1A6LA

T14c mutant of azotobacter vinelandii fdi
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYCDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A T14C variant of Azotobacter vinelandii ferredoxin I undergoes facile [3Fe-4S]0 to [4Fe-4S]2+ conversion in vitro but not in vivo.
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport
molecule keywords FERREDOXIN
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1998-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1a6lA00
1Y5NB 5CHCB 1C4CA 1F5CA 1C4AA 1DFDA 1K0TA 1FRLA 3MMCA 1FDAA 1Y5LB 2C42A 1DAXA 2VKRA 2FJBB 2C3OA 1GT8A 2VPWB 2Y0SD 4L6V3 4ID8A 3IR5B 1Q16B 5BYQA 3GYXB 1BD6A 1H7XA 3MMBA 2FJDB 1BWEA 2PMZD 3MM9A 1FCAA 4YDDB 2IVFB 1JNRB 2FJEB 2UZAA 3PNIA 1GAOA 1H7WA 1PC4A 3MMAA 3MM6A 3MM5B 1FRXA 1FTCA 1BLUA 1WTFA 1JNZB 1SIZA 1FF2A 1AXQA 2C3UA 4AYBD 2XSJA 3MM7A 2FGOA 3MMBB 4KT0C 5L8RC 3MM8A 1FRMA 2FDNA 1H0HB 1G6BA 2VPYB 2FD2A 1B0VA 1BC6A 3EXYA 1SJ1A 3OR1A 2ZVSA 1F2GA 2V4JB 1SIWB 3MM7B 1KQGB 2WAQD 1CLFA 2VPXB 3OR2B 1KEKA 1VJWA 1BQXA 1IQZA 1KQFB 1FDNA 2XSJB 1IR0A 3EGWB 5E7OB 1FXDA 2WSCC 2C3MA 1FXRA 3LW5C 3EUNA 1B0PA 1PC5A 1FEHA 1G3OA 1FRHA 3MMAB 4XDCA 4OMFG 4XK8C 3MM5A 7FDRA 5FD1A 2WSEC 1HFEL 5BYRA 2VPZB 5BYSA 2V4JA 6FD1A 2PA8D 1FRKA 1Y5IB 3IR6B 1B0TA 2WSFC 2O01C 1FRJA 1XERA 1Y4ZB 3MM6B 4OV1A 1R27B 2WB1D 3MM8B 1F5BA 1D3WA 1JB0C 1RGVA 1FERA 3MM9B 4DHVA 1H98A 1ROFA 1DURA 2PDAA 3OR1B 5CH7B 4RKUC 2GMHA 1FRIA 3HKZD 3IR7B 2C3PA 3C8YA 2GMJA 6FDRA 2V2KA 3MMCB 3OR2A 1GTEA 1GTHA 1FDDA 1FDBA 4XDDA 4CI0B 2C3YA 2Z8QA 4Y28C 2FJAB 1A6LA 7FD1A 1FD2A
chains in the Genus database with same CATH superfamily
3Q8QB 2RU3A 1PIEA 4WPAA 4DSKA 1AUDA 1CS4B 1FE0A 1RHJB 1C4CA 3OXLA 3SDEA 1T0TV 3N01A 1HQUB 1LWFA 2POKA 3T9ZA 4K4WA 2HWIA 4C8ZA 2IA0A 1GXUA 1DQ8A 3R5CA 2Y9HA 4CH0S 2AP6A 4W4MA 2VPWB 3EYZA 2IFXA 1UKUA 4ID8A 4ERDA 5ADZA 3MR2A 4DLGA 5DM6Q 2NREA 4DL7A 2OIHA 3QYYA 3NGRA 5BYQA 1BD6A 2Q6BA 4X4NA 3I87A 2XO6A 2IDLA 5DETA 5L46A 2FJDB 2UUAF 1BWEA 5KT6A 3BH7B 1GEHA 1REVB 3MM9A 4JOUA 2MKCA 1S6PA 3TJ8A 4B9NA 3NNCA 2HHVA 4Z2XA 4K4UA 3TVYA 1VRUB 1KTQA 3PYGA 5L9NA 3MUMP 3HJVA 5H9FK 3OFFA 4ZDNA 3BGFA 2CQDA 1P9QC 1RWOB 1PC4A 2H4WB 3PM9A 2X1GA 1WWHA 4A8XA 3B78A 2YWHA 1SIZA 3G96A 1H6KX 3R6GB 1PAUB 3BGRB 2IJNA 4EK2A 4OJ1A 3OSNA 2DITA 4JV5F 1R3NA 2JL9A 3HHLB 2E5LJ 3LQVA 2MGZA 3JB9k 3CJKB 3TR5A 2CQ3A 4I69A 1NB7A 1FRMA 4B3TF 3M8SA 2WVFA 1NBEB 4KH0B 2AIRB 4CNZA 2RVJA 1FHTA 3MTKA 2RKIB 2W9CB 2K8GA 5KFYA 5IWAJ 4OLPA 5D4LA 3PKYA 5K14A 1SH2A 3UNYA 5KOXA 3DOKA 2VZ9A 4PPDA 2FVCA 5EHHA 4LR7A 3AJ1A 1F6TA 3GMGA 1VCTA 5EWFA 1FKPB 1IKVB 2JSXA 2JVOA 5ETLA 2VUGA 3OR2B 1WACA 4RJVA 4ALZA 5LMUJ 4DL6A 4TXSA 3KG0A 3TUIC 1S0NA 3TUJC 1EIYB 1K8AT 3EICA 2HK2A 5HL7Q 3FBBA 4K2XA 2BZ2A 2ZOFA 3SBMA 4TY8B 4LRFA 4RW7B 2XMMA 3I32A 2CQBA 2V69A 3Q0AA 4J9QA 2BQ3A 2VA2A 2KFNA 2PE8A 3LH2S 2BEFA 3CE8A 3JSYA 4O3NA 2K7KA 4CP5A 4E8UA 2EC2A 1MSWD 2ROPA 3O2IA 4QIGA 4DPXA 1WEZA 5BXIA 2N3OA 3IFEA 1WD6A 1KC8T 2B8PA 4X4QA 5F3ZA 3MECA 4QU7A 2ZBPA 3POTB 2A6MA 2EXUA 2OPRA 2HNYB 4TYAA 2CG4A 2XS7A 4ETXA 3OJUA 4USKA 3R5BA 1YQHA 2ZWOA 1ZETA 1T03B 1ZA1B 5EX3A 1VQNS 5F8HA 3OD2A 2VG7B 1L5UA 2R7XA 1YGYA 1RT3B 1VK8A 2NUHA 3R2DJ 2ZBCA 2VG6A 2MJUA 5MAOA 2HHHF 2VONA 2BUNA 3CJ0A 2HBRB 1HD0A 4NLXA 1K44A 1BQNB 4ED6A 1NDKA 2J76E 2MQLA 2ZZNA 4HACB 2GMHA 3HF5A 3HKZD 1JLCA 3RTVA 3E3XA 2HFOA 1M5VC 4DL0C 4FKXA 1RAHB 1WOPA 1RYSA 1K1SA 2IC3A 2HBYB 1EQMA 2C2MB 2HNDA 1U1OA 4ZPVR 1XNQJ 1F9FA 2ZEJA 2C2OB 2A1BA 2VQFF 3W3SA 5DQHA 2DNNA 4MTPA 1NAQA 3GZ7A 2KZMA 1OPIA 4M5LA 3MD1A 3M7VA 2FY8A 2HWTA 3UN2A 1NSPA 4RW8B 1WC5A 1FA0A 3MDFA 5HN0A 3C66A 4K5SA 3KLVA 2OUGA 2BDPA 4P7VA 4YDXA 4OX8A 1TAUA 4EBCA 4ES2A 1FKOB 2V34A 1B7YB 1P1TA 3QGIA 3N79A 3QLHA 4LSZB 3R9LA 3P96A 2W9BA 4HHUA 1F2HA 4ECWA 3TA1A 2R7OA 4WK1A 1F9HA 3DLKB 1U1NA 3IWXA 2VOPA 4JI1J 2CQ1A 1HWJA 5GVQA 1F60B 1WF0A 5IS2A 1S0OA 1SJFA 1LW0A 1DZ5A 2RRNA 4ILRA 4JV5J 2PEHA 5A6PA 2HS0A 5IZHA 3D6MB 1OSCA 4MAKA 2VFRA 3D68A 3GE9A 1FVSA 2CZVC 1GAOA 4O3SA 2AEMA 5HATA 2FLPA 1RI7A 5B0BA 4DR5J 4B3SJ 3G86A 4GKJF 3GIIA 4E98A 4M5HA 2XQCA 1O51A 2UUTA 3VZIA 3WDOA 3MR6A 1C1CB 3FGVA 4FYVB 1JJ2R 2HMIB 2XLJA 2CPIA 2UUAJ 4PQAA 5GAGI 3CCSS 3KLFA 3EMTA 5D0RA 1TKTB 1UWAA 3E51A 3SFGA 1UL3A 3KLIB 2B5JA 1Q5YA 3EDRB 5E3RA 4ZVFA 2DK2A 1FFWB 4LRCA 5F8GA 2YKOA 3OUYB 4DL5A 1N54B 4MT1A 4DUZF 2OLWA 4WFXA 2M8DB 2AJQA 4Z7YA 1LOUA 2CQ2A 3N28A 4Y34A 5JVGQ 2XMKA 5C25A 3ZZOA 2KFZA 1WC6A 1RWUA 1Q82T 3BV8A 3G8QA 3TZZA 2IM0A 4DV1F 3UFCX 1TK5A 4DF8A 4X4UA 3SCKE 1XR6A 4G6VB 3LPYA 4DX6A 2R4FA 1FFSB 1X9SA 2ZNYA 3AOCA 4AD6A 2JX2A 3CULA 2QMUB 3TAMB 4RUCA 4IOAQ 2LA4A 3RBEA 1NRKA 4OX7A 4ED7A 3RB4A 4P6QA 3BQ0A 5K14B 3EGWB 3C3LA 4OHXA 4DZ6A 1MMDA 1X4GA 4F0MA 2FJXA 1RWWB 5KG4A 1PC5A 2LQ9A 4O0IA 1YBUA 4LF5F 3PR5B 3Q8SB 1FKPA 3LOUA 4DJBA 1KP6A 1ELOA 3MEKA 5GAEU 1RYRA 4M63A 3DRPB 4UF4A 3VCDA 2CJ9A 3R2CJ 2AX0A 1LK7A 2FLNA 2LQBA 3PRVA 1T9WA 1YK9A 2LXIA 2ZNZA 1GH8A 2D74B 4ELUA 1U4BA 4ZIWA 1HBUA 4RW7A 2G0CA 4A8FA 1VQLS 1QTMA 1HHQA 3EVMA 3NLCA 1X9MA 2ZJRQ 5EUHA 2ACYA 4X65J 3ZXWA 1EHWA 4PG5A 4W98A 