1A6PA

Engineering of a misfolded form of cd2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
94
structure length
94
Chain Sequence
b'GTVWGALGHGINLNIPNFQMTDDIDEVRWERGSTLVAEFKRKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILDKALDLRILE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-CELL SURFACE ANTIGEN CD2
publication title Engineering an intertwined form of CD2 for stability and assembly.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion
total genus 7
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a6pA00
1A6TB 5F6IB 1OTTC 4QOKB 3T77B 5DFVC 4BA8A 4G6ML 3F7QA 4NKOB 3MA7B 3S36H 4CJ1A 5CEZL 3JWNC 4NWUH 1GGBL 4PS4H 1HKLH 4DQOL 4IDLA 1CGSH 4XPAH 4G6JH 5AZ2H 4DW2L 3QR2A 2ESVB 2JJVA 4MNGE 4ZFOA 4ZPVA 1EEYA 5I16A 2A6DA 3ULSA 5FB8B 5EUOB 5C3TA 1NUFA 1WZ1L 4U49A 3DETD 3UO1H 2Z4QA 2XG4A 2A1WL 1H5BB 4ZXBA 1U8NA 1YMMB 2FL5B 5FGBC 2QTEA 5CD5C 3FAWA 4ZAKB 3QCVL 2IAMA 3P4LA 5MENE 1CFVH 1VADA 4U3XA 5IB4A 5IKCA 2W0FA 1GGUA 5L6YL 4JHWH 4NYLB 2B1HH 2I07B 2GJZB 4OQ1A 3GK8H 4XX1G 4YDKL 3L3KB 4R6UA 4F7EA 1LO0L 1ZS8A 4DN3H 1X5JA 5C6PB 3ZSSA 1YN7A 1KCKA 5JOEA 1BPVA 1OF2B 4JRYA 4FMFA 4L29A 2R4RL 2HLAA 1SEQH 5JIPA 3CC5A 4KPHH 3ISWA 2HRPH 3QNYA 4YXHH 5E08L 1OLZA 5FXCH 3B9KC 4JJHA 4RFNC 5AYUH 2ZCKL 4K7FA 2VDLH 5TGBA 2ED7A 3TNMB 2DLHA 2NY0B 1QSEE 4KTEL 5F9WB 3ULVF 1OAXH 1MI5B 1C7SA 4NN5B 1GJIA 3V4PH 1KLFA 5CBAB 3CSYB 1F4WH 3U2SB 2O5XL 2YWYA 1I4FA 4HK3J 3H9ZA 1LD9B 1UZ6E 1BWMA 2ADGA 5K9QI 5TQ2H 2CMRH 4H20L 1U8KA 2CGRL 4S1DC 2FEEI 1NDMB 5LWYL 2PTTA 1OGAD 2EDKA 3FOLA 3E0GA 4RGNE 1NBVH 1NEUA 4LLMB 1RIHL 4BQBA 1DBJH 4TVSa 3ARGB 4PYGA 3F5WB 1LK2B 5JMRA 1OP3K 2P7TA 5DMJB 1W72B 4HBCH 4ZQKB 3RWCB 4NPYB 3MRNA 3EYOB 4S1SH 4R7NA 1V3LA 3JVGA 5HHXL 3SE9H 3MLVL 5JHLL 4TULL 2A6KA 4UU9B 3NVQA 4MNHA 4G5ZH 1TMCB 5HDOA 1K5NB 1L7TH 3P0GB 3TFKC 4I0PB 1QSVA 5EU5B 2GFBB 1YUHA 5CGYC 2OYPA 3OPZL 