1A6AB

The structure of an intermediate in class ii mhc maturation: clip bound to hla-dr3
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
187
structure length
187
Chain Sequence
b'PRFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title The structure of an intermediate in class II MHC maturation: CLIP bound to HLA-DR3.
pubmed doi rcsb
molecule tags Complex (transmembrane/glycoprotein)
total genus 48
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 1998-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a6aB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1a6aB01
3X3FH 1NGWA 1RVFL 2CH8A 4KDTC 5AD0A 4FRWA 3S5LB 2DQIL 1XF2A 1JGLL 4PLKC 3V6BR 4D9QE 2F58H 2KL6A 4D0CA 1QRNA 3MLTB 5FGBA 2W9EL 4PRAB 3D25B 3MODH 5I30L 4YWGL 1MI5E 4YE4L 2GTWB 4WDIA 3GZKA 1MWAH 4LKCA 5E95B 2ARJB 2BHUA 4KH2A 4TSBH 1R5VB 4IJ3B 4R0LB 4MYWB 3RQ3A 4YJZL 3FQTB 1GGBL 3K4ZA 1FZOA 3GSWA 5DJAB 1KV3A 4JQXC 1DL7H 5E6ID 4BQ8A 3VXME 1WTGT 1UXWA 3C6LA 3REVA 3D2UB 3L3JB 1L0QA 4F9LA 1F45A 3TWCH 3GSUB 4XHJC 3L5JA 2OJEB 5CEZL 4DCQA 2NXZD 5EU3A 4CUCA 4F7EA 4ZAKA 3QDMA 4IRJD 5EUKB 3O6KL 3UJTL 5T3ZD 1JWUA 5L88L 4XNZC 4GKNA 4XCFL 1U3YA 4GQ9H 2A77H 1M7DA 4YO0A 4IMLA 3WEXA 5ALBL 4WU5B 2WQ8A 1LO2H 3QPQD 5BVPL 4U6VH 4NKMA 2XA8L 1B2WL 3P0YH 4CKVX 3HS0B 3EYFA 5I8CB 4TUJA 4GG6F 1M4KA 4P2QD 3QDHA 2F5AH 3JZ7A 1Q9OB 1WJ3A 4KJYA 3UTSA 3TO4C 5D7JD 2EZ0C 5C0EB 5T3ZE 1XGQA 4LQFH 3MGAA 5EG6C 3DYOA 4Y19B 3T0VA 3CXHK 4PJ5A 4HCRA 4JFDA 1KLUA 5E8EA 1PEWA 5CZKA 4P99A 5AYUH 3WE6B 1EO5A 4AH2A 4EZMA 3AMLA 4XWGL 5HGGS 2FGZA 5T33L 3GNMH 5I19H 1QOKA 3ET9F 2VXTL 4PJ8A 4FQ1L 4U3HA 1VPOL 3MNWB 1A3RL 12E8H 1OQXA 2FR4A 3ZDXE 2ZSWA 5DYOB 4MS8C 5C0GA 4MDIA 3HA0A 3BUYA 3MACL 2R1YB 3P0VL 1JGLH 3ZSSA 3A6CL 3RGVA 1I9IL 3PHSA 3BH8B 2W9EH 1A9EA 1DBBH 2YUVA 3OTTA 4HK3N 3TBTA 5EORH 4YWGH 4OZFB 5ID0B 4YXHH 4R4FH 1IC4H 3NH7L 1X5KA 3OXSA 4K94L 2IPUK 1JFQH 2Z8VC 3LH2L 1A6TB 5FYLH 4LKXB 2A1WL 1CLYL 1SYSA 2JELL 5EOQL 1J8HA 1X7QA 3WJJA 3WXWH 2G2RA 3HAEH 4KFZC 4AMKL 2YA0A 4UOW0 3V6ZA 4OF0A 1OAZL 3N50A 4YAQA 4UIMB 4PLKD 1QSEA 4UU9A 5GGSB 4HUKB 4JHWH 5FDWB 1AQDA 1TPXB 4DZBA 1NGPL 3V6OC 2HMIC 4OQTA 5C0FB 2XNAB 2B2XL 4JRYB 5LG1A 3D18B 1RZIB 3QIWD 3K80A 2CRZA 5ALBH 4ZXBA 3HG1D 3QFJD 4JO2L 2ZUTA 1QFPA 2CLZA 2E6JA 2YN3A 3IRPX 4JKPL 3WSQL 4ODSL 1NBVH 1S5IL 3L9RA 5EZOH 2I24N 2XTJC 3L5XL 4LAQL 3IXAA 2RGSA 4XHJD 2FX8L 4FMFA 4PRDB 5JOPD 2J88L 1S7WA 3WL9A 5JZ7D 3TZVB 3KXFB 2WZPD 2P5WA 4X7TB 5BQ7B 1WEJL 3E0GA 1IAOB 3RWGB 5KSVB 5CEYA 4YC2C 3CVHH 4XT1C 5JHLH 2AJVH 4NRZB 5FEBA 4CN1A 3QT2A 3RVVC 4OZIE 4AQOA 4F57L 2HN7A 3IFLH 2Q76B 1HHKA 2PO6B 1KOAA 3HG1E 3C5ZC 3QFJE 4NGHL 2XZZA 1X5LA 3TC9A 4PRNA 2AQ1A 4G9DA 2EDTA 1RJYA 1RURL 1RIUH 2IBZX 4JQVC 1N5YH 3JXAA 2FEEI 1OAUL 4M93C 4M5ZL 4C59B 5BW7A 3RWHB 3W5NA 3SDCC 4M1DH 4G42A 1KN2H 4CDHA 3H8NA 2JJTC 3I85A 3DX7A 4YBHA 3TO4D 1I9RH 5E2TH 2ZCLH 3FO0H 1BQHG 1N26A 2N7BA 1TZIB 1XGPA 4C54A 2NY1C 4CMMA 1AC0A 2VLRD 2YBRA 1YEEL 4NKOB 4ZOAA 3UCRA 3ARFD 1FJ1A 2FEDC 4POYA 4LU5H 4JREB 4PR5A 4TRPH 3M8OL 1UWGH 2OQJB 3LIZL 2HFFB 4G6KH 5E8PB 3H2WA 1CFTB 5EOQH 5FA4B 4EI6B 5IMKA 4G6JH 3GI9L 4APQC 1O0VA 4LSDA 4D94A 3KDMB 4FFWD 3U6RB 1JN6A 4MQXD 4MS8D 5HTSA 1YDPB 4F33B 4M43L 5DI8B 3QFDA 1S9WB 2ICEA 4Y5YC 1JNLH 4OGAD 3N0PB 2GJ6E 4X6FB 5LWYL 2VLRE 5D71L 3CFBA 1RI8A 1UB6A 1H15B 1MELA 5K9KB 3QNZA 5DS8A 3HC0B 5HGBA 4L4VE 3WFCL 4I18B 1FRGH 3CIQA 3JWDH 4CVZB 1CFNA 2D0FA 1NCCL 2NXYC 1ETZA 2YD3A 4FFVC 4LASH 2UWEB 3DXAD 2NPLX 2OK0L 1YJDH 5I6XC 2UYLB 2YUXA 4P9HL 3EO0A 2VAAA 4HMDA 3WCYA 3TBSA 1Q9OA 3SDXA 3JV6B 3KPLB 4KI5E 2L0DA 4HKJB 4FFYH 5T1LB 4RMTA 1RUAH 1MRDH 4AIOA 5C0CD 5EBWB 1CLCA 3FCTB 1UM5L 1DBAL 4GOSA 3ZDZF 1KN4L 1P1ZB 4ZTPL 3SKNB 1TQBB 3E1F1 2FD6L 1XCTA 2Z93A 2R0KH 5CBAB 5AG9A 2EYRB 2AKRB 3ETBF 4WEBL 2CKNA 4K7PL 5JDJA 1L7TL 5JW4N 5IG7A 4D0DA 1YNLH 3WBDA 3KPPB 2R1YA 3O11A 2NYYC 4YHPA 3FOLB 3L3HB 1A5FL 5EU4B 4WHYG 1MFEL 2VLKB 4K9EH 4U7SA 3KLAA 1RZKH 4HCRH 2X4NB 3BWUC 1WK0A 4TN9A 3IDXL 2I5YL 4JN2A 1FE8L 2ICWI 3BP6A 1YEEH 2D7PA 1U6AL 3RVVD 4Z7WA 5E00A 3S96B 1KJMA 1Y18A 2I9TB 3U9PH 5IKCA 3FTGA 4XPTL 5FCSH 1F6LL 3AY4A 4FQXA 3TT3L 1NCAL 5DUMH 3CU7A 1MHEA 3IU3B 2BNQA 1XF4B 2EEAA 3GI9H 3E6FA 4HT1L 3T0WA 2X70A 3RP1A 3MO1B 3Q6GL 2APVA 1HDMA 3VXQB 3CDGA 3L3OA 2AVGA 2HWZL 3SOBL 3H3KA 5I1GL 4NUJB 3VD7A 3DURA 1I7TA 4HULB 1L0XA 5BO1L 1A8JH 2EIBA 5ERWB 4XP9L 3A0OA 2GSIA 1LO3L 1F8TH 1G6VK 2HJKB 4YX2L 4L3ED 4P9MH 4M6MH 3QDGD 5F7DA 2B5IC 2E9IA 3DARA 5TGBA 1JZ7A 1CR9L 3DNKA 3DYPA 1N6QL 3GHEH 2XFXA 1KUMA 3L3GA 1T7XA 3FT2B 3VXRD 2R23B 5IMLA 3U46A 2BNRB 1CT8B 1GL4B 4HIXL 3QUXB 4U6XA 2X1XR 4MQ7B 4LRIA 1IAOA 3MJ9A 1MFDH 4LBEB 4JLRB 4P2OA 1FIGL 4KDWA 1JPGB 4OQTH 5HJ3B 4NRZA 2R2CA 2XY2A 3PWUB 3GB7B 2GSGB 4QRQA 1DBAH 1AI1L 3TYGH 2PO6A 4TVPD 3X12B 3FB6A 4KJWD 3V52H 2CDEB 1UQSB 2NY3B 5GZNC 3QXAA 2QSCH 5K9OA 1DQTA 2AV1B 3E8UH 2YXMA 4MGXA 5F7EH 4IDLA 3WXVH 2VUYA 1KIPA 2Q1EA 2YD2A 4ZFZB 3DPBA 5HDOA 4JVPA 1LD9B 5DFWH 1AP2A 1UJ3A 1Z9OA 1M71B 3QXWA 5KAQF 4H26B 3K8KA 3FFCB 5C07E 2AK1L 2ZWLT 4JPWH 1T83A 1J1OH 1KTDA 4I0KA 2X4PA 1Q94B 32C2B 