4XPEA 2DYAA 3L4BC 5C7PA 1ZAVA 1MWQA 2P9CA 1XWLA 4HDGA 4KHPJ 3JAMY 1LWEA 4DHVA 3ILIA 4DSEA 2J9EA 4KTQA 2BRKA 3ELHA 1LFPA 5CYQB 2CJAA 1XEZA 4L72B 3GSDA 5HMXA 1PCAA 5ETVA 4DWIA 1RLDA 1U1QA 2H9ZA 2XS5A 3EZOA 4PXCA 1IJEB 2DY1A 3C8YA 4UOCA 1HNWJ 3G6XA 1D09B 5DDRC 3UD3P 2VG7A 4RNFA 3OTCA 2E66A 3H5UA 4X4PA 1QAYA 2B0GA 1K9MT 3CW2C 3M05A 1RT1B 5DGBA 3EX7B 1IBLJ 4M94A 3CSKA 1UVLA 2MXYA 5LT5A 4NLVA 3CCLS 2E7XA 2K2PA 2J7KA 1RT5A 2MTLA 4WE1B 2FJAB 5IV3A 3K5LA 4K0KF 2RIJA 1IQTA 2A18A 3AXMA 3R7SB 1NDPA 5DGAA 1I1GA 4RU9A 3OT9A 4IRDA 3QSIA 3H2VE 4WXWA 1R0AB 1IXKA 1HI1A 2BJ8A 2CJQA 2IC3B 4LBHA 4LR9A 5J2PA 1YJUA 1IWGA 3I5AA 1WKLA 1YBTA 5CZVA 2ZH5A 5HMWA 3PJXA 5EGYA 3T6JA 3OL7A 1RP5A 2H51B 1YX2A 2AW0A 1VQYA 3IS9A 4X65F 3GIKA 4X64J 4I2PA 3BYRA 2QE5A 1X4CA 3CGIA 1HIYA 4ZVHA 1UA0A 1HWUA 1AYEA 2KJWA 4XIUA 3EPGA 4G65A 4DN9A 2CZ9A 2JC1A 2OEJA 3ZNJ1 1KSPA 4YHHJ 2NCKL 1G4CA 4Y00A 2X3GA 5KG5A 3KHHA 5AT1B 4IG3B 1YBAA 3TQEA 5J2MB 5L1KA 4H54A 2JOQA 1TR0A 4Q8EA 4DF4A 1NM2A 4CCHA 2HK3A 5CYMA 4DV0J 5HVGA 4HT7A 2HBQB 2CPYA 1CSJA 3DLKA 4OZ0A 3SQGB 4PCQA 3RU0A 2BJ7A 2ZBIA 3W9JA 3MCNA 4J9MA 1U45A 4NLGA 1WNEA 4J9VA 4C0BA 2I5JA 4E2FB 3D1HA 1S6OA 4XPCA 4TQRA 1NZAA 5KT5A 2JEGA 2W4CA 2YKMB 1R8CA 2MHNA 4Q0BB 2DXFA 2YPYA 4LF6F 1SV5A 4EO8A 3HI9A 2E1CA 2BE2A 2W7PA 3VAHA 3DOLB 1T8EA 2B7CB 2QSFA 2V8VA 4QPXA 1QUPA 4RW4B 2FDNA 1CJVA 3HFKA 3NAIA 4ZP7A 4DV1J 1E6VB 3W5YA 3PYEA 1FVQA 3TQ1A 1CULA 2ZOGA 3K7RA 5F8MA 2MMYA 4P52A 3PHTA 3TZYA 4LF8F 4YEAA 4DV4J 2IMWP 2PA3A 2Z2YB 4KB7A 3KLFB 2RRAA 3GCWP 1URNA 4I56A 1JXVA 3M8RA 5F0UA 2C1EB 2YWFA 3DRXA 3DRYA 2D3ZA 3MOJB 1DQ9A 2UVWA 1NJXA 2E9TA 3I9V9 3QAEA 1Q8LA 3G2XA 2L9DA 5KFRA 3VQSA 3I9ZA 1KFDA 2Z56B 3IRWP 5L1JA 4PWDA 2RF2B 2P5VA 2QL9B 2WCXA 3AB2B 4XTTA 3W66A 5C25B 3NMRA 3QWPA 4UZBA 2QGFB 2F4VF 3FSYA 5DDQC 1VQ8S 4LBIA 3DC2A 3D1QA 1B0PA 3R5DA 4LIRA 1FEHA 4K4TA 1FRHA 2QX0A 3GLJA 3MMAB 4NCGA 3QJPA 1U24A 1XN9A 4F4KA 2G1HA 5CD4H 1APSA 2WSEC 2AJ0A 8AT1B 5A2QU 1KFSA 1NH7A 4CYUB 4JI4F 3B4MA 1F3FA 2XWXA 2F8EX 1B0TA 4IDKA 1HBOB 4QBUA 2MQPA 2B4OA 4HI1A 4K7QA 1BXNA 1NK7A 5EWGA 2EFOA 1QE1A 3MR7A 3NL0A 4NWBA 1QD1A 4UUXA 3PW4A 2DNRA 4CZCA 3K8VA 4Q2MA 2E9RX 1JWWA 1FWLA 4OX9F 1JB0C 2KKHA 1ZM2A 3HHLD 3K5PA 4OZ2A 3J81U 4ED1A 1QSLA 5KT4A 5IC6B 1OJ4A 5G4DA 4KBIA 3WQPA 4AL6A 2XCAA 5DS7A 2C2DA 2QSWA 3PVXA 3L9ZA 2B9XA 3D2WA 4F4XA 1KLMB 1S0MA 1AUSL 2XNQA 1SQGA 2CRLA 3FC9A 4AXIA 2DBBA 2WVEA 3RB3A 3KUGA 4H4KC 4HDHA 3K57A 3UR0A 2CKWA 5KFQA 5B7WA 1FDDA 4X84A 3W1YC 3PY8A 3MHYA 2CDQA 2CNOB 2HGNA 4H4MB 4ANCA 5B0CA 5E0OA 1SJQA 5KFFA 3R5JB 2YWKA 2B43A 4BDPA 1E6YA 1CJUA 3H5YA 2DXDA 1FD2A 3QQCD 4FNHA 5H9FJ 4X64F 2PIIA 3WIVA 4RWWA 3GV8B 1IBMF 1U02A 3RGIA 2PMHA 2E1MC 2VD3A 4WP8A 5DQIA 1SXLA 1UMJA 2ILYA 1HNVB 2C3OA 5E3PA 2YX4A 4F0HA 2QN6B 3PX4A 2G0IA 1TMJA 2MSTA 2DXEA 1N0UA 2R7WA 1RADB 4F3MA 4NZ0A 4NRTA 3G82B 5HJXA 3D3CJ 2GIQA 3DU5A 2W8KA 2HFNA 1T9VA 4HTIA 3GYXB 4OJGA 1TL1B 4Y2MA 5KFDA 1MN9A 4YFUA 4USHA 2G4BA 4OYIA 5HJYA 4IFVA 4P2SA 2KG1A 5A8KA 1R0AA 4BBYA 2JJ4D 1M5SA 1RKIA 3NRBA 4OHWA 5J2PB 4X4OA 1JIHA 3AD9C 5LXYA 3NCPA 5B0GA 3HD2A 3UN3A 5AXNA 1SL2A 1JLGB 4B3MF 4EGLA 4LF7J 4QIWD 2YKNB 1ZZNA 1MW7A 1V3ZA 2C2ZB 4JI6F 2RD5C 3KJVA 4DR3F 1IWAA 4AL5A 2ASLA 4IKAA 1GMUA 4URSA 1U26A 2ROGA 3Q8PB 5L38A 2E9ZA 5ETSA 2FVRA 4ED4A 4NE9C 4AYBD 3PO5A 2XSJA 4IG3A 4DU7A 5CCMA 5I4MA 2AU0A 3V4MA 1VMBA 4JI5J 4U7UD 3JXOA 1SC1B 2BKNA 5DZ6A 3MR5A 3K59A 3V6DA 1U1MA 1RHRB 2GIFA 1WTBA 3MMBB 2XHCA 1TVRA 4R8UA 5D3GB 2KDOA 2QTWA 1I6JA 4DR7F 3IM9A 3WX4A 2FGCA 1TELA 2OGUA 2CJXB 2ACMA 1B0VA 1WEYA 3AFGA 3H0PA 1RAEB 4OYAA 1HWIA 3HHLC 3I0RA 3QO9A 4QR2A 5J2QB 3HPOA 3M8PA 3OR1A 3KJFB 4ES3A 2I38A 2JNJA 3KLGA 4FYWB 4ZN1A 2EFQA 4WZMA 3ZZZA 5KFOA 4X4TA 1J2VA 3SDEB 1RU1A 3CCQS 2MB0B 1Q78A 2J6TA 2UP1A 3CDAA 4IFYA 2LXFA 2ZKUA 4RLEA 1FXLA 1CJVB 1HLWA 1LFWA 1BQXA 2WOMA 4WCEQ 3T19A 1PYOB 2B9WA 1BMQB 2VH7A 4LSLA 4A46A 4JI7J 1YG0A 2JVRA 1IR0A 2BACA 3KLHB 3R5GA 2XY6A 3EVWA 3SCIE 2V67A 2HZCA 1RT7B 1MU2B 2J7UA 4PG7A 3J7Z5 2AT1B 3RAMA 2DH7A 5C2CA 2ADBA 3FDSA 1VC5A 4F8RA 2RHSB 2VKZG 4FVCA 2XCPA 2M8HA 1RAJA 3D6TB 3N9UC 4HLBA 4KYZA 5SUHA 1H2TZ 3U1NA 3T5JA 1UJ4A 1UFKA 1NPRA 2XBPA 3FMWA 3A3OB 2AF6A 2WB1D 3FBFA 2XHWA 2DEIA 3UDEA 2UXCJ 2PI5A 3ZZYA 3BGRA 4LF9J 2GHVC 2CJYB 3A8IA 2GV1A 3DXSX 3H2UB 2W7OA 1S0VA 3S7RA 1FJGF 2KYXA 2HG4A 3W64A 4EFAC 3ZZRA 4CYUA 2HEKA 3PEHA 2HHQA 4NXNJ 2QLJB 4IDKB 4ID5A 2W8LA 4O3OA 1U49A 2GC8A 2V2ZA 4OYWA 2Y8YA 3BF4A 3DYAA 2DIVA 3IBWA 2DGTA 2LU2A 4Y2KA 2W9CA 1Q0NA 1QSYA 4DQPA 1HARA 2AJ4A 2OPSA 3M6WA 1NNDA 3DOKB 3OHBA 3MXHP 3HHKA 2FVPA 3SXLA 1SUQB 1OS5A 3PYFA 3H59A 4R5PA 1V5VA 1A6LA 2KN4A 2MY8A 4ZVOB 4NMXA 1XMOJ 1Y5NB 1UW9A 2OJ3A 3TWZA 2JEIA 2GNKA 1Y00A 3RBDA 4QU6A 4DUTA 3GR0A 1HQ2A 1QTNB 3M6VA 3UDVA 5DDPC 5SZTA 1WI6A 1X0PA 2P9EA 4J9KA 4V19X 3MEEB 3PO4A 2BJEA 1NCLA 3C16B 2I1RA 2VFUA 4J9UE 4W92B 4ZMMA 2DH9A 1TK0A 3HHLA 3IR5B 1Q16B 1M1GA 1RLCL 3KFWX 2OPPB 3NGUA 3PIOQ 1TK8A 3G8SA 4UY85 1U1LA 2VA3A 3NMAA 3D0HE 2GCFA 2NUUG 2OPRB 3BGUA 4OJ3A 1T9YA 4PPZA 2BOAA 2GHWA 3B8HA 1UZDA 3GG1A 3D0GE 1IR2A 3MOZA 4UQTA 2XMVA 1PJ5A 4DV2F 