2YSSB 5FYKD 5DK2B 4RGNC 1QR1A 4WHYG 5I1EH 2EC8A 5J57B 4W6YB 4DN4L 1S5IL 2Y06L 2E7LC 2DLEA 5D1ZD 1FNSH 4AH2B 4WHYH 4RWHA 2VH5L 1G7IB 3QUXA 4NO0D 1TJGH 3EOTL 2LFGA 4IMLA 1D5ZB 1OP3H 4PB0H 2R4SH 1A4KA 2X09A 3LQAL 2L7UA 3H2WA 2GSGA 4X6BA 5D7IF 3FN9A 4XNMA 2ICCA 3DYMA 4OF0A 3U79A 1G7JB 1QLRB 1AGFA 3K7UA 5SWZD 2O61B 2IPTL 4RISH 3QZWA 4WHDA 3ET9F 1C12B 3H9HB 4P2OC 3QNXB 1BGXL 1IFHL 4H5SA 4MMXC 1WICA 1R5IB 4P46B 1KB9J 3GSXB 4G80A 2QQKL 4GMSL 4LSPH 1FZKA 3KLSA 4TTDD 3KVQA 3NIGF 2GEEA 2P44B 1KTKE 5DJDB 5HHOB 3MLSH 3FQNA 4WEBH 4YBLC 3T3MF 3WFZA 3Q1SH 2QHRL 4R7DB 1P7QD 4ODBD 4UNTA 2HTLD 5IM7B 1ZHBB 5CD3A 3TWCL 4PRNA 2OR9L 5F7YC 1U2CA 4Y5YC 3TT1L 4WWKA 3QDGA 4LP5A 2P45B 2XZAL 1IC1A 1KJ2H 4RNRA 2N56A 4P2YA 1F3JB 1KB5A 3W9EA 5SWQB 4PV8A 3BEWB 1S9WA 1IGJB 4KTDL 1INQA 1RJYA 2Q7YA 2J8HA 1SY6L 2F58L 1IARB 3AXLA 4Z0XA 3OXRB 2C1OB 1B4RA 2FRGP 1MCHA 5LGHL 15C8L 3R8BB 2BK8A 4OUUA 4XWOC 4KKNA 1WIOA 4HCRH 5FK9A 3P4MA 4HIEA 2HJLB 3PGCA 3ULVE 1OY3B 4M7LL 4JQIH 1IM9D 1FAIH 1UH2A 4ELMF 4XAWL 2ICWB 4EDXA 3TN0B 3THMH 1HSAB 4XP9H 5GPRA 4GAJL 2Q87A 1KPUB 1Q0XL 4B53A 4BK5A 5KN5A 4QF1A 1FLRH 4W4NA 2ZUSA 1KT2A 4OZIB 3FAXA 5GJTH 2FH8A 5IGXH 1U8JB 3PL6B 3C5ZB 2AJZB 2PR4H 2DQHH 1CD1A 3QIWA 5KVFL 5D6DC 3QDAA 3BDYL 4GW4B 1A2YB 3ULVC 5IOPA 4X8JB 4NHCH 5CJQH 3X13A 3MUY1 3QO0B 4UDTA 5JXEC 2VLLA 3MFGB 3STLA 3NFPA 5F7HA 3HNTL 3NIDE 3KPMB 3HC0B 4JJ5A 4AG4H 5MEPB 4QRTB 3OF6D 1JWMA 4ZODA 3LY6A 4K8RL 1C8PA 1XF2A 3IFNL 3L3OB 4G9FD 1UENA 4LU5L 1JPGA 2A77L 5ID0B 4ZUVA 4XVUC 4YHYB 1P5VA 3DGGB 3BWAA 1GC1L 4LEOB 3U4BL 4S1DD 1KELH 3E3QE 2Y25A 5ECJE 1FNEA 5D7JC 3WJJC 2W9LA 5IMKA 2HVJB 4OV6F 5E2WL 5D7IE 5C0AA 3MJ9H 2FJHA 5DHYA 5GGVH 3MA9L 2XTJB 4OGXH 2IANA 2OTPA 2QADC 3SGKC 4OI8A 1RJZA 1NJ9A 1E27A 3SJVB 4YHNA 3Q0HA 1CGYA 3NIGE 4WVRA 3X3FH 2E6PA 4Q2ZB 1RHHB 1FVDB 1BZ9B 4PY8I 4NRZA 3T3ME 3MACL 3QDMA 4LLQB 4NKIL 4U1IA 2AEPH 