1A6AB

The structure of an intermediate in class ii mhc maturation: clip bound to hla-dr3
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
187
structure length
187
Chain Sequence
PRFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title The structure of an intermediate in class II MHC maturation: CLIP bound to HLA-DR3.
pubmed doi rcsb
molecule tags Complex (transmembrane/glycoprotein)
total genus 48
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 1998-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a6aB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1a6aB01
4PLJD 2IFFH 4JFDB 2ZCLH 3DVGA 1NEZG 5H35B 1KTLB 2B1HL 2HN7B 4OLXH 3GRWA 5ESAB 4A6YA 1TNMA 3ULVF 1NCBH 2X41A 3GI9L 1GJIA 4KUCD 1XAUA 5IB1A 2Y7QB 2CUMA 4GKNA 4D0CA 1G7LB 1RVFH 3T0EB 3P4NA 4YHZL 1BD2E 1AKJD 1JPFB 2P5WB 4ZG1A 3L3IB 5FGCE 1TVHA 5K9KB 2IGFH 5F7DB 5ITFA 1UM5L 4RGNC 2NY5C 3KYMA 1SEQH 2NZ9D 5DRWA 3JWDL 4ODVL 5HVFB 2YPLB 2XT1B 4K7FA 4F57H 3RHWF 4Z76A 1XGYL 3PF2A 4W4OA 1CFVL 3C6LA 1S3KH 1YYML 2ADIA 3EHBD 4ZMAT 2D7QA 2XKNB 3TIDA 1CK0H 4JRYD 2X5PA 4MXVE 3WN5C 1A1MA 5I17B 3KPLB 1RIVH 1TJHL 3UO1L 1KXTB 1RUML 2ICWI 2VDRL 3CCHA 2PO6C 4ZPVB 4W6YB 3VD9A 1BVZA 1LO3L 1MI5D 2H3NA 2IC2A 5D1ZA 3QIWD 3G9AB 1EDQA 1ETZA 5FK9B 4S1RH 4Q7DA 4AT6B 2IJ0C 3BKML 4XNZC 4XWOD 4X4YA 5F93C 4L1DA 4NWUL 5HI3D 2J8UF 3SKOB 3WUWB 3GMPA 3ZYIA 4U6HA 2WP3T 4F7PA 5ICXB 5IW1B 3VFRB 1DE4B 4KVCH 3FQRA 1I7TA 3H0TA 2LVEA 2YD4A 4BZ2H 2P1YA 2B0SL 3BZ4B 2DLFL 4OIAA 5C0EB 5MEPB 2VL5B 1NJ9B 3P9LB 5CD5D 4K2UH 1IARB 1U93B 3EYSH 3BIKA 4LGSB 1T6WA 1NH6A 4IRJD 5AD0B 5FA4B 4MMXC 4UT9L 3RJDA 4BUGA 4FG6C 1KPUB 1JL8A 1EHNA 4FABL 1H0DA 5IROC 3BQUB 2XV6B 4YDKL 5EN2A 5I66B 4JFPB 2BVEA 4B50A 1IT9L 3R06B 3RVWD 3W11C 4X6CB 4WO4C 2R56H 4YK4C 1U6AH 5C09A 5DWUL 5I8KL 3RRQA 2R2EB 5T3XD 5C86A 3MODL 3CUPA 4XAWH 4ZUSB 5BCAA 5IEKA 5F72S 1WFNA 1A7NL 1CG9A 3LQZA 2R0KL 3NIGF 1MCPH 3UJIH 3LEVH 2AJSL 3QULA 4JQIH 2YD7A 3I6LD 4H20H 2ICWJ 5BRZA 4OD1L 1MRFH 3KYAA 2NY1B 4CDHA 3ZYZA 3QQNA 4NQDB 4F3FB 2WWKO 2QQLH 4LCWE 3NFNA 3I2CH 1NCCH 2VUYA 1RJCA 1INEH 4YPGB 5DUBA 1V3MA 3QDJA 5LQBH 3P4LA 3G08A 5C0JB 1KCLA 4FOMA 3FCTA 4O2EB 3KPNB 5D6DC 3AVEA 1J8HD 3LMJL 1LO0H 4XPFL 2XFXA 4LLUB 1RU9H 3DBXA 3QUXB 1M7IA 4EDXB 1C16B 2W9EL 4IM8A 4NNXB 3KR3L 2D7PA 3FMGL 1ZLSH 3GI8H 1Q0XH 3TA3C 4JZNB 1RHFA 1N2RB 3NACL 1G84A 1F58H 5F7LB 1OT1A 2B4CH 4PJIB 3HC4L 1VPOH 2VZSA 3P4MB 4B7IA 1U91B 2CD0A 2Y36L 4YBQC 3V4PL 4KZEL 4YXHH 3PHQB 2FX7H 5D7IE 2XXCB 4WY7H 3MRQB 3R8QA 3HE6B 3G5XA 4FNLL 5MEQA 1IC7H 4OQTA 4I18C 5HGAB 1EVTC 3E6FB 4ERSH 4CN1A 4H25B 4C4KT 5E8OA 5F7KC 1AE6L 1CGTA 4BFEA 4TSBL 1R5WA 1D7FA 3MRBB 4Y4KD 1H8SA 1B9ZA 3CSYA 2WIMA 4O51A 4Y19D 3OX8B 1IZKA 5C07B 2GW5A 3OKEA 3B6SA 4PJDB 1D6VH 2GQHA 1TPXB 1N6QH 4UT6H 1YYLH 1SBBA 1DZBA 3PL6D 5B21A 4LPUA 3N0PB 3H2WA 2FIKA 2NY2C 2EKSB 3MROB 2AEWA 2G60H 3VXTB 3MLYH 5DQJA 4RBPH 4MD5B 3ZL4H 4U7SA 1GIGH 1HSAB 2FDBP 1URLA 3KYKH 4ZQKB 2P5EA 1KG0B 3KLAB 4FQCH 5IMMA 3JVGA 2FD6H 1QO3A 1RURH 3QXDA 2CRYA 1FBIH 1WISA 2ADJA 3AROA 4JDTH 3VW3H 3EOBB 1ACYH 1EJOH 4JFDA 3QCVL 4U3XA 3NFPB 1UM6L 3UPAA 3KJ6H 5ESAA 5E08L 1VERA 4P23B 4WW2A 1CD8A 1DQJA 4WCYL 2GTZA 3X3GH 5L8JB 1KFAL 4BM7A 1W0WB 1G7LA 1MFEH 1QFWM 3T0EA 1T7WA 1JPFA 5B8CB 5K9OB 4QXWA 1U58A 3BW9A 5F7DA 5I18L 3E3QE 2X2YA 4CMHB 5TFSH 4NC1E 4RAVB 1T0NB 3DARA 4TUKH 3NIFF 5J1TC 5HYJA 3GIZH 2ARWA 2NXZC 3C6LC 2YPLA 3RI5F 4JFFB 3K46A 4MB4A 6FABL 4ODUB 4GLRH 1CDJA 1HYRC 2W92A 3V4VH 2EH7L 3HE7B 5EH1A 4BFGA 2XKNA 4MDIB 4JFZH 1RULL 3C60C 2HVJB 1MVFA 3LN5B 5FM5O 1X5JA 5I17A 4QHKI 1BWWA 3RTQD 3SDXF 2XTJD 3GRWH 4K55A 1BFOB 2NXYC 5C09E 1OP5K 5J0BA 4RFOL 2CXKA 2NY7L 1YQ2A 4D9QD 4MDJB 3LD8B 1IAMA 4IS6B 4MA8L 1A6UH 2D0GA 4AT6A 2B2XH 5HD8C 1ZGLB 4QHNB 3SKOA 3WUWA 1ULVA 3KLHC 5BRZE 3HPJB 3CH1A 3HMWH 4S0TD 2VN4A 5C08B 3VFRA 1DE4A 4LVNB 4H88L 2YXFA 5T1DL 4MJIB 4DAGH 3BZ4A 2MQCA 5MEPA 2VL5A 1NJ9A 3P9LA 1S8DB 2JELH 1R6VA 1U93A 1WTLA 3VG0L 3BEWB 3UX9B 5FA4A 2PYED 1BQLL 2IALB 1JMXA 1NCDL 1KPUA 3IYLW 5L2KA 3ARYA 2Q8AH 2XA3A 2DBLL 4QRPE 3O2WH 3D3VB 2ZCKL 5J12C 5I66A 4JFPA 1I1AC 3R06A 2Z4QB 4X6CA 2JJUA 2P43B 3O3DB 4MAYD 3MLRL 4OV5B 4NKMB 4MSWB 2R2EA 1INQB 4U0RB 2AI0L 1JPGA 4M62H 2B20A 1RPQA 3AGVA 2VXUL 3GO1H 3WKMH 4M6OH 3L7FB 5CJOL 1UYWH 2ZUXA 4QHKJ 1BJ1H 3ARFC 4MCYA 2IFFL 1BJ8A 2ZCLL 4CVUA 4NQDA 2JE8A 3PGDB 4MJ6A 5CZVH 2Q7NA 3NCMA 4OLXL 5EO0B 1O7SA 4JO2H 4LCIH 5DYOB 4YPGA 1ZT4B 5C0JA 2JB6A 1RVFL 4FFZH 2AERT 4O2EA 2XICA 3KPNA 4JHWH 1FL3B 1D9KA 1TDQA 2IGFL 4XPAH 1DANU 3GMMB 4NN5B 4BH7B 4EDXA 1C16A 1ZSDB 1SEQL 3ZTNH 2AQ3A 5IQ9B 3KXFB 5FFLA 1IGCH 2AQ2A 3ESVF 2P5EE 3MNVB 4PJIA 1R3LB 3SGEI 1S3KL 1H3GA 5EC1B 3P4MA 3V6FB 4WEBH 1U91A 4NM8H 1CK0L 3T09A 4GRLC 1MAMH 1HQRA 4RGMC 5E94A 4Z0XB 3S9DB 3MRQA 1RIVL 4JG0H 4Z78A 4JFDE 1YQVH 5E70A 4OCWH 2HKFH 1U3HC 4YXLH 1XR9B 5HGAA 3V5KB 1CDUA 3E6FA 3QDGB 3LKRB 1KJ3H 5J06A 2PO6D 4S1RL 3MRBA 4YFLF 2VLRB 1QACA 3STBA 1VKXB 3T0EE 1A7PH 1J88A 4XCNB 3OX8A 5C07A 2QJDA 4PJDA 2ITDB 4APQD 2LAAA 5INCB 4XHQA 2R1YB 4KVCL 1W72B 5HYJE 1YY8A 5D8JH 1HHIB 1AP2B 2YD1A 1ZLUK 4BZ2L 5FXCH 