3BO8A 5IV2B 1CFTA 3WNMA 2OSLB 4EI6A 2BVEA 1B88A 4ZUTB 4F7PA 1BIIA 1NCAH 4HAGA 3GMLB 3HMWL 1ZLUK 1UWXK 4WWKB 1SEBB 2R1WA 5C6WH 2ZOKB 4XI5C 4Q58C 4C56A 3DETC 4TOYH 1MUJB 5JQ6L 3CPLB 3EW3B 4X6FA 3SCMA 3I2CH 2Y23A 1K8DA 2PTVA 1N59B 4IRSC 3R1GL 3VFNB 4D3CL 4MLSA 3X14A 4JZJA 4IRZL 4HWZA 5L2JA 1H3TA 4DW2H 3SE8L 3ZT5A 3KAAA 1LDPH 1MVFA 4QYOA 4JDTL 3O3DB 1FDLH 1PDKA 5CJBA 2QHRL 1OF2A 1EDQA 4PJXB 3ZKQD 2BOCA 4PG2A 2OP4H 3MLVH 1ZANL 1A7QL 4RBPK 2DI7A 4U1SB 4HS6A 4JE4B 2EDYA 1X4ZA 3UTQB 2A9NH 3D69A 3ALPA 5EBWA 5CD3B 3ARBB 3O41A 3FCTA 5D1QC 1EXUA 1UM6H 4ZQKB 5EUOF 1WVZA 1J0HA 4XBGB 5EO9B 1C5DA 3ZDYE 2C3VA 3IGAB 3KPSB 5TDNA 3S4SG 2YD5A 1P5VA 3IDGB 2XN9D 4GXUM 4MCZA 1S5HA 4P49A 4Q9QH 3O6FC 3RWJB 1GYAA 2A6KB 3RBSA 4MQSB 4JO3H 2AGJL 3MOAH 4UILL 1D6EB 4KROD 2B4CH 4NO0D 1PKQE 3WMSA 4B0MM 5LQBL 4PG9A 1NSNH 3MV9D 1SJEB 2FJHA 3FOLA 4OKVA 5B38G 1NBZB 1T21A 1XR9B 4XP6L 2XRAH 4LOUD 5DRNA 2YD9A 4RA0C 5D1XB 3K74B 5EOCL 3S36H 4Z78B 1FNSH 1A7PL 5FYKU 2VKXA 2XN9E 4YHOL 5BMFH 2ATPB 2FRGP 5T5NF 5GZND 2HRLA 3VDAA 3CSPA 2HJFB 5KTEH 4Q7DA 2GTZA 4RGOL 1T5XB 1U8OB 4YDIL 3D3VE 4OBSA 3MV9E 3OR6B 1R6VA 3FO2B 5B3JF 2V5SA 3B8YA 3HUJB 4OI7A 2J8UF 3MREA 3F58H 1RHHB 5C0ND 2IPUG 1I1AA 1G7MA 3B83A 1KELH 1WGOA 4KK8D 2ZSVA 4PJHF 4RCAA 4Y2OA 4OZ4B 2Y25A 5E56A 5DJ0A 2LTQB 1RZJH 4MLIA 1KT2A 3VGAC 1HILB 3QUYB 3VI4F 5D72L 5DDHB 2GJZB 2DLIA 4PJAB 1H0DB 1VGEL 2FIKB 2UVEA 3VI3F 1U8QB 2DYPA 2HYMA 3HCVB 4YR6A 1FPTL 2H6PA 2FBJL 4QY8A 4R2GB 5D7LB 3L3DA 4OCYL 2BY0A 4WGWB 1Q1JL 5LVEA 5EZIL 1FVEB 1NMCC 5HJ3A 3ARGA 3P11L 3IDJA 1HEZA 4IRSD 1RSFA 1WZ1H 4PJGE 1U3HD 1MCFA 5FDYA 3MRQB 2GSGA 1NEZG 4Q6IC 2ZG3A 3FONA 4JM4H 1HIMH 4OZHF 2IMNA 5HHOD 4JG1L 3NOIA 2CDEA 1CDGA 2UUDH 2X9XA 5CJOH 1QFOA 4N5UA 3RY5A 1I7RA 4XC1L 4P57A 4DEPC 4G80A 1RJLA 3RL1A 1ZLWH 3QXDB 3DUHA 1GGCL 1MNUH 1N8ZA 5JIKA 4RFEB 4BJLA 1DANU 3MJ9H 3GI8L 3SGJC 1DUYA 3INUH 3FFCA 4XCNB 1WFTA 1AFVL 1B4RA 5D70H 5D1QD 4PRIE 1B0RA 3QEUA 4NKIL 3EJZC 4RZCA 5HHOE 5AZ2H 3VXPB 3WD5H 4BK4A 2VQUA 3R0MA 3EFDH 4HIIB 5D9SA 4J3UA 1MOEA 1U8NA 3QDJB 4OLUH 1M7XA 1W72A 4ODXA 2NY5C 3LKOB 2VDQL 2BZDA 2J3SA 4WWKA 3U7WH 3VDCA 2DB8A 3BUTA 3LEYL 3T0DA 3VFVB 4P3DB 2R56H 4RX4D 5BJTA 1BQLL 2P5EE 5TF0A 4LLVA 1QBLL 1XF3A 1R5IA 3ALWA 2IH1B 4FABL 3WS6C 4WUUD 3D39B 4DUVA 4LP5A 3CCHB 1I1YB 3PABB 4QHMA 2E6PA 1E0OB 1HHHB 1FZJA 3AXLB 1KPUB 4PJXA 5DFVC 2V2XB 5IMOB 4PB0L 4GW4B 5IHLB 4GS7B 1KCVH 3S37H 1T7WA 4E41E 7CGTA 1JMXA 1NH6A 3V7AG 3GRWA 5CJ8A 4M5YH 5FYJE 5DMKB 3EJJX 1YY8A 5DQ9B 4KPHH 3T08A 4BSWB 1MRCL 5GGVH 4GRMB 3CDCA 4JM2B 1AHWC 4FQCL 2MQ0A 5SWSB 4LCCC 4HPYH 5K93A 3QG7H 4L8DA 1K4DA 4PGDB 3BH9A 2ARWA 3VXTB 2Z8SA 3IGAA 5GGQL 4AL8H 5DD5H 1KJVB 4YHLH 4G8IB 4JFFD 1K3IA 4LVNC 3KJ4B 4NOFA 4P23A 4JPIA 1RUQL 4PRBA 5CGYC 1G7JB 3ZTNH 4ELMA 1ZT4A 4EVNB 1J5OH 2P8PA 4OSUL 5DT1L 5KSUB 5JHDE 3U1SL 3EIFA 1SBSH 3OR7B 1ZS8B 3QEGL 4NM8L 5KVGH 2OTUA 1UH2A 5B39A 1HI6B 4GG8B 4NQCE 2VO5A 1E4WH 1XR9A 4ONGL 1EJOL 4QRSB 4LFHG 2HKFH 3TT1L 1CICD 3ZLQC 2XI9A 4HK3J 1OGAB 4JKWA 3MXWL 5E8NA 3PGDA 4HJJL 3CLFL 1GZPA 3EDKA 3PHOA 2ATPA 3R8BB 3BDYL 3IB4A 2OMBA 3ZE1E 4OV5A 1BM3H 2XZCH 4OLXL 1RZGB 1NBQA 4G7VH 1T5XA 1Q0YL 4I77L 4O2FA 3FO9B 5DC4B 1AO7E 5DD6A 1J86A 4O02H 4LSQL 4NRYA 4U1GC 4L8CB 3RNKB 3HUJA 4CADA 3TNMA 1RHHA 3H9SB 3GSQB 4HV8A 1YA5A 2AP2A 1C7TA 4DGYH 1QBBA 1UKTA 1DDHA 3BRGC 3DX8A 1WFNA 1EO8L 2GW5A 3EJZD 1RJCA 4FP8H 5J6GA 3QUYA 3EFFB 4P5TC 5CJ5A 4FQLL 2VDLH 4QCIB 1M05B 2DWEB 4WO4D 5KVEH 1UEMA 4IIQC 2DTSA 3FQUA 2W60B 2NMSA 5JXAL 2BHZA 4ZFFB 5E1HB 3QWOB 3SGEH 1LEIA 3CFEB 4NQUA 1KBGH 1KEGL 5T5FH 3NVQA 3BD3A 4HUMB 3BSZL 1FVEA 3GMNB 4P4KD 2IBBA 2RQ8A 3LN4A 5ALCH 3U4EA 1FSKC 1TQCC 1OW0C 1MRFL 1ADQA 2BRRH 2BXYA 2WK2A 4GO6B 1KC5L 3BPCB 1IKFL 2PR4L 4GW1A 1U8IA 3NIDE 1S9XA 1YN6A 3S88L 1Z0MA 3C87A 1MFBL 4MXWH 2N4IA 4UDTA 5GISH 1S7XA 1WT5C 2H45A 1MVUA 3L3KB 2ARJQ 5L8KB 1WC7B 4DQOH 5I73C 1XT5A 5F70A 3OAYK 1ZA6A 4F9PA 4J4PA 5FUOL 1BZ9B 4N8VA 4RAVB 4BKLA 1E28A 3MRNB 3RNQA 5FYJL 1FIEA 2ZUXA 4MNQB 4PRHB 1FG9C 2W65B 3SE4A 1P6AB 4MZ2A 3RTQC 3VXPA 4TSCL 3EOYG 4HXBL 4J3WA 5CGYD 5F88A 3ZHLA 3WUWG 1F90L 2H9GA 1OB1B 2Z92A 1W0WA 4N0FB 4I13B 3W9EB 4Z76B 4WTXA 3ES6B 1UEYA 5CJXC 4DAGL 5EU7C 1AD9A 5F89B 1BFOB 1ACYH 1EFXD 1AIFA 2OM5A 1V5JA 2IH1A 1XF5A 2XQBH 4OCLC 1BEYH 1H8NA 4GUPA 3TA3C 4DUWA 5TE7L 2DTML 4JRXB 2VZ3A 5EH1A 5EFIB 2Z8RA 3VFSB 1HHHA 5ESVB 3MLPA 1W72H 4NWUL 5E5MB 4OLVH 4S1RL 1PQZA 3QCTH 4I2XA 3AREC 5SWZE 1GC1C 1KEML 2DKSA 3OZ9H 4WHCA 1BGXL 4KVNH 1GHFH 4XZUA 4W4OC 5SWSA 1IGMH 3QCVL 4PV8B 2SEBA 3JWOC 1XGUB 4JANB 3VG0L 3RWIA 3MUJA 3GSXB 4K8RL 3VFTB 5EPMA 2BRQA 1T3FA 2CPCA 5C09E 4XMLL 5E6IB 3AAZB 3O3EA 2PYEE 4P5TD 3ARYA 3U79A 1RUMH 3LD8B 1XGRB 2ZOLA 1MCKA 2R15A 3QIBA 1P6FA 4RGNC 3TGXA 2DQUH 1FO0B 3GRWH 3OR7A 1HH6A 2NXZB 5MERB 4OJFH 1BJMA 2ZUQC 4IRJB 4MJ6B 4UUJB 2EH8L 3MRRA 1OM3H 3SPVA 5GIRA 4AZ8A 4GXUN 4V1DA 5E2WH 4ZO6A 1ZXQA 1NFIA 1LO4L 2DQDH 3JTSA 2ESVA 2DLTA 4AG4L 1MAMH 3QHZH 3QUZA 2FO4B 4HLJA 4PTUA 2WUCH 4X6DA 4LF3B 3VWJC 4Z7UF 4X5WB 5FHAH 1LEKA 3OG4B 4R8WL 3BHBB 5I9QB 4XNUH 4P2QB 2V2WA 1F90H 1T04B 3RAJH 1YYLH 3SGEI 