4RGND 3RGVD 3E3QC 5J12B 3PWPD 4U6VL 3OAUH 2AJSL 1AKJD 5C70A 1VERA 3PQYA 3UBXI 4NKDA 3D9AH 3UPAA 4TUOA 1GIGL 5TDOB 4P9HL 1KJ2B 2FNBA 3BPOC 7FABH 1AP2A 1XT5A 1HSBA 3UAJD 1EJOH 4NO3B 3ZL4H 5HHPB 4S1QH 4KJWC 2YK1L 3AREC 3PXHA 1QFHA 1OAUH 4R96A 3LMJL 2PO6C 2ZZUT 1T1XB 4F37F 5ESQA 5B38G 5L0QB 4F9PC 2V9TA 3F65A 4I18A 8FABB 1BLNA 3VRIB 2QR0B 1KJVA 3GKWL 2R1WA 4JAMA 43C9B 1JGVL 3QEGH 5GZOD 1H3PL 2C7UA 4NCC1 3IDMA 3EO9H 3B5HA 1RK1B 4OCLC 5E56A 3ARBC 2R29H 3CH1B 3F7RA 3GB7A 2Q6WA 5HI4C 4AIZB 3O41A 3SO3B 5IJVB 5LKNA 3O4LD 2J6EA 3PWNB 1QEWB 5F8QC 2BNQB 1QQDA 3LPWA 1HOCB 3T2PA 3DX8B 2CDGB 1I1AA 2PXYA 4K9EC 2X4NA 5C0CD 4AL8H 4XTRD 2YRZA 2GQHA 4MHHG 1J10A 2VISA 4PYHA 5DJAA 5IB1A 4PJIA 1T5WA 1JRHH 3GMQA 3BW9A 3OB8A 1WZLA 4Z5RB 1I1CA 5INDA 4LPUA 3U82B 5CGMA 3RHWK 1V7NH 1QLFA 5F3HA 1QO3A 1E4WL 3ILQD 4LF3A 4F58L 4F57L 1MUJA 4P4KC 5DK3A 1RUQH 3KDMB 1SYSA 3FO0H 2XN9D 3P9MA 1Q9WA 4KVCH 4ENEC 4KJPD 4K2UH 3LKPB 1QFOA 2HH0L 3EIFA 1CGTA 1YJDC 2YPLD 3K81A 3ZKNC 3KHQA 2YBRA 2VDQL 5F70A 4RMUA 5KVMC 4XC1L 4UT9H 5CSZB 3QIUD 3U7YL 2HFEB 2H2SD 2ZSWA 4LGSB 4HJJL 3GSNH 4TQEH 5HGDA 3TO2A 1YPZF 3EOYG 4Q97A 3IU3A 2DYPA 5JXED 1AGEB 1EO8L 4NQED 2UVEA 3OKOA 3HE7D 1VGKA 2AJ3B 4MD5A 3CPLA 2X9YA 1MPAL 3VD3A 4M6AA 1N6UA 3O0RL 4LCWA 4U6XA 4YXKH 5T5NG 3B2UC 4LNRB 4RMQA 1DBMH 3KPQA 5E7FA 1S7TB 3MRBA 1JZ8A 4MWFB 5HI5C 5ICZB 3SDCB 2R0ZL 4PRHB 1FHGA 4HS6B 1RK0B 2VIRA 1IKNC 4AMKL 5EPMA 1G7HA 3IDGA 4UNUA 3ZE2F 3QULB 4JPVL 5MHSE 3ARFA 5EG6C 4ONFL 4L8BA 5MEOB 3BPLB 4Z7NF 4KDWA 1K3ZA 4X7SL 1CIDA 2NZ9C 3OQ3B 1G6RA 1R3KB 2FLRT 3TJHD 3EDEA 4AZ8A 4HX1A 4G7YL 1X6NA 4KUZH 1ZMYA 3U9UB 4EXPX 1NC4A 3SKNB 5ALBL 4W4OC 5DVLA 4NJAL 5DYOA 1QFWH 5DJ2B 4KAQL 2CDFA 4MLIA 4BSWA 3O3DB 3L7EA 5BV7H 2IH3A 4GMTH 2EDYA 1MVFA 3MLRL 5FDYA 4J6RH 1ZHLB 3C5SB 2RJMA 1F58L 4MCYB 4KFZC 1J8HE 4C4KO 1ZA3B 4TVPH 1FVCB 1M05A 5HGAB 4RMSA 3TPUB 1GZQB 4NZTL 1ZLSH 