1T03A 1IKXB 4UY8T 4WP9A 2I8EA 2XYPB 2OSQA 1H7WA 1R0BG 1WHWA 3AA9A 4QIVA 1YJVA 3CDBA 2V2QA 3P5TL 4YUDA 5LSRA 1UVMA 4DR6J 4NI2B 2G9OA 5J2NB 4FYDA 2V9WA 5J1EB 1L3KA 3LAKA 2C3UA 4IFVB 1FF2A 3UI3A 4Q8FA 4GVLA 2E1PA 2CVEA 2KU7A 1XC9A 2YWWA 1WI8A 2MKSA 2Z2LA 3NGSA 1L3VA 3FVYA 3CJ2A 3BDEA 2XGQA 1D9AA 2NXUA 1SKUB 5M2PA 2RS2A 4ZVUB 3UNGC 1IM4A 1XJWB 1NDLA 2BJ1A 4OYPA 2YKAA 4NYZA 4ZJQA 1NPKA 4KPCA 2MKIA 3C2PA 1U47A 2MQ8A 2A3JA 2F1FA 4LFBJ 2B3TB 1HNIB 2M52A 1SC4B 1R89A 4B3RJ 4CLUA 2DR9A 3K5NA 3THTA 2D7SA 2K1RA 3CJ5A 1Y0HA 5B0FA 3V6DB 3QPIA 2WAQD 1VBZA 2MY7A 2ROEA 3JTOA 3HJFA 4IH7A 4MKVA 4X2BA 3MGJA 4Y3CA 3UD5A 1N32F 4MIWA 1RWXB 3MEGA 4RZRA 3KJNB 4OYOA 1WHYA 5BR8F 1R0CB 2ILZA 4YB7A 2V4QA 4F4YA 4B3OA 3DLHA 4HACA 1RISA 4OQJA 4PABA 3KDNA 3M2VA 1RAAB 1JLCB 3EJMA 3FNNA 2RU9A 4OMFG 2Z57B 2VBXA 3PJWA 5DRKA 3G8TA 3V5RA 5CABA 5I3UB 2MKHA 2KJVA 3G4SS 2V4JA 5E3QA 3GV5B 2RDJA 1N52B 1KN6A 2X51A 2IRYA 3F0NA 1W2BR 4DV5J 4JYAJ 1FNMA 4XAKA 1NK5A 3P8BB 1VQPS 1PJ6A 1YSJA 2CPZA 2YNFA 3I0SA 2EFNA 4DZDA 2GJ2A 4OV1A 3KYLA 1P9YA 2ZJPQ 4TQSA 2XM3A 5H9EJ 3T6BA 3C46A 1C1CA 4HHHA 3RB6A 1GNKA 1SH3A 1ZM9A 4KKOB 3IWNC 2Y1RI 1ROFA 1SVDA 1EETB 1VBKA 4I64A 4PXDA 1DURA 2E29A 1FO1A 2RUSA 2B5JB 3D5MA 1RU2A 2ZUGA 4HR2A 1FRIA 2YQ3A 4ZP6A 1RT4A 3ZC4A 4ZP9A 3FEZA 1WF1A 4I4BA 3NNHA 2DGVA 1LWXA 2EI5A 2LVWA 5T7LB 2O66A 4NX9A 1S6QB 3M9OB 4DEZA 1GTHA 2ZD1A 3DRSA 2IPOB 1CQNA 3ISND 1LW0B 5C42A 2X1BA 3L7UA 2IMOA 4QWCA 2LFVA 2UXCF 1JKHA 1NUEA 1V6HA 3R7BB 4Y2AA 3SSQA 5CXTA 4W90B 1S6UA 2DGQA 2R7UA 2F8MA 3DU6A 4Y2IA 5HROB 3P6YC 1XIQA 2BABA 2XZTB 4U7UK 3TNVA 4ZLPA 1ZTTA 1PYTA 3RJMB 2XY5A 4YOEA 1C4AA 1YRTA 2CPFA 4TU8A 5L1IA 4FBUA 4DR4J 1L3TA 2HVHA 2B51A 3ZTQA 1FDAA 4J9SA 1VRQC 2ZM6J 1UVJA 2CUYA 1MMLA 2OPSB 2QLWA 2RS8A 2DHHA 2FZGB 2HVZA 2VFVA 4ITSA 4M5JA 3OHAA 4BS2A 3KUHA 3Q22A 2HIQA 4A8WA 5HVFA 3EWGA 4OI2A 2FB0A 4L6V3 1S4FA 4C8OA 1OY9A 4HVZA 3OVBA 1UVNA 1YJ7A 2FUG9 4ZVRB 5D4OA 4D3GA 1RT6B 4CRJA 3Q2SC 3KNAA 2X3DA 1BQMB 5D4PA 3R97A 3CF5Q 2VC1A 1FWKA 3VZHA 1EJ7L 1FCAA 4ZPDA 3HLUA 4JP8A 5KFTA 2ZZMA 2FJEB 1I51B 2RNEA 1HI8A 4Y0FA 1X4DA 4C2MA 4DV0F 1YZ7A 1VQ9S 3O3LA 1FFGB 2XMUA 3NCQA 1KDNA 3C19A 1LV5A 3NGTA 2MDAA 1IUJA 5AE1A 4DR5F 2DCLA 2DGSA 2OMLA 4N8NA 4DS4A 4P2XA 3NNAA 2RSQA 2IM1A 5FIIA 5IT9Y 2HURA 4HHJA 3TA2A 1WSRA 3HK2A 3U1LA 3J7ZT 3TVZA 2R8IA 2IM3A 4PUOA 3FK4A 2ZWPA 2FGOA 2I0XA 3M32A 2QA2A 3QT7A 4F2RA 3CCWA 3K58A 1HNZF 1WKJA 4ZK7M 3HM9A 2KYZA 2VPYB 2WK4A 2QA4S 4AE5A 3PW7A 3RAXA 4NLTA 4ZPWR 3MFHA 4OZ5A 3MAHA 2HQCA 3H4BA 2DTJA 4WFYA 4RNHA 1UWBA 3GYNA 3U02A 1FT8A 2DD8S 2EPIA 4DR3J 1SIWB 1JLAA 1VQOS 1U1PA 1PAEX 2QG9B 4JI0F 3CCZA 5G0RA 3IG1A 5GMKa 2PSZA 1BGXT 4NA1A 2QT7A 2JFKA 1KEKA 2ZH9A 1IBKF 1CPZA 2F9DA 1B99A 3GTYX 5B08A 5JMNA 1KHVA 5C5JA 5F8LA 2HBZB 3LP1A 3VAMA 3LTOA 1HNIA 3GIJA 5T41A 3TUPA 2H5EA 1XTZA 1MNEA 4OZ3A 4Z7CA 5KT2A 1GQEA 3JSRA 3DMJA 1M5KC 3BO2A 1WF2A 1T11A 5KG1A 2RH3A 3WX8A 1NJWA 1RWMB 4DV6F 2NZ4A 1VK3A 2XG8A 7FDRA 1X60A 3JS9A 2J6UA 1TKXB 1RCOB 4USTA 2QMWA 3LGNA 1NMEB 1HNZJ 3HO1A 2KXHA 1R8HA 1NSAA 2JLEA 4F67A 1ZTWA 3MI7X 1NDCA 1S76D 3SQGA 3V6JA 2DPJA 3MPDA 2UXDJ 3MF5A 2GS8A 1N36J 4EUVA 4DUYJ 1H2UX 4MK8A 3TJ9A 1C0TB 3V2UC 4CLZA 2HQIA 4Q0BA 4BC7A 2NS1B 4PR6A 2BE2B 5T14A 4HKQA 4FKYA 3E01B 5CH7B 3HFVA 2CQGA 1MROB 4X4SA 3QJJA 4CM0A 4TLRA 3IS9B 3Q8UA 3UVJA 2D1CA 3A3PB 4RBUA 5THWA 1E6VA 1GFWB 2N7YA 3P5BP 3ZTRA 1M1KT 3QRPA 2V8HA 1K0VA 2VODA 3RRHA 4RL1A 5E33A 3GFYA 3T5LA 3TARA 3OQ2A 4C3MA 4NZ6A 1SH0A 2HHSA 1RHMB 3CMAS 3LWLA 1SL1A 5B0AA 4KGVB 1N88A 3PX6A 2L41A 4PKDB 1TUGB 3CVKA 1SBRA 5CHCB 4YN3B 1YRUA 4DV2J 3D54A 3UDLA 2J8SA 1UEVA 3HT3A 1T05B 4JI4J 1K47A 3NOCA 5T7LA 3W2WB 4Q43A 3LPEA 3DRSB 1GK8A 3PJ9A 2QYGA 5C42B 1AFJA 1S1TA 5ETTA 2H5IB 2WONA 4QQBA 3P45B 1JKHB 5KT3A 1IR1A 3HFZB 4IYQA 1SV5B 1TUVA 2CYYA 2M9KA 2CQ0A 1VDHA 4DR2J 2Z2MA 1RBLA 1X5OA 1KD1T 1J5OA 1AZSA 5ETRA 3M8ZA 2PMZD 3R3TA 3V81B 3GFXA 2FLOA 1CULB 3FRZA 3BJYA 4CDIA 4BWMA 3CCMS 1Y9OA 3IN5A 4KGMA 2W4PA 4X62F 1YHQS 1S5ZA 4F04B 2LDIA 3MPVA 2DHGA 5C24B 2YNHB 2YTCA 1RUSA 1FRXA 4I0WA 1EB0A 1U09A 1WTFA 1XMQJ 1SC6A 2GVZA 4DCJB 4K59A 4Z37A 5HLFB 4E0DA 2KM8C 2CVIA 3F44A 2DNYA 2G2ZA 1TL7B 1U7LA 3R7NB 4NXNF 3OTOF 3BO3A 2YBVA 2FHJA 3FSXA 3VVUA 3MM8A 2HRUA 3L95X 4DOZA 1S97A 3CJTA 1MLAA 1IKYB 4PG4A 4IO9Q 2ASJA 1S99A 1N34J 2FIUA 1F2GA 1PBAA 4YR2A 4UW2A 1U6BA 1S4EA 2OAUA 2KB2A 1HL6A 4J91A 1R8AA 5A8WB 3I56S 1RT2A 4DQRA 1YJ9S 2DJWA 3KLEB 2Q6CA 3KK2B 1QE1B 2W2OP 1VJWA 4QIEA 3T1HF 2GW8A 3M6UA 1X4HA 4J7CA 1C0UA 4XO0A 3M8WA 1HYSA 1R8BA 4ZHRB 2J9DA 1SPBP 3TZXA 2NSCA 4DCOB 3FCHA 4RUHA 2D9PA 2UXDF 2UV8A 3SV3A 2LCWA 4EBDA 2WBRA 1SCJB 4FYXB 3DI6A 4WIQA 5G0RB 3DDNA 1F5AA 3MM5A 4USWA 2PC6A 3X1LB 5IT9U 3AAWB 3MEDB 3QT5A 5DG8A 1HFEL 5BYRA 2BR0A 1VQ5S 4U7CA 1JLGA 3BREA 1JLFA 3KNGA 4ZA1A 4ZKAA 4RNOA 2YKNA 2CJKA 5KG7A 3W9HA 2ALYB 3DMJB 1EKRA 2UUBF 1JLQB 4DS5A 3LP0A 2VHGA 1C1BB 1Q1KA 4WWSA 4U95A 1X8DA 3CO0P 4ICLB 2EFPA 1N5QA 1RGVA 1IBLF 4ED5A 2DO4A 3PXGa 1KBRA 2ZDOA 2HAIA 2HQGA 1T94A 1HWLA 2PFFB 1TV6B 3W5ZA 3SSSA 1EQ0A 3HDSA 4I6WA 3SSRA 3IR7B 3IO1A 4R8UB 2CPXA 2CPEA 4UQGA 