4BELD 1IZKA 4PYHA 3ABZA 4X7EC 1WBXA 2YPKA 1NGZB 5D7JB 4OF5A 5HHVH 4H8WL 3I3EA 3V7AE 4OFPA 4OCXH 1CIUA 2B1HL 4YXKH 2EEDA 4EN3D 4LSSL 4U0QB 2ADIA 4LNVA 3RVUD 4GKSB 4MA7H 2VDOH 3W2DL 1P7QD 4LFHD 4JCMA 4HPOL 5I16B 2AAVA 4ZODA 3BP5B 1YEIL 3PWVB 2DL9A 2WBJB 4IS6B 1XCQA 3MUHL 4UZGA 1WBYB 3OKDB 4OV6F 3T0EE 4ZDHA 4TTDC 5J3HC 3TNNB 4AT6B 3UTOA 3GMRB 4K3JL 3DYMA 2FZ3B 1E27B 5DD0H 3GMNA 2A6JB 3SDDA 1YMHA 3CAFA 4K7PX 1DVFD 2H8PB 4XGZB 1FL6B 3PHQA 3TA3D 2FO1A 3PXHA 2QSTA 2WV3A 5DVMA 1JNJA 3LZFH 3D6GA 4G9FD 3SEPA 1YEKL 5TPWH 1NL0L 1QEWB 1T0NB 2RJMA 4EOWL 5L0QB 4OUUB 3L3KA 3T2PA 4QF1B 2PXYA 5L8LB 2EXYD 3BN9C 3ARED 5BS0E 3BPLC 4KKAD 3JTTB 2D03H 3V79C 2EC8A 3KJ6L 5DWUH 3TN0C 1PY9A 1JJUA 4WW1B 3IKCB 2I07B 3QJFB 1J0YA 3G6AB 2EDHA 2DQCL 1ADQH 4Y4HD 5IESL 3QIWB 1AGDB 3N1QC 1F5WA 3RUGF 2Y5TA 1V7NH 2EXWD 3UO1L 1ZLSH 4LSRH 2MQCA 3QUMB 2IGFL 2HVJA 1LWRA 4POZC 3L5HA 4UT6H 2D31B 1QHOA 1JWSB 1CDJA 1P84K 3STLA 2FECL 4RGND 1IZJA 1FN4A 2DQGH 4JFQA 5CP3A 3IJYA 4HKXB 5F89A 5EDXA 4DN4L 3D85A 4HWEH 1MI5A 4U0RC 1YEFL 3F7RA 5D7IF 1M7IB 5I1JL 5HHPA 5FV2A 3CDFA 1KCKA 2AXJA 3PG2A 1V3LA 2BNUA 1IGFL 2ZUVA 1VB9A 3I6LE 1T1XB 2Y36H 4UBDD 4XNYL 3T4YB 3VFOB 3VXMA 2Q6WB 3FAXA 3OHXA 4KUZH 3P3YA 5HHXL 1UH4A 4PJEF 4DTGH 4PJDE 4OFYD 2WSKA 5DJ2B 2R9HD 5IR1B 3FT4A 3CLEL 3EYOA 3QRGH 1FFNB 4KTYA 3BAEL 5E7BA 4DOHB 4DJMA 5I71C 1NGQL 3TO4B 3QG6B 1UM4H 4MB5A 1YPZF 3G6DH 3V0AC 4C4KO 3ULUH 5CD5D 1YQVH 2GK2A 1U8MB 3MLYL 1HWHB 1WWWX 4PV8A 1H5BB 1FGVH 2MPAL 5FF6A 2BCKB 5J11B 1WCQA 4TYUA 2AJYL 3NABH 5EU6D 3NZHL 1UYWH 1YEGL 4NQXB 1NDGB 2JB5L 5EO0A 2AEIT 5F93C 4PJ9A 3IDYB 3NCYP 4KGJA 1WUNT 3T2NL 2EICA 3EYSH 5SV4A 4OD1H 4PJFE 5L2KE 4XMKH 3L6FA 2JJWA 4X7SH 4RAUB 4NWTL 1JHKL 5I1KL 5CILL 3EOBB 1MCJA 4I3SL 2EKSA 5HDBE 5J3HD 1BVZA 1T66D 4R4ND 2APBA 4MJ6A 3CXDH 1ZHLB 1KYOJ 1AKJD 5H35A 4HG4J 4KY1L 5IFHH 2NZ9C 1QFUL 5DTFA 3ZTJH 4P59L 3ZL4H 1K85A 4JY5L 1QTYT 1QSFE 4D2NA 4X4YB 2YA2A 3OKLB 4NSKA 5CMAB 3RWEB 4Z6AT 2V2TA 5DO2C 5E8DH 3VXSE 5EBGA 3RX7A 3DXAB 2A83B 4OLYL 4X7CC 2X10A 4FTVE 4ODHL 2EIZB 1HH9A 2QHLA 2YSSB 5IHBA 2APWA 2Y1VA 3UYRL 5JUEL 5D7JA 1OTTC 3NCFB 3IS0X 5C0CB 4MJ4A 2QKIA 3ESUF 1JP5A 3REWB 3F7PC 1CF8L 1WFOA 3O6LL 3C5SB 3DMMA 3MRIA 1ZAGA 4DGIH 3QNXA 5IJKC 1ZK9A 2CQVA 1JF1B 5I16A 4GG6B 5GS0H 3ROLA 4PBXA 4QRTB 2OJZH 2O5YL 3JUYA 5HYSG 1PW3A 5HGDA 2V9RA 4JVWA 2Y9RT 1WBYA 3LV3A 4QXWA 3KYKH 1QBMH 1N0XH 4Y4FC 4KDVA 3MV11 4YZFE 5D6DA 2DRUA 4NQED 4X8JB 4KMTH 4MNHA 5HD8D 1FG2B 3QO0B 4NO5B 2IAMA 1CXIA 4P48A 4QHLB 4ODTH 4HFUL 3LSOB 3QULB 4YC2B 3PL6D 5EOTA 4GAYB 4FQIL 5GGUB 2VTFA 4ESKA 3V5KB 1OWRM 3QIUD 2H8PA 3MJ8A 5DEFB 5JO5B 3DHJA 3MMEA 2DL2A 3MRBB 5MEQA 4P5MA 3C5ZB 4G43A 2QTEA 4WCYH 4NRXA 2R0LL 1X44A 4MJ2A 5DJ8B 4XP5H 2JB5H 1MJUL 3MC0A 4Y16D 1QEWA 4WFHD 4JPKL 1BBJB 3JVGC 1FP5A 1T22A 4M93B 4Y7MA 3GSNA 2E9JA 3D9AL 3SDCB 4JHAL 3UYOD 1F42A 1YYML 4M6OL 5D8JH 1BQUA 1A1MB 2DM2A 2NY1B 2H32B 1LEGA 3SKMA 4M4PA 1RUKH 2D9CA 3MROA 1RUPH 1BF2A 1JPFA 2VABA 3WNOA 2YK1H 2VWEE 4X99B 3U4BH 3HG1A 3QFJA 3WFDH 4L3EB 5FKAA 1KCRL 5SX5H 3QDGB 3B2UC 3MRCA 4ZUUA 2CLRA 4M7KL 1FO0L 3VA2C 1JGEA 1JWSA 1JZ6A 4ODVH 4HS3B 5KSBF 4JN1H 3VXRB 3THML 3MNVB 4P4RB 4Y5YB 2Q8BL 1A6AB 5IW6A 2CMRH 1S9YA 4YHZH 5FYKE 1CK0H 5F1IA 3S35H 2O61A 4WV1B 1HZHH 4QXUH 4UI2A 4RFOH 2NZ9D 3AM8C 3D0VA 4G5ZL 2GK0A 4N0UB 1Q9LA 4LGSB 2MHAA 3CU1A 1K4CB 5T3XH 4L29B 1UXSA 3I75A 5DO2D 3V5HA 1MIEH 4Y5XA 4YGVA 1RZFH 1ZSDA 3GIVB 1UA6L 3WIIH 3LHPH 2BMKA 5I6XB 3NA4A 3I3BA 1NMBH 3M1BB 4K3DH 4ZSOE 3FQWB 2OX5A 1FFNA 5CP3H 1JGUH 5JLZB 4FHBD 3P9MB 2BC4B 1OTTD 1DUZB 1PAMA 2GJ6A 4UT9L 1UCBH 2KQNA 1Q72H 2VLRA 2I25N 3MLXH 3ARFA 5EBLB 4WIQA 1U8LA 2NCMA 5KS9E 1CD8A 4NQDB 3OKKA 4F8TA 4L4VA 1J0KA 3WIHL 4M4RA 4XPFL 1UVQB 3G5VA 3LKNB 2EC9T 1EEYB 2FIRT 3GHBH 3QQ3B 2HFEA 5DVLA 2ADJB 3PGFH 5EN2B 3HI1B 4OIIH 3SQOH 5LXGL 2R2HB 4ZPVA 4G8EB 3AS1A 4AIZB 3NFSH 3EJYC 5J13B 5GZOD 2G75B 5CUSL 3RZCA 2HT3C 2XYCA 3HNSL 1ZE3C 4PLNC 1SYVA 3MA9L 1CGXA 1HXYA 4ZD3H 3AGVA 3OKLA 4HX1A 5CMAA 1DE4B 1YN7B 3AC0A 1LO5A 4JGJA 4LVOC 5ICXB 3ARDD 3DXAA 1GRWA 2BSRA 5EWIL 3T3ME 5IOPB 3KPRE 1QQDA 2BY3A 4B7IA 1MCDA 3BW9B 3O2VH 5IVXE 2AV7B 2X4UA 3C5JA 3HR5A 4Y5VC 1JYNA 4XBPB 2P8MA 3CH8A 5T3ZH 5SWQA 4EIZC 3TFKC 1AR2A 5KW9L 2E6QA 3QHFH 2KKQA 4W68A 5EBMB 4PREB 3QUKB 3F8UB 2XTJE 1A0QH 2J8HA 2Z31A 3MSPA 4LDLB 3MLSH 3QUML 4Z0BH 2HRPL 1Z3GH 1QSVA 4TTGA 3WJLC 1VCAA 5DF0A 3BWAB 1HKLL 3WLWD 1KXVC 1FNAA 1F4YH 5B3NA 3LS5H 5A16B 5TE4L 1YEJL 4X6CE 1MPAH 4XVSH 1U2CA 5E0QA 4RNRB 4QHLA 2QQNH 2NX5D 4QTIH 4OM0H 5MI0C 2VC2H 2FX9H 4RQQB 4GXVH 4JY6B 3VJ6A 3RIFF 4R97B 5FGBC 3GKWH 4QOKE 4WRLA 4GMSH 4X7FC 3N1PC 4PJCE 2NY4D 5FYKL 4YEEA 1NC2A 2BOBA 1A47A 1ZTXL 3VFMA 4Q9BA 4OCSH 1Q0XL 3BEVA 5IBLC 4X5XB 4YUEL 1GZQB 1M1SA 5DSCA 4M61A 1S7RA 3DX9B 4JVUA 4OLZH 5LAXB 1IGTA 1P4BH 3VXNB 2X4SB 3JWDC 2MOVA 4WJ5B 3C6LC 5EC1B 4L4TE 1Y6MR 3BPOC 1F4WH 4F9LC 1R3HB 3O2DL 3ZYZA 4Q2ZA 1N64L 1OLZA 2H32A 4IOFD 4U1HA 3KYMB 4GMTH 1P7KB 1A1OB 4ZAKC 3ALXA 2EO9A 5I1IL 1CFSB 4RGMC 4AM0A 3V4VL 4L3EA 1MQ8A 4OI9A 4JJHA 4H25A 2AJUH 4MHHI 3GFUA 4NDMA 3F12B 4XMPH 2QQKH 4OLEA 1JRHL 5MEOB 