4WEMB 1U42A 1BP3B 3HZVB 1H3XA 3TNNA 3C9NA 4GKNB 4G8GD 3UTSD 2ZUXA 3SKJH 3MZTA 4AEIH 3ARED 4PJ7B 2P1YA 3BKYL 3IFPA 1A1OB 4G6FB 2XWBB 4LSRH 1KBGH 1L0XA 2X4TB 2AI0L 2X5PA 2AXFA 2EH7L 5EA0H 4PJHB 4NUJB 4OF7A 3AGVA 3DHMA 3FFDA 2F8VA 3KPSA 2ZOKA 3C09B 4M7KL 2YN3A 4M6OL 4NRYB 1FP5A 4NM4L 5HI4D 1ZLVK 2IEPA 1XR8A 1LP9F 3WHXB 5KSBB 1DE4A 3QFJD 3E2HB 5GGQH 1TZHB 5BRZB 5LGJA 4HKJA 1I3GL 1IC5L 3Q6FB 2Q1EA 1MF2H 3BKML 3PP4L 4OLUH 2AEWA 3TO4D 5I1CH 3V0VB 2DLFH 5DI8B 1LE5B 5FGRA 3GSNB 4KDTA 1YPZE 4C59B 3JWDC 2P8LB 4YX2L 3KLAA 4HH9B 2DLGA 1HHIA 1F4HA 2F8XC 4WUKH 4MAUL 1KCVH 1VA9A 1WZKA 1L4IA 2P24A 2FJGB 5C0EA 2Z8SA 1BM3L 4EDWL 2VLKB 4JFDE 1WT5A 4PJAF 5ACZA 3OR7A 3RWIB 3IF1A 4BZ1H 1G9MH 4WV1A 5AWNH 3P30L 1GGCH 3FONB 3BISA 3MBEB 4P4KD 2PCPA 2FATL 3D0VA 2FBJH 5LAXA 4KK8D 4OI9A 6FABH 4MS8D 1L7IL 2WIIA 1NL0H 4K94L 2NY2C 3GMLB 4BQ6A 3G6JA 1E4XL 5DT1L 3ZE2E 1J18A 1ZVYA 3BRFA 3HCVA 4D3CL 4MVBC 4N0RA 3UZVB 3ZKND 4Z7NE 1UADC 4FQCH 4KRMB 2JJUA 5J1AA 4ZPTB 4DWHA 5EOQH 1P4BH 4X9GA 5IQ7H 1RZ8B 3B3IA 2GITA 3MV9A 3CNKA 4NQDD 2GYSA 3QP3A 3KYKH 4O4YL 2EE9A 4HHAB 2XQBH 2YKLL 3ME0A 2FCBA 2ZPKL 5C0BE 1FG9C 3MMEA 1DQJA 1EFXB 1DUYA 4MD4B 1W2KT 4EI5A 3L7FB 3H9YA 3B2UD 3C6SB 3O3BA 3RDTD 5JNYA 3LN4B 1YQ2A 5T33H 3KNBA 2B5IC 4O2CB 3CX2A 4X99A 4HUUA 2EDXA 5SWZA 1P4LA 1T7XA 4QCIA 3FOMA 5AD0B 4Q0XH 4NC0B 3HG1A 2OR8A 5DA4A 2GTWA 3VFWA 3IKCA 4J1UA 2VDPL 4XVSL 3QZWG 3BN9C 1FLTX 1YEJH 3UYRL 4NHUB 3AROA 4MJIB 5GS1C 3WFBL 3DJ9A 1LGVA 1ADQL 2NZ9D 4ZFOB 2YOCA 3KXFE 4Y5VA 3VWKC 4ZPVB 1EEYB 3TP4A 5I16B 2A6DB 2FX8H 3GM8A 1PSKL 3ULSB 1FSKB 1RMFH 3O2VL 3WFCL 1AHWC 2Z4QB 1FORL 2LTQC 4F7TA 4ZXBB 1FRGH 4NBYB 1FCGA 1MRFH 3RPIA 3RJDA 4AYFA 2IAMB 1RV6X 2AXGA 4ZFZA 4HXBL 1LP9E 5EWIH 5T1KA 1UYWL 4E41D 1VADB 3SEPA 5IB4B 5KTEL 4TNVK 2W0FB 3GSQA 5IKCB 3WDIA 2F5BL 2BDNH 4JFFD 4YZFF 3RP1A 1B88A 3TBSA 3PV7A 1UACH 4F7EB 5JDSA 3TPKA 1KB5H 