4NA2A 4OIXA 2EKNA 2HZAA 1S1UA 4C48A 2H54B 2L9NA 2YH0A 3CJ4A 3BN4A 3UN5A 3FEXB 4TVAB 5KFMA 3FSIA 2FVSA 1UVIA 5J2QA 3I0RB 4N76A 1C0TA 3GV7B 2NXCA 4MKYA 1KTVA 4RW9B 4ZN3A 2HS3A 2QRRA 2XS2A 2VG5B 3CCTA 3CNQP 3LF0A 5A8KB 4DFMA 4LVNP 1RTIB 5LMUF 2LQJA 1QY7A 1R31A 3E01A 1HHSA 2LQ5A 3IAM9 5LOQA 4JI6J 3ONQA 2J7WA 1Q53A 3ENQA 1IM6A 4DV3J 5GADI 2IYIA 4GVBA 3UVJB 2J9DE 4MJKA 1NKEA 4M5KA 4TLQA 4MIBA 5HAOA 4AUKA 3BSNA 2EBGA 2J0XA 1SJRA 2ZHAA 2U1AA 4TYBA 4DX5A 2K3IA 1BUXA 2Y0SD 3ITHB 4QJVA 1LW2A 4JI0J 3LP2A 1MU2A 2QA4G 4F02A 1DHMA 4KC5A 4DG1B 2WVBA 2ASDA 2UUCJ 2HPUA 1H7XA 1FWPA 3MMBA 1CG2A 5HVHA 1PSDA 5KFJA 3EVOA 2SXLA 3QGGA 4CTAA 4EI2A 3S8SA 3MPYA 2WW8A 2GAGC 4F25A 2DNOA 3QO9B 2HZVA 3MCOA 2W2QP 3FUYA 4CO1A 2BE7D 2YNGA 4B9TA 1YIJS 2B6AB 1VC6A 4TKTA 3FRYA 2BM0A 1SKRA 2FC9A 2R8KA 4IFYB 4F3QA 2R9LA 3AA8A 3HVAA 3M8QA 2XWYA 3N6LA 3LWMA 2C22A 4IR1A 4ID5B 1B70B 3W65A 2LDYA 4WFZA 1KWMA 2AJ2A 1H0HB 1RT7A 5LSOA 1G2EA 3J7YU 1N34F 1G6BA 1R8PA 4LREA 2KFYA 2V8GA 4CLPA 1CJKB 2EBEA 3PYDA 1RTJA 2BRLA 3GYGA 3L3CA 4G3IA 4GKJJ 2AGPA 3MFIA 4N56A 2VQEJ 1QAXA 4GO5X 3DRRB 1H3DA 4NLSA 3KHGA 5KFSA 2N7CA 4J9NA 5HO4A 2DR6A 4ZPTR 1Z2LA 3KK3B 2ALZA 2DRBA 1IQZA 4ETZA 3IBCB 2OKQA 3KWMA 4U8YA 3T5KA 4B17A 3QT6A 3MEEA 3BR8A 1SB6A 2J0WA 4DUZJ 5LSLA 2YX7A 3DOMA 1I5OB 2BBEA 4AQYJ 3O5TB 4O4GB 2LEBA 5L9XA 4QCLA 3OV7A 2QFIA 4P10A 2I6WA 4D3HA 3H20A 1SL0A 5KFNA 1HYSB 2GO9A 4NL5A 2JC0A 3NCRA 3WIUA 4X66F 1TL4A 3NOGA 4ZHRA 2EEYA 3IR6B 4M95A 4B08A 3OJSA 2ZC3A 3DLLQ 1U0HA 3TW0A 4R5PB 5LJ5Y 4EYHB 3NP5A 5J2NA 3VAIA 4OYXA 1R27B 3VAJA 2XZWA 3M9NB 2ZH1A 2DR7A 3ZNUA 1M5OC 2DVIA 3LGHA 2VQFJ 1F5BA 3DI6B 1SJ3P 4NXMF 4ES1A 3FFIA 1REVA 3MM9B 2UU9F 2ZVIA 3MEDA 2RB7A 1X5TA 1VRUA 3QFWA 3T3FA 5ETOA 3H8YA 4KGZB 1DTQB 3OPKA 1XQIA 3QNWB 1HD1A 2ERRA 2APOA 1KQSR 1DJ0A 2W2PP 3MAAB 3BDPA 2LU1A 3LP0B 3PR4A 1W7WA 5JVHQ 1J5EJ 4C6AA 4ICLA 5D15A 5E3CA 2D3OR 3NEKA 4EMDA 2DO0A 5AXLA 4DR1F 2CAJA 2ZH2A 1RCXB 4FNIA 3OFHA 5EWEA 2RQMA 3Q8RB 5L1LA 1NKCA 3T1YJ 4NA3A 3TZWA 5AE2A 1DARA 2F65A 3GJQB 1VYAA 1NJYA 1IKXA 5BR8J 4J9PA 4RBTA 4ZPBA 1NK0A 1IJFB 2XSFA 2F63A 1RTHB 1PG5B 1VRTB 1KOHA 4YHHF 1NEEA 1RWVB 3OLAA 3H5SA 2VG5A 3HXMA 4QR1A 1DLOB 1FEEA 1LWCA 2ASYA 2RHQB 3JQMA 4ZVQB 1Q95G 3D4JA 6AT1B 4B3OB 2ZH4A 2DY9A 5LMNJ 1RACB 5LMNF 1Y10A 2UXBF 3K17A 2BQUA 1JLBA 3KDOA 2OH2A 4TU9A 1YWXA 2OD6A 4EBEA 4M1KA 5J1NA 2VV5A 2E5IA 5D0EA 1WG5A 2AEFA 1U25A 4ATNA 1RAOA 4DN0A 3T1YF 3LP2B 2VC0A 1I94J 2MZ1A 3L09A 3QATA 2HW3A 2JH3A 4IUFA 2HHTA 2B7BB 2LEAA 1WC4A 5J1PA 2VDHA 4FVMA 1Q79A 4PWWA 4CLFA 4OX9J 1VBXA 1GMVA 2A2DA 1EARA 1TTHB 5KFIA 3UWTA 2VOOA 4LIWA 4B3TJ 4FF2A 3MUVP 3AB4B 1HNWF 4PEOA 2WVCA 3LGMA 3MEGB 4ZLLA 3MM7A 3H2LA 4I6YA 3TANA 4FXDA 5F8NA 3D6FB 4QIFA 3A13A 4F0KA 1JLEB 1Z4UA 1ZZFA 4WYLA 2LKZA 2ZD1B 4DFKA 2B6AA 4PRFA 4OX6A 4IH6A 3P49B 1P8GA 2B4VA 2IAJA 2U2FA 3M8QB 3D1OA 2D3UA 4OI0A 2PMWA 2VB6A 2WB4A 3O1LA 3PV8A 2V4JB 4HI2A 3PDNA 3UW1A 5K8PA 3GIRA 4L3KA 1HKAA 1UAWA 1ZPVA 2GZOA 4PYDA 1I3OB 3DLGB 4OI6A 4OHVA 2I2YA 1VISA 1CLFA 4MFBA 2DRDA 1NHKL 5GAEI 3FBCA 3BBFA 2BM1A 4C11A 2HNDB 1KQFB 1P1LA 2W7AA 4RR5A 3W7BA 3G6VA 4KKOA 5DJBA 4P72A 3AQOA 3W8PA 3RRGA 2HFZA 3G87A 1EETA 4IG0B 4H4OB 5E7OB 2Q43A 5KT7A 2DGXA 2IRUA 1XMOF 1S72S 2ZH8A 3EDQB 5CQGA 3Q2TC 1B4SA 1UZHA 2RQ4A 4QPTA 3AD8C 2BW2A 3K8WA 2AYGA 3BKUA 3NWGA 2EFVA 4XK8C 2E44A 3S01A 3Q83A 4P2MA 5CA5A 3DM2B 2CQ4A 3JTNA 5HK4A 4ECZA 2R7VA 1S9GB 3M8YA 3QZ8A 2PA8D 4CO4A 1RABB 3FBEA 2R3VA 1VLOA 1X4FA 3OL8A 4KGKA 4J37A 1WHVA 2MZRA 5GAHU 4M5MA 5D6GA 3CJKA 3TUZC 2EG1A 3IGVA 3AOBA 3R1HA 2JLFA 4LF6J 4FF1A 1AFIA 4EU0A 2ZH3A 4NPOA 1S48A 4CLKA 1KNZA 4K8RA 3SQOP 2CFXA 3KXDA 5A2QY 4ZVGA 2JEJA 2HNZB 4PUOB 2EC0A 1CC8A 1T95A 1VIOA 3M32B 3CMES 3AHPA 4BC9A 3NGDA 4L3NA 2J6SA 4TN2A 4JV0A 2KHDA 2LQ8A 2VF3A 3DDKA 3PACA 3BSOA 3HSJA 2ATLA 5IXUA 4DL4A 3OR2A 4QWEA 3W61A 3C6UA 3J81Y 1BQMA 5M2RA 1EX8A 4RUAA 3BBCA 4DLEA 5ETMA 4JI8J 3OXGA 3VGVA 3N6MA 1UTAA 1IN0A 2RE1A 4LF7F 4CLLA 3J81j 3G9CA 3R6LB 4DV7J 3CDEA 3W2VB 3BGLA 3BPDA 2X7IA 3FCVA 1RQ0A 5E2QA 3DXBA 4C7QA 2K06A 3J80U 2VKRA 4DFJA 4JI7F 4JI3F 1Q7LB 1B7FA 3O8WA 3PHEA 2MPUA 2GQCA 1GT8A 4KJIA 3BBBA 4FYYB 3D28A 4YR3A 1EP4B 1FTRA 3PEJA 4PYAA 4JI1F 9RUBA 2HQFA 3QRQA 1PILA 2HYIB 1WKKA 2HFUA 4RUBA 2KT3A 2MKYA 3R1LA 3UCZP 5LXRA 2I9SA 1RTHA 3ENAA 4Y6IA 2IHR1 4DR7J 2NR0A 3DLEB 3SCJE 1X0FA 2HQDA 2XMTA 1DLOA 4LVOP 4J9OA 3PFOA 4USVA 1VIXA 1NXIA 2KTQA 2UZAA 1UWBB 1VQ7S 2Y0BB 1F1BB 1M5HA 3TOQA 1H74A 2KI2A 4DPTA 4X4RA 3EPIA 4JV1A 2HHUA 1VQMS 4NLDA 2CG8A 4WP3A 3IG1B 2BV3A 3M2UA 3K5MA 3OSPA 4V1Ak 2PO4A 3CC2S 2HVIA 2DT9A 3SZ2A 2BQRA 3ZZ0A 1OMSA 3TEHB 1TP7A 5U47A 1TL5A 2L9WA 3PKMA 2AV5A 2UXBJ 1PBUA 1M5PC 4GMKA 2O3DA 4O3RA 4KSEB 1D1UA 1T3OA 4LFBF 1ZS6A 2YWEA 2OEKA 1U6FA 2Q79A 3GB0A 3MUTP 2VFSA 4QWAA 4P71A 4LFAJ 2M7SA 2HGMA 1TKXA 3EXYA 1TKZA 2YH1A 1HR0J 3PW0A 4G1QB 1U8SA 1SQFA 2UUBJ 4UOGA 3MM7B 1KQGB 3QRRA 2F40A 3GG0A 2V2VA 2GIRA 3I55S 3QGHA 5HP1A 2HQ3A 5BJRA 2QC3A 4QOTA 3CJQA 3KHLA 4ECYA 1FDNA 4MH8A 3UD4P 3BZQA 3ICLA 2FPHX 4NYPA 5DG9A 4NLUA 4MYTA 5JJBA 1DRZA 1FXDA 2MJNA 3R8YA 2ADCA 5HBMA 4P7TA 4N47A 