3IF1B 4EQ2A 1JZ3A 3GSNH 3TJEH 4NC2B 4NJ9H 4HHAA 4UIKH 3MNVA 1JWMB 1C1EH 2IPKB 3QEHA 3EJYD 1CU4L 3LQAL 3IJHA 3K1DA 2AJXL 5ITFB 3V7MA 3DLQR 4H5SA 5DGRA 3X13B 4IRSB 1QHPA 2CXGA 2OYPA 1U3HB 2PW2A 3LDBC 4XPAH 1QFWH 3GSVB 1KJ3H 3GUTB 2YD4A 5E6YA 3N06B 2OXHA 3OXRB 2VXQL 1XGYL 5FK9B 4K9EC 2ICWJ 2F19H 5ABDE 1RZKC 4ZS7H 3GIVA 3W5MA 4CU6A 3V2AR 2NNAB 4CRPA 3KNBB 4HH9A 3QHTC 2AJ3B 5LGJB 3FQXB 3EYUL 1AR1C 4C58B 3IDNB 5JLZA 4PJ8C 1YEJH 1B6UA 1ZEAH 3TBWB 3SJVE 5C2BL 4RDQF 4ONFL 5INDA 3O0RH 1CL7H 4JJ5B 4PLOB 5D1QB 1N4XL 4RISH 4ZO8A 3RGVC 5C0DA 4JFZL 1D5BB 4PV9A 3LKNA 2EDKA 4YFDB 2ZG1A 1GCFA 1JGVL 3I84A 3IDMB 4HXAL 3ZYIA 3WLBB 5A2LH 2JKXA 3QQ9C 4Y4KC 3RI5F 4A2MA 2GY5A 5DR5L 5TE6L 3HE7A 4L3CA 2J7LA 3PWNA 1BVKB 1I9JL 4NIKB 4R26H 3V0VA 5TQ2L 2UY7A 5C9JA 1HCVA 1OP3K 3TLRA 1IGCL 3CX2A 4Q9RH 3HZYB 4L8SA 7FABL 1A2YB 5KBNC 4WUUB 1BQHA 2CJUH 1QRND 5ILTH 4DGVH 2X4RA 4BH8B 5IT2H 4MDJB 4NYLA 5F7MC 5FKPA 2EDBA 2GAZB 3MRFA 3IFOA 2BVQB 5T1DL 5IBLD 1S9VA 2LFGA 1T20B 1FNEA 1JYXA 3RRQA 1PKQA 4MCYA 4L9LB 1RY7B 3MLZH 1S7UB 3C6LD 2ZNXA 5I0DA 2F53D 5DJCB 1ORQA 3LQAH 1DQJB 4HWNA 2EDXA 1TJIH 4X4XB 5I8KL 1QA9B 1NC4B 5HDQL 1PZ5A 5INCB 3UTTE 5ISZD 3PWPD 1T2XA 3SDXF 3H3PL 3VGAB 2XN9A 4JFFB 2VDPH 1R5WB 4JZOA 3UJIH 3TH4T 4M48H 2DQHH 2CIKB 4G7YL 3GJEA 5LBSH 5J89A 4NO0A 4U1LA 1WAAA 3KYOA 5DEGB 3D3VA 5D93C 5LGHL 3MV9A 5I1CH 3KLHD 1T03L 1D5XA 2X41A 1A6ZA 1NMCB 4J8RB 2OMNA 3GMPB 4J1UA 4TVPL 4I4WA 4NZDA 1KJ2A 2P7TB 1FNGB 4Q6IB 3UTSD 4YQXH 5TF1L 4JRWA 1XR8B 2YPVL 1AQKL 1Q9WB 3DHMA 4XRCB 4PJ5D 3CZFA 4DEPB 4YEFA 2VSDA 3BIKB 4IJ3C 4R0LC 1GZQA 3IVKA 1A4JB 1FL3A 5TDPA 1U95B 4K2UL 1LP9E 3I6GA 4Z7WF 5DR5H 4Z5RB 1I9JH 1AR1D 1AY1L 2IBZY 4WU7B 3ECBB 3P4MA 4PJ8D 2HFGH 1FV1B 3MNZA 1UKSA 3LKPA 1IM9D 4N8CL 1RIHL 1QFWI 2UZIL 4PJGA 3T65B 4YDJA 2Q7YA 5F7NC 2VXUH 4MJIE 4HBCH 3VFWA 2WWKO 5DK2A 3HC3L 2W38A 4Z95L 3EO9L 4YIQB 4ZNCD 4TSAH 2VUOA 1SM3L 5I8EA 1WFUA 2NY2D 3RDTA 4WO4B 2YD6A 5I1HH 2DD8L 4I3RH 3IF1A 5ICYB 3HNVH 1NQBA 1VEMA 1JK8A 3MR9A 3VRJB 3U0TA 5DUPH 2C4FT 3EUUA 2YXFA 1KIQA 4PJHB 1CL7I 2H32H 4KKBD 3RL2A 5A3IC 2B4CC 1DEEB 4M7JL 1QSED 4PRIA 2XACC 2HA1A 2WINB 4NUGL 3GUTA 3ME0A 5HHOA 2GITA 3OXRA 4TNVK 5J12C 3F6LA 4JFOB 4KVCH 3H42L 1HKFA 5E2UH 2CK2A 1KTLA 3OL2A 5EIVA 4F3FB 2KPNA 4KUCF 3GSRB 2XOTA 4ZXBD 1X5JA 5HI4C 1NMAL 1JPTH 2AXGB 4KHXL 2P5EA 1AGCA 3S3PA 1OQOA 3BEWA 4JQIH 4KK6C 3MRMA 3KWWA 4Z7NF 2VISA 2FJGB 5JORA 5CINL 3ZZ1A 3L5IA 4OZHB 1QRKA 2CDGA 4LCCB 1ZHNB 4X98B 5I76A 1N2RB 4KV5F 2Y72A 2Z8WC 3AS0A 2GYSA 2J5LC 1I3GL 3UC0L 1QNZH 5KVFL 2A6IA 2FWOB 4KKLC 1MHCA 5HVFB 5AEAA 3OKYA 3MRPB 1KLGB 4U6TA 5JPNB 1RZJC 3X3GH 4E41A 4JAMA 3K7UA 3AY4C 4FQXC 2A74B 4ORZC 4HDIB 2QV2A 2I26N 4NBZB 3ZKSD 4PJ7E 1EFXB 5AWNH 4H20H 4H0GA 2IADB 4M6AA 4WUUA 4M1GL 4P2RB 3WKML 1TPXC 1CLOH 5ETUA 3BQUA 1BFVH 1MH5B 5DD3L 5ENWB 3CH1A 3KPOB 4MB4A 1GPOL 2A38A 4BZ2H 1C16B 5EC2A 2MMXA 5JHDA 4NN7B 1HSAA 3UTPD 1DLFH 1WIOA 1S7UA 5A1AA 4U33A 4C55A 4MNGE 4H0HB 1IGIH 4NNXB 1NFDE 2GT9B 4XPGL 4NNPL 1OT2A 6FABH 3CUPA 2ENYA 1F3JA 1Q9KA 5HI3D 4GRLA 4PBWD 1A22B 4LRIC 3TVMA 3HRZA 3GGWB 5J8OA 2B8OT 1R5WA 3TBYA 3DUUB 2IFFL 4JFED 2KH2B 4P5TB 2VDKL 5EUOE 2JK5B 1LK3L 2PO6C 1U92A 2X4QA 3ARSA 1PLGL 1MF2L 3KPQA 1AO7A 4ZTOH 4KRPC 3FO1B 4KK9D 1BX2B 3O45B 3BZEB 5HVGB 2A2QT 4N9OB 5IQ9B 1JPSH 4XXDA 2VH5H 5C0AE 4MX7A 3HZVA 4J8RA 1CICA 2ZKHH 1FSKB 4ZPTB 1R0AH 4NT6B 4S1SL 1XR8A 3RGHA 1UJ3C 5CGTA 2XWTB 1AE6L 4OF8A 3UTZA 3S4SA 3CGTA 2C5DC 2ATKA 4UQ2B 3T0XA 1P53A 1ACZA 1T83C 5IJVA 1C08B 4N0YL 4ZUSB 3RWFA 1I7UA 1DSFH 5HI4D 1AJ7H 3SKJH 3MJGX 3IFPA 3MUY1 3LRGA 2FB4H 3NIGE 1FV1A 3CFCH 4WNQA 3BP4A 4EN3B 2HTLD 1IC1A 4QXTA 5B38A 1KJ2H 1KLFA 4ZS6D 5E2JA 2NW2B 3TCXA 2J8UE 4AEIH 4F58H 1MFAH 1GGIL 3RTQB 3SCMC 4HKZB 4QNPF 4HWBL 4JZJC 2K7PA 3LKQB 5DD3H 1L7IL 4LIQE 4LRNL 4JDZA 4NPYA 3VI4E 2C1PB 1WCBB 1BBDL 1TZGH 4FQXD 5FA3B 2G60L 4OTXH 3S34L 5FM8A 4PG2C 1GGTA 3PQYE 2KBGA 4U1NA 4P4KA 4WHYH 2EECA 1NAMA 1DVFB 4KJPC 1XGTB 1K2DB 4O5LH 3TA3B 1BLNB 1G0YR 4P46D 1FC1A 1NLBH 4IBLT 4JFOA 4G9FB 1BAFL 3DVGB 4OGYH 5GS1B 4YXLL 1AGEA 3ULSB 3ZHKA 1W0YT 1U8PA 3AREB 5ADPH 4PS4L 3DV4A 3FHQA 3MV7E 1TZHA 1IC7H 2Q20A 5EA0H 1DQML 3B9KA 4U6HA 3QO1B 3VCLB 1ZHNA 3T8XB 5CJQL 4Y4HB 1JZ5A 5HYJE 3WFBH 5CFHA 1IAIL 4ACPA 4WTZG 4P2OD 3FN9A 1B4JH 5E8OA 1NEZA 2RCSH 3ULVE 3NACH 3HKFA 3MRPA 5ID1A 1PSKH 5F1OB 1GAFL 3L3IA 4HC1A 1RK0B 4P2RE 3P4OA 4RGNB 2DBJA 5IB5A 1YEDB 4EUPA 2ZUQB 1CE6B 4KRPD 1XH3A 5SWZA 4TUOB 1IT9H 2HLAB 4OD2B 1EFXA 4UTBL 3RVXD 5J1TC 3NTCL 4DVRL 2GJJA 4MWFB 4XBEH 4WFEE 3I6KA 5JXEA 2P8LA 4HF5L 4XAKE 2E5EA 3FFDB 1IAKB 4MD5B 4QT5A 3RA7H 5C09A 1FZMB 2PYEA 2ZCHL 4WFGD 3VWJB 1SVCP 4LHUA 3VMPA 5IK3B 5IMMB 1G0XA 4LMQE 4PUBL 2F5BH 5IFAL 4EDXB 5AG8A 2EDQA 5MENE 5CWSA 2DQJL 3WUWB 4HKBB 1CE1L 2M8XA 1GOGA 5TH2A 3VWKD 3WFZA 3LPWA 4PJXF 2AK4D 4WVRA 1IARB 4C56D 5D2LE 5H2BB 3A67L 4MD4B 1D6VH 2EYTB 3BT2L 3QUXC 4K55A 2WWMD 3ARVA 5ADOL 3GM8A 5EU6B 1BD2D 3SCMD 5CEXA 4HUWB 3ARGC 3V8OA 2NY5L 1JUFA 5HPOA 4ERSL 1KCSH 5HYQB 4OGXL 3RU8L 3WO3B 5FUZL 4EDWH 4MA3B 1J18A 1KGCD 3DRTB 4MD0B 5IQ9A 3RWDA 1AKJB 1LHZA 1J7VR 4GKOA 8CGTA 