4PBWD 4KV5F 1W0YT 1ZS8B 4PJ5D 1NGXA 3ZT6A 2WBJD 1DN0A 1OARH 1YN7B 4JRYB 1I8IA 4L29B 1KV3A 2VLJD 4FFWD 1V3MA 3FQUA 2IADA 5FGBA 2HLAB 4NUGL 4M48L 3CC5B 1HIML 2FR4A 2QSVA 3QNYB 4DKFL 4Z9KB 1P7KA 4K7FB 5TGBB 4X4YA 3SDXF 4NQCE 4WFHD 3UPRA 4UIKL 4ISVA 4H8WL 3LIZL 2CUIA 3KJ6H 1MCWW 4MNGA 1I4FB 4DKDC 3IS1X 5DO2C 4TSBL 2ADGB 5TQ0L 3E6FA 5D6CA 1U8KB 5C7XL 2PTTB 3FOLB 5KSAD 5C0FA 1NCBL 4L3EE 4ZO6A 3C6LC 4OCWL 3NTCL 4N0CC 3B9KA 3PNWA 4BFIA 4V2CB 2P7TB 5MENA 3RWJA 3G08A 2HLFD 4R7NB 4EIGB 1AR1C 2A6KB 1N6QH 4LCCB 4NNPH 4MNHB 4U1HB 4NZJA 4KQ3L 3BDXA 1YUHB 4JFZH 2JF1A 4OIIL 4MQTB 4OGYH 3TYFA 4MA8H 5A2JH 4LVOC 1QR1B 1NCCH 1N4XH 1YEIH 3IDYB 1IQDA 2ITDA 3FT4A 3BKJH 3QUXB 4NO2A 4AQOA 1QSEA 3O8XA 2EE3A 3IRPX 1MIEL 1D5IH 4IMLB 3MRIA 4OD2A 1A4KB 1KCLA 4KRPB 3AMLA 5AUMA 1AJ7H 4LAQL 4IIQC 2GSGB 2ZUUA 4JLRA 4XNMB 1AGFB 2E8YA 1YYMH 4LSTL 3QZWB 1KLGA 3R1GL 1T20A 4MQSB 1YC8A 3UJIH 2GSIA 4H5SB 2CKBA 5LQBL 1DL7H 4G80B 2E7LA 1FZKB 2OXGA 2RQ8A 1AD9A 1Y0LA 2IQAA 3BZFA 4ORGA 1EHAA 2PN5A 2YMXH 3IU4L 1BAFH 1A0QH 2OLDA 4Y0GA 4FTVD 5FF6A 1JNNL 3TBVB 3WUZA 4FMKA 4KI5D 2YN5A 4QGYA 5CD3B 1NGYA 4FG6D 4FQ2H 4HK3N 2WANA 4JO2H 1J0YA 4PRNB 2QV2A 2DIAA 2B2XH 3BIKA 1UM5H 5HHMB 4WWKB 3CDYA 3QDGB 4P2OA 4RNRB 2XRAH 4KV5E 1KB5B 3W9EB 1T1WA 4PV8B 1S9WB 4M93C 1SVCP 1OAZH 1INQB 2HFFA 3ARPA 4MSWA 3P4OA 3AXLB 4Z0XB 3RFZC 2R8SH 5ERWA 5D7SH 2VUYA 5FK9B 5E4EC 3VWKD 3P4MB 3Q5OA 3GMNA 4HIEB 3SDXE 5C9JA 1KACB 3PGCB 4TRPL 3SGJC 4XVJL 3WDJA 3U7AA 5HYFA 3LN5B 2B39A 4Y5YA 5DC0A 1RI8A 1A64A 5HDBF 4EDXB 5FHAL 3V4UL 2A9NH 2ZKHL 4EUPA 4ODXA 3CMOL 2J6EH 5KN5B 4O51A 7CGTA 4QF1B 43CAA 2NY6C 1KT2B 4P49A 4LSQL 4OF5A 4R8WH 5HJ3A 1AGBA 2NXZB 3QIWB 1CD1B 3DUUA 1G7MA 2WZPD 3TA3D 3LPGA 5I8CA 4L9LC 2GJ6D 5IOPB 3CZFA 3GM0A 3X13B 2CK0L 3BESR 3DXAE 4JPWL 4UDTB 5KOVC 4XMPH 2VLLB 5GGRY 3STLB 4XMLH 1TTFA 2DQGL 3NFPB 2P5WD 1XR9A 1KEMH 3VFGH 5FM4A 3SPVA 4JJ5B 