2DIUA 3BYPA 1MROA 2AHOB 4CH1A 3BN7A 5AXMA 1QVFR 2LMIA 2AYEA 1JQGA 1A0OB 5LJ3Y 4DSLA 4LMZA 4PQUB 3CB4A 4F2SA 1U2FA 3T1HJ 1KR4A 2DNPA 2AJFE 2HMIA 1HBMA 1RWNB 2GGPB 5D0GA 4DR4F 3MPWA 3BGOP 4HH1A 2R7TA 4H4OA 1V3SA 1ZOTA 5F9LA 3K89A 2W1BA 3HZGA 4LR8A 1TU0B 2HIYA 3N4WA 1KVJA 3I5BA 3IBFB 3CD7A 1Q8BA 3GR1A 4IR9A 4ANEA 1WOOA 4LT6A 1EKSA 2DGWA 3W2WA 3W62A 4F7VA 5J2MA 4L75A 4B9VA 3QAUA 1S9GA 2B56A 3GWCA 1ZH5A 1TL7A 2JWNA 4KIAA 3A1YG 2OPQB 4RKUC 1HPZA 2DNMA 4QWDA 1VJQA 4ECQA 1X9WA 1N5VA 2C3PA 3ULHA 1S12A 6FDRA 2J0QD 1RZMA 4USIA 4C8MA 2I5JB 3GP9A 5DM7Q 4FXWA 1J5OB 3GJSB 3TAMA 4TY9A 1TMMA 4M5NA 3T1AA 3SIPB 3J7YI 3KUEA 4OL8A 4M5DB 4JI2F 3V81A 2C3YA 5K20B 3JYTB 5KFAA 2KXFA 3IMQJ 5A8WA 1NK4A 2WBMA 1TQLA 1OSDA 2RRBA 2VQEF 4DV5F 1U8WA 1S79A 2VBWA 1RHKB 1SKSA 4NRUA 2YNHA 3FKBA 4DDFA 4K4XA 4LF4F 2C42A 4OJHA 1DAXA 2GX8A 2MQMA 3C6UB 5KG2A 5AJ3F 3H42A 3A3NB 2XO7A 4GC7A 3V6KA 2G13A 2GAHC 2H4YB 5GMDA 5E41A 8ATCB 2GVZB 4WU3A 4C3LA 1QAIA 3JSMB 2FQQB 2AD9A 5KOWA 5HLFA 4WZQA 1JXEA 5KFHA 1D0EA 2N4DA 4A47A 2WZ1A 2PN6A 3LAMA 4OZNA 3CWJA 4AL7A 2F7VA 3BSCA 4CO2A 4PWDB 1M1HA 1N32J 2VBZA 1RSCA 2IA6A 2K3KA 2N82B 1XNQF 2FHOB 2HHPA 2MEWA 3ETOA 4FXVA 3KLEA 4O44B 4F26A 1YJNS 3E2EA 2W24A 4ED8A 1URRA 5CCLA 4ZJLA 1NJZA 1VLYA 1N4LA 2WTFA 4V19J 4UZCA 4KE5A 5F41A 5IM0B 3MMAA 4ZCIA 2B9EA 1U0SA 2MLZA 4M5IA 1R6YA 3G6ES 3RZAA 4QW9A 1B3TA 3D7SB 4FF4A 2HHHJ 5F0WA 5I3PA 3CIZA 5HMYA 1T02A 1QJHA 2CPHA 1IBKJ 4USUA 1H38A 3DLEA 5LM7E 4WE1A 1Q8IA 2R7QA 1CJTA 3C6TB 4OI3A 5GAGU 1S1UB 2R8GA 2YNIB 2XMWA 5KFZA 1VR6A 2MZTA 4ZCLA 2CADA 2BYCA 4U8VA 3CCUS 3CCVS 1XNRF 2QIFA 4K4VA 2G2YA 4Q5VA 1AT1B 1FJCA 4U67Q 2V5HG 1JK9B 3JQKA 2ZH7A 2EW9A 1RTIA 2V63A 4NEYA 4DFPA 3VALA 1SJ1A 2HVEA 3BO4A 2BMBA 4DR6F 2P2CB 3PRBA 2GVDA 2LLZA 2FHJD 5E3AA 1KLMA 3PRDA 1MN7A 1LKZA 3GONA 4LUBA 4I2PB 5IOLA 3MTJA 2JHEA 1C1BA 4P73A 4H4MA 2ZHBA 1FKAF 2Z4PA 2V8DA 3TX0A 4G1IA 1CJUB 4MIAA 4QW8A 1FXRA 5KFUA 4WFBQ 2VJVA 2GMLA 2MQNA 5CYMB 5H9EK 2E7VA 4C8YA 2W2NP 4ZVTB 2DPIA 3TAPA 5B0EA 5HP1B 3EGZA 4OHYA 1VHFA 2NZCA 2M2BA 1SI9A 2CPJA 3M2RA 3QT8A 1HNVA 4F4AA 2DISA 1UCNA 4HH0A 4A8SA 1RAIB 3LUYA 2YKMA 4ER8A 3M1VA 1QUVA 5KFGA 3S6EA 4ELTA 2O01C 2QLXA 1FRJA 3FJ2A 5HBMB 1YTYA 2E5LF 2MZJA 2XYGB 3DGPA 2NQPA 4BHQA 3RBZA 4QWBA 2ZKTA 4GVBB 1RE1B 5HQLA 4DQIA 1HW9A 2M88A 2ZHOA 1AB8A 4C3KA 4ECTA 4C9DA 4PQUA 1B64A 3P3DA 3NS7B 4I1TA 3VVTA 4C98A 3RW6A 3SMZA 2BX6A 4K50A 3C15B 3BR9A 2XI2A 2PT0A 3KJVB 1LW2B 1UETA 2QA1A 4LF2A 1XR7A 2MYFA 3NS5A 4URGA 1FE4A 3RW7A 4ENOA 1PYSB 2EWHA 2G2OA 3MMCB 3ADAC 4G1PA 4DG1A 3D3BJ 1HMVA 2BW7A 1Y3JA 4LF9F 2PI4A 1RB0A 2DB1A 2P8IA 2Z8QA 5M2UA 4NYOA 2NLWA 3CIMA 3OVSA 1N5YB 1ITPA 1VHIA 4EZ9A 9ATCB 1OY8A 1S59A 2KHCA 3D66A 4DPUA 2R2SA 3BEGB 1F5CA 4DMZA 4IQMA 3U27A 1DFDA 1K0TA 2XULA 2P6TA 3DGVA 4IQXA 3L7OA 1L3UA 2DR5A 2FJBB 1ZPWX 2H3EB 3DOMB 3IA0A 4M5DA 2UVRA 1WC3A 3V4IA 1RAFB 5ETQA 4A8MP 4TNOA 4OLOA 1HBOA 2CA9A 4YR0A 1VQ4S 1OY6A 3B6BA 4HT5A 2IJRA 2XY7A 3KTQA 1WHXA 2WOMB 3DLBA 4ECXA 5DO2A 2Z2ZA 1XMQF 4YS2A 3B4DA 1S10A 1F3VA 4WIIA 1HI0P 3THVA 3KLHA 4ZITA 2VICA 1RAGB 2JEFA 4EZ6A 1CJKA 2B4UA 3TYTA 3GIMA 1N8RT 2QFJA 3PNIA 1R43A 4WKRA 3DRRA 3PCOB 4NLYA 4BWJA 3MM6A 1WG4A 1N33J 2JZ5A 4PAAA 4N8OA 1P27B 1T7PA 1S9EB 1UJ5A 2IIHA 2MLYA 3CT9A 5KFCA 2O1PA 2V6AA 4U9RA 4Q44A 4KHMA 2F3JA 2C2NA 1Y11A 5EDWA 2DNQA 2GQ2A 1X5PA 3AH6A 2Q1LA 1S1XA 2KL8A 4FP9A 1HA1A 4LSNB 4NLPA 4O44A 1OQ3A 4FPRA 1UPPA 2FC8A 2CQPA 3M30B 1E6YB 3MAAA 5F8IA 4R0EA 1O6XA 4JI5F 1TZ0A 5IQQA 2EVZA 3EGVA 2GJFA 2FD2A 2EKYA 1S49A 2CNKB 4LF8J 2DHSA 3Q8YA 4BLGA 1BC6A 3DHXA 4PG6A 1C2PA 4C8NA 1GMWD 2ZVSA 1GX6A 3KHRA 1TKDA 5EN1A 3CJ8A 1XR5A 2MKKA 1DY3A 1RA6A 2NSBA 2R2UA 3DYAB 4ZS6A 1U0HB 5KFBA 3OL6A 4DSJA 4K2JA 1UW4A 3M9MB 4ECSA 3Q23A 2VL1A 4C8LA 3QBCA 4FDFA 1LWCB 2RILA 3G6YA 1FNXH 1RTDB 4FPIA 4RW6B 5ITHA 1SC3B 5CZXA 4S0MA 3BH6B 3FZBA 2GVDB 2JDJA 5HANA 4F4WA 1I94F 4WF9Q 1DTQA 1REGX 5K8NA 3M6XA 3K2YA 3OTBA 4CIOA 3MD3A 2UUWA 1NB2A 3TEGA 4FS2A 4I7FA 1U2CA 3IGNA 2KRBA 4EWTA 4KFBA 3TVKA 2ZBQA 5HSPA 2BJDA 5BYSA 3HVTA 2RJZA 6FD1A 1YZ6A 2DGOA 1U6ZA 2EFGA 3ZTSA 3KMSA 1UA1A 4LFCJ 4RNNA 2QLBB 2KG0A 2LP4A 2G1DA 4M8LA 2OPPA 4L76A 3U1MA 2VIHA 2LEPA 2KZZA 4L73A 5KG6A 1BWVA 2HLUA 1WOSA 5D3GA 2BJ3A 2F9JA 2HGLA 1D3WA 1CC7A 5D78A 1BY9A 4Y65A 1VRTA 4O3QA 4CO3A 2O5DA 3IP0A 2XNRA 1WELA 2KVQE 2L3MA 3M8PB 3OR1B 3KLGB 3ZZPA 2CZ4A 3G71S 1JLEA 2B8QA 1GX5A 2IBKA 3BM7A 3UE2A 1NK6A 3GU0A 3VQTA 4Q2LA 3HD1A 5ETPA 4NI2A 1UPMB 3CDUA 3DGPB 2IAJB 4GKKF 4KV8B 4WTYA 2YX1A 1J5EF 3NBPA 4XDDA 3KK1A 1GXLA 4I2QB 1VC0A 1O5JA 2A0FB 2NXEA 3HVWA 3D9BA 1S77D 2GJIA 3DLGA 3HT0A 4A48A 2YKQA 4PWUA 4MFBB 2Y3YA 7AT1B 2W4DA 1S1WB 4P74A 2C2KB 2CNLB 2PEBA 2QL5B 2V94A 2PFDA 3D67A 1IKWA 3MMCA 1N33F 3WZ0A 3O6QA 4HL9A 2UU9J 4JI3J 1SJ4P 1WG1A 3TAQA 2BOPA 4P75A 2D9OA 3NY0A 2K1RB 4MYUA 5F9NA 1N5YA 3EGNA 3VWSA 3R27A 2BJ9A 1N6QA 4C4WA 1T3NA 4L74A 4RPFA 4U96A 5KG0A 3N0VA 1MWYA 1UFWA 2O67A 2F4VJ 4UTGA 4FF3A 2V8PA 4LQ9A 3DM2A 3BB5A 3UO0A 4QZVB 3SV4A 2RQKA 2CIMA 3CD5A 4CLSA 3ZTOA 2KH9A 1D9FA 1NH8A 3W63A 4UOFA 3V4IB 1U1RA 1WDDA 4ILLA 2YVSA 4LRBA 1CS4A 4IO1A 