3ZKSD 4KQ3L 3V5DB 2YPKB 1VKXB 1FV1A 5I0ZA 2H2SD 2G9HA 2C4FU 4POZC 1VADA 1FFQA 5EU5B 5F7LB 3ULSB 5JOFA 2GTWB 4EI5B 5CSBA 5D7KE 5K9QG 3O3DB 4ESKA 5KS9B 2XXMB 4ODWB 3CDGB 4I3SL 3U0TB 3FHQA 4EVNA 4CU6A 2Q3AA 2EZ0C 2E5EA 2VXTL 3WKMH 4ZTPL 2VXVL 4OQTA 4EDWL 3OAZH 1JMXA 4RISL 4CL7A 1HQRB 3KYKL 3CZFA 3KXFE 5LGKA 2YD8A 5GS3A 4M7KL 2VLRE 4LBEA 5CINL 2EYSB 1DE4A 1KB9K 4LPTA 4N0CD 1NCWL 4G8FB 1GZQA 1LP9A 2OM5A 1KYOK 5D6CA 4Y4KD 5SWSE 4PP2B 3CLEL 3RVTC 5HGBA 1R3HA 2OX5A 2DIJA 5F7WC 2BNUA 3UTOA 4YHOL 3PHOB 3L3KB 3HFMH 4Y16A 1NC4D 4H26A 3MROA 1RY7B 3HAEG 5DD3H 5ELIA 4TUKH 4TNWK 5DJDA 4XWOD 1JWUA 3ILQD 4TNVF 2P5ED 1KIQA 5DVLA 3HAEA 4KHTL 3BUTA 3PHQA 3H6JA 3KPQA 1X5GA 4XVJL 4XP9L 5DYOA 1UACH 3BIKA 5D7KD 1X6NA 3CSBA 5E6IA 3TO4A 1AGBB 1KTKE 4I77L 1RJYA 5A2FA 2XZCH 4PJAE 5FGSA 5C08A 3SO3B 4OSUH 1V05A 2VIRB 2IANB 4OM1L 3U83A 3WBDA 2VTFA 3ZT7A 3P0VH 1J18A 1S9VB 1G7QB 3VG0L 3KXFD 3W2DH 2Q8AL 5I71C 3QIWD 5FYKE 3U7YL 2ZUWA 2RR3A 3H9SB 3MJ9H 1FNAA 5TH2A 2RFXA 3HB3C 2FHFA 3DMMB 3B9KA 5C1MB 3U36A 3I6GB 1NGQL 4ZTOL 1ZAGA 1P69B 1OGTA 5SWSD 2GHWB 2V2TB 1AC6A 1T1WA 4CVXA 2ZZUT 5JNYA 1Z5LA 3BHBB 3VFGL 1MRDH 5C07B 5I71B 4U49A 3HR5A 4F58H 4L29B 3NFSH 3ETBF 5CBAB 3RA7L 1UM4L 2DAVA 1U3HB 3S34H 4JN1H 4PJEA 1A6ZB 3MYJA 5ICZA 4F15C 1XR8A 3NZ8A 4PJDA 5T3ZE 3WV0A 5ALBH 5DJZA 4ZUSA 3EOBA 2Y4SA 1DVFA 1ZLVH 2PYEA 4NT6B 1F02I 3Q6FB 3DJ9A 2YOCA 3ULUD 4FP8L 3QUZC 2ICEA 4R3SB 2Q1EA 4OI7A 3NH7L 1P5VA 3L5WA 3U9PL 1U8IB 4E0RB 1NMAH 5IMOA 3UO1L 3T4AA 4FZ8L 1IKFL 3RVVC 3EZJB 4H8WH 4K8RL 3IJSA 2X6MA 5HHXL 1MFDH 1ZWIA 1UH3A 3QUZB 5GRZA 3P0GB 5ITFB 1ONQA 5GS2D 3VE0B 4HXBH 3MJ9A 1P9MA 2GQHA 1CDGA 5EZIL 2VDPL 3GHEL 4OAWA 5EFIB 4NBYB 1IEBA 5IW1B 5DLMH 4QRTA 3EFFB 2G75B 4TNWF 4V2BA 1NLDL 5GS0L 2ZSVB 5HGHB 2C4FT 5BS0B 5FM5O 4JR9H 3REWB 4M93B 2PR4H 2R56H 1S7XA 2P5WE 4KK8D 1OF2B 25C8H 4I18A 4WI9A 3KNBA 3NIGE 1H5BA 3LS5H 4XNYL 1ZA3B 1AR2A 4HEME 2ED8A 3VFNA 5L2JB 1MNUL 3SDXB 2FBJH 3U9UA 1WVZA 1QR1A 4WFEE 2ITCB 1EJ6A 3SEPA 2HT4D 4UINH 4GKSA 4QGTA 4Y5VC 5GRWA 1FL6B 3ZE2E 3ZE1E 4L8CB 3VFSB 5HGAA 3TEUA 3PGCA 1NL0H 2P24B 2X4SA 4N8VB 3H2WA 4UQ3B 3VXPA 1HINH 1SEBA 2K7PA 5D2LA 3D85D 1FL3A 2JB5H 2PW1A 4FABL 3MSPA 2EXWC 3MRLA 4O02L 2P44B 5ALCL 3P4NA 3BZFB 2W59A 1JF6A 1FVEB 1OHQA 3MLZH 3NBNA 4NGHH 1QEWA 3GKWH 4D9RE 4KKAC 2VITB 1XF4A 4CU7A 5H2BB 2FGWH 4YPGB 3MXVL 1M71B 3O2WL 4XC3L 1NEZG 2IH1A 1IM3A 1AD9A 3IU3B 4LHJB 3VDBA 4LKCB 4PJHB 3WNKA 4F33A 5D72L 5I76A 3TBWB 1CZ8L 1OARH 1ZKAA 4C54A 2P8LB 5CCKH 4PRAB 1AO7E 2MSPA 4ZUVB 3I6LE 1NEZA 2P46B 3VXME 4MHHI 3WUWB 4TTDC 4RMUA 3L5XH 2DYPA 2P5WD 1CD0A 4YAQB 1JRHI 4MXVE 4IHOA 5C0DA 5GRVL 1YEFH 4G42B 2A77L 3EYFA 5I9QB 1ORQB 3QFDA 5HD8D 4DGYL 1Y6KR 2I25N 1A6WH 2X41A 1BIHA 3CFKA 1HYSC 1NBVH 5DR5L 5MERA 4GAGH 5F1NB 5IFHL 3QNZA 2FRGP 4WFED 3D3VA 3KPPB 1U42A 1WF5A 1JGUH 1ZA6B 2JELL 4KZEL 3KPSE 2X5PA 1S8DA 4F7CA 4WRLA 2H1PL 5ACMA 4UBDC 4JG1H 2VXSL 3O6FB 3FT4A 2WUBL 4HJ0C 15C8L 1EVTC 1MAMH 2A2QT 3KPMB 3MLPA 5GZOD 3MV8E 4NQCE 1KJ2B 4I8DA 4JFDB 3N50A 1I3GL 3BP4A 4WUKH 1FO0H 3U4BH 3ZKXC 2LVCA 5ISZB 4F7TB 2BMKB 1ZTXL 3I85A 