2EKSA 1R5IB 2IBBA 4K2UL 5T1LD 3EYSL 4MD5A 1XR8B 2OJZH 3RY6A 1W0VB 4NO0A 2JKXA 4J4PA 4R9HA 2VAJA 1KG0A 3KLAA 1CE1H 2UUDK 4NFCA 2OCFD 3OKYA 4P57A 1A14H 3WFBH 1XMWA 4PJCF 1JF6A 1Z0MA 2VDMH 3TH3T 4JR9L 2PKDA 3EOBA 4OCRH 4OLEA 4NP4H 2R56L 2LV4A 4RMVA 1U6AL 5DJDA 1JF1B 4RZCB 4UTAH 4CW1A 2ID5A 4WO4D 5F1IB 2A9NH 4YFDB 3RX8A 1VFUA 1W0WA 1MCPL 3UJIL 2AAVA 5B8CA 4JQIL 5C9JB 5K9OA 4PB9L 1B4JH 1UACL 1A7QH 2F8OA 4HXAH 1MRFL 3D25B 4HGWB 5ILTH 1BIHA 1OTSC 3ZDYE 2OK0H 2IH3A 3F58H 4LCCB 1T0NA 5C0DB 2QQLL 4OLVH 2AK1H 3I2CL 2DM3A 1NCCL 4JFFA 4N8VB 2DQEH 4E42B 1INEL 5ICZA 3QZWA 5L2KE 4XX1E 3S37H 5LQBL 1U8KA 3HE7A 3RVTC 3GK8H 2OR7A 4MDIA 1OGAB 1ZXQA 3X3FH 3IDYB 3EGSB 3V0AC 3LN5A 3T0BA 3VRJB 1RU9L 4KJWC 5DURB 4WV1B 4PRIE 3LRHA 5AYQA 3CXHJ 1YDPB 3C5SA 3EOAA 3GI8L 1Q0XL 5C92A 4G8EB 5FB8B 4XX1G 1F58L 2DRUA 4CGTA 2B4CL 4IS6A 1HH9A 1HILA 4XXCC 1VPOL 1T1XB 1E6OH 5D2NC 4MA3B 1HWHB 1U8JB 1ZGLA 4QHNA 1LO2H 4YXHL 2FX7L 3HPJA 3CFDB 1BPVA 4WY7L 4FN0A 3HZVB 1CLZH 2FZ3B 1IC7L 3ARWA 4NQDE 5C08A 2V6HA 4HKJB 4YBQD 4BFIB 2ZSWB 4ERSL 4MJIA 1IGYB 2VDPL 4ODBD 1S8DA 4FQQA 2IMNA 3ZT7A 2XWBB 3VFPB 1OWRM 1G9MC 3BEWA 4HUWB 3QEUB 3TZVB 1AIFB 2RQ8A 3BQUC 3WE6B 4WTWA 4PRHE 2IALA 2XNAB 4JJHA 5E7BA 5L8KB 1D6VL 3OV6A 3X12B 2E27H 3D3VA 3TBTB 3VFSB 1N6QL 4UT6L 3MV7B 1YYLL 4O5LH 1V3LA 2Z4QA 3O3DA 2G60L 4OV5A 3MLYL 3T0XA 3ZL4L 4ENED 4P46B 3T08A 1INQA 1GIGL 5GGUB 5CGYC 3KYKL 5GISH 2NY2D 1FVDB 3VRLF 4FQCL 1WWAX 1P84J 5F7MC 2FD6L 5L9DH 1RURL 1MIEH 3B9DA 1FBIL 1R5VB 1OB1B 5DJAB 5HVHC 4JDTL 3VW3L 1ACYL 1EJOL 5SX5K 3PGDA 2VWEE 2UYLB 4OTXH 3AFLA 2E9IA 3KJ6L 2ITCB 5EO0A 5DFWH 2GJ6D 2FATH 3LIZH 1PW3A 5DYOA 1G9MH 4KMLB 2MNUA 1V3JA 2NW2B 3X3GL 1RJLB 4ZAKD 3KDMB 3QUXC 2VR5A 1ZLWK 1MFEL 4LPTA 5H37H 2Q87A 2ERJB 3GMMA 3H9SB 2KKQA 1F3RB 5TFSL 4BH7A 1BZ9B 1DTUA 4TUKL 3SE3A 1ZSDA 3GIZL 1I8LC 1KJVB 1UKTA 2L0DA 3LN4A 3P40A 3KXFA 1OL0A 2QSCH 1CICB 2IAMB 3RWDB 5I2IB 2WWMC 3DO7B 2CRMA 1R3LA 2OM5A 4TVPH 2NXZD 2JIXD 3FONB 5CP7B 3V4VL 3V6FA 3FO1A 3HE6C 4HUNB 3MRLB 3MRFB 2XY1A 1BQSA 1HOCB 3C6SB 4Z0XA 4BJLA 4MNGA 3VA6A 5FKAB 4LOUC 3GRWL 3C60D 1XR9A 2C3VB 1KACB 2V2TB 3V5KA 3QDGA 3X11A 3I6KB 1ND0A 2IBZX 1UZ8B 1S9VB 3QEQD 4JFQB 2AK4D 2VLRA 3BMVA 3PWVB 1VKXA 2B2XL 3K74B 3V6BR 4XCNA 1PVHA 3RNQA 2XPGA 1HSBB 2ITDA 2KDGA 3HMWL 4KXZI 5INCA 2R1YA 5HD8D 1W72A 4AM0B 1LO5B 1T7YA 3EKCA 2XG5A 1HHIA 1AP2A 3ZHDA 5DHVB 3WIHH 4DAGL 3RY6C 4FQIH 3S3JA 3HNVL 4MB5A 1R5IA 2NQCA 2JELL 5C2BH 3DMMC 4HDIB 1XR8A 2BXZA 3I3DA 1AI1H 2ZJSH 3STZB 2EH8H 3O2WL 4R97B 5TQ0L 1QRND 5FO8B 1WLHA 4N0FB 4ELMB 4XRCA 3QZWG 1YPZF 3RKPA 4P23C 1EEYA 3Q48A 1P7KB 5T3ZE 1JF1A 1I1AD 3V7AE 2R4SL 4M62L 2MCG1 5F1IA 4L29A 5FYLE 5B8CC 4K3JH 5HHOB 3GO1L 1FFOB 3WKML 1TVDA 3MFFA 1ZGLP 4M6OL 3BZFA 4YR6B 4U1GB 1UYWL 4X4XB 5EU5B 5C08E 2YUZA 3IDMB 4TNVK 2GJZB 4YHNB 3D25A 3VWJB 3JWOC 3L3HB 2VKWA 3MLTB 1XGRB 3MPCA 2DQUH 1A6VH 4LCCA 2MMXA 5GRYA 3V7AG 5CZVL 5IIEB 4S1QL 4MLIA 1JZ5A 3ARFD 4N8VA 4E42A 5EUOF 4JO2L 4LCIL 1CU4H 4ZO9A 4I0CC 4FFZL 5T1KA 5E9DB 3D3VE 4JHWL 5MEOA 1RSFA 3EGSA 4JG1H 4YHKH 4QCIB 4XPAL 5I74B 4PRNB 4OZGF 3MR9B 4JJ5B 3LD8C 4WV1A 3S35L 1JTPA 4MNHB 4WRLA 3K1KC 3ZTNL 5DD6B 4LVEA 1AGCB 4G8EA 2BSRB 5FB8A 1ZHBB 1IGCL 4JREB 2C1OA 4WI2A 2R2BB 4JY4B 5GGRY 1T1XA 4WEBL 4NM8L 4MA3A 1U8JA 2DYPD 1MAML 4LVNC 4F58H 2YBRB 1A21A 5DMIH 3BT2H 4Q9RL 3HZVA 4PJFF 4JG0L 4LLQB 2FZ3A 4OCWL 5H94B 2HKFL 4GRLD 4YXLL 4HKJA 4BFIA 6CGTA 2ICES 1SBSL 5F1SA 1IGYA 2DQGH 1KJ3L 2X1QA 4ZYKB 2J8UB 4LCYB 3UTTB 1S7TB 2HFGH 3NFSH 1T6VN 2XWBA 3RL2B 3VFPA 4HUWA 4LEXH 2PUQT 3QEUA 2APXA 1AIFA 1MCEA 1A7PL 1NGWA 3WE6A 1BVKA 4JPKH 2G75B 3UTSB 2EDEA 3TBTA 3VFSA 4NQCD 3O2DA 3MV7A 3KPSD 3GM8A 4UIKH 3AAZB 5D8JL 3U0TB 4S1SH 4OSUH 4P46A 3AMKA 2OJZL 5GGUA 3DGGB 4BH8B 5JO5B 5FYLH 4M7KH 1FVDA 4POUB 3QUZA 1CE1L 1NGXB 3BUTA 4MNGE 4OQTL 2WBWB 1A14L 4Y89A 3U48A 3WFBL 3UZEA 4QRQB 2VDML 1R5VA 1ZT1B 3QDGE 1OB1A 1FV1B 4I9WD 5ECJE 5DJAA 1S7WA 4OKVB 4OCRL 4NP4L 2UYLA 3AY4A 3TVMB 1MCQA 4Q9QH 2ITCA 4UTAL 2VLRE 2A9NL 4P99A 4NDMB 2NW2A 1AR1C 3ARSA 1RJLA 4NN5C 1K4DB 3KPRB 4PJ8D 5BXFB 3LKOB 1AJ7H 1DUZB 5D1XB 2P5WD 4IDLA 1B4JL 1A7QL 4HXAL 3H9SA 3IRPX 5ILTL 1GOFA 3IJHB 2OK0L 3F58L 3MNWA 1BZ9A 1P53A 5EOTA 2EDJA 4OLVL 1KJVA 2AK1L 5FV1L 2IAMA 3RWDA 1DN0B 2ADGB 2DQEL 3QDME 3CXHK 3S37L 3FONA 5CP7A 1NDGB 3GK8L 1VHPA 3ARDD 3X3FL 3MRLA 4EEEA 3F7YA 3MRFA 5TE4H 1KLFA 2CKBB 5C0RH 5FKAA 3DGCR 5JDJA 3MA7B 4L3ED 5CD3A 2C3VA 5IW3A 2V2TA 4RCAA 3RPIB 3MGTA 3I6KA 4KJWD 1OOAA 3ZTJH 2F74A 5FHAH 4BQBA 1UZ8A 4QRTA 1O5DT 1S9VA 3D0LB 3CC5A 3F6LA 3M07A 4JFQA 1E6OL 3PWLB 1BZ7B 1D3CA 1EXUB 3PWVA 1IKNC 5E6IB 4WNQB 1LO2L 1O0VA 1U92B 3HLAB 5BO1H 1CLZL 4JN2B 1P69B 2P24A 4UNUA 4M6MH 4ZODA 4AM0A 1LO5A 3FB7B 4QTHA 3F5WB 3T0VA 3G6JE 4TNVF 5DHVA 1EMTH 5DJ2A 2HTKD 2V5TA 1YEHH 2D9CA 2CXGA 4Z7VB 4Q2ZA 4RA3A 4KUCF 4Y16C 5HDOA 1J0KA 1S9XB 1TIUA 2DKSA 2V17H 3L3GB 4HV8A 1D5MB 3STZA 4WWKB 5IVZA 3EJZC 5A2JH 1OQOA 3C2AH 3EO9H 2E27L 3WS6C 3BQUD 4CBPA 1OARL 1MCIA 1CXFA 1P84K 1FJ1B 4O5LL 5FO8A 3E2HB 4FTVB 4ELMA 5HPMB 3LKSA 1CL7H 1DLHB 4CVZB 1FZOB 1JFQH 2FGWH 2R0LH 4PBXA 1JV5A 5CGMA 1P7KA 