4WUUD 3EYSH 2ERJC 3T1WA 1T2QH 4K3HA 2EDTA 2IPKA 3DX7A 1BVLA 2C9AA 4M5ZL 5JUEH 5JR1H 2FIRT 1XF2B 2DI7A 4JO1H 2IGFL 5JW4Q 1JVKA 1MHEA 1T22A 1JPGB 4RGOH 1ZV5A 4ZUVB 1INEH 1PQZA 5D6DA 5JDJA 3SOBL 3BWAB 4JFEE 2V7HA 4IDJL 5EB9A 1ERNA 1UZ8A 2W0KA 4RBPH 1FNEB 3WO4B 1O7SA 5FO8A 3V5KA 5IMKB 1DBBL 5HHQA 3KPPA 2OP4L 5C0AB 3WNMA 2FJHB 5DHYB 1G9NH 4XWGH 1LQSR 3KPRD 2YRLA 2D7MA 1RIUL 2CUHA 2IANB 4OTXH 3WJLC 5IVNA 1RJZB 1OT2A 1NJ9B 5FHBH 1E27B 2DRUA 4YHNB 3RTQC 1PJ9A 1RZJH 4OQTL 3PWJA 4PJBF 1RAMA 2JB5H 4NRZB 4P5TC 2E27L 1MIML 1TQBC 1VEPA 2AW2A 4WJ5A 4H88H 4G3YL 2HWZH 3QDMB 4U1IB 4RMRA 2NW2A 4IJ3B 4PLNC 5D2NE 3WJJA 5D7JA 3JV4A 1QSZA 2Y07H 5IG7A 2E7BA 1BMGA 2VABA 3PQYB 4KH2A 5IB2A 4XCYA 4NKDB 2CLRA 4LDEB 4TUOB 2R1YA 4HK0A 1TVBA 4WU7A 4EI6A 1YC7A 2BSRA 1FVEA 3K2MC 3W11C 3BE1L 3X3GH 1AP2B 1BQSA 1HSBB 5EZOL 2YA2A 5CKGA 3AB0B 2I27N 2QQLH 3ALWA 4R96B 4APQC 1G6RH 5ESQB 5ENWA 3QEQD 4I18B 3DROA 4JCLA 4K3DH 1OPGH 1BLNB 3O4OB 1KJVB 2R1WB 4QHLA 4JAMB 1JUFA 5D7IA 3EKCA 2C7UB 4Q9RL 2HKHL 2VUOA 3MV8D 1XF1A 4HS8L 2NLJA 5HDBE 3MREA 4ODSH 3GB7B 1LDPL 1WIPA 4XP6L 2Q6WB 2R56L 4N8PA 4S11A 1RVFH 3O41B 1CE1H 1N5AA 2XY1A 2BJML 4UV7L 1OW0C 4LLVA 9CGTA 4G8GA 1JHKH 1RUML 2A9MH 4XI5C 1KFAL 4JDVA 3FO9A 4CN6A 1TJHL 3AREA 4XB7A 4U1MA 1N7ML 1QQDB 2PO6A 1I1AB 2PXYB 5F1SA 2X4NB 5GRUL 4F9PA 5IP4A 2EEDA 5T5FH 1DBKL 2D03L 2W9DL 2FD6L 4WI2A 3HPJA 5HYIA 3QPQD 1ZEAL 5EOTA 1F4AA 2VISB 3S3JA 2NY1B 4ZTPH 4POZC 3HI6H 5DJAB 5IB1B 4PJIB 1T5WB 4DKEL 3GMQB 3ARBA 2VXTL 3BW9B 4JVPA 2DN7A 4Y4HC 2MCPL 5INDB 1E6JH 4JZOA 1QLFB 4HJ0D 4FXGA 3DIFA 1LWRA 1FNGB 1QO3B 3FHQA 4LF3B 3UJTL 3TLRA 4HC1L 1JGEA 1DQTA 3MO1A 1MUJB 3O2WH 1MAML 2F54D 3NCJL 4CVUA 1SYSB 2WUCH 3GBNH 4J3XA 3P9MB 1UWEL 1Q9WB 2VYRE 4L4VD 4GKSA 1RZKC 2X42A 1LVEA 4Y8DC 1CK0L 3W0WE 1PGRB 1CFQA 5GS0L 1RUPL 3RVUD 1KIPA 4XZUA 5C2BL 4L4TE 4TSAL 2YBRB 5JA9A 4Y16A 4TUJA 2E7MA 4C56E 2ZSWB 