4OCNC 1U93B 3MLRH 5F9WB 4C56B 3PP4L 4FN0A 4JY4A 4DOHB 4NQEE 1II4E 4CBPA 4PRBB 4J4PA 4L5FH 5GRUH 4WW1B 1EEZA 4PFEA 5L2KE 1RZJC 3GI8L 1WCQA 1AO7D 2EDOA 3D2UA 4OD2B 4X6DF 3I6LD 4XP6H 5ETUB 4GBXC 4LLUB 4HS8L 5MI0C 4KDVA 5DJCA 5EIQA 2X1XR 3QRGL 1KLGB 1T80A 2MCPL 3EHBC 1P1ZB 3LQMA 1A7OL 1ITCA 5C0AD 4P3DA 2YZ8A 1S3KH 4LLYB 4NN7C 1XGTB 3VA2C 4RAHA 2BCKA 4BYHA 1JNLH 1NFDF 5DMIH 1PVHA 2IAMD 3GJEB 3QDGD 3G04A 2E9BA 1TMCB 5TGBA 3MNZB 1OTSC 3MNVA 4GW1B 1BBJB 4KRLB 4PB9H 4LAQL 2ADIA 3S5LG 5KTEH 5TE6L 5JLZA 3NACH 1OTUD 1VCAA 2FX8L 4ELME 4PLJC 2DLEA 2FB4H 2YA2A 4JZJC 4WHTA 2DICA 3MODH 2VDNH 3EYSH 1RPQA 3MV8D 2IBBA 2LU4A 1CE1L 1KPUA 1YEGL 4KJYB 1OB1B 5F6HI 3S5LA 1W8OA 5IMMB 1ZLSL 1V7NL 3TV3H 1CFVH 3SGDH 1M7DB 2X4RA 3JV4A 3TNNA 1MREH 1VACA 2IFFL 2P8PA 4JLRB 4P2QB 4U6XA 4AMKL 1HILA 3H7BA 4UDUB 1CIUA 5JXAL 2ED7A 4Z7VE 4J7RA 2B1AL 3DRQB 4LSUH 1I9JH 3EDEA 4HUMB 4NHUB 1KXTB 2MQCA 3L5JA 2LAAA 3DI2B 4JHZA 1W72H 4EUPH 1PZUB 3PUCA 4OCXH 5FF6B 1PKQE 3E6FB 5T1MB 2CIIA 4UTAL 4WCYL 3GK8H 4NRYA 5IVZB 5CMAB 2AXFA 1I7ZB 1I1YA 5J0BA 3RZCA 3U6RA 5BCAA 1GPOH 4KJPD 4NZUL 4R2GC 5DK3A 4KUZL 4Y8AA 4HV8A 3RX8A 5K9KB 2CK0L 3WN5A 5E00A 3WS6A 2BK8A 3PABA 4MA1C 3BGAA 4CW1B 4YBHA 5BV7L 3AFLA 5FYKU 2F54E 1CLZL 2UVFA 3V0VA 4HUWA 3CK0L 5D1QC 5B4MD 4WI3A 4XMKH 3V95A 3G6DL 2B0SH 3QO1A 1UWEH 4R2GB 2QQLL 2NY3D 4NZTH 1C1EL 1E6OL 4KMTL 4ODXA 1MI5E 3TBTA 2YD6A 2MPAH 4GJTB 1WC7B 1MH5B 3KS0H 3FOLB 5KANG 4M7LL 2NY5L 5KSBE 1BQSA 4GMSH 2Y06H 5D1QB 4W4OC 1AHWB 3SCMC 3O6KH 1HHGB 1ZMYA 2B5IC 1OTTD 3HUJA 1BVLA 1CFNB 3HMXH 3T0AA 2HRPH 1OGAA 3K74B 3BPCA 1G9NH 1KCRL 1R3LA 5IW6A 4EUPG 2RAMA 2HFGL 2P8MB 2A74A 5DUPH 5EC2B 5JW4M 3MLVL 4OZIA 12E8L 1C12B 4PUBH 3H0TA 1W72A 4IS6A 4EUPA 1I7RB 2XPGA 3SCMB 4Y0GA 2B5IB 4OLWL 3UYOD 3L3GA 2J88L 4WEMB 5HHNA 3K8MA 1L0QA 1IQWL 1RUPH 3VXQA 2UUDK 1DEEB 1KN4L 3DETD 1AIFB 4U1SB 1MAJA 3TWCL 5HVGB 3NIFF 2F54D 4L1HA 4X8JA 5HDQH 3SBWC 4YNYA 4GMTH 4DKFL 2AJVL 3Q0HA 4X5WB 3WFCH 3B9VA 3C5ZB 2V2WB 4QHMB 1IGJA 4OLYH 1FDLH 3T1WA 4R0LA 3HPJB 1R3IH 4ZXBA 4HF5H 4MAYA 3OKLB 1MI5D 2C3HA 1G7IB 5F8QC 1IRAY 3OKEA 5AG8A 2XNAA 4M6MH 1BFSA 3DUHA 1MFBL 1N64L 5IQ9B 1HSBB 1I8LC 2F5AL 3R06B 4GRWF 3WMSA 4PJBE 2OLDA 5F1OB 3IJHA 3VRJB 2Z93B 2FJHA 3U0WL 2UWEF 4JANA 1J1PL 2JLLA 4LLWA 2VXTH 1X7QB 2AV7A 1FRGL 2PXYC 2VXVH 3BUYB 2X9XA 5DT1H 4EDWH 2AV1B 4RISH 1FZMB 2CLZA 1RUKH 3OPZL 3KYKH 4JDTL 4XX1E 4JFEB 4G6ML 4M7KH 3HMXA 5EU3B 5DJ2B 1JBJA 3BI9X 3HC4H 5CINH 1Q9OB 3NN8A 5FKAB 2APVA 5FO9B 4I4WA 1KJVA 1T7ZA 5BJTB 4JEGB 4KKCC 2MTPA 1DUZB 4Q97A 2PXYB 3OR6B 1BIIB 3CLEH 4MX7A 1B0RB 2I07A 5MENE 1QHOA 2A6DB 4ZO8A 2DJUA 1QFUL 2P4AB 1WBZB 1YMHA 3WFDL 4MNGA 2VLJB 3O8XB 1CT8A 1E28B 3T0BA 5CZXD 2ENYA 5CJXA 3LHPL 1YEEL 3VH8G 1UT9A 3V7MA 3VFUB 3EYUL 2BVUA 2BZDA 2CLRA 4N68A 4XVJH 4XP9H 1NGPH 2N56A 4ERSL 1KCUL 3VH8A 2WBJB 2Z8RA 3P30L 1RIUL 3CXHK 1CGSL 3NOIA 1MIML 4WI4A 1O7VA 2E7HA 3CCHA 3QQNA 3LS4H 4NUJA 1XGQB 1LEGA 1G7PB 1NBQA 4WUUB 4ONGH 4JRXB 4ZDHB 3ZDXF 43CAA 1EMTH 3NCEB 4YXHL 1ZLUH 3GSOB 3ISWA 1LE9B 2ZSWB 5B3NA 5IF0B 2FWOB 4U7MA 2QTEA 4U1NB 4G8IA 2DD8L 5EU4B 