3DYPA 4AQOA 3ABZA 1P5VA 5GISL 2Z92B 4X7FC 5HHOA 1FFOA 3BGFB 3B8SA 3KHQA 3MV8D 1OGTB 5L9DL 5CGYD 3DX9A 3GSWB 1W72H 4YR6A 4TVPD 5EU5A 1MIEL 1I85C 3IDMA 4JGUA 4Q0XH 4YHNA 4PJ7B 1ZS8A 1G7JB 4PGDA 3L3HA 1XGRA 1FZKB 4NRXB 5IIEA 4OTXL 4JRWA 2FECL 1I7RB 5E2UH 2FATL 3LIZL 5JW4M 1BECA 5C0AD 4KFZC 2YRPA 1G9ML 1F97A 5DHXB 4UB0H 4Z7UF 3WNLA 4WJ5B 4PLOB 4WV1C 2FEDC 4H0HB 5E9DA 2ICEB 4CVXB 4QCIA 4G43A 4PRNA 3MR9A 3QUXD 5E56A 1KIRB 1YEEH 4MNHA 5DD6A 4FQXB 2P46B 1AGCA 2KL6A 2QSCL 3QFDB 2BSRA 3PHSA 4DKDC 5J3HC 4LKXA 4JFOA 1J18A 4TVPL 1X5ZA 4JY4A 1GYAA 2QBWA 4J1UB 3SDXB 2WWMD 12E8H 4OIBA 1SY6A 3N50A 2X09A 3V52H 2HT2D 4N8CH 2YBRA 4NIKB 1MEXH 5EOCH 3KAAA 4XP9H 3WO4C 4D8PB 4LLQA 3HE6D 5H94A 3SJVB 3LS5H 4OZIF 1OPGH 1EEUA 3UAJD 3TZVC 5FYJH 2VLJD 1HXYB 2J8UA 3UTTA 1S7TA 5D7LB 3RL2A 3HG1B 4P2RB 3ZKND 4D9LH 4ONHB 3PQYB 1BF8A 4NO3B 2P7TB 1NFKA 1JCKA 4L4JA 4BZ1H 4LLYB 1B6UA 3H9SE 2G75A 4K8RH 3B5GA 1SMAA 3C87A 5CWSB 3AAZA 3N85H 4HKBB 3BRDA 3WIHL 1WZMA 4PLKD 4FQIL 1HNFA 2K7PA 4HULB 1IEBA 5C2BL 2LFGA 1IC5L 4XI5C 1AI1L 3DGGA 4BH8A 2ZJSL 5JO5A 3U6RB 1FFNB 5BV7B 5EWIH 4JZOA 3LCYA 4WFHD 1JZ8A 3DMMD 3WXWH 2EH8L 1JZ2A 3QSKB 1TZHB 4IIQA 4KMTH 4QRQA 4RQQB 1ZT1A 2IH1B 5D4QA 1FV1A 4LRIC 1FYTD 1NGQH 4OKVA 4HEME 4QO1A 2L7JA 1U8QB 4Z0BH 3G6DH 1A3LH 4PREA 5E0QA 4NDMA 3X14B 4K3JL 4E41D 1WSST 3KPRA 3O2DH 3LKOA 1N7MH 1TTFA 5D1XA 5JIHA 1UG9A 4FXLA 1JYNA 1XCQB 5CGTA 3IJHA 3LKQA 1CICC 2IAMC 3LV3B 2DQUL 1A6VL 3NCBB 2CMRH 1LK2B 4XNXH 1DN0A 5HGBA 1XH3B 4GQ9H 1CU4L 1UENA 2O5YH 5GGTA 3SY0B 4L3AA 3TCXA 1NDGA 5JW5B 4YHKL 4JG1L 4PG2A 3ZDZF 2GSIB 5ID1A 4ELME 3SE4A 2Z91B 4DW2H 4H0IA 1EFXA 3MA7A 4IMLB 1CQKA 3E8UH 1S9WB 4R26H 2WINB 1Y6KR 2WMPA 3FFCB 3OF6A 5E6YA 2EDNA 5F71A 4MVBC 1JI2A 4PRAB 1KXQE 5EU6D 3D0LA 3RKDC 5F9OH 2V7NB 3NCYS 3C5JB 3Q5YA 1BZ7A 1EXUA 4OQ1A 3JTTB 3A67H 3CXDH 5E6IA 4WNQA 1IM9B 4F58L 1U92A 3H3PH 4ZPTB 2MWCA 5DMIL 3BT2L 4JY6B 3ULVE 4JN2A 3BD4A 3MV9A 3O45B 3FB7A 2X6MA 3F5WA 5F97E 2HWZH 1ES0B 4NZJA 3ULUD 3T0AA 4UUJB 5LCVH 3NGBB 4P49A 4B53A 4Z7VA 3NFSL 2HFGL 3MJ8B 2HT3D 3S36H 4LEXL 4PJXF 3L3GA 3BN3B 3VGEA 1JMZA 3QFJD 4LPWA 1D5MA 2YC1B 3QIUC 3ZLQC 4ETYA 5DJYB 2FJHA 4HK0A 4JPKL 4XP6H 5C0BD 2NY3B 4M48H 3S35X 2DMBA 3TBSA 2X4SA 4UIKL 3SDYH 1FJ1A 5JHLH 5HPMA 4FTVA 5EZJB 3MV11 4NRYB 1DLHA 4OF3A 4CVZA 1FZOA 4S1SL 2EDYA 4DN3L 5HPOA 4FXGB 4OSUL 2Z8VC 4EBQH 5FYLL 4M7KL 1ORSB 1UWXH 3AU1B 2Z92A 4U1GC 3VXUB 1YEFH 1VFAA 3UDWC 1CIUA 1OGTA 4PRPA 3MLWH 4NJ9H 3ULVC 3VWJC 1CGYA 5I0ZA 5F6IC 3UTQB 1KCKA 3IDGA 2VR4A 5DHVH 2ZUYA 4XMLH 4JQVA 4PJ7A 4G6AC 1G7JA 4NQEE 4TSAH 4LLVB 4QWWC 2G2RB 3MREB 1JNNH 4LMQI 3T4YB 4U6VH 2J8UE 1FZKA 4NRXA 4EOWH 4Q9QL 1NMAH 3H3KA 2DJUA 3LSOB 3HNTL 5HVWA 1CD1B 4QY8A 5HJ3B 2VLLB 5KAQG 5IGXH 1IAOA 3NCJH 1T04B 1QHPA 4Z7WF 2RBLA 3LY6A 2XZZA 1E28B 2ICEA 1AJ7L 1NBYB 3BH8A 5F96H 1A6TB 3DTXB 1X7QB 1KIRA 3FB6B 4RMQA 4X80H 3LDBB 2GEEA 5C8JB 3QIBB 5DLMH 5GGSY 3QFDA 4JKLA 2GITB 5D93C 2VITB 1P6FA 5EO1A 4ZXBD 1YY9C 2NYYC 3GBLA 2F53B 1XIWA 4X6DB 2G9HA 2XQYG 5A2KH 1IEAA 4PJGE 3ULVH 1FQ9C 4OT1H 5C0RL 2YRZA 3WV0A 3SJVA 5CJXA 2Y4SA 5EBWB 2NZIA 2FBOJ 5EDXA 3TWCH 1Y18B 1NCWH 1KB9J 4XMKH 5CINH 3QHZH 5D7LA 5F7NC 3WFHA 5L0QB 3HG1A 3KPRE 4ONHA 2VLMD 3PQYA 1CVRA 4NO3A 3ARGC 2EZ0C 1U8IB 2CGRH 4KKAD 5BO1L 1CF8H 5ENWB 4N5EC 2EDWA 4M6ML 2HTLC 2OJEB 2C4FT 1ZA3B 4KHTH 3VFTB 3D9AH 1H3WM 2YN3A 4DUWA 2PCPB 2A83A 1EMTL 4OZHB 3L5WB 1R24B 5SWSB 1YEHL 3GMOB 3L5JA 3B4NA 3PWPD 5FV2A 1GSMA 1IAKB 3IU3A 3S37X 1FFNA 2V17L 4FQHB 1SY6H 4YNYA 2M1KA 1NMBH 4DZBB 1G6RB 4EUPG 2R1WB 4Y16D 1HDMB 3MUJA 1IILE 3OR7B 5KOMC 3U4BH 3V7MA 3C2AL 1SQ2N 4MHHI 3EO9L 4LSTL 1SMOA 1TZHA 1QLEH 1I8KB 4LRNH 5D70H 4M1DH 4RQQA 3TVMC 2X4PB 3EJZD 2LU3A 1CL7L 1J0HA 2FGWL 2R0LL 1TLKA 4U6YB 1GZPB 5MENB 1S7SB 2XZCH 5GGRA 5TDNB 1ZANH 1RIHH 4YZFF 3FHQA 5D1XC 3X14A 1U2CA 1UH4A 5DJZB 1W72L 2A1WH 1NCAH 1BBDH 3MV9E 1U8MB 4Q0XL 1SM3H 3HI1B 1XCQA 2ATPB 1GC1H 2LTQC 3LV3A 2BVYA 2LABA 4Z7VE 3DRTB 3CH8A 2Z9TA 1UFUA 5E2UL 4HH8A 3L9RB 1XH3A 2F54D 4PG2C 1ZT7B 3W39B 4UB0L 3SY0A 1UEMA 3T3MF 5KTEH 5C2UB 3BGMB 3W81A 1X44A 1OGAD 4NZRH 1L4IA 2GSIA 4MS8C 2PN5A 1QPXA 4AMKH 4FTVE 4ACPA 1KYOJ 3SO5A 5DURD 3U9UB 5AZEH 1YEEL 4Y4FB 1S9WA 4FP8H 4N0YL 4PYHA 2WINA 4X0KA 3CK0H 3FFCA 3DXAB 4U6XA 3DYOA 5E6IC 4UI2A 4BYHA 5IESH 3RA7H 3ZKXB 3RWHB 3I84A 4PTUB 3DJ9A 4PRPE 3C5JA 2L7UA 2R39A 12E8L 4Y5XC 1IM9A 1MCLA 3G5ZB 3V52L 4N8CL 1H15B 4PJ7E 4JY6A 4MZ3A 5EOCL 5JR1H 1FFQA 4XP9L 4FZEH 2QV2A 3LS5L 1OPGL 3DHJA 3G9VA 1RZGB 4KRNA 4M43H 2Q3AA 4DKEH 1ES0A 4P5TB 1WEJH 3SKMB 2HAZA 4YJZL 5GGTH 3IFOA 4KKCC 1YUHA 5FYJL 3IF1B 1QSFD 5MHSD 3OTTA 3MJ8A 4WWKC 5C3TA 1FAKT 4HUMB 2R1XB 1FVEB 3MBEB 4U49A 3O8XB 4KU1A 3TJEH 2VIRA 2BVUA 3TZVD 5CLWA 2CKBH 5DJYA 1B3JA 3LQAC 5C0CE 3WXVH 4XAKD 3E2HC 3ILPB 4K8RL 3JUZA 3VJ6B 1D5BA 4QXTB 1A7OH 3N85L 4M5YH 1LD9B 3ULSA 4Q6IC 5EZJA 3BSZH 2PTVA 3OHXB 4NRYA 2WBJC 4NC0B 5DSCB 2EDKA 2FL5A 1VSCA 4TN9A 3OB0K 2DQJH 1S5HB 3BGFC 3A6BH 1LNUB 2Q76B 2VDKH 3IKKA 5EWIL 3VXUA 1ORSA 5KVFH 1A9BB 4NRZB 4XI5D 3WXWL 1W8NA 4P9HC 2WBKA 2HP4A 3FRUB 1YNLL 3SJVE 4KMTL 2O5XL 3NOIA 5JXEA 3OAUH 