1DTTB 2AWZA 4JUZA 4DPYA 4LRDA 1DBDA 5KFPA 1HQUA 1LWFB 2QO3A 2XYHB 2UVVA 2Q66A 3PW2A 1VQSA 1R6VA 4DV4F 4IOBA 5DLGA 1FTCA 2M5YA 1TL3B 4I68A 1JNZB 1ICEB 4KRWA 5F3TA 4C11B 4P2FA 4K4ZA 2HNZA 5GAHI 3VTIA 4HEA9 3QIPA 4ED3A 2H5JB 3CUNA 3CEDA 3FQLA 1SUQA 5D77A 4OV6A 2NYHA 4IG0A 1QM9A 2MKJA 2YNFB 3I0SB 3ISZA 1KQKA 4KT0C 1V9OA 2LA6A 3JQJA 3WHIA 4YB5A 2DCUB 2QJ3A 2N3LA 1MWZA 5K5MA 2VJUA 1N5SA 2QMXA 3MMJA 3AT1B 5FDLB 1Z2ZA 1G1XA 3CJ3A 2H1YA 2N4CA 4LSNA 3OL9A 3TX8A 2CQCA 1CBKA 1S1XB 3IRXB 1RT4B 2GO8A 3C16A 3TA0A 2DR8A 1NK8A 2ZE2B 3PX0A 1BE4A 2UV8G 4DPOA 2IM2A 8RUCA 1S6QA 2EK1A 3I4PA 4K4SA 2ZOMA 3ZTPA 2VBYA 1S7IA 5ETNA 4TU7A 4QYRA 2QV6A 3CCES 4B3SF 5KTQA 4DUYF 4ZP8A 1S9FA 3F56A 1X31C 3IC1A 1P6TA 3DN9A 4PXEA 1OYDA 2FVQA 1RDRA 4XDCA 2DKOB 2X1AA 5CYJA 4C0HA 5MLCV 4H4KA 4JI2J 1ZM3A 2HVDA 5FD1A 4R0JA 2OFHX 5K9FA 4DCPB 5J1EA 1UEKA 2C2EA 4KAIA 1L3SA 1AW0A 2KM8B 1NO8A 1VOMA 5A76A 1RTDA 1FNOA 1X4BA 1O8BA 1AA1B 2WSFC 4OZ1A 3AODA 2L48A 3AQPA 4JYAF 4X62J 3LA0A 4DQQA 2FJWA 5IFMA 1RT6A 2E1AA 3QMQA 3SFUA 4ANDA 3ILOA 2BANB 5DDOC 4N5SA 2F4FA 4K0KJ 4OFZA 3W2VA 1WDTA 3OTDA 4K5RA 4YY3J 3GQCA 1XNRJ 1WC1A 3J80Y 3RR8A 1H98A 1PO6A 4IRCA 1WEXA 2IJFA 3ZZUA 2M70A 2PDAA 3B82A 3HVTB 3AJ2A 5D4NA 2GFFA 1FK9A 4DR2F 5A8RA 4A8YA 4JV2A 1EP4A 2HS4A 2P6SA 2YQ0A 2MGZB 2AQ4A 4ZPCA 3A12A 5KFLA 4DXLA 2OEMA 2Z30B 3W60A 1U1KA 1RHQB 4OZJA 1GTEA 2OP5A 2ZITA 1S1VB 3HZEA 2A6OA 3MECB 1LQ9A 3GFZA 4J90A 1HNXF 2ZUAA 1TKZB 2RKIA 4KGXB 3FCWA 4AT1B 4CI0B 3CXCR 4Q7AA 1D9DA 3NS6A 2FJVA 5KFXA 3EXCX 4ZCMA 1FJ7A 3DLJA 1NSQA 3GPAA 7FD1A 2C2RA 1K73T 5KFEA 2IYGA 1RT3A 1FJEB 3OBIA 1HQEB 1N56A 4B3RF 3M2VB 2ZFHA 2UVUA 1OQ6A 1Y5LB 5A6WA 1KONA 2AJ1A 4KV8A 3VGSA 1CEZA 1OPZA 2P9GA 3BSAA 3M2UB 4RWXA 4ECVA 4HYKA 5I3UA 2HKEA 1D8YA 5D8HB 4NZ7A 3ETMA 3VHQA 2YXLA 3OFEA 1JLAB 1W2IA 1X5SA 3FQKA 4NLWA 5D0HA 4NCBA 1YJTA 1HR0F 4QYZJ 1KRPA 4DR1J 4PG8A 2C28A 2RAQA 3TP2A 2B9YA 1HBMB 5I3QA 1IKWB 4HTJA 3W9IA 1HHTP 4LFAF 1FESA 3WC0A 5B09A 3DFEA 3KG4A 3VAKA 2XTJP 1JNRB 1X4EA 4RW8A 4CO0A 3C14A 3HCXA 3KKFA 3OFGA 3POTA 4F3OA 4OI4A 4G1QA 1N6QB 4LFCF 2KT5A 1W26A 2DGUA 3U7JA 4WYWA 4LJMA 4NOHA 2V4RA 1FKOA 3Q8VA 3QLHB 1BLUA 2DNKA 1FX4A 1S7HA 1RJJA 2OD4A 4J5OA 2ZM6F 3TRGA 4FBTA 4OYMA 2BVZA 2VG6B 3ISNC 4DV6J 4ED2A 4NXMJ 2BKOA 2HAFA 2BA9A 2PD1A 3T9NA 3F41A 5HQMA 2LECA 2EG2A 4DSIA 3KMQA 5IV4A 5HROA 1CQMA 2M0GB 4AFFA 3ILJA 2IVMA 5L8RC 5KAKA 2RMLA 3AY0A 3HMJG 3CTRA 4KPYA 5IWAF 4MMOA 4ZVSB 2KVIA 1NZ8A 1ZM4A 2NYIA 3JYTA 3HVRA 4IOCQ 1RHUB 1NU4A 1Q4RA 3HSZA 3BPSP 2J0SD 3QIPB 2GGPA 5K8MA 1X4AA 2Z0GA 2CWXA 3GFHA 5IT0A 1FX2A 3PZPA 2QYCA 2DNGA 4MKAA 2VPXB 3TJAA 4MK7A 2GQQA 2OSRA 1ZA2B 3MPUB 2XEXA 3DCAA 4DX7A 2Q3PA 2DH8A 2F8HA 3N6NA 3K5OA 4WBFA 1F0XA 2NPIA 3CCJS 1M90T 2EK6A 4NLOA 3JSMA 1ZYQA 3RB0A 3OUYA 3IRXA 5IT4A 5DZ7A 2DNHA 3DDIA 3HHDA 2WHOA 2OPQA 3KJQB 1HPZB 5CD4A 5AE3A 5DLFA 3S1TA 2YY3A 3ET6A 4Y2CA 1FJGJ 1JMTA 3PTWA 2V68A 4F50A 1NJIT 5DG7A 1S1TB 4YB6A 4F36A 1TUWA 3GJTB 4A8OA 1Q81T 3BQ1A 4R25A 4BCAA 3OW2R 1FRKA 1NHUA 2PGCA 3N5FA 5IM0A 2AZ1A 4QR0A 3CDWA 1XERA 4YP3A 3GJRB 2BKPA 2H48B 4CT8A 1AZSB 1NHVA 4LRAA 3L7PA 2WRMA 4OZLA 5HQ8A 1U2RA 4YMEA 2MHEA 2V0NA 4JB8B 4ZLJA 3F73A 1FERA 3I31A 2R8HA 3UR3C 3HP6A 4OYBA 4CO5A 4EEYA 2K7JA 4F4ZA 1BHNA 1YJWS 2CDRB 3NG8A 4B9MA 1TKTA 4EO6A 2GMJA 4ZJOA 1N5TA 2V2KA 3KLIA 3V6HA 1G7CB 2AX1A 3B54A 4NLQA 5KFVA 2BANA 3O44A 3H4DA 1T9TA 1VQKS 2ZZTA 1HBUB 3LP1B 3DKDA 1KVKA 2GHPA 3NWRA 3QSYB 3TI0A 2OHDA 3FMBA 4DSFA 1FK9B 5A8RB 5LL6d 4DQSA 1ULRA 3RG6A 1Q8KA 3MR3A 4EYIB 2MLXA 1RKJA 2MZSA 4M5GA 1SQEA 2G0JA 3T41A 2FHKA 3NGKA 5K8OA 1NKBA 4IRKA 1IKYA 2FHMA 2ZBRA 1XMBA 3JSBA 1EZZB 1S1VA 5IC4B 4DL2A 5CYQA 3SI8A 3D6HB 1ZAXA 2L08A 3MZIA 3UDCA 2HRTA 1XBWA 2XZDB 3WBZA 1KVIA 3RUBL 4FZVA 4DV3F 3PIPQ 4N7TA 1RT2B 2MQQA 3C6TA 2Z58B 1CJTB 3H40A 4ZIVA 4IH5A 2AEJA 3KK2A 2YNIA 1TAQA 2XMAA 1HQEA 1LNQA 1PJ7A 1RK8A 1RT1A 2A10A 4ZLNA 2YWGA 5KFKA 3HSDA 2YQ1A 3HSGA 1HNXJ 4CNYA 2J9CA 3DRPA 1RT5B 4NEZA 2IVFB 1JX4A 5L39A 3IXQA 1PKUA 5F8JA 3RAQA 1RBAA 4B3MJ 2W9AA 2E1RA 2JLGA 3CJSA 3IM8A 3RR7A 5HMZA 3DNCA 2E5JA 3CJRA 1YRXA 4URQU 3CCRS 4ECUA 1NLKL 3MM5B 5I42A 4ILMA 3BKFA 3IWLA 1YLXA 3Q24A 2VU5A 3PFEA 3HKWA 2Y1JA 3OLBA 1J27A 1FD8A 1W25A 1AXQA 4KO0B 2R2RA 4GKKJ 5FJ4A 1LWEB 3W5XA 1JLFB 2DEJA 1Y3KA 3N5BA 4OHZA 2XLIA 3AOAA 3T5HA 1X7VA 3US5A 4B02A 4DU8A 3RBXA 3HHNB 3Q86A 3C14B 3VR1A 4B9LA 3H25A 1KOOA 2AKWB 2R42A 4WU2A 1QLNA 2KT2A 4X4VA 2D41A 4O0NA 1HMVB 2DNLA 1YITS 1ZBTA 2RUGA 2BXJA 3NAHA 4LF1A 3THPA 1T05A 4ED0A 3KOAA 3AJDA 1JJHA 4ELVA 1WSVA 5GADU 2CNNB 2F5GA 2AZ3A 3TO8A 2HHXA 3M2RB 3UCUP 1TV6A 3BKTA 3H7HB 2WONB 3WC2A 4I6AA 1GXTA 1F9EB 4WFNQ 3M1VB 3RYLA 1VS3A 4MKBA 2Y8WA 2E5GA 4UOHA 4A8KA 3ENWA 3SCLE 4CT9A 2QZ8A 4JI8F 4I67A 3P4UB 2HWHA 2KXNB 2ZDPA 2ZC4A 4USMA 2OMOA 4ECRA 2IRXA 4N77A 3CMQA 4RW9A 4PZVA 1VGYA 2AYMA 4ZVPB 4AXJA 4WFAQ 1OO0B 2JRSA 3M4XA 4WXOA 4OI1A 3DOLA 1AROP 2HRYA 4NLRA 4ZCKA 4RX6A 3I6PA 4YDDB 4UT4A 5FLXY 2DHAA 2R7RA 3W8GA 4K4YA 2E5HA 3RRKA 4PXBA 3Q89A 3C15A 1YKWA 4JBCA 4ZVEA 2AGOA 3MCMA 2OTJS 3I96A 5C24A 1S57A 1JXLA 1UVKA 2LYVA 1GMWA 4KR0B 4RU2A 2W01A 