3ZE0E 2K9UA 2PTTB 4HDIB 1YEDB 5IB3B 4QRRA 4K7PL 3P0YH 3V5HB 1NGQH 4M6AA 5F93C 1DP0A 4O2FB 4ZTOH 3JWOL 4XCFL 3F65A 1YECL 1TZIA 3S4SB 2YR3A 4XI5C 5EOCL 3RWEB 3MUHL 2BNRE 3ZHKA 3ULVH 1G7MB 1TJHL 3DVNA 4D3CL 5E95B 5D6DA 2HRLA 1U92A 3RA7H 3V0WH 4P4RA 4YFDB 1UM4H 4A6YL 5JZ7C 5DJXA 3O6LL 4EN3C 1A3RH 4W68A 1FVDB 5CWSB 2W60A 3H9HB 1RZKC 4LSDA 1XR9A 4ZNCD 1KT2A 4Q9CA 1NGXA 1IL1A 3IVKA 3HE7B 1LEIB 1P7KB 1YNLL 1JV5A 3LRHA 4PY8I 1ZS8B 2O5XL 1FE8L 4G43B 1QRND 4FP8H 1ZGLM 1OW0A 4GKZB 4I5BB 1FL5B 1BOGA 1LP9E 3NH7H 4R7NB 1T0MA 3BPOC 4JFFD 4ZSOA 2F8OA 3JZ7A 3U9PH 4Y1AA 2CR6A 3UO1H 1CFBA 5HHVH 1IGIL 3B9DA 4FZ8H 4QWWD 3L7FB 1OWRM 4M1DL 2F74B 1FJ1B 5EC1A 3OB0K 1AGEB 4AEEA 2D7QA 5KSAC 5HHXH 4MJ6B 2D3VA 5JHLH 3BXNA 5IT2L 3U1SL 2JCCB 4XCCL 3DI3B 1RMFL 2BNRD 2EH7L 3MLTA 3SDDC 3BPOB 3HI5L 1S5HB 1WWAX 1EZVY 5EZIH 1N5AB 3U4EB 2BNQB 5EZLA 3O6ML 3GHEH 4NOFA 1D6EA 2NY7L 2OZ4L 1MWAH 5GSVA 4OF0A 1QLFB 4L3CB 3TJEL 3MRBB 5GS0H 3ULVF 5KSAB 2WQRA 5IP4A 1HXYB 1T7YA 4HIIB 5MEQB 1HI6A 5DRNB 3GHBH 3T3PF 5C08E 2XN9B 4HCRL 4IIQC 1TZGL 1FFOB 4MDIB 1KTLA 4HUUB 4XNYH 3RDTA 1UB5A 4NKOA 5GRVK 1MNUH 2OTUB 4N8CL 1F5WA 5IFAL 1PDKA 1TCRB 3D39D 4X9FA 4HX1B 1FP5A 3FFCB 2OP4L 1CL7L 2KUTA 4JFYB 1T2QL 1IBGL 4LRIA 1FZOA 1H9VA 1MCSA 4KKBC 3I3BA 4WO4C 3OB0H 1PG7X 2X1OA 4IOIB 3JV0A 1CN4A 4FABH 3FO0L 5FUCE 3GIVB 4O02H 4P5KB 4UI2A 4WGWB 4Y16D 2AJXL 5I30L 2FO4B 4PGDA 2YA1A 4IOSD 5GGQL 4GRLC 3BEWA 3LV3B 4JY5L 5EUOB 3V8CA 3VD5A 3OKDB 3EGSB 4PGCB 3DO7A 3C08L 3MXVH 3F7VB 4XC3H 4PJEE 1AP2A 3A6CL 4WO4B 5GGSA 4PJDE 3AU1B 5C2BL 5I17B 1D9KA 1T5WA 1T6WA 5HDOA 5IKCB 1CFSB 5HY9A 1JZ3A 1WCBB 1YMMD 2PYFA 1GC1C 4P2RA 4Y19D 1FYTD 1W0WA 1WAAF 4GRLB 3L3JA 3VXRB 2PYEE 1WAAA 1BQLH 1FAIH 3OGCB 4G80B 1MWAA 1VDGA 3C8KB 2J5LB 5IHUL 1HOCA 1W0VA 3WIIL 5JR1L 3U7WL 5GPRA 1WUNT 2XZQH 1GH7A 4K2UL 2JIXD 1GSMA 5EU7C 1I3RA 4NKIH 5IFHH 3BH8B 1S7WA 5ADOL 3TO2B 5EIVA 4KZEH 3IF1B 3B9KD 2QEJA 3KVQA 4IDJH 4MA7L 4NP4H 2H1PH 3FN0L 3UJJL 1J10A 2WUBH 15C8H 3I6KA 1QA9B 3AREA 1J88A 1KTDA 1KELL 5I66B 1A5FL 4ZAKD 1I3GH 2BY1A 2KKQA 1ZTXH 2IALA 2YKLH 4ZFFB 2Y07L 4Z0XA 3PP4H 4WV1A 3QIUC 1M7IB 1U8MA 2VLME 3CX5J 4S2SB 1R5IA 5FK9A 4HKXA 2VDOL 3LQZB 2PF6A 2FGZA 2X70B 3B9AA 3FQTB 1U8LA 2HG5A 1T04A 5L9DL 4Y4HD 4HKZA 5T1KA 3ARDA 3R1GL 4KJWD 4XCEB 5T1DL 2APFA 3TT1L 4Y8DC 4OBSA 5ERWA 3RWIB 3UBXB 3B8SA 3ALXA 5DSCA 5CS7A 3QRGH 3QIUB 3VWJA 1HQ4B 3NCYP 1A7OH 2V5RA 3WE6A 1QFWI 4F7EB 1AC0A 4XVTH 1JK8A 3BT2L 2R9HC 3NFNA 1T03L 1X9QA 4OLXH 3O4LD 5GS1C 4PLKD 5GQBA 3OJ2C 5D2LE 4NNYA 4PJIB 3X3FL 1H3UA 3EJJX 2QHLA 2VLLB 4QF1A 5TE6H 4YBQC 2FX8H 2PCPA 2C1PB 4TSBL 1X5FA 4P5TA 1INDL 2GI7A 2VL5B 5IB1B 1CE1H 1I1AD 1YEGH 2RGSA 4HPYL 2RCSL 1PG7L 5I0DA 1ZLSH 2MWCA 4LNRA 4P46C 1RZ7L 1TQCC 2X2YA 3M8OH 1MFAL 5J6GA 5JXAH 4DK6A 3AGVA 3BFOA 4HJGA 3TIDA 4IRJC 3O3EA 1DLFL 2B1AH 5F3BB 2CLVB 5I8OL 2W0KA 3ARFD 2QSCL 4NRXB 3HCVB 2UYLA 1W0YT 1OL0A 1QLRB 1C16A 5SWZA 3MBEA 3WJLC 4XBPB 3LMJH 2J8UF 1U8JA 1TFHA 2HYMA 4UTAH 3ALWA 4MQXC 1MHHA 5ACZA 3SJVD 3D3VE 4JB9L 4OD1L 2J6EL 2XWJB 3TBYA 4G9DA 3WXVL 3T0EA 5L6YH 2VQ1B 1CICD 1GHFH 1MPAH 