1HH6B 1NGQL 3EO1B 2DKUA 4LLVA 2G2RA 5C0GA 3T4YA 4X99B 5D7LE 4Z0BL 3G6DL 5ESQB 4O9HH 1A3LL 1YA5A 4QT5B 5A1AA 3O6FB 3PQYE 1CD1A 4HMDA 4X9HA 5HJ3A 4AZ8A 2ESVA 2WIIB 1TJGH 3MRHB 3OPZH 4L8BB 3O2DL 1E28A 4UNTA 4Y1AB 2WV3A 1NBYA 4MX7A 3WBDA 4B5EA 3B9KB 4P4RB 1JIBA 5I8OL 2AW2A 4YUEH 3H42H 4FQXC 4W81A 5DR5H 2YS4A 3DTXA 1X7QA 3FB6A 1WT5C 1JGEB 1HXMB 1GL4B 2VN7A 2CMRL 5C8JA 1IE5A 3QIBA 4KJPC 1MHCB 3JTSA 4XNXL 3LAFA 4ZNCD 1CICD 1QOKA 4QTIL 2VITA 2O5YL 4Y2DB 3TNNB 1D6EB 1QR4A 2F53A 1IJ9A 1RZFH 4OZGB 5D5MF 1CFNB 4EXKA 1FNSH 5DC4B 4UBDC 2N7AA 3FQXA 4X6DA 3C5ZA 5DD1H 3U0WH 4HPYH 3N1FC 3AS1A 5TH2B 3P30H 4DW2L 4KKLD 2UY6A 2NX5E 5IBUB 3KNBB 4X9GA 4W4NA 3E8UL 2AJYH 4R26L 5BZWB 1HE7A 1U95A 3RWEB 2HVKB 3QA3B 1EZVX 1REIA 1VDGA 2QR0B 5JA8B 3BJLA 4QOKB 5HDBF 4ZO6A 1JRHH 5F9OL 4OLWH 1AR2A 5B3JF 4PJFB 4FHBD 4LL9A 4PGBB 3O11A 3A67L 2OTUB 3CXDL 4M4RA 4MVBD 4G5ZH 3H3PL 3QQ3B 1B88A 4U1IB 4UDUA 3RKDD 5DJCB 4LAJH 3BPOB 3QNYB 5ENWA 2VQTA 1HKFA 2GSGA 4PJ9B 2EIEA 2OJEA 1YMMD 1ZA3A 1FDLH 3VFTA 4WU7A 2HWZL 2PCPA 5LCVL 4OZHA 2D7TH 1QP1A 1QSEB 1R24A 5BV7C 5SWSA 1QBMH 3GMOA 4LAQH 5DEZA 5GZNC 4UU9A 3IXAB 2EYTB 3U30B 2IBZY 1T03H 1A1NB 3S36L 1IAKA 4XGZB 4ZSOB 4CL7A 1P2CB 4PJEF 1KLGB 2IQ9H 4Q97A 1S7QB 3HZYB 4DZBA 3NIDE 2BVQB 2R1WA 1JGLH 1T1YB 1HDMA 2DB8A 4XP6L 4M48L 5F3HB 1LO4L 1JGUH 1H5BB 1I8KA 3QIUD 4G3YH 3SDYL 4YDLC 5JHLL 3BP6A 3FFCE 3TO2B 3WCYA 1S78D 1DP0A 2ENSA 4NSKB 4U6YA 1GZPA 5MENA 4XC1H 4EBQL 3ZT6A 5TDNA 2Q6WA 5HYQB 4JPVL 4HWUA 5JDSB 3FOMB 2BMKB 1XF5B 4HLJA 3WLWC 2HJKB 1NPUA 3MLWL 5DJZA 1J5OH 4WFGE 1KEGH 1II4E 4KI5C 3VXSB 3HI1A 4XMLL 2ATPA 5DTFB 4TSAL 4HWZB 1JNNL 3MYJA 1DFBH 4U1LA 2UWEF 3DRTA 4U6VL 3FAWA 4EOWL 3RVUC 1NMAL 5BV7H 1KPRB 4R4FH 3BEVA 4G6AD 1QFUH 3L9RA 5CCKH 1F6FB 5IGXL 3NCJL 1ZT7A 3BYYA 4WGWB 5HHPA 1C7SA 3DVNB 3BGMA 1NAKH 5FUCC 3W0WD 5D96C 5EU7C 2BSTB 1CGVA 2VR9A 2HMID 5F96L 3OJDB 3U9UA 5IV2B 4KVNH 1VFBB 1UWGH 4X80L 4Y4FA 5ADOH 2PR4H 1UZ6E 5DLML 5E8NA 3DXAA 3FOLB 3IFNH 3VXUE 1WBXB 2APBA 4PJ5B 5D6CB 2D7MA 3RWHA 1I8MB 2E5EA 2FEEL 4ZS6C 1FNGB 2OTPA 1KB9K 3G5ZA 5CLTA 3L3OB 3NPZB 4DOHB 4NKQB 4E5XA 3ULVL 4OT1L 3PE9A 1YY9D 3QI9B 32C2B 3DRQB 5M94B 3NGBC 3ARBC 3O3EA 5LXGH 3R0NA 4LPXA 1KELH 1RZGA 2IG2H 3SKMA 2R29H 3TWCL 1T2QH 2ESVE 1NCWL 3IF1A 4XMKL 5CINL 5DVLA 1EAPB 2R1XA 3QHZL 5DT1H 1FVEA 3MBEA 3SE9L 2YSSB 4YGVB 4JCMA 3O8XA 4P59H 2CGRL 2R0WH 4ZO8A 4YDVB 1CF8L 4KGJA 4NT6B 5FF6B 3ILPA 4R90H 3VJ6A 3V5DA 1JYVA 2V5MA 3ARGD 4KHTL 5J56B 2EZ0D 5BQ7B 1LD9A 3D9AL 1BEYH 3VE0B 3OHXA 5KSAC 1CVSC 1SJVA 1Z5LA 3QQ9C 1OF2A 4TUOB 3MRPB 2F53E 1QUNA 1LNUA 5LBSH 5JZ7D 1SY6L 3FQNA 4X6DE 1NMBL 1A9BA 1EBPA 5SWQB 1LK3H 4NRZA 4I8DA 3HC0B 3M45A 1JZ4A 3U4BL 4OFIA 1PQZB 3FRUA 4FQJH 4LRNL 1QLEL 1BOGB 3D5OF 1X5IA 5D70L 1NAMB 4M1DL 1YN7B 5KS9F 1HH6A 2CLRB 3EO1A 4CU6A 4OV6F 3ARVA 5AUMA 4X99A 3JV5A 3QEGH 4JRYB 4NFDA 2HJLA 5ESQA 3TVMD 1LE9A 4QT5A 2XZCL 1OTUC 1IBGH 2ED8A 2P8LB 1RIHL 2N7BA 4KDTA 3MRHA 1AC0A 3CLFH 2Y5EA 3CX5J 3BH9A 1HEZB 1KGCD 5BW7A 2A1WL 1NCAL 1MI5B 4Y1AA 1BBDL 4HC1A 2EO9A 3BWAA 4HHAA 3LDBC 3QIWB 4P4RA 1SM3L 4MB3A 3ZSTA 1GC1L 3QIBC 4OZHE 3V95A 5SWSE 1JGEA 1HXMA 5I1EH 4JCLA 4Z7UB 2RHEA 2LQRA 4YC2B 1KYOK 1MHCA 3JZ7A 3GMLB 4N0UB 3TH2T 4Y2DA 3TNNA 1D6EA 5KTEL 5ACLA 2ZKHH 3HB3C 5I76B 3UPRB 5C0FB 4NZRL 1K8IB 1OP5H 5I8EB 5J4MA 4AMKL 5TH2A 2P48B 4G9FE 4R4BA 3FZUC 2W60A 5AZEL 4IRJB 1FNEB 3KNBA 1FORH 4FP8L 4MS8D 5BZWA 4I77L 5MENE 3RWEA 3CK0L 2HVKA 5L0QC 3QA3A 4ZTPH 5IG7B 5SWZB 4QRPD 1FC2D 3PABB 3IKCB 1RZKC 5IESL 4QOKA 2QSTA 3RA7L 4HUKB 3VXNA 4PJFA 4KHXH 4PGBA 4AENB 4OZIB 2OTUA 4RMUA 3QQ3A 4U1IA 1L9MA 3TT3H 5D1QA 4KJQC 5DJCA 3QNYA 5JR1L 4FZEL 2VC2H 4HFWA 1UVQB 4NQXB 3M8OH 1H3UA 1T5XB 2CO7B 3MTRA 1IAII 3MCLH 4M43L 4DKEL 5LJYH 4KJYA 1WEJL 3PIQB 3VI4E 1QSEA 4ORZC 3NCYP 5GGTL 4JFHE 4KKBC 3IXAA 4YE4L 2EYTA 2JLLA 2KUTA 4BUHA 4NJAH 5FKPB 2D0FA 3SDAA 1WITA 4ZSOA 3TJEL 4D0BB 1KLGA 1S7QA 3HZYA 4KKCD 2RR3A 2CKBL 1WIPA 3IDIB 2QQNH 1T1YA 3WXVL 4HUVB 2J7LA 5JA9A 2VTFA 5FM5M 1H5BA 1A7OL 5E5UB 4M5YL 4O2FB 3BGAA 1I7ZA 3BSZL 5DEGB 3DXAE 3TO2A 3CZFB 4XHJC 3HHRB 3EIFA 3UZVB 2DQJL 1J8HB 1GAFH 3A6BL 3PXHA 5CEZE 2VDKL 4OZFB 4MD0B 1RZKH 5HYQA 2WBJD 4ODSH 5KVFL 1UQSB 1DCLA 3FOMA 2BMKA 2Q86B 2DQIH 3H7LA 4YDJB 4Z7OF 3O9WA 4WTZG 1B0RA 4KK8D 4PFEA 4ELKB 4F9LA 4DZ8B 1U8HB 1L6ZA 2N4IA 5L2JB 2ZUQB 4M7LT 2PXYC 4H1LB 1CE6B 1FL6B 3TP4A 1DL7H 1F4YH 5DTFA 3OAUL 5HI5C 3BAEH 4HWZA 5KG9A 1NDMB 4PGEB 3PJSB 2A9ML 3QCTH 5E1HB 1KPRA 4O9HL 4FS0A 1G6RH 3KYNA 1TJGL 4K94H 1S9YB 5JUEH 2Q20A 3QNXA 5IM7A 3DX6A 1EGJA 2BDNH 4OFYD 4WHCA 1EEZB 2BSTA 3TF7C 5E8DH 4YUEL 3ISWA 3H42L 2VLKD 2PTTB 5DR5L 1G9NC 5IV2A 1VFBA 1H3XA 1YNTA 3OGOE 5DUPL 4L9LB 4Y0GA 4X83A 3D39D 5KSUB 3BIAX 4Y19B 3ZKXC 3BE1L 4TQEH 1SVZA 4FQXD 2UZXB 3ARRA 1TTGA 1I9IH 1WBXA 4PJ5A 1AQDA 1RZIB 2MQ0A 5D6CA 1RZFL 5AAWA 4EIZC 2EXWC 1XCTB 3PL6B 1FNSL 2ZCHH 1C08B 1QEWA 5DD1L 3U0WL 4HPYL 1YNKH 3QI9A 3DRQA 3P30L 3TC9A 4P5TC 2OSLB 1J12A 4UBDD 2XA8L 2AJYL 3NAAH 1EJ6A 5F7HA 2PYFB 3QYCA 4KQ4H 5KJRH 3P4OB 1K3IA 1OSPH 1WAAA 1EAPA 1JRHL 2E6QA 2YMXH 4ONFH 4OLWL 4YGVA 4R0LB 4P2RD 3GFUA 4M1CD 1AC6A 