4FFZH 3ZE0E 4U1MB 2WLYA 4ELMF 3RWCB 5HHMD 4XVTL 5IEKB 4LLYB 3U2SB 3N9GH 3MGTB 5KANG 2X1OA 4ZPTA 1ITBB 4HIJB 1BD2E 2XWTA 3DV6B 2P44B 4ZFOB 3U0PB 2VZTA 3WHE0 2AABH 5EU5A 5IHZA 5C0BE 3QZWB 5JIPA 1CXEA 5I17B 3OSKA 2EIDA 1KGCE 1KTKE 3ELAT 1P9MA 4WUKL 3D48R 5J06A 2YHGA 1ND0B 4LCIL 3CK0L 1TFHA 3EOAA 2QQQA 5F7YC 4WWKC 2EEBA 4TQEL 4EN3A 5I1DA 4DVRH 4S11A 4JG0H 3DBXB 3NZ8B 5MEPA 2VLJE 1P7QA 1MREL 2ICCA 4OZGE 4Z7UB 3P30L 2CRMA 4KZEL 3HUJF 2A6DB 2J6EA 3LKQA 4PGEB 3C09B 3V6FA 5FV1L 4XVJH 3SE9L 4HLZG 1W0VA 5IIEB 4NQEB 5DJDA 1INEL 1KNOB 2ZCKH 5BS0A 3IDIA 5F44A 1OP9A 1SJHB 3BIAX 4U0RB 3FQNA 3PL6B 2CLVA 5CZXC 1OAKH 3QIUB 1D5IH 5K9JH 1FFPB 1CD0A 2VZUA 2XA3A 2VXSH 1F6FB 1HHGB 2BVOB 3V5DA 1UACH 1I1AD 1G9NH 4J23A 5CGMA 4RAHA 3ARBC 1KF9B 3Q2CA 2W0PA 4G9FA 4Y16B 1T0MA 3CSBA 1OTUC 5SX4H 5GS1A 1FQ9C 4F7TA 4QRRE 4OGXH 3BN3B 5C0IB 5I71B 1TNNA 4P23C 3QP3A 3ORJA 2VZOA 4CW1A 5L6YL 2DYPD 5F9AC 4L8BA 4S1QL 1NAMH 4HIEB 5CIPB 2PW1B 3IDUA 3EOTH 3QO1A 4L9DA 2KQMA 2XWJB 1QLFA 3G5ZA 2IF7A 5D7KD 5GJTH 2H26A 1FVCA 5FECB 4XVUC 2FL5B 4YDLB 4RFNB 5IGXH 4PJDA 1BWWA 4JZNA 4IOIA 4NQSA 3L5WA 5E9DB 4BFIB 2E7LA 5HGHA 1J1PL 4R7DB 1Z9SA 2FJFB 5A2FA 4CNIB 4EI5A 4X6BB 4OD2A 4PP1D 1VKXA 2R2EA 4N0CD 4PGBB 1DR9A 5D96C 2Y07H 4RWHA 3OAZK 3UXFA 1RD6A 3L95B 4NO2A 4EKXA 3WKNA 3C8KA 3DGGA 3WUZA 5D7KE 3W0WB 4XXCA 3R06A 3O3BB 1NLDH 3LMJL 4XNXH 2BJMH 4PJFA 5L2KA 3QA3B 5GRUL 5BCAA 1HINH 2AXFB 1YY9C 5HHQB 4HC1H 2JJSA 4FQHA 4EDXA 2XZQL 3ULUF 2LTQC 2V7HB 2D7NA 4OFYA 5GRYA 5CCKH 1NANH 3QUYC 1AXIB 4H88L 3NN8B 4EUPH 4PY7B 3DX6B 5MHSD 1ONQB 3TO2B 5D7IB 2NY0C 6CGTA 4YBQC 4YK4C 3AU1A 4G8GD 1MJJB 1GGYA 2YWZA 1OP5K 2YEZB 4MJ5B 4Y1AE 1IL1A 2Y06H 1CFVH 5H2BA 2HTKC 1QSFA 1RMFH 5E99L 1FORL 5EU6A 4XPBL 1YNTA 3ARZA 1MJ8H 3E6HB 2X9WA 1IEHA 3N85H 3ZTJG 1CGSH 1GIGH 1BOGB 1MWAB 4Q0XL 3LQMA 2YPLD 2M2DA 4D0BB 2C1OA 5DHVA 1AD0B 4JM2F 4FTVA 4P5KA 1YC8A 1G7LA 1ZT1A 5JTWA 3HPLA 4KHTH 4GAFB 1HQ4A 3B2VL 1YPZB 8FABA 3LQZB 4MD0A 2WIIA 5C08E 4DKEL 2VZVA 1QVOB 4G8GE 1B6DA 4XWOD 4RWYH 2C7UB 1D5ZB 3MRLB 3RWCA 5IEKA 2VLME 2JCCE 3WFEL 1KIRA 3EGSA 4F9PC 5GGTA 3A6BL 3EYVB 4J4PC 1EEZB 3B3IB 2QR0B 1I3RA 2DWDA 2P24A 3SY0A 4LLWB 2ZZUT 5L9DL 3ARDB 1R24A 2IPTL 1NUNB 1QFHA 3K4DA 2YPLE 1H3PH 1X9QA 1HOCB 1LK2B 2AEQL 2G5RA 4X9BA 1EUUA 4XH2A 1B0GA 4U1KB 1EHLH 3MOBL 1GC1L 1KCUH 4QEGA 5ANME 1IM3B 4X6DF 4R3SA 3JWOL 4OM1H 1UZ8A 3BJLA 5GJSH 1DJSA 4AEHH 5F96H 2K9UA 3WHXA 1FZKB 4OB5H 3QJHB 4NHCH 4YNYB 2C3XA 2G5BA 1VGKB 4UB0H 1TLKA 1IC5L 3MRHA 5DLMH 3ULUC 4LK4A 5SX4I 5CSZB 3QEQE 2BFVL 3OKMB 1FGNL 2A9MH 2LVEA 2YZ8A 4XCCL 4DN3H 4ZFGH 1XZ0A 1EHXA 4GAJL 4MQTB 1J05B 2NX5B 3GBNH 2EYSB 4KKCD 1RZ7L 3PL6A 3Q6FB 2ITDB 3OB8A 3NBNA 2VDMH 4ALAH 1A6VL 4PTTA 1CFBA 2X44D 3LEXA 4TUKH 1X5ZA 3K1KC 3KPMB 4X6EA 4HJGA 5E99H 1FORH 5ACZA 5TFSL 2VN7A 3NPZB 2D4FA 4JM2C 1FAIH 2J6EH 2FYYB 1DBKH 3HMXL 2FATL 4LLUA 3BGFC 4O00A 1TCRA 1CZ8H 2PCPB 4UQ3B 4OLWH 1L9NA 2XXCB 5L8JB 1TIUA 1RU9H 4Y88A 2Q86B 3AB0C 3ILPB 3HAEB 5DJZA 1DQLL 3HE6A 5FHBL 1PZUB 1MJ7H 1NBYA 3PDDA 5GGRY 1PEZA 3U7YL 4XNMB 2BY2A 2HTKD 1TJGL 4CVWA 5FO9A 2FGWH 3U83A 3W39A 3QQ4A 2Z35A 3S8WA 3CX5J 4NQVA 2WANA 3GBLA 4U4BA 4HUUA 3KPNA 5AUMA 1MCNA 1NDMB 5C6TH 2QQLH 5D2NB 1KENL 1NANI 3RUGE 2B20A 4ZSOA 1KCLA 3RVWD 3QUZC 4R4BB 4GRWE 4R7DA 3GJFK 3UX9B 5FO7A 4FZEH 3RFZC 5F9OH 2XT1B 5BZDB 4JDVB 1N6UA 3DVNB 1CBVL 1MLCA 5HSFA 3IU4H 5KS9A 2IANE 5F7KC 1T1YB 4ZFOL 1URLA 2R29L 2XKNA 1KTRL 4YDKL 3O3BA 4LVOB 3CVHB 2NR6C 1CGUA 3SE3A 3VXOB 5IBUB 1RK1B 4UNTA 2JB6A 1JHLH 4LSTH 3CFDB 25C8L 4PY7A 4WHTB 4Y5VB 1CQKA 1I4FA 1OCWL 2YKLH 3OGCB 2DQEH 4PJEE 4P0DA 2MCPH 3ZKXB 3VXUD 2DIJA 1HHJB 1J0JA 2X4TB 4QRPE 3PIQB 1RZ7H 3BMVA 2JF1A 1A6VH 4FQ2L 1S7SA 2VLLA 3O2WH 3PWLB 4MXQC 4G6AC 2DBLH 2H1PH 2XPGB 2YWYA 2W0FA 1IBGH 1MHHB 2HKHL 3SDDC 1VFAB 2ADFL 4ZOCA 1GH7A 2H2SC 3DO3A 4EXKA 1MCPH 1OL0A 2D7QA 2H3NB 2F74B 5TQ0L 4XCEA 3KPRA 1A6WL 5IUSA 5IVXA 3SGDH 3T4AB 2IALA 4QTHA 1RJZA 1CDIA 1MCOL 2AEPL 4G6FB 4W70A 2NZIA 1EFQA 1TVBA 5AD0B 4HUVA 4TNWF 5IW1A 4GKZA 5MI0B 3LPFA 2HVKA 3VXUE 4DKFH 1XF2B 1X5FA 2PXYC 3TPUA 3P4NA 3MFGB 4D0CB 1QRNB 2IQAA 4UOW1 4XNQA 2X09A 2QR0A 4K7PY 4WDIB 4LPCA 2VQTA 4LLWA 4LKCB 4QWWC 3VMOA 3ARDA 1OAXH 3EZ8A 4LEXH 1RFDL 2IWGA 5DHVH 1ZLUH 1UWXH 1HOCA 4FXLA 2NY7H 1TJHH 1OAQH 2FHCA 1FZOB 4J3TA 4U1KA 1V7ML 3GSWB 3W9DA 4X6CA 5BRZE 1ES0A 3C6LB 1UXWB 2FH6A 3REVB 1MCQA 1MEXL 1GOHA 3BKYH 4UV4L 2BDNH 3QIBD 2D7OA 2IQ9L 2E9BA 4DCQB 3ZDXF 5EU3B 3HFML 3GMQA 4F7EB 5JW3H 5GGTH 4ZAKB 4QOKA 3PWPB 2ORBH 1JWUB 15C8L 4PJCA 3WS3A 4GKNB 1G84A 1BPVA 2EDOA 4V1DD 4JO1L 1M7DB 3I9GL 4MAUL 4YO0B 1HN1A 4IMLB 5DXWA 4RBPH 2ADGA 3VDBA 5IW3A 5CEZD 1KPVA 2ESVD 2VAJA 4TPRL 5DHYA 1ZVYA 2FLRT 3FN0H 3BMWA 4NKMB 4C83B 5GS0D 3EYFB 4TUJB 4APQA 2EDEA 3UMTA 1YMMD 4XP1H 1WICA 4KJYB 3UTSB 3MRKA 2CK0L 4KTDL 1XGQB 3FB5A 3L7EA 2YA1A 4PJ5B 4GW5A 3UPAA 1KLUB 2QADD 4G3YL 5E8EB 2NR6D 1NAKL 3IRZA 5IB1A 4NM4H 3H9ZA 5CEZE 4O58H 4J6RH 1A6WH 4PJ9C 5HYSA 3X3FL 3O4LD 3PV6A 1WIUA 4PJ8B 3R4DA 3ARRA 4JEGB 1L6XA 5BV7H 2FR4B 4OFIA 2ZSWB 5D5MA 4FZ8H 2F58L 1YMME 5C0GB 1FBIH 3ROOA 4MDIB 3BUYB 2OR8A 2XZAL 3FOMB 