4GAYA 2P42B 4DCQB 4X6CA 3WEXB 3SKNA 2I5YL 4YFLF 2CK0H 1S7SA 4N1EA 4QTHB 1JWMA 4ZUUB 3STZB 4ZFGL 5I75C 5J8OA 2DTML 2R2CA 1HIML 5BV7H 4HSQA 4ZS6C 5AAWA 3OKKB 4LMQE 1MHEA 5KSUA 1S7TB 1S7UB 2GCYB 3CK0H 5CGMA 5J13B 5JHDA 3G6DH 2FEDD 3B9EA 4Z76B 1FNEA 2QQLH 4XCYA 3E6HA 2AXJA 1BFOA 1K4CB 3MGOB 3BISA 1E6OH 4KMTH 2HVKA 1IGYB 4OZ4A 5I75B 2AEIT 3T3MF 3GFUA 2YC1B 2FECL 2ZG1A 3B6SB 5K33A 2O5YL 4M7LH 2ZPKL 5DF0A 4NQDD 2NY5H 1U8HA 4LLQB 2JKXA 3KXFB 3SDAD 3LIZL 2K3TA 3O3BA 3QIWB 2VLRB 4UT7L 2DQGH 1F2XK 4P57B 1MELA 4NUGH 3RUGF 4XBGA 4MD4A 3RVUD 2HFGH 3MACL 3QI9A 3MLVH 3DUSA 5SWSB 2FATL 3C87A 4IOFC 1C08B 3TT3H 1BLNB 1J0HA 3W81A 4J6RL 2W07A 4JGUA 3PWUA 3ZYZA 3VGEA 3BQUA 1ZHBA 2ZJSL 4PJXF 4XPBH 2J88H 1U0QA 3LN9A 1IJ9A 3ARBD 4PJXA 4G7YL 4NO0B 3VD7A 1K8IB 1BREA 1IQWH 1KN4H 4X7SL 1QZ1A 4L8DB 4ZYKA 1ZVSA 4JFHD 5IEHA 2HLAB 5INDA 5C92A 1CYGA 4XVSH 2AJVH 4XZUA 4AM0B 5JW4N 4CUCA 4HWZB 3I75B 4WHCA 4JHWL 5K9OB 4QY8A 3MC0A 4F7MA 4LHUA 4PJAB 2NTFB 3HRZB 3GSRB 3ZKND 1IKNC 1RK1A 1FNLA 5IGXH 4D0BA 2G5RA 3LEXA 1KJMB 3JBG7 4KI5E 4UZGA 1N64H 1NFIB 4ZFZA 5HYQA 1IAOB 2FJGA 4LLVB 1KFAL 3DGGB 4JREB 3OKOB 4KXZH 1KB5L 1AD0A 5FUZH 5CAYB 1JZ8A 1U8OA 2CKBB 1A1OB 2NX5A 3K2MC 3C5SA 3UAJC 3OPZH 4JDTH 2R1YA 1T83C 4L8BB 3W82A 5D7IF 1DQLL 4F57L 4NCC1 2Q7NA 4GXVH 1CD1A 3TN0C 1PGRB 4AK1A 1JN6B 5IK3B 4OFYD 2MMXA 3IDGA 3LOWA 4R9HA 3O9WA 1D5MA 4JZOB 2E9JA 5L88H 1G7HA 5BXFA 5JPMB 3S97C 1QFUH 1MY7A 4XT1C 4HK3J 4LCUB 5DQJB 5HYSB 1UKTA 5EOTA 3TN0B 4P59L 2MJWA 4YQXL 2YXMA 3IDIB 1BQHA 3RVWD 4UT6L 3LHPH 4U05A 4OTXL 2FIKA 3EYUH 3HUJE 1HHJA 1OGAE 4WI8A 4MNHA 4ERSH 5ID0A 3FMGL 1KCUH 4U6YB 2VABA 1RIUH 2WP3T 1MIMH 5CSGA 4OZIE 4OF3A 2EYTB 4LSSL 4JJ5A 3QPQD 1OSPL 2QR0B 5E0QA 4LSTL 3STLB 1CGUA 4DQOL 5LGJA 1EFQA 1DUYA 3W5NA 4YXHH 5DQ9A 1IZKA 4LOUD 4K94C 3D9AH 5I2IA 4YH6A 2DM4A 5F7UA 4X6EB 2VAJA 3TJHC 3GUTB 4D94A 2YD4A 2XT1B 4HT1L 4MD5B 1ED3B 4P2OC 1EDQA 3KWWA 1IT9L 3GSQB 2Y6SC 3JWOH 3O11A 4XCFH 4LSPL 1YECH 4AEFA 1JYNA 1Q0YL 5EOCH 2D4DA 4LRNH 2N7AA 4WU5A 1XCTA 1KULA 2P5WB 3A6BL 4U3XA 1L6XA 4NFBA 1FAKT 4D3CH 4LCWD 2E3VA 5TDPA 3RWDB 4P2OB 5GZOC 1ACYL 3KDMB 3O6LH 2WK2A 4QKXB 4GRMA 3TYGH 2I26N 1AKJA 1ZLWK 4YFEA 3CFBA 1OGAD 3IGAB 4H1LB 4I0PA 1RJCA 5E2UH 2X4QB 5HTSA 3FB6A 4UT9L 3VI4F 2BERA 3FONB 3CFJA 3QFJA 1ZXQA 4UIMB 4PJ5D 5FDWB 2O5XH 3WS3B 2X7LA 3GSWA 3D0LB 3MGTB 4HUVA 5CGYC 3P9MA 3WIFA 3EOTH 4UV4H 3C9NB 2DKMA 4JO1L 1IEAB 3QIBC 2YSSA 2DM2A 5CP7A 4PB0H 2XTLA 5C6WH 2IGFH 3VW3L 3VRLF 1IM9D 4NSKB 3AY4A 1FIEA 5DJ0A 2Z8SA 3MJ8A 1Q38A 4HUXB 1OAQH 3D18B 1AO7B 3GB7B 5JQ6L 4MNGE 1AI1L 3RU8L 4KZDH 2C1OB 1HHHA 3BP5A 3LPWA 1RMFH 2EH7H 3MV7A 3HI5H 3QIBB 1T89C 5MP6L 4KV5F 4NM8H 3O6MH 2Q3ZA 2HFTA 2OZ4H 1SJEA 2L0DA 3TA3A 3GSXA 4WHDA 1ZLWH 4U6VH 1NCAL 4YEEA 3TBVA 3TJEH 3NFPB 4NZRL 1UM6L 4GFTB 4EI6B 3FQUA 3KLDA 1CD9B 1JRHL 1JGLH 1TZGH 2FZ3B 1FNSL 4R4BA 4GW5A 5FDYA 1VPOL 3IDJA 1B2WL 4X4YA 4QRPA 1H3TA 5TDNA 3ZDXE 4L3EA 4P4KC 3MV8B 1HH6B 3HHRB 1CFQA 4JO3H 4FS0A 5HGDA 2WWMD 4M5YL 4RFEA 1J1OH 4OGYL 4QRRE 2WWKT 1DTUA 1I1FB 2OP4H 4R96B 4YDLB 1T2QH 3CVHB 5FB8A 1IBGH 3CNKA 