5SV4A 2G5BB 2HFFB 4G5ZL 4YDVA 4Y5VC 4UAOC 1ZLUH 1G9EA 5FF6A 4MYWB 1MLCB 1OAZH 1F00I 5JPMA 1P4LB 2ZUVA 1FDLL 1CN4A 1JF5A 4PJXB 3VE0A 3FT3A 3CPLB 2D7TL 4MD4B 2BSSB 1QBML 3EFFB 1KCVH 4LAQL 3F8UB 1AKJA 4HUXB 4AYFA 5JXAH 5DD5H 2UUDH 1G7PA 2IQ9L 4CRPA 2ZSVB 4KK5C 4WHDA 1L9NA 4XBGB 5GZND 4DK3A 1T89C 3MLXH 1JGLL 2R15A 1DQMH 3BUYB 1WFUA 3UTPE 3VXRD 1JGUL 3DV6B 4G3YL 5J8OA 1NAMA 1KIQB 5DDHB 1BHGA 1YN7A 4G8FB 3O6FC 3PWJA 4NOBA 2EE3A 4KDTC 1SEBB 4QOKE 3AREA 4JRYA 5FGBA 4XC1L 3TYFB 5IP4A 1IAIM 2JJVA 4PRID 3NA9H 5DGQA 3RTQB 3B9KC 2XTJB 5IBUG 1HEZA 2I9LB 1H3VA 1XGPB 1FNFA 2N56A 4JO1L 4JHBA 1MI5A 3HPLB 1J5OL 1MJJB 3QIWA 1KEGL 4JANB 4S0SD 3VFWB 3LZFL 2CIIB 5DMYA 4I0PD 1QD0A 2KZWA 1QSEE 2NY0C 1DFBL 3IFPB 5I1IH 2DQFA 1WFTA 4KI5D 5BV7L 3MUHL 4R4FL 3S36X 4Z7WB 4ZSOE 1E4XH 1QFWH 1QFUL 5CCKL 1Z3GH 1WIUA 3GMLA 1GPOH 2Z8SA 3QWOA 4N0UA 2YRLA 1MPAH 1JI1A 1T80A 3GZKA 4GAJH 4URTB 4EI5C 3OGCB 1NAKL 4OJFH 4UQ3A 1QFOA 3UPRA 5C0FA 5HHMD 5DO2C 5I8EA 3H9HA 3P9WB 3ILQC 3O4LB 4KVNL 4IRJA 1FNEA 1V3KA 1UWGL 2DLHA 2F8XC 1T2XA 2V2XB 4PRHD 5ADOL 2PR4L 1NFIB 4Z7QE 1T5WB 1XEDA 5IG7A 2O5ZH 3IFNL 1IQDA 3EDKA 3PABA 3IKCA 4DGIH 2WLZA 3WNNA 2Y5TB 5DGRA 1FLTX 3VFNB 3BPOC 4HC1H 4OZIA 4PJ9C 2YZ1A 1BIIA 3KPQB 5IB2B 1BQHB 1WGOA 2VE6B 4LGRB 3LH2L 3BD3A 1UVQA 4NQXA 4ZS6D 5LXGL 2FSEA 4U1HA 1GH7A 1KELL 1T5XA 2IG2L 4D3CH 3PIQA 1T1ZB 2R29L 4MGXA 5E4IA 4L8DB 4AL8H 1T2QL 2CQVA 3ARBD 1C1EH 4GAGH 5DT1L 5FKPA 3GKWH 3O3BA 4JGMA 4D0BA 1TFHA 1H5BC 4P59L 4U4BA 2R0WL 5HGDB 5GSRB 4LLWB 4HUVA 4R90L 5EZIH 1NCUA 4GKOA 5KN5B 2CIKA 1KTKE 3QEHB 4OM0H 1BEYL 4O2FA 1BLNB 2EDXA 3CZFA 5I71B 5A3IC 2YUVA 3QJHB 4PJAA 3W9EB 3ZKSD 4PJ5E 3SDCC 1J8HA 4QKXB 3IJYB 2M26A 4MD0A 3WL9B 1K6QH 3VWKC 5KSAD 4F9LC 1V7NH 1P9MA 1UQSA 3QQ9D 5FECB 3ZMRA 2HLFC 2PNDA 5KW9H 2Q86A 5D7KD 4YDJA 4NO0D 5SX5H 4ELKA 4JRXD 4FQJL 4DZ8A 3B5HA 5L2JA 3CX5K 4H1LA 1FL6A 1AHWC 1BQUA 1KPVA 1NBZB 3PJSA 4XNQB 4GXVH 3QB7C 2JJSA 1WAAE 1OD9A 3ALWA 1ZLWH 1IBGL 1K2DA 1UJ3C 3CLFL 1S9YA 3CAFA 4NBXB 4LSDA 1A3QA 4M4PA 1TETH 1EEZA 2XZAH 5CJ5A 1NEUA 1MCFA 1E4JA 1FIGH 5I1GH 1MFDH 2PO6B 3BJ91 4Y4KA 3ULUF 3GSVB 1CDBA 5I1EL 4L9LA 5KSUA 1PEWA 4Y19A 5HGGS 3FB8B 3PWNB 4OF6A 2YWZA 4Z7NE 2RCSH 4APQB 1ZEAH 3QPQD 4XPTH 1RZIA 1CLCA 2YPVH 2ZKHL 1XCTA 3PL6A 4JM2F 1ZVHA 3BHBB 3KYOB 1C08A 3JUYA 2E3VA 3ARQA 4HX1B 5T1LB 3KPPA 2F58H 2BERA 2OSLA 3HB3D 4LSQH 5F1OB 1FORL 2MKLC 1Z9MA 2YD2A 4ZTPL 4GMTH 4KUZH 4NBYB 4NGHH 4TOYH 3P4OA 3MOQA 4PLJC 1QBAA 1EGJH 4WI7A 1OAYH 4DN4L 5EBMB 4KHXL 3UYRH 1MI5E 5T33H 4HLZH 5IHZB 3QXAB 4KDVA 2G5BA 2HFFA 4M7LH 3TT3L 3K2MC 2EIZB 2IADB 1MLCA 2VC2L 3WFZA 3GHBH 3M8OL 4BQ8A 1P4LA 4WO4B 3MCLL 5ELIA 3MGAA 4KJQD 4I2XB 3CPLA 4MD4A 3ARPA 3EFFA 5FYKD 3SOBH 4U0QB 2YR3A 4GOSA 4NJAL 1ZOXA 3BXNB 3SBWA 2HLAA 2NZ9C 3ES6A 2RAMA 1IGIH 3D87B 4MNQB 4XBGA 3CFEB 5ANMB 2QQNL 2VZ1A 5F1NB 4MXWH 3BUYA 1FGVH 3EHBC 3SGDI 1MLBB 1HHHB 1KIQA 3VXOB 4G8FA 2FO1A 2UVEA 1QBBA 1T20B 1SEBA 2BNRB 3D2UD 1GAFL 3TYFA 1RZKL 3MRIB 5JOFA 4ODSL 4XHJD 2QSVA 1D5ZB 1F45A 3RTQA 3FO9B 5TE7H 4YBLB 3OXSB 5GIRA 1XGPA 2DQIL 2IANE 1IKFH 5T3XE 3HPLA 1MJJA 1G7IA 4NHUB 1FG9C 4PG9B 3RNKB 1PG7H 3VFWA 4ESKA 5I73B 5JMOC 1DL7L 1F4YL 2CIIA 2I5YH 3BAEL 2RFXA 1VGEH 2DTSA 1SYVB 1NGZA 1ZVSB 2FWOB 3QCTL 3I6LE 2PXYD 5HI4C 4Z7WA 5JW4Q 2OTWB 1G6RL 4R3SB 4FZ8H 4K94L 1Z9LA 5JUEL 4NO5B 5CD5C 4P5MB 5D7SL 1HHJA 3SKJL 1RAMA 3OGCA 2BDNL 1MCCA 4IRJC 1LDSA 3TBYA 5E2WH 3VXME 3WUZA 5M95B 2P8MA 3LPWA 1PX4A 2V2XA 4PJAE 2PYEA 2FECI 1J8HE 4TQEL 5D5MB 3RUGA 1NFIA 3Q3GB 1T5WA 1BGXH 3U4AA 5I1KL 3RVWC 3QG6B 1I9IL 4O02H 1AD9B 1UCTA 1VENA 3VFNA 1R3KA 2XN9B 2HT4C 4WW1B 3NTCH 3KPQA 1IGMH 1YNKL 4MAYA 5IB2A 3HUJE 5IFJB 1BQHA 4MJ5B 4ODWB 2VE6A 3S98A 3PV6B 2NY2B 2DKMA 3NAAL 1GGUA 1T1ZA 4L8DA 4KQ4L 5KJRL 1QSVA 3IJSB 1OSPL 3OL2A 4OD2A 1NKOA 1T2JA 2YMXL 4ONFL 1O7VA 2WZPD 3F7PC 4ODTH 4H1LG 2JCCF 2LU4A 1DQLH 1WCQA 2DL2A 2HH0H 5HGDA 5GSRA 4PY8I 3HCVB 3MRCB 1OAZL 3OKDA 2GJ6B 5KN5A 3U7YH 4AEFA 3VI3E 1BLNA 3BPNB 4ZAKB 4I5BA 1KCVL 4CJ0A 4W70A 3FT4A 1S7XB 2H2PC 4LBEA 5I75C 1U8NB 1MFCH 5JXAL 1MREH 5DD5L 3VFVB 3IJYA 5DJXB 3SGEH 2CDGA 5F8RC 2J6EA 2AJZB 4U1MB 3EOTH 5FYJU 3MLXL 2CK0H 4ZUUB 1DQML 2FBJH 3O41B 3N1GC 2D4FA 3QDMD 4X8JB 1F11B 5KSVA 1D5XB 4KK5D 2JJSC 1B4RA 2BP3A 2C1PB 1YC7A 2NXZB 1LDPH 3QJFB 1NBZA 4WI4A 4XNQA 1B0GA 5T5NF 1UKQA 4FFVC 1YEIH 4N0RA 3NA9L 2J8HA 3C60B 5DI8A 3RZCC 2ICCA 3V0VB 3WN5A 2J4WH 2BOCB 2K1MA 4N0CC 4DVRH 2UWEB 4KAQH 2CJUH 4L9LC 1Z0NA 3B9KD 4PP2B 2PO6A 3OJVC 5D2LA 3QEQB 4HIXL 2AK4B 3GSVA 1WIOA 5I1IL 4OCSH 1G7QB 5KBNC 4OZFH 4JPWH 1MUJB 2EEDA 3PWNA 1E4XL 1QFWL 3DNKA 4FQLH 3RWCB 1Z3GL 4JZJB 4APQA 2EIBA 1GPOL 4PD4J 2NY0D 1MPAL 3BWUC 1HWGB 3ZYJA 3UTZB 5IB4B 1JN6B 4GAJL 3CFCH 4OJFL 1A64A 5I8CA 3BHBA 3KYOA 4V1DA 4BZYA 3B9AA 1P7QD 1CLYH 4EI5D 2MJWA 2GIYA 5T1KD 4C59B 5E6ZA 2BOBB 3BI9X 3TT1H 5DO2D 5TF0A 1SVCP 3NABH 4YH6A 3R8BB 2EDDA 4R0LC 4MA7L 4OI8A 3QR2A 2O5ZL 2C4XA 5F9JA 3ILQD 5EOQH 4DGIL 2XTJE 1NQBA 1QRNB 2EEAA 4HC1L 1U3YA 4D9QE 3AMLA 1EAJA 2W38A 5IHZA 3QXAA 4FXKA 2SEBA 4FQ1H 5IROA 3THMH 1P1ZB 3DROA 2QHRH 1NGYB 1I1AB 2EIZA 2IADA 2XIDA 4FRWA 1JK8B 