3MODL 3NMEA 3RGVB 2VIRB 4HGKC 5CHNA 3S5LG 4KKNA 4Z7QE 1MWAL 3TBTB 5ITBH 4JFPA 4NZRH 1IFHH 4TSBL 1WZMA 3SDDD 2NY2B 5I75B 1BJ1H 3OXSB 5HHNA 2OLDA 3PGCA 4YHKH 3OBAA 3MV8E 2I60H 1DL7L 2X7LA 3JSSA 1J8HB 1X7QB 3VRLE 2VR4A 2APFA 5FUCE 3TWCL 3SJVA 2FEEL 5KSBE 4YAQB 4JDVA 5E4IA 4U7MA 1QSEB 3UP1A 4UU9B 1JPST 2E27H 1MLBA 4PGCA 3HFMH 1I8KA 5D7JC 5ESAA 5F8QC 1AQDB 4DZBB 2OXGA 4GQ9L 2A77L 3V4PH 4YPGA 2IMMA 4EBQH 5EB9A 3DO7A 4F7MA 5A40E 1EZVX 4QHNA 1GJIA 1LO2L 3TPKA 5JW4Q 4LLAA 1AC6A 3SGDI 2I9LA 3U9UA 4U6VL 4ZXBB 1OSZA 2R0ZH 5CZVH 3TYFA 2CLZB 3P0YL 4GBXD 3L9RB 3PE9A 2DQTH 2EDRA 2V17L 3V9FA 2F5AL 3IXAB 4M3JA 1S7WB 1D7FA 3DUSA 3WL9B 1T6WA 1SY6A 2CIIA 4LQFL 4PJIE 5H94B 2P5WB 4R96A 3Q3GA 1ZOXA 2IAMC 3PWLA 3D85D 2UVFA 4PJBE 2XPGA 5AYUL 3CNKA 1VHPA 2VYRE 3KS0J 5GGSY 2BP3A 5IVNA 4EXPX 2HN7B 3LCYA 2QBWA 3GNML 3Q0HA 1HHKB 3ARQA 3GO1H 3T4AA 1JF5A 4PRNB 1Q38A 4YHYC 3VXMD 4X0KA 12E8L 1M6OA 4G9DB 5L0QC 1RJYB 2BERA 5DD1H 5E03A 4G42B 1QKZH 3LRSA 2XZAH 3Q5YA 3O9WD 3GSOA 1DBBL 3DX7B 3UTTA 5EORL 4NZUH 4YXHL 4R4FL 1IC4L 1XGPB 4CMMB 4KI5F 2YBRB 4JKLA 4NP4H 1NCTA 2YS4A 3AROA 3C60A 1EAJA 1FJ1B 2X1PA 5FYLL 1JFQL 3QIWC 5MP6H 1XIWD 4PR5B 3QDME 4OZFG 1XMWA 5AAWA 3WXWL 3P77A 3U0WH 3AVEA 3EYQD 4PJ9D 3GIZH 5IMKB 2F53A 3BGMB 2D7TH 4JY4A 1JNHA 3G5XA 1VERA 4O2CA 1JN6B 4JHWL 1KB9K 3OPZH 5JZ7C 3NFPA 5DMYA 4YLQT 5I1LA 3QFDB 2OZ4A 2RR3A 1JBJA 2ICEB 3MLRH 1F3RB 5DHXB 4LSUH 5ISZA 1VDGA 3PWPA 3RJQB 2UZXB 2MCG1 3CFBB 1UB6B 4JFEB 1QACA 3QNZB 5DS8B 1GSMA 4N8PA 5HGBB 2VZSA 2UZYB 5JIIA 3SDYH 1LP9A 5J1SC 3PNWA 1CFNB 1NBVL 2GHWB 1I85A 1REIA 5I18H 1ETZB 5EZOL 4C83A 4F80A 5CKAA 4DZ8A 4JFDE 4UTAH 4IMKA 2YD8A 3FKUS 1K8IA 3BPNC 3WV0A 4KQ3H 2D0HA 2V17H 2LVCA 3EO0B 2VAAB 1JYWA 3TBSB 4CDGC 1CDHA 4MSWA 3SDXB 1E6JH 4KTEH 4W81A 1UH3A 3CVHL 3LB6D 3N1GC 5JHLL 2B1AH 2AJVL 5J12B 2CKBA 3PDOA 3X11A 4MAYA 3ARFC 4V2BA 4UNVA 3IFLL 4I8DA 4WI6A 4JGMA 1H5BC 3UJJH 3DMMD 2DLFH 5J11C 1PKOA 4HFWA 5FO8A 3NCBB 3IDYC 1VEOA 1XCTB 2Z93B 4UV7H 1EH9A 4PBVC 1S3KH 3MBXH 1RIUL 1N5YL 1CGVA 1ZT7A 2O5XH 2WWKT 3BE1H 4FFWC 1IM9A 2X40A 4MQXC 2VR5A 5IG7B 3QR2A 4M1DL 4I3GA 4D0DB 1KN2L 3O11B 3FOMA 1I9RL 2F54D 4YHPB 4KI5C 2ZCLL 3FO0L 4OGAC 2VIRA 5E2TL 3RZCC 2J5LB 3EAKA 3RY4A 4FXKA 2IAMD 4LCWE 3LQAC 3KLAB 1ZMYA 2QLVB 4ZMAT 4BZ1H 4JN2B 5D1ZA 1JTTA 4J12A 3BP6B 4LU5L 4Z7WB 5E00B 4S0SD 4TRPL 1UWGL 1KJMB 4MA8H 1Y18B 5H8DA 4G6KL 5IKCB 4Z8FH 3FTGB 3G6JE 4FQXB 5M7QA 4G6JL 1MHEB 2ZUUA 2BNQB 2W1NA 5L7XH 3E6FB 2O26U 5KZCD 2X70B 1AXTH 1FYTD 1EMTH 1JNLL 3FZUD 2F54E 1HDMB 3CDGB 3WNLA 4N1HB 3L3OB 4P46B 4NNYB 2VJXA 2BHYA 2LU4A 3DURB 1I7TB 2EE6A 3OJDA 1RZ8A 4Y2DD 2GSIB 4NBYB 3LKSA 1NGXA 1T2QH 2Z31C 1FRGL 4F37K 3JWDL 2OTWA 2A73A 4BSVA 4OCNC 4PRPE 3L7FA 4LASL 5DQDH 4UT7H 3HB3D 2PKDA 4NHUA 1YJDL 2R4SH 4K23H 5F7DB 5IQ7H 3VH8A 5TGBB 1QYGH 1H3XA 3VGDA 1PG7H 4PJ7A 1BMGA 2XFXB 1FYTE 3L3GB 3KPTA 5T1MA 3NCJH 4FFYL 3U46B 5IMLB 1RUAL 1MRDL 5H94A 1UCTA 4U6XB 1CN4A 4P2OB 4E0RA 1Y0LA 3NA9H 5DRZA 4FOMA 1K5NA 4RMRA 3PXJA 4QRQB 3LS4H 2CO7B 3H9YA 3MCG1 3FB6B 5I66A 3E2HC 3OAYH 2R0KL 4KRPB 3QXAB 5K9OB 1ZVSA 1JYVA 4MNGA 5HY9A 4M02A 1NFDA 1YNLL 1BFTA 5I0ZA 1OAYH 1KIPB 1SY6H 4JKMA 5A2IH 4J3XA 4K9EL 1DTUA 4QHUA 1WZLA 1RZKL 4HCRL 1AP2B 2GJ6D 3QH3A 4JFHE 1UJ3B 5JW5A 5D7SH 2PTTA 2R2BA 3FB7A 3C2AH 1A3QA 5CP7A 4K3EH 5EUOA 5EZJA 3U9PL 4E5XA 1MCWW 4L4VD 1BP3B 3STZA 1KTDB 1A3LH 2X4PB 1F58H 5DUML 3ZDYF 3BO8B 5C0JA 3ESVF 4F7PB 3BGMA 1BIIB 2CGRH 3RVTD 3RHWF 4ONHB 5C0AA 4RRPG 1QLEH 5GRJH 1DZBA 2AK4B 2R1WB 4PD4J 4C56B 3O8XA 4KI5D 3RZCD 1BIHA 1KFAH 4OFKA 1TTFA 3SCMB 1C12A 1K8DB 5DK0A 2VDNH 4WV1C 4JFEA 3X14B 4JZJB 1ED3B 4HWZB 4JFYA 5L2JB 1F8TL 3IYLW 4P9ML 4KJWC 2HT4C 4QYOB 4FS0A 4B53A 1TETH 3F5WB 4M6ML 4Y19E 5F1NA 5F3BB 1OF2B 1UENA 4BSJA 3VGGA 4G8FA 2BOCB 3GHEL 1J10A 4AY0A 2X05A 2XIDA 5GS2D 5HHMB 2OZ4H 3EDJA 5E2VH 2COQA 4HS6B 5C0RH 1MFDL 1WAAF 4OQTL 4D8PA 3VRIA 3HPJA 1EGJA 4AENA 3D69B 1U93B 1E4KA 3VFRA 3O41B 3HLAA 1EXUB 3TYGL 2Z31D 4JFXA 1C5DB 3V52L 5DJXA 2C3VB 5TDNB 5M95B 4MCZB 5J1AA 4CN4A 1S5HB 2QSCL 3LOWA 3BYYA 3E8UL 5F7EL 3WXVL 3O3UN 1S7TA 5JNYB 3PQYA 3TBVA 2VKWA 4BFEA 3HE7C 1TVHA 4J3SA 1FH5H 4LLQA 2E3VA 1X5AA 4PG9B 2FJHB 4YBLB 5IHUH 3VMNA 5J13C 4HWUA 1C8PA 2W59A 4OKVB 1E4XH 2P48B 2AJZA 2CKBH 1ZA3B 4G6MH 1T21B 1U0QA 4CU7A 1VFOA 2HLFD 1D3CA 4HEME 4U3CA 4JPWL 3K2UH 5DRNB 5FGCB 1N3NA 1YECH 1IEAA 1AHWA 2A0LD 1TVDA 1J1OL 3WFHA 1FCCA 2DN7A 5F9WB 4YHNA 5GHWH 1NC2D 1I9EA 3F6IA 4KXZH 3MV7A 1DFBH 4JRYE 2GTZB 3VE0A 4TOYL 4GAGH 3U48A 4P46A 4NNYA 3T0AA 3I2CL 1A9BA 3MREB 3EO1A 1TENA 4F7CA 1I1AB 1G7MB 1T7VA 3MV01 5F6IC 2ZSVB 3MX0A 3U7AA 4DW2L 1T1ZA 4RMSA 1LDPL 5DJ0B 4M8QA 4M7LH 3KXFE 1FDLL 1KT2B 5I15H 4X9HA 4DWHA 1D9KA 2OP4L 4PGZA 2NLJA 3MLVL 4RIRA 2DYPB 3WNKA 4KROC 3FRUA 4YR6B 2H6PB 5E5UB 5F1KC 4QY8B 3L1OL 2Y6SD 3PWJA 3L3DB 3C8HA 1U41A 1S7QA 1A6UH 2A9NL 2YUZA 4HSQA 4Z7NE 1HYSD 3MCKA 5J6HA 3ARGB 4LOUC 3IDJB 1HEZB 3FAWA 1UM6L 3U36A 5C07D 3ZKMD 1WSST 4O9HH 1S7VA 4R97C 3W82A 3FONB 1GXEA 5MENA 3QWQB 4LARH 2HT4D 1B9ZA 1K6QH 4Q9QL 4Z9KB 1I7RB 4P57B 1PD6A 2EO1A 4G80B 4KAQL 4Q97A 1RJLB 3RL1B 4JO3L 4R7NA 3MOAL 