3TYFB 1I8MA 1PYWB 4NQEB 4IRZH 3I02A 5AUMB 3QUKB 4BH7B 1LO3L 1SYVB 2NYYC 3FRUB 3QO0B 3FO0H 5A3ID 3NCJL 3FAXA 3BVNA 4LPWA 5T3XL 5L2KB 5I30H 1A4JA 2NR6C 4WU7B 1CQKA 1EXUA 2ESVA 3TCXA 4JY5H 4GXUM 4OLZH 3C09B 4PTTA 1BVKA 4CN4A 3C08H 3QUXA 3W9DA 3A6CH 4JPWL 1WJ3A 3WO3B 2DQCL 5J7CC 3BJLA 2PW2B 2BY0A 4PRNB 2EIDA 4TUOB 4GUPA 4JM2C 2WP3O 5EWIL 5BW7C 2GFBB 3SE9H 4YUEL 2G2RA 3TH3T 3UJTL 4H0GA 1LK2A 4G6KL 3BE1L 3T65A 2OZ4A 3UTTD 2OK0L 4HZLA 1GYAA 4PJ8C 2DL9A 4NZJA 5DWUL 3WIIH 2NNAB 5JR1H 4JHAL 1HHKA 2WINA 4ORGA 4ZFOL 2HVJA 3QQ9D 5F3HB 2H2PC 4ZSOE 4PPTA 1Q9KB 4Y1AE 4L8SA 3QZWA 3RWGA 1C7SA 4JM2B 4HIEA 1MFNA 3BX7C 3BZDA 4QRRD 5JPNA 1DBML 3N9GL 1FVCB 3GBNH 2BP3A 3FT3A 1GGBH 3UC0H 3UJJH 2Y7QB 5EBWB 5FO7A 4OZFG 5DC4B 5IJKC 1K5NB 5BQ7B 2VE6A 3NAAL 4PJ9C 1WZKA 3DVGA 2EO1A 4AIOA 5IVOA 3MRFB 4AEHH 3PJSA 3L3DB 1N5YH 1KELH 4GKNB 1A5FH 4Y5VA 5AZ2H 3S37X 3F12A 2BRRH 5EU6A 3RZWA 3TPUA 4PJHF 2W1NA 2Y07H 2ZWLT 4NN6C 1MUJA 3TH2T 2FL5B 3AS0A 1Q72L 1PKQB 4UTBL 3OAUL 2AQ1A 3RWHB 2VDOH 3KPNA 4X6FB 2CIKA 5CJBA 4Y2DD 3PDOA 5HBBA 3ULVE 2IPTL 4WWKC 4PD4K 2GKIA 4KI1A 4MZ2A 5T1DH 1CIDA 5TDOA 3GM0A 3QAZC 2X4OA 3LKRA 4X5LA 4AG4L 4QRUB 3KYMB 1BZ7B 3HS0A 2F54B 3E3QE 1Q0XL 2UZIL 4N1CA 3BT2H 1LDPL 2DTSA 4Z7OF 5DO2D 3MRJB 5D1ZC 4D8PB 3W0WD 1AQDB 4U1LB 3TNMB 3UTSA 1NCUA 2A1WL 1JUFB 1EFXA 5FUOH 2YMXL 3QAZB 3QEQA 5E8PB 4G8GA 3X3FH 4NQXA 1MI5B 3QUMB 3VFTA 1L7TL 1HNGA 4Q9QL 4TSBH 4RAVB 1INDH 1ZT7A 1VEMA 2B4CL 5AYUL 5KSBB 3FTGA 2RCSH 4M1CD 1PG7H 4RZCB 4C55A 3MREA 1M05B 3CDCA 4MDJB 5CIPH 4WI2A 5DD6B 1A2YB 5T1LA 1RZ7H 3TZVD 2DQTH 3HNTH 4FA8A 5DC0A 4LEOA 4P2RE 1F6LL 3ULVD 5GIRB 4GLRI 5CKGA 3U30C 2QSCH 5HVFB 1GJIA 1WAAE 1T5XA 3CUPA 1IGTA 4OB5L 4XPGL 5F9DC 4MWFB 3UBXI 1EZVX 1OWWA 4JY6B 4Z7UA 5F1IB 3CU7A 5IWLA 4JO2L 3MRHB 5GGUB 1RD6A 2HN7A 5DD0L 4JB9H 4BFGA 2J6EH 4GBXA 3U30B 4W6YB 4H5SB 1OAKL 2AABH 1E4JA 3QHFL 4HFUL 3P73B 1FC2D 3ZT6A 2WWKO 1N6QL 2A73B 1OPGL 4QTIH 2EO9A 3O45A 4NN5C 1P2CA 2I5YH 4GG6F 4ZFGH 1ROWA 1QPXA 3S36X 1E4KA 1WWCA 1L6ZA 3KYNA 3TLRA 1G0YR 4UNTA 4YHKH 3X3GH 1HIMH 2EKSB 1UGNA 4WY7H 5C3LD 3K7UA 4RQQB 1NBYA 3X14B 4RFNC 2ZUQB 2Z8WC 3L7EA 3OB8A 4NWUH 3WHXB 4PJBB 5D1XD 3RWJB 4NN5B 3GJFK 4JZJA 4R4FH 1TNNA 2X4UA 3MRDA 3QA3B 3FN9A 3UTPE 2BX5A 4QOKD 1V3LA 3BDYL 3WLBA 4RFNB 2N4IA 3PP3K 4DKDC 3VXOB 4B53A 5DVNA 4OCWL 4N0YL 3SGJC 2AQ3A 2B20A 4HBQA 3LKQB 1MCKA 4M7ZC 1J11A 2H32B 1U2HA 3NCFB 3B2UD 3PV6B 4HLJA 3A67L 1OAYL 2YPLA 5DEGB 3IDNB 4GW4B 1JHKL 5JIHA 5I8EA 1YNKL 1TLKA 4NKDB 3RKPA 3RY4A 5MENB 4J6RH 3Q3GA 2ZJSH 1A7QL 1E4XI 2XTJE 3F7YA 1X5HA 1WSST 4UIKL 1WFUA 4EXKA 3DX9B 4M61B 4MJIA 3DX8A 1CBVL 2HTKC 3R0MA 4X7SH 2BSRA 2J6EA 1JZ7A 3NABL 5HDLA 2VJXA 2B1HL 1FSKC 1ETZB 3EBAA 2WUCL 1P7HL 3MO1A 4NO3B 3PIQA 4Z95L 4JHWH 2ZOLB 3GSUB 32C2A 4FQJH 2PO6C 4LLAA 3SKOA 3VFPB 3A6OA 5BVJB 1ES0A 4QWWC 5D7SL 5HHPB 4BSWB 3QH3B 2QL1A 5T1KD 3UTPD 5C0IA 3PP3H 4OCSH 5SWZE 4PY7A 4R7DB 5C0GA 1EO8L 1FSKB 5EPMA 4MCYB 2GT9A 4ODTL 3VMNA 5L7XH 4JFFB 1ORSB 3ZO0A 1AGCB 3QDAA 2D31A 1UVQA 2PO6B 1EX0A 1NH6A 1KB5H 3FO9B 3T0EE 2D7PA 4LGPB 3CSGA 4X6CE 4YHPB 5C09D 5IUSA 