5A0YA 4MK9A 4RNMA 2RQCA 4FN5A 1PGZA 3J7AN 3EZ5A 2XI3A 2VPZB 1JJCB 1H2VZ 2AYBA 3QIDA 4NASA 3ITHA 2X1FA 2Y1LB 3ZFVA 1T9UA 3GSIA 3OTOJ 1CVJA 2YPZA 3HULA 1R7IA 1HBNB 1KLNA 2FLLA 1RBOB 1XK8A 3FZ2A 2B4PA 3JTPA 3MM6B 4UUWA 2NXJA 3MM8B 2HFSA 2KRRA 2MZQA 3ET6B 4GRSA 4CTAB 3K0JA 2R2TA 5HI7A 3HHEA 1HW8A 3VF0B 4DX8H 2Y1IA 2ZJQQ 2MSSA 2HLTA 1VQ6S 3M30A 2GA7A 5IQ6A 3CD6S 3QFHA 2QL7B 3I5CA 4A8QA 3DHWC 2YNGB 5ETKA 5JXSA 3UPFA 4LBPA 5GMEA 2NPFA 3BS9A 2AMCB 3EE3A 3SYZA 4NCAA 1U48A 1Q5VA 4RW4A 4WKYA 2D69A 5AJ3J 3NKYA 4LF4J 3UCGA 2W2MP 4RBVA 1C0UB 3AXKA 2J5AA 4B9UA 3VV2B 2CXEA 2NXNA 3SEOA 1V3RA 2WVDA 1NPPA 2CJBA 2OO4A 2CQIA 2V9KA 2XGPA 4QYZK 4C8KA 1JJ4A 3PW5A 1LXNA 3R5AA 4AQYF 2VDIA 1RTZA 2M3DA 1FRLA 3MWBA 5H1SV 1S6PB 1VI7A 3MCSA 1S9EA 4RW6A 2RF2A 4GC6A 1RTJB 1YVFA 4KH1B 3VAFA 1KHWA 5C2GA 1T9XA 3I4HX 5DQGA 3FEYB 1Q7YT 4B9SA 1UEUA 1N0VC 2KO1A 3EM1A 3ZZTA 4GO7X 1JLQA 1H73A 4I7FB 4O3PA 1KS2A 1NSKL 1WJ9A 1Z1ZA 4NCGB 2H65B 5AXKA 2ZH6A 2RDDA 1ZAWA 2XLKA 3JAMU 2DHXA 3QZ7A 2V50A 4N41A 1O0PA 1RWPB 3H98A 2DNZA 2M4MA 3LALA 5EX0A 4O23A 2MQOA 4O4GA 1Y7PA 5JUMA 4CQ1A 1SKWA 2FY1A 1DQAA 1LEOA 2BE9B 2ATCB 2OELA 1TFWA 3A8JA 2DRAA 1RXOB 4O4RA 1TFYA 3OVAA 3QGPA 2COLA 3VGTA 1IBMJ 4YQWA 2RT3A 4CWBA 4OYZA 2CPDA 3A8KA 2R8JA 3BQ2A 1N36F 4KQZA 1RWKB 1UP1A 2W25A 4DPWA 1IKVA 1MG7A 1WORA 4WTOB 1D8ZA 1OYEA 2A2CA 4DI6A 3UQSA 5I42B 3FFIB 3HX9A 3KG1A 1VFJA 1NK9A 4J9LA 4FS1A 1H72C 4I2QA 4KO0A 4USJC 4KFBB 1IBCB 3IAS9 4TY8A 2HSEB 2HHWA 3MURP 4P9SA 2UUCF 1A9NB 4KHRA 2J8AA 4DL3A 3A4TA 3CPWR 4CM2A 3ILLA 4ZOSA 5CAAA 1V5IB 3GCXP 1FI4A 3QWUA 1LK5A 5KFWA 2IVYA 4KY3A 2FZCB 2CWKA 4Q45A 1OIAA 2JFDA 2XSJB 4A4JA 2D3O1 2OFGX 4WK3A 3GILA 3VAGA 2QEXS 2HNYA 3VGUA 1MMNA 2XC9A 2WSCC 1N48A 2C3MA 3LW5C 1OWXA 1M0SA 4CLWA 3MAQA 3ZO7A 3CC7S 3EUNA 2CQHA 4J9RA 2VASA 4LQ3A 3J7A1 3G82A 1IVZA 1G3OA 1KKHA 2HFVA 4CLYA 2E7WA 3I82A 1TL1A 3LANA 1VBYA 3H5XA 3D0IE 2IY5B 1QVGR 4C0OC 4KHPF 1YJRA 2LXUA 1Q86T 1BQNA 1UFLA 1Y5IB 3NBPB 3KK1B 4DV7F 1DTTA 2ABYA 1Y4ZB 1QAJA 1WUUA 1JLBB 2XB2D 3H90A 4X66J 4YB1P 3CO9A 3A8EA 1TL3A 3EZUA 1S1WA 3AD7C 3NXZA 2YKPA 4LSLB 5KG3A 5A0YB 4WJBA 1YDLA 4YY3F 3PG9A 4LF5J 2FYXA 3E8OA 2XMJA 3OTEA 1HWKA 4NMLA 5B0DA 1YI2S 5E5NA 1EAYC 1HBNA 2FZKB 1QSSA 2RDIA 2WW4A 2IBOA 3LO3A 4ZPAA 1A7GE 2FTRA 4DBQA 1QDUB 2IDEA 1K1QA 1TVRB 4C97A 5FDLA 5FLXU 2VFTA 3CD0A 3KK3A 2AGQA 4CLTA 2OI2A 3OXFA 1FDBA 2W9BB 4CH7A 2QLFB 4RO0A 3X3UA 5RUBA 3CC4S 1UJ6A 3ENVA 2OTLS 2R7SA 4Y28C 4U6PA 1ACMB 2ZE2A 1RA7A 3QJLA 1LXJA 1WC0A
chains in the Genus database with same CATH topology
3Q8QB 2RU3A 4DSKA 1AUDA 1FE0A 3OXLA 1C4CA 3SDEA 3N01A 1HQUB 1LWFA 2POKA 3T9ZA 4K4WA 2HWIA 4C8ZA 2IA0A 1GXUA 1DQ8A 3R5CA 4CH0S 2AP6A 2VPWB 3EYZA 2IFXA 1UKUA 4ID8A 4ERDA 5ADZA 3MR2A 4DLGA 5DM6Q 2NREA 4DL7A 2OIHA 3QYYA 5BYQA 4X4NA 1BD6A 2Q6BA 3I87A 5DETA 2UUAF 2FJDB 1BWEA 5KT6A 1REVB 3MM9A 4JOUA 2MKCA 1S6PA 3NNCA 4B9NA 2HHVA 4Z2XA 4K4UA 3TVYA 1VRUB 1KTQA 5L9NA 3MUMP 3OFFA 4ZDNA 3BGFA 2CQDA 1P9QC 1PC4A 3PM9A 2X1GA 1WWHA 4A8XA 3B78A 2YWHA 1SIZA 3G96A 1H6KX 3BGRB 2IJNA 4OJ1A 3OSNA 2DITA 4JV5F 1R3NA 2JL9A 3HHLB 3LQVA 2MGZA 3JB9k 3CJKB 3TR5A 2CQ3A 4I69A 1NB7A 1FRMA 4B3TF 3M8SA 4CNZA 1FHTA 2RVJA 3MTKA 2RKIB 2W9CB 2K8GA 5KFYA 4OLPA 5D4LA 3PKYA 5K14A 1SH2A 5KOXA 3DOKA 2VZ9A 4PPDA 2FVCA 5EHHA 3AJ1A 3GMGA 5EWFA 1FKPB 1IKVB 2JSXA 2JVOA 4DL6A 2VUGA 3OR2B 1WACA 4ALZA 4TXSA 3KG0A 3TUIC 1S0NA 3TUJC 1K8AT 5HL7Q 4K2XA 2BZ2A 2ZOFA 2HHXA 4TY8B 4RW7B 3Q0AA 2XMMA 3I32A 2CQBA 4J9QA 2VA2A 2KFNA 2BQ3A 2PE8A 3LH2S 3CE8A 3JSYA 4O3NA 4E8UA 2K7KA 1MSWD 2ROPA 3O2IA 4QIGA 1WEZA 2N3OA 3IFEA 1WD6A 1KC8T 4X4QA 3MECA 4QU7A 3POTB 2OPRA 4TYAA 2HNYB 2CG4A 2XS7A 4ETXA 3OJUA 3R5BA 1YQHA 1ZETA 1T03B 5EX3A 1VQNS 5F8HA 2VG7B 1L5UA 2R7XA 1YGYA 1RT3B 1VK8A 2NUHA 2ZBCA 2VG6A 2MJUA 5MAOA 2HHHF 2VONA 2BUNA 3CJ0A 1HD0A 4NLXA 1BQNB 4ED6A 2J76E 2MQLA 2ZZNA 2GMHA 3HF5A 3HKZD 1JLCA 3RTVA 3E3XA 2HFOA 1M5VC 4DL0C 1RYSA 1K1SA 2IC3A 2HNDA 4ZPVR 1F9FA 3W3SA 2A1BA 2VQFF 5DQHA 2DNNA 4MTPA 1NAQA 3GZ7A 2KZMA 1OPIA 3MD1A 2HWTA 4RW8B 5HN0A 1FA0A 3MDFA 3C66A 4K5SA 3KLVA 2BDPA 4P7VA 4YDXA 4OX8A 1TAUA 4EBCA 4ES2A 1FKOB 3QLHA 1P1TA 1XNRF 3QGIA 3N79A 2W9BA 3P96A 4ECWA 3TA1A 2R7OA 4WK1A 1U1NA 3DLKB 3IWXA 2VOPA 2CQ1A 1HWJA 5GVQA 1F60B 1WF0A 5IS2A 1S0OA 1SJFA 1LW0A 1DZ5A 2RRNA 4ILRA 2PEHA 5A6PA 2HS0A 5IZHA 1OSCA 4MAKA 2VFRA 3GE9A 1FVSA 2CZVC 1GAOA 4O3SA 2FLPA 1RI7A 5B0BA 3G86A 4GKJF 3GIIA 4E98A 1O51A 2UUTA 3VZIA 3WDOA 3MR6A 1C1CB 3FGVA 1JJ2R 2HMIB 2XLJA 2CPIA 4PQAA 5GAGI 3CCSS 3KLFA 1TKTB 3E51A 3SFGA 1UL3A 3KLIB 2B5JA 4ZVFA 5F8GA 5E3RA 3OUYB 2DK2A 4DL5A 1U1OA 3PY8A 2YKOA 1FJCA 1N54B 2M8DB 4DUZF 2OLWA 4WFXA 2AJQA 1LOUA 2CQ2A 3N28A 4Y34A 5JVGQ 2XMKA 5C25A 3ZZOA 2KFZA 1RWUA 1Q82T 3G8QA 4DV1F 2IM0A 3UFCX 1TK5A 4DF8A 4X4UA 3SCKE 1XR6A 4G6VB 3LPYA 2R4FA 1X9SA 2ZNYA 2JX2A 3CULA 3TAMB 4RUCA 4IOAQ 2LA4A 3RBEA 1NRKA 4OX7A 4ED7A 3RB4A 4P6QA 3BQ0A 5K14B 3EGWB 3C3LA 4OHXA 1MMDA 1X4GA 2FJXA 5KG4A 1PC5A 2LQ9A 4O0IA 4LF5F 3PR5B 3Q8SB 1FKPA 3LOUA 4DJBA 1ELOA 3MEKA 5GAEU 1RYRA 4M63A 3DRPB 3VCDA 2CJ9A 2AX0A 1LK7A 2FLNA 2LQBA 1GH8A 2LXIA 2ZNZA 2D74B 