2LVCA 1L7IH 3PHOA 4WO4A 4D3CL 4Z7WE 4MXVF 4I2XA 4NO2B 4AL8L 1EZVY 1C1EL 4GAGL 3GKWL 4LHJB 3ORJA 4E0RA 1PZ5B 3STLB 4TRPH 1A7BA 2N1KA 2X4TB 5IMLB 1MJ8L 1A02N 3L3JB 3QP3A 4K71B 3VRIB 3GM0A 3M17B 4KGLA 5EZIL 2Q3ZA 3ARFB 1MLBA 3MLZH 2C9AA 1HHHA 4OM0L 2PYEE 1LWRA 1Y6NR 2H45A 5A2IH 3RUGE 2QKIB 3T77B 4PV8B 1XF1A 1BFTA 2Y07H 2OYPA 3VCLB 3RTQC 3PNWA 3OSKA 3PGFL 1MOEA 2YZ8A 1K6QL 1JYXA 5A3ID 1V7NL 1DQTA 1D5ZA 2QLVB 3FO9A 5FGRA 3TO4C 5D6DA 5KW9L 3OXSA 3KGRA 3SDCD 5KS9B 2YXMA 2QADC 4LEOB 3VWKD 2FLBT 3SQBA 4NHUA 4PG9A 1Q9OB 4ONOA 3QUZD 3RNKA 5J1SC 3VXSD 1F3DJ 1C5BH 3P11H 1I8IB 4DK6A 1UEYA 1SYVA 1IFHL 4G9DB 1ZVSA 4GXVL 4MCZB 2FWOA 1G1YA 2ZUSA 4OD3H 2DYPB 5DRZB 4R3SA 1BQHG 4X6FB 3FO2B 4GRLB 4NO5A 5EIIB 2GFBB 1E27B 4X5WA 4X6EB 1TETL 4LPVA 3TFKC 2XZAL 5KSBA 4P3CL 4QHUA 2DD8H 1FIGL 5I1GL 1MFDL 4LKCA 4LASH 1GZQA 3VDCA 5HHVH 4EDWH 3F65A 2RCSL 3QG6A 5JHDE 3VGAB 4XPTL 3L5XL 1AD9A 4NZUH 4NQCB 5K93A 4XNYH 3KPSB 2YPVL 3NPSC 3GMRB 4WW1A 3MBXH 3PDOA 4RGNE 4YHLH 2F58L 4YO0B 2OX5A 4ODWA 4LSQL 4HG4K 1ZV5A 5FUOH 4DKFH 2Z93B 3ESUF 3SCMB 3QO0B 43CAA 3EO0B 4LLAA 2GI7A 4NQSB 4KUZL 4I3RH 4TOYL 3SKNB 3IJSA 2K7QA 4WDIB 5IOPB 2FIRT 1EGJL 1OAYL 3R4DA 4K3EH 3UYRL 3V8OA 1HNGA 5T33L 3ROLB 4L9DA 3WJLA 3FTGB 4M7LL 2B7DT 1RUKH 5LGHH 3HCVA 3MRCA 5D2LE 5I71C 1A6ZB 1MCSA 3GHBL 2GJ6A 4PB0H 4X5LA 4R8WH 2X4NB 5D7IF 1DVFB 1OAUH 4PJ8B 4ZAKA 1S7UB 3SOBL 2XG4A 4JKPL 3S5LB 4CUCA 2HFEB 2QEJA 4OF0A 1U8NA 4WGVB 3VFVA 1IGIL 4AH2B 3IAGC 4V1DE 2AJZA 4U1MA 5D9SB 2XWJB 4XCFH 4ZUUA 4D0DB 4MXWL 1JWUB 1NANI 2AJUH 4M03A 2B39A 1FGVL 3O41A 1D5XA 3QNZB 3X17A 3Q6FB 2XYCA 2H6PB 4CU7A 3RWGB 2JIXA 1DUYA 1MAJA 5E7FA 3QJFA 2XKUA 2UY7A 2VUOA 3ARDB 1WZ1H 3G04B 2DBJA 2VAAB 3BP5A 4HXBL 2M2DA 2BVOB 3SDDB 5TQ2H 1J05B 4GG6A 3RX7A 1FFPB 3KHOA 4L3EB 5TE7L 5JTWA 5FCUH 2WUCH 3C60A 5IFAH 4HUUB 3FN9A 5TDPB 5I6XB 4Z9KB 1IKFL 3V0VA 4QRRB 5EPMB 5LWYH 3HR5A 2YD8A 1PG7L 2X89D 4PP2A 1MCBA 4I2XE 2I5YL 1OY3B 4O58H 4NC2B 1CL7I 4NUJB 2CLVA 3QEQA 4APQC 1VGEL 4XVJH 1G7QA 1SJXA 1F6AB 1MUJA 4ZFOB 2J6EH 2VZVA 3RWCA 1CT8B 4JZJA 4U1KB 3T1FB 4FZ8L 1KEMH 5D2NB 4LLDA 2YUXA 5AZ2H 4X7SH 1JP5A 5IB4A 2VABB 3UTZA 1JN6A 5HI4D 3RI5K 4HKXB 3UBXB 3G5YB 3IXTB 2FO4B 1NAML 3F7QA 2NY5H 3UYPA 4UIMA 5E95B 1K5NB 5E2WL 3TGXA 4LCUB 4W6XB 4K07A 1X5FA 2A6JB 2BOBA 3LEXB 5FO7B 1HI6B 2EDFA 1LP9A 1BGXL 4CKVX 1P7HL 5SWZD 4NNYA 4X98B 4K7PH 4Z18A 1KCUH 3OWEA 4NCC1 5GJTH 1QRNA 1L6XA 4RFEA 1F5WA 3IT8D 3BFOA 3NTCL 3ZE1E 5F6IB 1ONQB 1IGML 1NGYA 2X4QB 1I1AA 2HT4D 4DUVA 3S97C 1JK8A 1FFRA 1GGYA 4PJBB 1KOAA 3ETBF 4JKMA 3SN6N 4HKZB 1F4HA 1EIBA 4NO2A 3MV8B 3RVVC 5ISZD 4RIRB 4HH9B 1PZ5A 4NQED 1UXSB 4ODTL 1RD6A 1OM3H 1DQLL 4Z8FH 2X4TA 5KSBE 5CEXA 5IMLA 2HH0L 3GMNB 1NL0H 3L3JA 2IFGA 4OLZH 1X5LA 2OQJB 3VRIA 3M17A 1T22A 1TQBC 3ARFA 2GK0B 4HQQH 4C56D 5HVHB 3U7YL 5C0AB 1ZHKB 1A5FH 1FCGA 2R2CA 4PV8A 3EYVB 1KCRH 1MCDA 3VCLA 3O0RH 4HSQA 2ZOKA 1MFCL 5IEHB 4YBLC 4P3DB 4EVNB 4OCYH 4F2MA 4HIEA 3EOTL 2R69H 1BWMA 2EDQA 3ZHLA 2CK0L 2H2PD 3MOAH 5I73C 5T3XL 3MQIA 2FBJL 4YX2H 3EZ8A 3MC0A 4LEOA 2EDBA 1LEGB 5B3JE 4LNRB 3UP1A 3WFCH 1I8IA 5C9KA 3VU2A 2FR4A 4I48A 4G9DA 5EZLB 2IQAB 3HA0A 1WF5A 2DYPA 5INDB 3WDJA 1YEIL 3U46B 3CSBA 4L3CB 1T4KB 4X6FA 1FVCB 2E7MA 4GRLA 5GS0C 1B90A 5EIIA 2GFBA 4FFVD 2J4WL 2BCKB 1E27A 4KZDH 4X6EA 4DVRL 4PD4K 2GJ6E 4KAQL 2CJUL 2VLJB 1U3HA 1ITCA 3RZCD 3WMSA 2YWYA 3MX0A 5GGVH 4XT1C 4DKAA 4N0CD 4N90D 4OCSL 4Z5RB 1BM3H 2DQCH 1OSZB 4JPWL 5I16B 1GGCH 4LVHB 4FQLL 2E9BA 4GUPB 1AH1A 4NQCA 1JZ6A 3KPSA 3CFCL 2EYSB 3GMRA 4ENEC 2I24N 2X4UB 1KULA 5DVNA 4BSWB 2YKLH 3VG9C 1CD9B 1CLYL 1YMHB 2OMBA 4W6WB 2JJTA 4U7MA 1AO7A 3C09B 4QXGH 3VFOB 5MERA 2Z93A 1PKQB 3TT1L 3GGWB 4OUUA 2PF6A 3NABL 3QO0A 3EO0A 4P2OD 3DMMB 3OXRA 1EFXD 2W65A 4GG6E 5EOQL 4WDIA 2A73B 3WJLC 4GKZB 2MCPH 3OAZK 5EB9A 3VD3A 3OF6D 2I9TB 3RP1A 3NN8A 5FO9B 5GS0H 1FYTB 2CUIA 2BC4B 3FTGA 3THML 4FQ1L 3QH3B 4RFNC 5C6WH 2QHRL 1W0YT 1KTLA 3BPNC 2HN7A 3WD5L 3QEQE 4EQ3A 4F7TB 5H35A 4ZAKC 1T83C 3IGAB 1L7IL 5A2LH 2VNCA 4HFUH 3V5HB 1F8TH 4E41B 2Y7QA 2X4NA 4OBSA 1L0QA 5DMKB 2BXYA 1S7UA 1MQ8A 3S5LA 2P5WA 3L3IA 3QPXH 4TRPL 5K9KA 5D9SA 2OP4H 4KMQA 1XF4B 4WW2F 2XWJA 2F5BH 4XC3H 3I50H 4D0DA 1JWUA 4M7ZB 1RJYB 1IL1B 2F8VA 4DTGH 5ESVB 3Q6FA 2H6PA 1LP9E 3RWGA 2Y07L 3CU7A 1X5YA 3ARDA 1LGVA 3G04A 1OW0C 1QRNE 3VXQB 1QRKA 2BVOA 1AGDB 1J05A 2EE2A 3KPLA 1GOHA 4L3EA 4U3HA 4HUUA 5TJWK 3E0GA 5TDPA 4ZPVA 4OGXH 3LVEA 4WFED 5JW4N 4MA1B 5EPMA 1Q9LB 3P73B 2HA1A 3TO4D 1WC7B 1C5BL 3INUH 1KJMB 4PTTB 4RA0C 5EU6B 3U2SB 3P11L 3HRZB 2QADD 5FK9A 4JZJC 4PS4H 3E1F1 3V8CA 5CKGA 4OD3L 4MMZC 1Y0LB 4ZFOA 4XXCA 4U1KA 2FNBA 4N1EA 5D2NA 4GBXC 5ICXA 4U1JB 2VABA 3VMNA 5IW1A 8FABB 3D69B 3UBXA 3G5YA 5L6YH 2FO4A 2DM4A 1JTOA 4GRWB 5GS2D 3IRZA 3T2OA 5C0EA 2DD8L 1WWBX 4LASL 4LCUA 3O4LD 3QDJE 3FQWB 5HHVL 5AD0A 3TFKD 2VXSH 3LEXA 3QFJB 4EDWL 5FO7A 5C0CD 1HI6A 1V7MH 3PV7A 4P2YA 1LQSR 4X98A 5ERWB 5C0BB 3ZDYF 4XVUC 2NLJB 4NZUL 3BQUA 4XNYL 3WNPA 5IVOA 2ZOLB 3UC0H 1ONQA 3MBXL 2VISB 3P77B 1J0YA 3ZDXE 4YHLL 1XIWD 1BF2A 2X4QA 5FUOL 2W59A 4DKFL 2DWDB 3HI5H 2C4FU 3HS0B 4ZUSA 2J12B 1PFCA 4JHAH 4PJBA 4HKZA 