4TVSa 2B4CL 1U8JA 4BQ6A 5JDSB 2J2ZA 1N8ZB 3JV4A 4IIQA 1NSNL 3MA7A 5DMGC 5KVDH 5D2LA 1OPGH 3MGOA 1JIBA 1SEQH 4P2CG 4L1DA 2XRAL 5C0NC 1CG9A 1DUYB 3ILQD 4KK8C 1R3JA 1TCMA 1VSCA 3MYJA 4F2MA 3S36L 4X4MA 1B0RB 5IWLA 3QEUB 5GSRA 1FNSL 3CVIH 3GMOA 4RZCB 5BMFL 1OW0A 3F7YB 4XP4H 1NEUA 5D9SB 4KU1A 1U8NB 1T5WA 3RDTC 4NJAH 3S9DB 4E42B 1W72B 5KTEL 4ODXB 1LE5A 4ONHA 3VWKA 4KRNA 3HE7D 1CS6A 2AK4A 3CSGA 5BJTB 4I0CC 3F58L 1TMCB 1T4KA 1BD2A 2UWEE 1KELL 3TJHD 2HH0H 2VL5A 2BK8A 4LLVB 1XF3B 3S3SA 1R5IB 2C9AA 1U3HC 4LP4A 4N1EA 1ED3A 5EIIA 1RZJL 1I1CA 5C0BA 1PJ9A 3VFPA 3DROA 4ISVA 35C8H 4QHMB 2VLKD 3F5WA 1CCZA 2DLHA 5DMJB 5F3BA 1FZJB 1G7QA 5F7UA 5DUBA 1H3VA 1QBAA 5DURD 5I1AA 5DMIH 4M6NH 2D9QB 1CD1A 3L1OH 2GKIA 1KSRA 1E4XI 4LSPH 1NCBH 1YY8B 3RX8A 5CJXA 4OZGA 3UPRA 1WZ1L 3HI5H 1U93A 4KJQD 1I7ZA 3DRQA 4JM4L 1HIML 4L8DB 1K4DB 4FQJH 2XG4A 3BH9B 4WI2A 2NTFB 5CJOL 3PP3K 1JVKA 5GRVL 3D5OF 3HNTH 2VLKE 4KXZI 5C7XH 4P23B 4JPIB 4PRBB 4ELMB 3MOQA 5C9KA 1ZT4B 1MNUL 4KAQH 2WUBH 5JNYA 2P8PB 2PYFB 3P2TA 3D3VD 1NCDH 3MJ9L 2OTUB 2HJLB 3I02A 5B39B 1SHMA 1EGJH 1ZA3A 1CDBA 3INUL 2V5TA 2VB5A 5D70L 2AJSH 1V3KA 2P46B 3CFJA 4LIQH 4LEOA 3BISA 4A6YA 4W4OA 2B0SL 5AZ2L 3WD5L 5E8NB 4QRRA 3PGDB 3EFDL 1KIUA 3PHOB 1GZPB 3BQUC 5F6HI 4Z7VB 4OLUL 4H1LA 4PP2A 4OV5B 3NIDF 2YC1A 5IROA 5AAMA 5BVJA 3F7VA 3U7WL 1LILA 5D96B 2OR9H 4O2FB 2R56L 5DMGD 4L9LC 5DD6B 3VD3A 3MRDA 4NRYB 2NY3D 2E7BA 3OKEA 2BSTA 4U1JA 1DQDH 4CADB 3TNMB 1KG0A 4HV8B 4DVBA 1QG3A 1ZWIA 1A7NH 5AYQA 1DDHB 3DX8B 4GRLC 3HZMA 1F4XH 2BNRE 5FOBA 5J6GB 1FLTX 5KSAA 4MB3A 5ESQA 2WM0A 2NY0B 3RDTD 4YDVB 1KCVL 4YK4B 3S37L 4Z77A 3FQUB 3RIAK 4M5YL 3FB8A 1KB5A 1LEIB 3PF2A 4KPHL 1A7OH 3OF6D 5GGVL 4MXVE 1VESA 3IETA 3ULVH 4HPYL 3LN4B 3BZFB 3QG7L 1CICC 1A21A 3U4EB 4PRID 4U6YA 1MFCH 4AL8L 5DD5L 4ZG1A 4YHLL 4GW1B 1U8IB 5FB8A 1I8LA 1S9XB 1NUDA 1ZGLA 1YN6B 3ZTNL 2APTA 1J5OL 3LEVH 4UDTB 3FFCE 3IJSA 1S7XB 1T89A 1IRAY 1MVUB 1SBSL 3TH3T 4EUPG 5JDSA 4LCYA 5KVGL 4Y1AA 1P4IH 2VNCA 4NC1C 1ZA6B 1OGTA 4MMZC 1E4WL 2P5ED 4N8VB 1U91A 4BKLB 1R3IL 2FX7H 2HKFL 3IXTA 1G6RA 1E28B 2YRPA 4LSVH 4WTZA 3RNQB 2QEJA 1G7HA 3FMGH 1D5MA 3S98A 1JI2A 2B0SH 4LHUG 2Z0BA 3F7YA 5E94A 1BM3L 2XZCL 4LCUB 4K71C 2Y7QB 1QR4A 5C08A 5F88B 3LN5B 4IM8A 4WO4C 4E42A 2H9GB 3OX8A 4G8GA 4G7VL 2Z92B 1W0WB 1P4LA 4O02L 4E41D 3KPSD 4LPXA 4N5ED 2JCCA 2CDFA 2L4OA 5FYJD 1AD9B 1MCEA 4PJXE 3Q5TA 4DGYL 1AIFB 1A14H 4P4KC 2DAVA 2G9HA 1XF5B 3Q1SH 4DUXA 3TN0A 2YPLA 4K7FA 4GUPB 4LGPB 4FP8L 3PJSA 2X5PA 5DJYA 4OT1H 3BQUD 1UB5B 2EH7H 3D87B 1L9MA 2VDLL 1LVEA 5KVEL 1A6PA 1ULVA 5ANMA 4NZTH 1PQZB 1WLHA 1CLZH 5JHDD 5D1XD 3KPSE 4I2XB 1KBGL 4HIHA 4J3VA 3ARUA 5T5FL 4KQ4H 3TIEA 1I8MB 2CRIA 4NQCD 2GFBA 3PV7A 5GRZA 5ALCL 2OL3A 4XZUB 3GK8H 3QEQA 2BRRL 3BGFB 2SEBB 4KMLB 4GRLD 3RWIB 2DMBA 2NTFA 3TVMD 5EPMB 4ODUA 1G1CA 1T3FB 4MXWL 4ZO9A 3O3EB 5GISL 5DGQA 3AB0B 3W81A 4GSDH 4CMHC 2ZOLB 1KPRB 2VXVH 3QIBB 5FM5O 4DQOL 3VD5A 2PYFA 1NUFA 4XAWH 1HH6B 2HT2D 1JZ2A 2L7JA 1AO7D 1QP1A 2HJLA 3V0WH 1IAIM 4K8RD 1EIBA 4WFFE 5K9QG 3MRRB 1R3LA 5IF0B 3BKMH 3NAAH 3SPVB 5GIRB 3GDBA 5B8CA 4BYHA 4S1DD 1R3IH 4V1DB 4CVXA 1NUGA 5JXEC 1NFIB 4R2GD 1OSPH 3KGRA 2VE6A 4XX1G 1RPQA 5EZLA 3JTSB 5FIEA 3FRPA 2ESVB 5IB4A 3HUJE 1IEBA 4Z7VA 1I8IB 3QUZB 4MVBD 4PTUB 4X6DB 1CYGA 1LEKB 1VEPA 3EDDA 4NN7C 2V2WB 3WN5A 4P2YA 5IBTH 3DSFH 4WGVB 1NCWH 2DMKA 2EDFA 1WBXB 2YPKB 1ACYL 2YD1A 1C5CH 4PJAE 2J1KA 3TIDA 5KJRH 4YHMH 2XQBL 3NCEB 3W11C 1BEYL 4I48A 1U8HB 5D7LE 2ADIB 3B9EA 3JV0A 5BZWA 1DANT 4KZDH 2R0WH 2DKMA 3O4LB 4H1LH 1W72L 4HUXA 5ICZA 4UAOB 4OLVL 4LHJB 1XCQB 4YDVA 5IP4A 3QCTL 5BOPA 4ZDHB 4WI9A 2DM3A 3DVFA 3MRGB 3CXHJ 1IGJA 3TEUA 2IANA 3TP4A 3OZ9L 2R8SH 4IHOA 4KVNL 3M17A 1GHFL 3QDJD 1EAPA 3QPXH 4LMQI 1IGML 2JIXA 3OJ2C 3BZFA 3SDDB 1YMHB 3ISWA 3PHQB 1E6OH 5JR1H 1XF1A 5IEHA 1IQWH 4TULH 3MBEA 1RUML 1TTUA 1U8KA 4IDJH 1CWVA 1N5AA 1NJ9A 4CAGA 2DQUL 4YHIA 4JB9H 5GQBA 4AYFA 3GRWL 3D39D 4OJFL 2PXYB 3P73A 4QRPA 1KB5H 4NCDA 3B9DA 4PJDF 1B0WA 1OM3L 1P9MC 3SDAA 4PGJA 3QDJE 5DJ6A 5E2WL 3B9KD 2C4XA 4EN3C 2DQDL 5C2UB 3T1FB 4WI5A 4B50A 3U30B 3RVUC 4M03A 3KR3H 4OCRH 3T3PE 1TITA 1MAML 3QHZL 2ZJSH 2WUCL 2Y5TB 3UAJD 5KN5A 1P2CA 2PUQT 5FHAL 4GBXB 5FAAA 4W4NA 4LCUA 2HVJB 3IFNH 2Y7QA 4XNUL 4YPJA 3ULUE 3LN5A 4WW2A 5D6CA 2PF6A 3RAJL 4PJFF 1YYLL 3D39E 2V7NA 3NFNB 5AZEH 3STLB 3VXUA 1WWBX 1FN4B 4PLJC 3AMKA 4JFQB 5HHVL 3IJYB 5I2IA 2XICA 5SWZD 4OCXL 5E08H 4BH7A 1G9MH 3D85B 4YXKL 1MI5B 1G6RH 5HHPB 5I1EH 4MA7L 4NKQB 1DVFC 5JXED 2VDOL 3SO5A 5I74B 2BNUB 4N90E 2YZ1A 5IB3B 5C09D 1JNNH 2FH8A 4RMQA 1UB5A 5BRZA 2W9DH 2R4RH 3VXMB 2PYED 3OHXB 1QD0A 1SBBA 4LHUD 5SWSE 3C6SA 5GS1C 2VSCA 4ZUWA 4FNLH 3FT4B 3EYOB 3OG6B 1ORSA 2EXYC 4HQQH 1DBJH 1FFOA 4OCWH 3JBG7 3SN6N 3HC4H 5DD0L 2FDBP 1QR1A 5F71A 4KKAC 1E4JA 1I8MA 4OGZA 2BSSA 3NCCB 3CMGA 1DCLA 1DQQA 3PP4H 4O51A 3W11D 2PNDA 2EE3A 4XPHH 5F21B 4IEFB 4Y4HC 5LCVH 1CFQA 1FLRH 1XIWB 3OKNA 4HK0A 5FF6B 1U3JA 1KXTB 1JV5A 1OWWA 1O7VA 5EO0B 2EXWC 3LZFL 4PJ9B 3C08H 5TPWL 4RMUA 1OP3H 3B9VA 1JHTB 4ZUVA 3L6FB 3NIFF 1KPRA 3B5GA 5A43C 2APXA 1YEHH 4U1IA 4HZAA 1OGAE 2EKSB 5TDOA 1HSBA 2DIAA 