1G6RH 2BVOA 3RGVD 1EAPB 1A9BB 5EA0L 1EHLH 5I1GH 1YYML 4F57H 5CUSL 2BNRB 3WNOA 3WO4C 1FV1B 3HRPA 4XNUL 3AC0A 5IMKA 2G9HB 1Y0LB 1J8HA 3E0GA 4M8VA 5AG9A 5JHDE 2D7TL 3PQYD 1F42A 2DDQL 4TQEL 3OL2A 4EVNB 2APWA 2DKSA 3MRMA 3T3ME 1FPTH 2ID5A 4JRYA 5DUML 4YQXH 1KC5H 2VR9A 2ARJA 3FZUD 2CRMA 2XQYK 5CFHA 4UT6H 1Q1JL 1WK0A 4JFZH 4NIKB 1J86A 3OJVC 4Y16C 4LBEB 1CXKA 3HC3H 2EIZA 1DE4B 5C0RH 1GZQB 3FMGH 2DLHA 4H25A 5D6CB 3NIDF 4ETYA 3IRZA 2X4PA 2EE3A 1WTGT 4LSSH 3FRPG 2IPUK 5HGBB 1R3HB 2X89A 4TSCL 1OSPH 2BNUB 1SHMA 1BGXL 4Y16B 4HKBB 5FYJL 4DQOH 4H26B 3MROB 5E6IC 1UWXK 3FRPA 2DQHH 5DJDB 3TO4C 2CK2A 3EJYD 4PJXE 1JWUB 1RVFL 4M3JA 3BYTA 1KIQB 1T0NA 2VQUA 2J2ZA 3HAEB 1KB5A 1S7VA 1KIRA 4I9WE 4HT1H 5B39A 1U6AH 3IU4L 5T5NF 4OLUL 2NLJA 2CO6B 1IT9H 1GIGL 5DYOB 2C26A 4QRSB 5CGTA 1G6RA 3BIKB 3T0XA 5HVWA 2QQNH 5E6IB 4Y19B 4POYA 3TO4B 1CLYL 4N0RA 1RJYB 4U1MA 3B9KC 3A6BH 5C08B 4OT1H 1AGDA 2AI0H 4PR5A 3VMOA 1B0GB 1UKSA 4L4JA 1HDMA 4WJ5B 5FUCC 4WHYH 2NXZC 1DANU 1JPFA 3RNQA 1RV6X 2VSCA 1X5AA 5EBLA 1BZ9A 5TH2B 3UMTA 3TFKD 2RFXB 4APQA 2NX5E 3B9KB 3U36B 4UT9H 2V5MA 5SV4A 1GGIH 1XGRB 3OKMA 1OGTB 4KQ4L 1MCBA 1A6PA 2V2XA 1T1WB 4J23A 1VENA 1ZE3C 2KBGA 2A6JA 5JNYB 1Z5LB 3UZVB 4UB0L 2NXZB 5D7IE 3VU2A 3HR5B 1DSFL 4JO1H 1DVFC 2NY2C 1H15A 4U1JA 5TQ0H 4Y5YA 1GAFL 3DBXA 2QADD 2UY7A 1NGYA 4I9WD 1QSED 3VRIA 4PJEB 3VW3H 3MYJB 3KG5A 5ICZB 1XR8B 3NZ8B 4PJDB 4DEPC 4ZUSB 3EOBB 4Y4HB 5J6HB 2W9LA 3Q48A 4BSJA 4F9PA 5IHZA 2KZ1B 4U1IB 1DVFB 2A6KA 2QHRH 5C9JA 1BVZA 3RWCA 3BP6B 4HH8A 2PYEB 4OFKA 1D5ZA 1IZJA 2C7UA 2RJMA 3RVXC 2AJ3A 1GCFA 5HPOA 4LKXB 3OKNA 2F53A 3TM6A 1RZGB 5ADPL 2ICEB 4DEPB 4LARL 4NZRH 5E08L 3L5WB 1UM6H 4HLZH 1P9MC 3V2AR 3JXAA 3G5XA 1A4KA 3BEVA 1JPST 1JRHH 3O4LB 2XQBL 4YC2C 5IMOB 5GJSL 5EDXA 3IAGC 3T4AB 3T8XB 4WHYG 2AKRB 2BDNL 5HI5D 2NX5D 1VPOH 1B2WH 4QO1A 4EN3A 3IJSB 1C8PA 4YWGL 4JKPH 5IVNA 3AXLA 3KPRD 1ZWIB 4PTUA 3P4LA 2IPUG 2IQAA 3FOMA 4M8QA 4P23A 4RMVA 1ONQB 4XHJD 5E5RB 4I18C 3CZJA 3LKPA 1DQJA 3BKYL 5IEKA 3QQ4B 3NCMA 4YC2B 1T6VN 4OAWB 4UOW1 1JZ4A 1RAMA 3IXTA 1IEBB 1KF9B 4D0DB 1BM3L 1JWSB 1VEOA 4CMMA 5KN5A 2JCCF 4QNPF 4P3WA 4LCIL 4TTGA 3NCJH 1YUHA 3CMOL 3U4AA 1S7XB 1TITA 4I18B 3KNBB 3QXWA 5C8JA 3I50H 1H5BB 2R4RH 3BWAB 1LEKA 1F13A 2IEPA 3VFNB 5FV2A 3EDKA 3QCTH 1KIPA 4EI5D 3L9RA 3HNVL 3MFFA 4JPWH 3SJVB 3ZTJH 5ECJE 2GAZA 1NAMB 4GKSB 3SDDA 4O9HL 2E6QA 2FX9L 5HGAB 1KEGL 3PGCB 4MMXC 2X4SB 4YUEH 4MHHG 3QFJE 4POZD 3VXPB 4H8WC 3MLUL 1SEBB 1Q94A 3DIFA 5D2LB 1FL3B 4JGJA 2OK0H 1QFWL 1V7ML 1SEQL 3MRLB 5IHLB 1HSAA 2X1QA 5HVHB 2DOCA 3P4NB 5C2UB 5IB2A 2EC9T 1YJDL 2ORBL 4KGJA 2DQUL 3V6OA 1QEWB 4Q74A 5CZKA 2EZ0D 4Y4FA 1XF4B 2APXA 1FFPA 1NGWA 1CXHA 2KPNA 1IM3B 1AD9B 2CDGA 3KAAA 5DEZA 4F33B 2I60H 3RVUC 5I76B 4JGMA 1DQML 1KNOA 2JK5A 2NY1C 3CSYA 1N0XL 4KTEL 2A6IA 1NEZB 4GOSA 1JPTL 1KB9J 4YHYB 3MV7E 1UJ3A 2DYPB 4HBCH 3SDAB 1KYOJ 1L9MA 4IHOB 5C0DB 4ODVL 5FAAA 2JJVA 3RVTD 4K71B 1L0YA 1MLCA 3EYFB 1E0OB 3QFDB 2YD2A 2VZSA 1J8KA 3OAUH 3DX7B 3CFKB 1DBKL 3AS2A 5E9DD 5GZNC 4DVBB 5MERB 3LY6A 3QNZB 3D3VB 2A38A 4UILH 4QXTA 1C5CH 1MHPH 3T0DA 2B2XH 3BJ91 