4ELUA 1U4BA 4A8FA 1HBUA 4RW7A 2G0CA 1VQLS 1QTMA 1X9MA 3NLCA 2ZJRQ 5EUHA 2ACYA 4PG5A 4XPEA 1ZAVA 2P9CA 1XWLA 4HDGA 3JAMY 1LWEA 4DHVA 4DSEA 2J9EA 4KTQA 2BRKA 1LFPA 5CYQB 2CJAA 1XEZA 4L72B 3GSDA 5HMXA 4DWIA 2XS5A 1U1QA 2H9ZA 4PXCA 1IJEB 3C8YA 4UOCA 3G6XA 5DDRC 3UD3P 2VG7A 4RNFA 3OTCA 2E66A 3H5UA 4X4PA 1QAYA 2B0GA 1K9MT 3M05A 4M94A 1RT1B 5DGBA 3EX7B 1UVLA 3CSKA 2MXYA 5LT5A 4NLVA 3CCLS 2E7XA 2K2PA 2J7KA 1RT5A 4WE1B 4K0KF 2FJAB 3K5LA 2RIJA 1IQTA 2A18A 5DGAA 1I1GA 4RU9A 4IRDA 3H2VE 4WXWA 1R0AB 1IXKA 1HI1A 2CJQA 2IC3B 5J2PA 3CMES 1YJUA 3I5AA 5CZVA 2ZH5A 5HMWA 3PJXA 5EGYA 3T6JA 3OL7A 1RP5A 2AW0A 3IS9A 4X65F 1VQYA 3GIKA 1UA0A 4I2PA 3CGIA 2QE5A 1X4CA 4ZVHA 1HWUA 2KJWA 4XIUA 3EPGA 4DN9A 2JC1A 1KSPA 4Y00A 2X3GA 5KG5A 3KHHA 4IG3B 1YBAA 5J2MB 5L1KA 4H54A 2JOQA 1TR0A 4Q8EA 4DF4A 4CCHA 5CYMA 4HT7A 3DLKA 2CPYA 1CSJA 4OZ0A 3SQGB 4PCQA 3RU0A 1WNEA 2ZBIA 4J9MA 4NLGA 1U45A 4C0BA 2I5JA 3D1HA 1S6OA 4XPCA 4TQRA 1NZAA 5KT5A 2JEGA 2W4CA 2YKMB 1R8CA 2MHNA 4Q0BB 4LF6F 1SV5A 4EO8A 3HI9A 2E1CA 2BE2A 2W7PA 3VAHA 3DOLB 1T8EA 2B7CB 2QSFA 2V8VA 4QPXA 1QUPA 4RW4B 2FDNA 3HFKA 3NAIA 4ZP7A 1E6VB 1FVQA 2ZOGA 5F8MA 3K7RA 2MMYA 4YEAA 2IMWP 2PA3A 4KB7A 3KLFB 2RRAA 1URNA 4I56A 3M8RA 5F0UA 2YWFA 3DRYA 3DRXA 3MOJB 2D3ZA 1DQ9A 2UVWA 1NJXA 3I9V9 3QAEA 1Q8LA 2L9DA 5KFRA 3VQSA 3I9ZA 1KFDA 3IRWP 5L1JA 4PWDA 2RF2B 2P5VA 2WCXA 5C25B 3AB2B 3QWPA 2F4VF 3FSYA 5DDQC 1VQ8S 3DC2A 3D1QA 1B0PA 3R5DA 4LIRA 1FEHA 1FRHA 3MMAB 4NCGA 3QJPA 1U24A 1XN9A 4F4KA 5CD4H 1APSA 2WSEC 2AJ0A 1KFSA 1NH7A 4JI4F 3B4MA 2XWXA 2F8EX 1B0TA 4IDKA 1HBOB 4QBUA 2MQPA 2B4OA 4HI1A 1NK7A 3NL0A 5EWGA 2EFOA 1QE1A 4NWBA 4UUXA 3PW4A 2DNRA 4CZCA 3K8VA 4Q2MA 2E9RX 1JWWA 4OX9F 4ED1A 1JB0C 2KKHA 1ZM2A 3HHLD 3K5PA 1QSLA 5KT4A 5G4DA 4KBIA 2C2DA 4AL6A 2XCAA 5DS7A 2QSWA 3PVXA 2J6SA 2B9XA 3D2WA 4F4XA 1KLMB 1S0MA 2XNQA 2CRLA 4AXIA 2DBBA 3RB3A 4H4KC 4HDHA 3K57A 3UR0A 2CKWA 5KFQA 5B7WA 1FDDA 4X84A 3MHYA 2CDQA 2HGNA 5B0CA 4H4MB 5E0OA 1SJQA 5KFFA 2YWKA 2B43A 4BDPA 1E6YA 3H5YA 4FNHA 1FD2A 5H9FJ 4X64F 2PIIA 4RWWA 3GV8B 1IBMF 2PMHA 2E1MC 2VD3A 5DQIA 1SXLA 1UMJA 2ILYA 1HNVB 2C3OA 5E3PA 2YX4A 3PX4A 2MSTA 1N0UA 2R7WA 4F3MA 4NZ0A 4NRTA 2GIQA 3DU5A 2W8KA 2HFNA 4HTIA 3GYXB 4OJGA 1TL1B 4Y2MA 5KFDA 4YFUA 4USHA 2G4BA 4IFVA 4P2SA 2KG1A 5A8KA 1R0AA 4BBYA 2JJ4D 1M5SA 1RKIA 3NRBA 4OHWA 5J2PB 4X4OA 1JIHA 5LXYA 3NCPA 5AXNA 1SL2A 1JLGB 4B3MF 4EGLA 4QIWD 2YKNB 1ZZNA 1MW7A 1V3ZA 3KJVA 4JI6F 2RD5C 4DR3F 4AL5A 2ASLA 4IKAA 4URSA 1U26A 2ROGA 3Q8PB 5L38A 2E9ZA 2FVRA 4AYBD 3PO5A 2XSJA 4IG3A 5CCMA 5I4MA 2AU0A 3V4MA 1VMBA 3MR5A 3K59A 3V6DA 1U1MA 1WTBA 3MMBB 4R8UA 1TVRA 5D3GB 2KDOA 1I6JA 4DR7F 3WX4A 5F3ZA 2FGCA 5B0GA 1B0VA 1WEYA 2NQPA 5J2QB 1HWIA 3HHLC 3I0RA 3QO9A 4QR2A 3HPOA 3M8PA 3OR1A 4ES3A 3KLGA 2I38A 4WZMA 2EFQA 3ZZZA 5KFOA 4X4TA 1J2VA 3SDEB 3CCQS 2MB0B 1Q78A 2J6TA 2UP1A 3CDAA 4IFYA 2LXFA 2ZKUA 4RLEA 1FXLA 1LFWA 1BQXA 2WOMA 4WCEQ 3T19A 2B9WA 4A46A 2VH7A 4LSLA 1YG0A 2JVRA 1IR0A 2BACA 3KLHB 2XY6A 3SCIE 2HZCA 1RT7B 1MU2B 2J7UA 4PG7A 3J7Z5 3RAMA 2DH7A 2ADBA 3FDSA 1VC5A 2VKZG 4FVCA 2XCPA 2M8HA 1RAJA 4HLBA 3N9UC 3U1NA 5SUHA 3T5JA 1H2TZ 1UJ4A 2XBPA 3FMWA 2AF6A 2WB1D 2XHWA 2PI5A 3ZZYA 3BGRA 2GHVC 1S0VA 2GV1A 3DXSX 3H2UB 2W7OA 3S7RA 1FJGF 2KYXA 2HG4A 4EFAC 3ZZRA 3PEHA 2HHQA 4IDKB 4ID5A 2W8LA 4O3OA 1U49A 2GC8A 3BF4A 3DYAA 2DIVA 3IBWA 2DGTA 2LU2A 4Y2KA 2W9CA 1QSYA 4DQPA 1HARA 2AJ4A 2OPSA 3M6WA 1NNDA 3DOKB 3OHBA 3MXHP 3HHKA 2FVPA 3SXLA 1SUQB 1OS5A 3H59A 4R5PA 1A6LA 2MY8A 2KN4A 1Y5NB 2OJ3A 2JEIA 2GNKA 1Y00A 3RBDA 4QU6A 3GR0A 3M6VA 5DDPC 5SZTA 1WI6A 1X0PA 2P9EA 4J9KA 4V19X 3MEEB 3PO4A 2BJEA 4W92B 2I1RA 2VFUA 4ZMMA 2DH9A 1TK0A 3HHLA 3IR5B 1Q16B 1TK8A 3KFWX 2OPPB 4UY85 3PIOQ 3G8SA 1U1LA 2VA3A 3NMAA 3D0HE 2GCFA 2NUUG 2OPRB 3BGUA 4OJ3A 4PPZA 5D4OA 2GHWA 3GG1A 3B8HA 4UQTA 3MOZA 3D0GE 2XMVA 4DV2F 1T03A 1IKXB 4UY8T 2I8EA 3AA9A 2OSQA 1H7WA 1WHWA 4QIVA 4ZPAA 4YUDA 1YJVA 3CDBA 3P5TL 5LSRA 1UVMA 4FYDA 2G9OA 5J2NB 2V9WA 5J1EB 1L3KA 3LAKA 2C3UA 4IFVB 1FF2A 3UI3A 4Q8FA 2CVEA 2KU7A 1XC9A 1WI8A 2MKSA 2Z2LA 1L3VA 3FVYA 3CJ2A 3BDEA 2XGQA 1D9AA 2NXUA 5M2PA 2RS2A 3UNGC 1IM4A 2MKIA 4K4TA 2YKAA 4NYZA 3C2PA 1U47A 2A3JA 2F1FA 2B3TB 1HNIB 2M52A 1R89A 2DR9A 3K5NA 3THTA 2D7SA 2K1RA 3CJ5A 1Y0HA 5B0FA 3V6DB 3QPIA 2WAQD 1VBZA 2MY7A 2ROEA 3JTOA 3HJFA 4IH7A 4X2BA 3MGJA 4Y3CA 1N32F 4MIWA 3MEGA 4RZRA 5BR8F 1WHYA 2ILZA 4YB7A 2V4QA 4F4YA 4B3OA 3DLHA 1RISA 4OQJA 3M2VA 1JLCB 4OMFG 3FNNA 2RU9A 2VBXA 3PJWA 5DRKA 3G8TA 3V5RA 5I3UB 2MKHA 2KJVA 3G4SS 2V4JA 5E3QA 3GV5B 2RDJA 1N52B 1KN6A 2X51A 2IRYA 1W2BR 1FNMA 4XAKA 1NK5A 1VQPS 4DL4A 1YSJA 2CPZA 2YNFA 3I0SA 2EFNA 3KYLA 2GJ2A 4OV1A 3TQ1A 1S77D 3C46A 4TQSA 5H9EJ 3T6BA 1C1CA 3RB6A 1GNKA 1SH3A 1ZM9A 4KKOB 3IWNC 2Y1RI 1ROFA 4I64A 1EETB 4PXDA 1DURA 2E29A 1FO1A 2B5JB 3D5MA 2ZUGA 1FRIA 2YQ3A 4ZP6A 1RT4A 3ZC4A 4ZP9A 3FEZA 1WF1A 4I4BA 3NNHA 2DGVA 2EI5A 2LVWA 5T7LB 2O66A 4NX9A 1S6QB 3M9OB 4DEZA 1GTHA 2ZD1A 3DRSA 3ISND 1CQNA 5C42A 1LW0B 2X1BA 2IMOA 4QWCA 2UXCF 1JKHA 1V6HA 4Y2AA 3SSQA 5CXTA 4W90B 1S6UA 2DGQA 2R7UA 2F8MA 3DU6A 4Y2IA 5HROB 3P6YC 2BABA 4U7UK 3TNVA 4ZLPA 1ZTTA 2XY5A