4LL9A 2D03L 5DWUL 3GMMA 1G7PA 5K33A 5H35B 5IF0A 2VQ1A 3VD9A 2OL3H 1ADQL 4HS8H 4U7KA 4X8XA 5DTFB 3FT3B 2HAZA 4P3WA 1V7NL 4NSKB 4UINH 2V2TB 4UBDC 1ZLSL 4LSRL 1I8IA 3H9SE 3DIFB 1NKRA 4UT6L 3GM0A 1BVLA 2AERT 2WBKA 3MQIA 4QXGH 1MIML 4S0TD 3CMOH 2DQGL 3O3AA 2R9HC 3T0ED 4BQCA 1HH9B 1YMMA 4KRMB 5EO1A 4HWEL 5LGKA 1MY7A 5B4MD 3QWRA 5CD5C 2OS7A 2QKIB 1U8HA 3GBMH 3DMMB 3OKOA 2Y36L 3HZKA 3MRIB 2Q8AH 3MV8A 3QNXB 1F02I 3MCLH 2J4WH 3O4LA 4DFHA 4KUZL 3VFUA 3ROLB 3J8F7 1QO3A 4DTGL 2NW3A 5HGDB 3LV3B 3QRGL 5KSBA 2VRAA 5E70A 4PRHD 3MRGA 4U49A 1T66C 3I50H 4R4NC 1UM4L 4PLJD 4MNHB 5BS0D 3V4UH 1ZHBA 2IAMB 3G6DL 3ULUL 4BFGA 1YQVL 2VDRH 5EOTB 3SQBA 1NGYA 1FGVL 3MJ8B 3NABL 2QL1A 3MMEB 1UYWL 1YUHA 4GFTB 5FGRA 5MEQB 2ZG2A 4P5MB 1HE7A 4G43B 4WTWA 4NRXB 4GRWH 3EYSL 1WF5A 4OD1L 4XMKL 3T77B 4X7SL 4XX1E 1PYWA 5B21A 4YHYB 4HLZH 3WJLA 2EDNA 3BKCH 4M7ZC 3RKDD 3KLSA 4MNQE 1T22B 4PRHE 3GSNB 1CXHA 1V8HA 2R69H 3CXDL 2RFXA 3Q5OA 2E8YA 2YD7A 4PJIA 4X4ZA 1MQKH 4LPVA 1CD9B 5IFHL 4PJBA 3UBXA 3QI9A 1LEGB 1WV7T 3QCUH 3SKMB 3ZL4L 4W6WB 4Y2DB 4OZIB 3T1FA 1A1NA 3MROB 3BZDA 4DK6A 1JPFB 2VABB 1DBMH 3O6MH 5E8DL 3HG1B 3QFJB 3I6LD 5KS9F 5FKAB 2E8ZA 4M3KB 4GBXA 3QQNA 2X4OA 3MRCB 4ZUUB 2CLRB 4HW6A 1F97A 3C09C 1JGEB 3NPSC 1MIMH 3NFNA 1INDH 5HDLA 1VACA 4JRXE 5HD8C 4CGTA 5DQJA 5IW6B 1S9YB 4EI5D 4OAWA 4WY7H 5BV7C 5F1IB 3OMZA 3PL6C 4U3XA 2O61B 4D9LH 1IGYA 3MRJA 4WI3A 1V3JA 3HRPA 3OB0K 3D0VB 3QIUC 3MFFA 2GK0B 4O2EA 4P3CL 1Q9LB 4DGIL 2MHAB 2VWEC 5IB3A 4LLDB 1UXSB 3I75B 3V5HB 5GS0L 4Y5XB 3AUVA 4YGVB 2OJZL 1ZSDB 4Y16C 3RJDA 5L2KD 3CC5A 2BMKB 3KYKL 1QBML 2ZPKH 3BPNB 1N0XL 4OQ1A 1OARH 1F11A 4KMTL 3T3MF 3O9WA 4JR9H 4ODTL 2BVUA 5HI5D 2YR3A 5IVXF 1OY3B 2GJ6B 5GGRA 3HE6C 2W07A 5CBEA 2VLRB 5E1AA 5DRWA 2F15A 3ARFB 4I0PA 1U8LB 1C5BH 3OWEA 2DDQH 4N1CA 3OKKB 4PB9H 4L4VB 1XIWA 4WCYL 1QSFD 3B6SA 3G5VB 4XP5L 1VADA 2HFEB 3TCLA 3VXSD 2X1QA 4BQBA 1JHTA 2XKSA 4LVEA 4LVHC 4M7LT 4YDLC 4RFNC 3P9LA 4L5FH 1YNKH 4FTVD 2AI0H 1FL5A 3DGCR 3S36X 4JO4H 3VFGH 1ZGLM 4ZPVB 4N9GB 3FHAA 4ENED 5D8JL 5KANI 3RZCB 2YMXH 1G9EA 4UDUB 3N1MC 43C9A 1JGDA 4X6CF 2WBJD 1RVFH 2DQFA 1RUKL 1SYVB 4P2QE 1RUPL 1HXYB 2YK1L 3FT3A 2DQIH 3U4BL 3WFDL 4HJ0D 3F62A 4HX1B 4OIBA 1LO5B 4QRUB 3DIFA 1FYHB 5I30H 2JE8A 4PJCF 3SE3C 4YE4H 2BSRB 4ODVL 5C8JA 4Y4KA 1QQDB 1T1WA 4JN1L 3VGBA 2D7MA 2X4UB 3C5JB 3HR5B 5J9PA 1IMHC 2CMRL 4YHZL 1GGBH 2P8MB 5SWQB 1CK0L 1LDSA 3S35L 1CVRA 4LCWA 5IB2A 1HZHL 4QXUL 4RFOL 1A7BA 4LPWA 3BVNA 4HH8A 2FSEA 5B22A 2Z31B 4UOJA 5T3XL 3G08A 2NQCA 5CEZH 2KDGA 1FVDA 1MIEL 1R3KA 4P3CH 1RZFL 1S8DA 3BXNA 3DTXB 2WNGA 3G6JA 3WIIL 3O6KH 3LHPL 5H37G 3UJTH 1I1FA 2WAHA 5L88H 1NMBL 4Z0XA 2NY6C 4K3DL 3JV5A 4XCFH 3TF7C 1JGUL 1U36A 2DLEA 2F54A 4FQQA 4HGWA 1HNGA 1RAMA 5GZOC 1CTOA 1UCBL 5BVPH 1Q72L 1PX3A 3UZQA 3MLXL 4ZYKB 3T09A 3UEZA 2XA8H 4W6YB 4ODWA 1B2WH 5D5MF 3VJ6B 4S2SA 3SKOA 3GHBL 1ZLVK 3CSYA 3E2HB 1NC2B 2BOBB 3PGFL 4PRPA 1LE9A 3T77A 3VFMB 1HHIB 3ARDC 5JPMA 3BEVB 4OIIL 4NO3A 3SQOL 1BZ7A 5DSCB 4K3GA 1QLRA 4M61B 3QSKB 1S7RB 1FYTA 3NFSL 1IGTB 2H41A 4HZLA 4FXGA 4XWGH 1HQRA 5T33H 3MUGA 5JOFA 3KYNA 5FYKD 3HE6D 4Q2ZB 2VXTH 5CKGA 4FQ1H 1VPOH 3S5LA 4U1HB 1A3RH 4Y2DA 4ZD3L 4OZIA 4KC3B 5JOPE 4AM0B 3MLTA 3MACH 3P0VH 4PRAA 3D25A 2EZ0D 4H25B 3A6CH 4NDMB 1BJ1J 1BHGA 1I9IH 1BOYA 2GTWA 3WLWC 3V95A 2ARJA 3O2VL 3NH7H 1R5VA 4R0LA 4HHAB 3FQTA 5T3ZL 4K94H 3QEHB 3LH2H 5DJAA 3IJHB 5K59F 2ED8A 2A1WH 1CLYH 2JELH 3CD4A 3LRHA 3QHFL 2DMCA 4H5SB 3D2UA 3L3JA 4XB7A 4OUOA 1A0QL 4AMKH 2PW2B 3GSUA 5C07B 2OJEA 3WNPA 3S37X 1OAZH 3MLSL 4DOHE 4Z0BL 3UYPA 1OTSC 2NY4C 5EUKA 1Z3GL 4LLDA 3GJFB 2F9BT 1F4YL 1NGPH 3LS5L 2ILLA 4NC0B 1F3DH 1VFBB 4HH9B 2YUWA 2B2XH 4WU5A 1MPAL 1P69B 1BJ8A 4XVSL 4X5LA 2JTDA 4JPVL 2QQNL 4QTIL 4OM0L 4JO2H 2VC2L 2FX9L 3WSQH 4FMKA 4JKPH 4ODSH 3HS0A 5I8CA 5INDB 3MLWL 4IOFC 1S5IH 4GXVL 1UFUA 2FHFA 3GKWL 2EDDA 3L5XH 3IAGC 4GMSL 4LAQH 3LN9A 4MZ3A 5C0DB 2FX8H 2J88H 4PV9B 5JIHA 5C0EA 4OCSL 1Y6KR 3NGBB 4Y19A 1WEJH 2HMID 4OLZL 2NY6D 5D2NC 1P4BL 3HE7B 3KPRD 4L3CB 3WE6A 3PWNB 5F8RC 4F57H 3V0VB 4N9GA 1T2JA 1F4WL 5C9JB 4NGHH 4UDUA 4V2CB 3DXAE 3U82B 3MNWA 3JUZA 4GMTL 4L8SB 4HGMA 5DYOA 2XTJD 3C8DA 2C3HA 1BQHB 1RURH 2X4RB 1OAUH 4Y89A 4M5ZH 4NYLB 2AJUL 5FKPB 3BH8A 4QRUA 4XMPL 4GH7B 5C0CE 2QQKL 3MRFB 4R9HA 4OZFA 3IFOB 3V6OE 3VGFA 5ID0A 1FCGA 3WNNA 1S9VB 3GSNL 3TJEL 4NJ9L 1FNEB 4UIKL 2PTUA 1C1EL 5GPRA 1PKQB 5DURB 1A6TA 4MCYB 4LKXA 3ARWA 3C5ZD 3M8OH 1LP9F 1WWAX 4GG6E 3LIZH 1ORQB 4F15C 3ZKXC 4XPAL 1QFWL 2VR9A 5F6IB 1KJ3L 4CJ0A 4UIMA 1PZ5B 3SDCD 4QOKD 3MXVL 5GGSA 2F19L 2MKLC 2XN9B 4M43H 4ZS7L 3H7LA 5FDWA 3DTXA 2X42A 1PBYA 1EZVY 4JZOB 2NY1D 4DKAA 5LWYH 3GJEB 5D71H 5C0FA 2XNAA 2FEDD 4JRYA 4KROB 3D18A 4NO0B 4U1LB 5JOEA 2IH3B 3KYOB 1RZIA 4KI1A 3H0TB 3D3VB 3MV9B 3WFCH 1ZEAL 1D5XB 4L4TD 3S97C 5KVMC 1A6ZB 4JPVH 3O0RL 4WI7A 1CL7L 2B7DT 2LAGB 4XTRC 4ZYKA 1NCCH 1XFPA 1U2HA 4APQD 1HXMB 4RISL 2OK0H 3LKRB 3MLWH 4J1UB 4I4WB 1KJ2B 4PRDA 2V5RA 4P9HH 2YOCA 3TZVA 3KXFA 1OTSD 4X7TA 5BQ7A 3RWGA 5KSVA 1HHIA 3C60C 3CZFB 1P5UA 4LGRB 4HAFA 3IVKB 1FL3B 4Y0GA 5TDPB 4R26L 3I6GB 2Q76A 1UM5H 1G7IB 1KN4H 5HVHC 4L3EE 4ZTPH </