4F7CB 3KR3H 1J0JA 2IAND 1KPVA 5SX4I 1CE6A 3ZTJG 3GRWH 5HHOD 1S9YB 3FT4B 4J4PC 5IIEA 3RJQB 3SKJL 4L3EE 1IE5A 4KRNA 3F7PC 5FYJD 5HYEA 5EO9A 4DUWA 4M4RA 5IBTH 2DB8A 3P4MB 3H9SD 4NWTH 1WV7T 2CUHA 1SYSA 2UZIH 3D0VB 1LDPH 4CN6A 3U46A 3GSNB 4JY4B 1QSFA 3DRTB 4J2XA 2YMXH 1KCSL 1YPZF 1EEZB 5DK2A 1KEMH 3BPLC 1G6VK 4P9HL 8FABA 5D71L 1B4RA 4ZFOA 1L7TH 1U3ZA 4OZHF 4UQ2A 4Q9QH 3IAQA 2VZVA 4AH2A 2Q76A 4OZHA 2ESVE 4D0CA 1CDHA 4X6DB 4YXLL 4O2CA 2B4CH 1AY1L 3HB3D 5DJCB 1I85A 3QNYA 2EE9A 3RTQA 5LQBH 1X6LA 1HKLL 1PBYA 3BDBA 5I73C 4U2ZA 3ARGA 1INEL 4JCMA 4QT5A 3BPLB 3RAJH 1V8HA 3IRPX 2OMBA 1V5JA 1TVBB 1I75A 3NMEA 4X7DC 2EYRB 4QHKI 4Z77A 1NFDB 4OZGA 2BOBA 3G04B 4K3HA 1BFVL 2CUIA 5TGBB 1FC1A 4XPGH 2ADIB 4EDXB 4TYUA 5JLZB 5F88A 1UZ8A 4K7FA 5I73B 3O41A 4WHTB 1MCFA 1I8KA 1I1RA 2HKFL 3U7AA 1KPUB 3S5LB 1EJOL 5DD0H 2VR4A 3N1QC 4NCC2 4OFDA 3SE4A 4KI5C 4PJIF 1OAKH 1D6VH 3QHFH 3GRWA 1N6QH 4QGYA 2X4RB 3TNNB 1VACB 4U6XB 4DGVL 1HILB 3H7BB 4HIJA 4BQCA 5C70A 5DFTA 3QUZD 1YEHL 2HA1A 3RZCC 5I1DA 3HZYA 1DDHA 4IJ3C 1NUNB 5EU6E 5EB9A 2VDML 4F9LA 2ESVD 5GGSY 2VB5A 3RVVD 2F8XC 1NMCC 2IADA 5L0QB 3WN5C 1FORH 4N0UE 4P5MA 3WS6C 2NTSP 5GRXG 1YY8A 2CIIB 1YY9C 1JPGA 3S37H 4NRYB 3IFPB 2AXFB 1JHTB 1I1YB 1E4WL 1HCFX 3SOBL 3RZCB 5KBNC 3U6RB 4XNMA 1UA6L 3BDYH 3THMH 4BUGA 2YXFA 1PEZA 4HV8B 4P46A 5AYQA 4P0DA 1NMCB 4OCWH 4N0YH 3WN5B 5E00B 3G5YB 3DROA 2FX7L 5DI8A 3MZTA 3PABB 4G3YH 1I7TA 3V0VB 4HUWB 3HC0A 3A67H 5KZCD 1OAYH 4YBLC 3UTSE 4B7LA 4CADA 3QO1B 4I48A 4IRSA 1YNKH 1S7RA 4X99A 3DX6B 3QEQE 3PL6A 1OAZL 2DMBA 4G8GE 3HI6H 4ODXB 4V1DA 1AXIB 3TBTB 1A6VL 2VL4A 4E5XA 4UIKH 3MRKA 3HE6A 2YPVL 2YZ1A 2AJZA 5CEYA 3NABH 4YBLB 2B1HH 3HUJB 1BVLB 1IGML 3S35X 1OGAB 2WUCH 1BD2A 4OF7A 3BPCB 4M7JL 3MZGB 3BMVA 1R3LB 2EXWD 4Z95H 5IW6B 2A74B 3GEWB 2EDJA 4OZIB 4JPIA 5FA4A 1HN1A 5SV3A 3H0TB 1W72B 4IS6B 3SDCA 4EUPB 4Y2OA 4KKAD 4ZNEA 4HWEL 4LCYA 2XPGB 2Z91A 4HFWB 2VYRE 2JTDA 1DCLA 2KDGA 4Z7UE 1EO8H 3L3GB 4R0LC 4ZXBC 4ODTH 4EXPX 4N1HB 5HHNB 3UYPA 4DFHA 1U3JA 4MAYC 3MRGA 2CPCA 2EDTA 1J7VR 3BPNC 3VXQB 5I16A 4XP1L 4GG8A 2XWBB 2YRLA 4TTDD 4X8JB 5SWQA 4YNYB 3QDMD 2VC2L 1KENH 1IGJB 1EFXD 3H3KA 4R0LB 4ZXBB 5EA0H 4G8GD 4GG6E 5HYJA 1ZOXA 3BPNB 4XNUH 5ISZD 1HYSD 3RFZC 2HKHL 1XF5A 4NFDA 1I4FA 3BO8A 2D7TH 2C3WA 2VOTA 3DECA 1ZK9A 4UBDD 1S9KC 4Z5RB 4JFXB 2DDQH 4GRWB 3MJ7A 2R2BA 1G9NC 4HJ0D 3LPGA 3IJHB 2AGJL 1H8SA 2OBGA 1R3JA 2FJHB 5I6XB 4JANB 4Z7WA 3GMNA 2V9TA 4LLWB 5DUMH 3MLSL 4LDEB 1EEYA 1A7RL 3C60A 2CLZB 2DQIL 1A6AA 3H3BC 1Q1JH 4BJLA 4DN3L 3LRSA 1KJ3H 3NN8B 4X5XA 3CH1B 1KOAA 4WDIA 4JQVA 1FZJA 2YPKA 1DLHA 4JDVA 4FQLL 2YPLE 5CJXC 4K9EH 3EYVA 4AENA 5EU5A 2GTWA 4GBXD 2GSGB 4OV6F 2I07B 4TOYL 2VH5L 4DUXA 4TVPL 3EHBD 4NQSB 5F44A 3U0TA 4MNGB 5ICXA 2QV2A 4FTVE 1ADQH 4MJIE 5D96C 1CT8B 5DHYA 1UM5L 2L4OA 2DMCA 2ZCLL 2BXYA 5KSVA 4CU8A 2VDLH 2VLKE 4CVUA 3BRGC 5GHWH 1H3PL 1X3DA 1OTSD 4G7VL 3VH8B 3QG6B 1CLYH 4PLJD 4KY1H 1ZANL 3CCHB 5D96B 4NUJB 3UTQB 3S35L 1KPRA 4TPRH 4FQXA 4PP2A 3UTTB 2Q87A 43CAB 4S0TD 3M17A 4Q0XL 4W4NA 3K4ZA 3KPOB 4FQ2H 4N9OB 1A21A 1JF5A 2NZIA 3L3KA 1ODAA 2VZ3A 2ADJA 