4I3RL 3MV8A 2AGJH 2IPTH 3HZMB 4JPIB 2FHBA 2ARJB 2XXMB 3L1OH 4L4VD 4OBRA 1QVOB 4K71C 4K3EL 2FEEI 1UXSA 4ISVB 3TEUA 4CU8A 3WIFB 4F3FA 1RUKL 5LGHL 2OQJA 4PBWD 4XXDB 2GK0A 4G6FB 4AK1A 4PB0L 2VQ1B 1NCBL 4QRSB 3OB0H 5C0AA 4EZMA 2KQNA 4KI5F 1OAUL 3EYVA 4UQ2B 3NA4A 5IEHA 3KPSE 4P3DA 3S8WA 2ARJQ 4LLUA 3QUXA 4XCFL 4NNXA 2AJUL 1RI8A 4PJHB 3BRGC 4HIHB 1AO7E 4JZNA 1N2RA 4F57L 4XVTH 3WIHA 1Y6MR 1JHTB 4F7CB 4LNRA 1I8LA 4ZXBB 3I85A 4IMKA 2E7CA 5EZLA 3FRPA 1WZ1L 2IQAA 4U6TA 1BVLB 3U46A 3PHQA 2NX5D 4I9WE 1P4BH 5TQ2L 4L3CA 1FVCA 3HE6A 35C8H 4X7TB 5FCUL 2WUCL 5IFAL 1RZ8B 5F9WB 5C70A 2BCKA 1NSNH 5CJ8A 5B39B 5LWYL 4H25A 2VLJA 3O3AB 4WTXA 4O58L 2OXGA 4TUJB 1QHOA 2YA1A 3VGAC 4XVJL 4Z5RA 4ZOBA 2D03H 2P5WE 1JUFB 2J6EL 1PY9A 4GUPA 4LDLB 1KEML 2AV7B 5AZ2L 4X7SL 5JIIA 4HJ0C 4HS6B 1YEDB 4HPOH 2JJTC 2X4UA 5B38B 2YPLE 2NY5L 3MROA 3UPCA 3SCMC 5HYSB 1YMHA 3VXTA 4BSJA 3S5LG 3PWPB 4XCYB 4YHIB 1HSAA 1I9JH 3VFOA 3AM8C 5HY9B 2J8OA 1ZLVK 5CP3H 1PKQA 4QNPE 3FJTA 4IEFB 1JVKA 2F19H 4ZQKA 3DMMA 4Y16B 1IC4H 1EBAA 3QCUH 3U4EB 1OD7A 2E8YA 1JZ7A 4K7PL 2A73A 2Q7YB 4GKZA 1KCUL 4L3EE 5GJTL 4F7MB 5DVMA 3U1SH 1M71B 2I9TA 1FYTA 5IF0B 1DN2A 5C0NC 1PG7X 5I1DB 3NFPA 3CNKA 3I02B 4F7TA 3REVB 1DVFC 2OXHA 4PJ8C 4R6UA 4XAWL 5FOJA 3IGAA 2OI9B 3P0VH 4P23A 5CILH 1RHHB 4E41A 2BVPB 2FX9H 4OGAC 1MHPH 5DMKA 3LEVL 5D2NE 3BN9C 1FRGH 4H20L 5EIQA 5B4MD 1OM3L 4KTYA 3RVVD 2YD6A 4Z8FL 3V4UH 1XF4A 4MNQD 1PGRB 4RAVA 2PW1B 3EYQC 4OLZL 2NY6D 2X4OB 3KPOB 1YECH 3N1PC 2OZ4A 5IBTH 1OAKH 4HQQL 3WUWG 1IL1A 4P4KC 3ARDC 3VD4A 2F54B 4ODUA 1KNOB 1U2HA 1A5FL 1MQKH 5ICYB 1CFTB 3SDDC 1CDIA 3UBXG 4L8CB 2BNRD 2HVJA 4LQ1A 3VXQA 1G7MB 1LO0L 4OCYL 4S11A 5I6XC 1AGDA 3ZSSA 4UILH 5IT2H 2CR6A 4UV7H 4N9OB 1KLUB 2DI9A 4X6CE 4QLRA 3MSPA 1F4AA 3MOAL 1BFOA 4X7CC 1Q0YH 2LU7A 1ZLSL 4CMMB 4YX2L 4MDJA 2FGZA 4HK3J 4K9EC 1HN1A 3P73A 4R96B 1WC7A 2WWKT 3GB7B 4PJBE 5EU6A 1MELA 4PTTA 3U2SA 3HRZA 4JB9H 3MV8E 1QFPA 2BHZA 4TVPE 5BVPH 3MUGB 5H37G 1ZWIB 4L4TB 5FDWB 4YHOH 3O6KH 3V9FA 1NEZB 1NUNB 2HTKC 5IVXB 4U1JA 3DECA 5LAXB 4RAHA 3T2NH 2AABH 1PYWB 1VCAA 4KZDL 1NBVH 4V2CB 4EKXA 3WO4B 4HF5H 5C0AE 1QSFB 5GS0D 5GGVL 1U3ZA 5JNYB 3FQWA 4ZOEA 1BM3L 3QFJA 2DQCL 1GGCL 4GKSB 5FYKU 3RU8H 5ERWA 5C0BA 2NY4C 4ETQB 2ZNWA 4XZUB 2VRAA 4MQ7B 2XN9D 2WK2A 2ZOLA 1QG3A 3P77A 4P5KB 3RDTD 2A0LD 2YKLL 4RDQG 5HDQH 1MIMH 4NKMA 4PJIE 4MSWA 4K9EH 1JNLH 2Z31C 4QXGL 2DS4A 3JWDC 3NZHH 4YAQB 4WHTB 3OKOB 4K3DH 3BP7B 3L7FA 4JPIA 3FN0H 3CJJA 2C7UB 2MCPL 4HAFA 1QVOA 1QA9B 5GS0L 2EDRA 3WIFA 3VD7A 2VLJE 1NC4D 3FRPG 1PY4A 5BMFH 2VMFA 4QRSA 5A43C 4MQXD 4HFUL 4M6NH 2CK2A 5E5MB 1ZT4A 5C07E 3MUZ1 4PJDE 3EYUH 3CVHB 5AAMA 4KH2A 1VACB 3V6OC 1OTTC 1OT2A 1JWSB 3QPXL 1FL3A 4J7RA 1QLRB 3T3PE 2C5DC 2OP4L 1JYWA 3VGFA 3TLRA 2F5BL 4XC3L 3I50L 1PZUB 5IQ9A 3KJ4B 4PJHA 2ZNXA 4LU5H 4IMKC 1PKQE 1I9RH 3VFMB 5IHLB 4F7CA 1JHTA 3VXPB 4ZXBA 2HT2C 2ZP0T 3MNVA 4U1SB 1MAKA 1FO0B 2EDLA 3J8F7 4PRDB 5EC1A 5F1KC 4ALAH 4JFZL 4G9FD 3AXLB 1BVLA 4LP5A 4B7LA 2WP3O 3G5VB 3UAJC 4X7TA 3KLSA 1V8HA 5DVKA 1HK6A 1RZ8A 1MRCH 1ZA6B 4XNUH 4OGXL 3ZKNC 1NUFA 1RK0B 3LKRA 2ZUUA 5B39A 2AXFB 5DEFB 3O3AA 4E41E 3INUL 1A6UL 4LVHC 4G7VH 4PS4L 4BFBD 4TUJA 1I3RB 1VGKB 5KZCD 3HC3H 1EO8H 1JUFA 4GQPH 4KROC 4AJ0A 4PLKC 3I9GH 2AV7A 3MRDB 2IPKB 1IKNA 5HGHB 1YMMB 1IGJB 4HS6A 1YEDA 4JVUA 3ZZ1A 1GXEA 5L6YL 5B38A 1MH5B 3C09C 4JFFE 3D85D 4GBXD 2CPCA 2EKJA 5HYSA 3OR6B 4TPRH 1CGSH 3OG6B 3PWPA 3EFDH 4XCYA 3QWRD 4YHIA 4GXUM 1X5HA 1W0VA 3EOYG 2VXSL 2KZ1B 4JQXC 1V7ML 5HHNB 4Y16A 3U4EA 1LEKB 2Q8AL 2Q7YA 3RQ3A 3QIUB 3O4OC 4FFWC 4F7MA 4RGOH 1M71A 5FAAA 4M6AA 5IKCB 1I3VA 3UC0L 5IF0A 3PXJA 4XVUD 4XP4H 3WS6A 2BJMH 4PGJA 4YDKH 5I1DA 5EU6E 5CEZD 3MRGB 5DHYB 5GZOD 3REVA 4RZCA 5DD0H 5DK2B 3HI5L 2APTA 4XMPH 1RHHA 4JHAL 5DWUH 4KRPC 2FJGB 4O00A 1J0IA 1MJUH 2AGJL 3K7UA 2IPTL 1F4XH 3L1OL 4U7KA 4AEEA 5C9JA 1DLFH 2XACC 5E8PB 4M7ZC 1ZE3C 4MJIE 3DUHA 2D2OA 4HGWA 4Y5YB 3TPKA 4GRWE 5C0DA 1I85A 2DTMH 2X4OA 3KPOA 4DWHA 3WDHA 2AV1B 3TYGH 3I6GB 2F54A 1KNOA 4QGYA 3RGVC 4A6YB 4YBHA 5C0BE 3W0WB 3OKKB 1OGAA 4L8CA 5DS8B 2DJ4A 1G7MA 4XVSH 2CDFB 3G6JF 3VRJA 4GKNB 1WUNT 1IGTB 4MA1C 1KLUA 3P4NB 2HRLA 5ITFB 4CMMA 4LIQH 1YDPA 1E0OB 4C4KO 4XVTL 3KR3H 4R96A 3GB7A 5DRWB 4I3SH 2ENYA 2WUBH 3NACH 1EO7A 4RMTA 3MUGA 5D93B 5DA4A 1ZWIA 5FDWA 2VZUA 4J3VA 1TXKA 1P4BL 3CFDA 3ULUC 1JGDB 1YEGH 35C8L 1YQVL 5IVXA 4DGVH 2OZ4H 5LAXA 1WVZA 3OAYK 4M02A 2YPKB 5CBAB 2HT3C 3ZE2E 1PYWA 9CGTA 2ZSWA 3HFMH 3JWOH 3ZKMC 1NSNL 5EULV 4BA8A 1QSFA 2OBGA 3CCHB 3FAXA 1WFOA 3ZE0E 4JM2C 5TPWH 1T7VA 5JNYA 4MXQC 4L5FH 3TZVA 5HYFA 4Y4HC 1Z9OA 2D03L 2VO5A 1PD6A 1ETZB 4GKSA 2EC8A 1U42A 2XNAA 4GH7B 4EJ1C 3W82A 2AP2A 4ETQA 3X12A 3ARGB 4MQ7A 3WKNA 3GMPB 4HPOL 4PJHE 3ZTJG 1IEHA 3KXFE 5IJVB 1CGWA 4P5KA 4F7PB 5ETUB 4OKDA 5I1CH 4HJ0D 1I9JL 5IUSA 3S96B 2APWA 2F19L 3MNZB 5IWLA 3SCMD 3UTPD 1IC4L 4POYA 3QCUL 4XTRC 3BP7A 3LRGA 4F37F 3ULUH 4YPJA 3U1SL 1BX2B 4OCMC 4GRWH 4OCXH 1QA9A 2DLIA 1H0DB 5CEYB 5EN2B 1WBZB 3U7AA 5K9QG 4LRIA 2VLME 3P0VL 5J13C 5CILL 5C0ND 1UM4H 2FX9L 2QL1A 1MHPL 3CUPB 1DVFD 1N26A 1VACA 3KDMA 1DBKH 2RB8A 4OGZA 1FRGL 5B39G 1CG9B 3U7WH 