3V52H 1ZT1B 3QNXA 4G8IB 1GGCL 3LAFA 5D6DC 5DFWH 4QRRB 1MJ8H 3RI5K 4HS3A 4RCAA 5FIEA 5IROA 2YPLD 3KS0J 3DVFA 4KUCF 1MJ7H 3QHTC 5I74C 4MNQD 4BZ1L 1F3DH 4KHXL 1RZKL 4XVUC 5DDHA 1KCLA 2VERN 3GKZA 5D4QA 4OIBA 3CDYA 4WFHD 4FTVD 4MJID 4YGAB 1U92B 3ARWA 5E6ZA 1J8HE 2CUMA 4G9FA 5KAQG 1GRWA 2OR9L 5DJXB 2VSDA 4R2GD 5LGHL 2VLKD 2W60B 5I74B 3CXDL 1XR9B 5DO2C 2ICWI 2ZOKA 3NIGF 2ADFL 1ADQA 2CRYA 3OJMB 1NGXB 1IL1B 2EDKA 1IQDA 4JRYE 3IVKB 4JO4H 1HCVA 3DMMA 1JV5B 4MQ7B 4M5ZH 5DMYA 1AXSA 3WCYA 5D1QD 5E8NA 5FO8B 5F72S 5CJQL 4KDTA 2GY5A 2ZUSA 2EE2A 5ADPH 1MVUA 5IB5B 1BOGB 1DR9A 5FYLH 3ZE2F 4LARH 3ZE1F 5E08H 3QXDB 1A0QH 4ZSOB 3W0WB 1DBBL 1NCBL 4HZAA 3CJJA 1I9IL 3O3AA 5I15H 1P4IL 1U3HA 1XH3B 2N1KA 2DI9A 2LAGB 1A14H 4Y5XC 3UPAA 3SCMD 5DVOA 3ECBA 4JFOB 3VXSA 3ULVC 3BXNB 1F97A 2MKWA 2XRAH 4PG2C 5LXGL 3MLTB 3MX0A 2HT3C 2QSQA 1VFBA 4E9LA 1F90L 4NJ9L 5DEFA 5EZLB 2KQMA 3RDTC 4NT6A 1D6EB 3D69A 4PP1C 5GSVB 1BM3H 1NCTA 5B38A 4PV8A 1X5JA 2XYCA 1GOFA 5D70L 3E3QC 1HI6B 3CMOH 1A7NL 4MXVF 5JXEA 1I9EA 4XPHL 4LRIC 1ULVA 5GISL 1KTLB 3RDTB 3IDMA 4FFVC 3EYQC 1UB5B 5D5MF 4NKOB 2VXUL 3HNVH 4GH7B 1FIGL 5D5MA 1PG7W 3EKCA 3GMLB 4Z0BL 3KHQA 1DQDL 1TNMA 3VD9A 3EO1A 4O9HH 2PN5A 4X98A 2FX9H 1FZOB 1KEGH 2APTA 1J0IA 4RRPA 2X89D 3MLUH 4K8RC 1D9KC 1QFWH 5CSZA 2AQ2A 1SEQH 5IQ7L 4TVSa 2AXGA 1R5VB 2ZUYA 3MLYH 3RHWF 1YJDH 2ORBH 3BEWB 2E8ZA 2DQUH 3PNWA 2GIYA 5H94A 1DL7L 4OCMC 1A6TB 1QFWM 3DO7B 2PTVA 5E1AA 1ZA3A 2PXYD 4FNLL 5BZDA 2NXYC 4BQ8A 1AP2B 4P4KA 5GGSB 3SDXA 5ITBH 5GS0C 1D9KB 1T5WB 6CGTA 5FHAL 5HY9B 2XG4A 2PYFB 2VR5A 4P2RB 1W0WB 2XKUA 2VLJD 1O0VA 3RY5A 1CWVA 3L3JB 3ROLB 2FCBA 4KKCD 4XAWL 4HH9A 3TIEB 1MWAB 4ODVH 4HK0A 2F53E 2NXYB 2F58H 2OMNA 1HOCB 1W0VB 2COQA 3AREC 5DFVC 3MCLL 3G6JA 3IFOB 1FN4A 4UU9B 4K3JL 5EN2A 1FVEA 1R24A 2V7HB 1NANI 1BJMA 2NPLX 4WV1C 5H2BA 4APQD 4WUUD 5C0BA 1NSNL 4YPGA 1RSFA 1M71A 4JRXD 4ELMF 1MQ8A 4PGJA 2BSSA 3WUWG 3SKJH 3I6KB 5TE4L 1KTDB 3ZTNL 4JM2F 3ARDC 1JI2A 3CXHJ 2H41A 1N0LA 3P3YA 2IALB 4MJ5B 4KVCH 4L4VA 1JNHA 4YAQA 4Z0XB 4WV1B 3VWJC 2FLRT 5GGTL 1U91A 4G42A 4Z7VF 4PJ8A 1U8MB 1R5IB 5FK9B 4HKXB 5GJTL 3X11A 1U8LB 2HG5B 1T04B 4P2CG 5JW3L 4P9HH 1RI8A 4HKZB 5T1KB 4K7PY 3ARDB 4YE4H 2HFEA 5JMRA 1EHAA 4YXLH 2E27H 1ZA6A 5ERWB 4HHAA 1CTNA 5E2WL 2EDBA 4PJFA 4X7EC 3O0RL 5B21A 1YQVL 5DSCB 3VDAA 3O6FA 3VWJB 5DZNA 4RMTA 1EBPA 2XTJC 3DXAE 1NMBL 1HKLH 2OYPA 3WE6B 4PJ9A 4XI5D 5E2VL 3TH4T 1INEH 4F37K 4P5TC 4JFDA 3SQBA 1TVHA 1JK8B 4XH2B 3NFNB 4LHQB 4F7TA 3AS1A 1RIVH 1U93A 1IFHL 5F9AC 3T04D 5KOVC 3WLWC 5DTFA 3F7QA 1CL7I 3UYRH 1BFVH 5FECA 1ND0A 5JZ7D 2Y36L 1VGKA 2DI8A 4ODUA 4QF1B 2EDDA 4EN3D 2XTJB 4U6HA 2PCPB 5JA9A 4QCIA 4P5TB 4WWKA 1UXWA 1QNZL 3V6OE 2Z31C 1MCIA 1EJOH 2DQDL 3MBEC 4LNRB 3BRDA 3RIAK 4XXDA 4ZUWA 1KLGA 5EBMB 2D0GA 4DGVH 2IBGA 4KGLA 1QG3A 5K59F 4OKDA 3O3EB 3ELAT 5KSBF 4YDKL 1YEHH 3T0EC 1I8IA 4G8EA 4M6OL 2UYLB 4HUKB 4ZS7L 1C16B 2Y25A 2BNQD 4KVNL 5D7LA 5SWZB 3MBEB 5H37H 1JI1A 1U8JB 3N85H 2HFFB 1BX2A 3DXAD 3H3PL 1MHHB 5KSAD 5TJWK 1E4WH 4G9DB 3T0EB 3SDDD 4ZO6A 1J0YA 4KKNA 4BQ6A 1UA6H 4GAYB 4X6CB 1LE5A 2XA8L 3C8HA 4I3RL