4OGAD 3LQZB 1QLRA 1MHEB 4ZUWB 3V4UL 3AS3A 4KV5E 1T0PB 3BN9D 4WFFD 3B2UC 3K4DA 5AWNH 3PWPE 4ZXBC 1YECL 5IBTL 1I1CA 1OAKL 2LTQB 1CICA 4U1NB 2YA2A 5I2IA 3VFMA 3EYQD 3DO7A 3NFNB 1MQKL 3VXPA 2XQYK 1FO0A 1GGTA 4PRDA 3WDIA 4K7PX 4HZAA 4P4KD 5B38G 1JZ3A 3AXLA 5F9WC 3MZGB 1NC2D 1X6NA 1HOCA 5HYSG 2EH7H 3C6SA 3SDDD 4UILL 5IT2L 4UV7L 2J88H 1DQDH 3T0WA 3NBNA 5CZXC 4IRSC 3QXTA 2IWGA 1UA6H 5F21B 1ZA6A 1Q0YL 3UYOD 4QRRD 1KV3A 1RK0A 4QRPB 2AXFA 1FSKC 5DEFA 4KKAC 3B9EA 3O9WD 4OM1H 3OKMB 1VGKA 5BVPL 4MA8H 4YHOL 3QXWA 2AEQH 1U0QA 3O6KL 1HSBA 3SGJC 1EUUA 1BFVH 2DDQH 3MRDA 2IPKA 2AEPH 1HCFX 1UWEH 4K3GA 4Y5XB 5HGHA 1YMMA 3T2NL 1IGJA 2AABL 2AXHA 5JMRA 1J86A 1NBVL 4HF5L 2F54E 4X6BB 3IDJB 3OR6A 5FYJE 4HDIA 1H3PH 3L3DB 4LLMB 3F62A 3ARZA 3CDCA 1OGAE 3IVKB 2V5SA 4JFED 3RU8L 4OI9A 1LEKA 5DQ9B 1IMHC 2BVTA 3B43A 3QIUA 2VXVH 4N8VG 3OKEB 1QYGH 5DRNB 3RL1B 5IKCA 2R9HD 1L0XA 4M3KB 4EN3C 4N0FA 4PY7B 2DMCA 2NY4D 2OI9C 5HDQL 1MIML 3MRGA 4WWID 4Q6IB 3BMWA 4K9EL 1JNLL 2VZ3A 5DK2A 2WBJB 1ZHNB 2AJ3B 4ZFOL 3NZHL 4K3DL 4AIXA 2Z31D 3DIFB 4F9PC 2D31B 3FN0L 4RISH 2JTDA 5IVXE 4X4XA 2P5EB 3ZHKA 2C3WA 2GJZA 3UDWA 5E8PA 1M7XA 5T5NG 3VWJA 3MLTA 5IVNA 3V2AR 1I1FB 2ADJB 5BMFL 5KVGH 2AV1A 3DUUB 3TN0C 3I6GA 4C83B 4M6NL 5K59E 3JWNC 4KTDH 4XAKE 3EYUL 3W0WA 4WW2B 2A6DB 3OKKA 1DQJB 1F13A 5DS8A 2KPNA 2Y1VA 3MV7E 2GTZB 4U2YA 2CDFA 2VLKB 5ALCH 1IGTA 2X05A 1EHLH 3MLVH 2XZQH 4JJ5A 1KB5B 5IBLC 1GVIA 2ED7A 1SYSB 2XI9A 1EA9C 1OTTD 3GNMH 4UV4H 1U58B 4UMGA 3BW9B 3D39B 2GK2A 4LU5L 2VB5A 4HCRA 4XB8A 2GHWB 1I9RL 5EFIB 1ZHBA 5E4EC 3K3QA 5HYJB 2R2BA 3JXAA 1C8PA 4RX4D 4ZO7A 4ALAL 2FYYB 5D7JC 3C8DA 2X9WA 1JGDA 4U3CA 3ARED 5F7EH 4JHZA 1MRCL 1JHLH 3DURB 2YPKA 4LFHG 5CBAA 4XNUL 3GJEB 4ZYKA 5CJQH 4LCYA 4G7VL 4YHYC 5KAQF 4M9OA 2E6JA 3HC3L 4LHUD 1EO8L 1GHFH 2DL9A 4Y7MA 4WU5B 3UTSA 3I9GL 1UCBH 4CN4A 3ARGA 1MHHB 3ALPA 4KTEH 3TV3H 1N0XH 4KROD 3CH1B 4KK6C 2E7LC 3QHFH 4M00A 5IJVA 5ETUA 3U0TA 4TPRL 4IOIB 1CGSL 5IWLC 3RJQB 3EFDL 2GUOB 3S96A 4P2QD 1MNUH 3MNZA 4G8IB 1E4XI 1AQKH 1QFWI 1A4KB 1B2WH 1NGXA 3BIBX 2A2QT 1WWCA 3VXRB 1VESA 3LKPB 3BPLB 5I9QC 2HJFB 4R7DB 4RGOL 5L2KB 1BX2A 3QUYC 1NGPH 5T1MB 1AGEB 4JM4H 4OUOA 4XP4L 5CEYA 2AKRB 4GMSH 2BJML 2JF1A 4FFWD 1H8NA 1WBZA 3TVMA 2BNQD 4JR9H 4YDLB 5DD0L 3CVIH 2DMKA 4PRIB 2X9YA 4XMPL 3Q5OA 2X7LB 3VGHA 1VADB 4NCC2 4PJGF 2IAND 5GPRA 2B4CC 1MJUL 1JPGB 2W9LA 1K4DA 2D4DA 1F4XL 5BXFA 1NUGA 1DUZA 1YMME 3DVIA 1DLFL 4KRPD 3KJ4C 1JGVH 1QKZH 1MHEA 4I0PB 2E9WA 4ZUWA 3SGKA 2F5AH 4PB9H 2DTML 5DMJB 1FL5B 1UACH 5BOPA 2BRQA 4MAUH 4MCYB 4U1NA 3TYGL 4Y8AA 2ADGA 4G8GD 4MJ6B 5IJKC 1FHGA 3I75B 1TITA 1HYSC 1MWAB 4ZFFB 1IZJA 4ODHH 4KKLC 4JFXB 3WS3B 2VL4A 1G0DA 5AEAA 5HHMB 4J3XA 3VXMD 2X1OA 3RGVD 4XVSL 4P9MH 5SV3A 2CKBA 4CNIB 2JB6B 3IFLH 3VA2C 3MXWH 5D96B 4JVWA 5HHXH 1PJ9A 4PRHB 1D9KB 4LIQL 4RMRA 3RPIA 4K23H 3EUUA 3OG4B 4QRPA 3MLPA 5I19H 5HHOE 3CVHH 3Q1SH 1IAIH 4I3SL 3RGHA 3OKMA 3EYOB 2WUBL 2ZPKH 3PWLA 4JDVB 4K3HA 3HLAA 5JPNB 3F7VB 1YEGL 4X8XA 4DGVL 2OZ4L 4Y5XA 1HQRB 2MHAB 2Y06H 2DN7A 5E94B 5HDLA 3RY4A 3EDJA 3HFML 3JWOL 1T1WB 4Z78B 2QTEA 3ARBB 4X7EC 2DQGL 2I07B 4X6BA 3IDJA 1FO0H 4POZC 5TPWL 3L3DA 4JKWA 4L5FL 3W0WE 1S9XA 5J89A 3ZKMD 1A6AB 4LLMA 3VH8B 2VDPH 5E9DE 3IVKA 4HBQA 1DBJH 2H8PB 4WWKA 4JM2D 4WUUD 4MXQD 5CZKA 2ZG2A 5DQ9A 1S78C 2GT9B 4LSRH 4Y4HD 1U9KA 1RV6X 4Z7VF 1CTNA 5DRNA 3RL1A 1ADQA 3T4AB 4PY7A 3GBMH 2OR9H 5I1CL 1YY8B 1XZ0B 2UZIH 4Q6IA 3WSQH 2WBJA 1ZHNA 2AJ3A 5KSAB 4OIIH 4PJCB 2VERN 1RUAH 5CBEB 3R1GH 4Y5YC 3DIFA 4NO0B 1QPPA 2D31A 3GSWA 4JRXB 2A6KB 1UKSA 1CBVH 3PGCB 3ULUL 3T1WA 4OCXL 2X4RB 1W8OA 1ZVYA 4P57B 4XTRD 2ILLA 2HKHH 3UTTE 1I1FA 4OZ4B 1JBJA 1EHAA 1I7RA 2E6PA 4G6FD 3MUY1 3DUUA 4ZDHB 4C83A 2HMIC 1UM4L 5DJDB 3EDDA 5KVEH 4ZFGH 4PJ7F 4WJ5A 4CW1B 3UTSE 5ID0B 2V9RA 4OFYA 1VB9A 2A6DA 1DBKL 4CVXA 3U7WL 1EO5A 2VLKA 1SJHB 2W1NA 1KB5A 5IW6B 1SYSA 5AWNL 1QNZH 1EUTA 3FN3A 3D39A 4GW1B 1LHZA 1KIUA 4FQXA 3BDYH 3KLDA 2IH3B 5EFIA 3B2UD 1WT5A 4W4OC 1TZIB 2VYRE 1YZZA 3KS0J 1J7VR 4J1UA 2FYYA 3SDXA 5ICZB 2FRGP 5TE4L 3QZWB 1U8KB 4J3UA 1KTDB 3F7RA 2J88L 1DQDL 5DQDH 3MRKB 4D8PA 4OF8A 1UA6L 3DURA 3E6HB 4HAGA 3TIEB 3HR6A 3NIGE 1N5AB 2VZTA 3JV6B 5D1ZC 3T65B 3GJEA 5FHAL 4A6YH 5CZXD 4IRSD 1HXYA 1HCVA 3C5SB 3EOAB 1KGCE 4OM1L 3GMQB 4P2RA 1EHXA 2P7TA 4LVOB 3OJ2C 4I4WB 1HILB 1HH9B 2AEQL 4LLYA 1R3HB 4WU5A 1BFVL 2DDQL 4O2CB 2AEPL 1UWEL 1MHHA 5CWSA 4XP5H 4HCRH 4HKBA 3E3QC 4NC1C 5JZ7C 1OLLA 1V5JA 4PRBB 2VDQH 3AC0A 2H2SC 2JB5H 1UB5B 3B83A 4IOIA 1ZK9A 2GUOA 4C55A 3MJ6A 2PTUA 1H3PL 3U6RA 4WI5A 3HNVH 3EAKA 4FQQB 4YHPB 4B41A 4G8IA 4MQSB 1A4KA 2B5IC 4JGJA 3VXRA 2I25N 3LKPA 2HJFA 4R7DA 5DUMH 2VXVL 2Y6SC 1QYGL 5T1MA 2IH1A 3WIIH 1AGEA 2EXYC 4NUGH 2AKRA 5TQ0H 1JFQL 2DIAA 3D2UB 1U36A 2FH6A 1U8QA 4EN3D 1XF2B 5GRWA 4LSSH 5GRVK 4PRIA 1DEEB 3VGBA 2X7LA 1J1XH 2ATKB 1VADA 2YD5A 3IAQA 4HWEH 2R4SH 1NFDF 2LAGB 4RISL 2EC9T 3SGKC 1NBQA 4I0PA 1NLDH 5CKAA 3CZJA 4WI8A 5IHBA 5CUSH 1FL5A 4DGYH 2PXYB 1LK2A 3U79A 2G5RA 5KVGL 4NWTH 1K4CB 1AGFB 4M5ZH 4R2GD 1J9CT 1U8PB 5LGJB 3I75A 4S1QH 4KTDL 1MWAA 4ZFFA 4JFXA 3WS3A 5JW5A 1FNHA 3TN0D 1LILA 4AEIH 4R7NB 3MXV