5IIEA 2NTSP 4BZ2L 5HGDB 1L0QA 3TO2B 1ORQA 1UG9A 1PLGH 4P4KA 4P5MB 3IU3B 2VR9A 2DYPB 2LU3A 3SDYL 2ZP0T 1A1NA 4RFOH 1VGKB 2XV6B 4MD5B 4PJBE 3CPLB 1WF5A 3TIEA 4NRXA 4LCWB 4TOYH 4U6XB 5FUOL 4F2MA 3A6CH 3ARQA 4R97B 4BUHA 3KPQB 5HYJE 1CU4L 3MRBB 4IRSD 5IVZB 1EH9A 5T3ZE 2WUBH 3B4NA 5DUML 1F90H 3C8HA 2VIRB 2NY5H 5CUSL 2CLVA 5EPMB 4MA7L 3VXQA 3IDGB 1I9IH 1FGVH 5E8DL 4YHLH 4GXVL 2R23A 4YDJA 3ARFB 3HAEA 4L8BB 5GISH 2C3WA 5T1LA 1RZ7H 4NCDA 4K71C 1KCRL 5FYKH 1MQKH 3T0XA 1TETL 2DMKA 2VN7A 1G6RB 1RUAH 1B4JH 4BFGA 1QACA 4HX1B 3GNMH 1NC4B 3MBXL 4YC2B 3WUWG 4OV5A 5DYOB 3RWGA 4CU7A 2CDFB 5F6HI 1GHFH 1IKNA 4BSWB 3L7EB 1XFPA 4MJ6A 2IBZY 2IH3B 4X4ME 1HXMA 2QSQA 4GBXB 4KVNH 3HI1B 3N9GH 3WS3A 5KW9H 4NOFA 3CLFL 4K8RD 2K7QA 1PZ5A 5GGVY 3RL1A 3W11D 5A16A 1M05B 1EEZA 3H42L 2VDKH 1NCUA 1UGNA 1LEIA 1E6OH 4UOJA 1S78C 3DGCR 1M7XA 3TNNB 3C9NB 5HD8C 3GHEH 4OB5H 4W4OA 5BMFL 3UBXA 4MNQE 1KXVC 3IFPB 1LHZA 1G7LA 2DS4A 5DD3H 3MV7D 5I8EA 3HNVH 1IKFH 4XBEH 2A2QT 4M1DL 3ULUF 2AXFB 3VWJC 4U1SA 1N5YH 2OTUA 3FFDB 5HGHA 2DLIA 3KPSB 2ZOKB 2ZUYA 3KWWA 1U91A 3FQTA 1UCBH 2BFVH 1XR8B 3TZVC 5BXFA 3SE8L 1DE4B 5CHNA 4X5XA 5LGJB 4FQIL 3UTTE 5HI3C 1UA6L 5CJOL 2HN7A 3G9AB 2VR4A 4UUJA 3L5IA 4PGCA 3SGDH 1F02I 2O5ZL 1NAMA 5JHDE 2WIMA 3T2NH 1ND0A 1NMBH 1KENL 4P5KA 2HVKA 3KLAB 1MJUL 1J8HA 4JRXE 2A0LD 3QHFL 1HHIB 4Y4HD 1PEZA 1XF3A 4RIRA 4GKOA 2P24B 1WAAF 5GQBA 5C0EB 1KXQE 1HWHB 3JWOC 4XNXL 5ACZB 4YE4L 4JRWA 3OR7B 3IF1B 1FPTL 2YRPA 4WV1B 2PCPB 3D0VB 5LAXB 1ZK9A 4YK4C 5IHUL 2WIIB 1ZANH 3G6JB 1FE8L 3U9PL 1N64H 4KMQA 5IW3A 3AU1A 2X10A 3HCVB 4JG1L 4WY7H 1CGUA 3OZ9L 3WHE1 4DGVL 1IC4L 1I7ZA 1JN6A 2WM0A 1I9RH 5J1AB 5E5MA 5CFHA 5H35A 4LSUL 3RVTC 1UXWA 5DD5H 1G6VK 3B3IB 1MJ8H 5IFAL 2GITB 4QYOA 3LHPH 1C5DA 4GUPA 3MV9B 1DLHA 2Y5EA 4HT1H 4AQ1B 2FHCA 3MMEB 3V6OE 1W8OA 1DQJB 2YD7A 2AK4D 2FB4H 1ZVSA 1DUYB 4LSSL 4PRBA 4D94A 3EOBA 1NMCB 4EI5B 3O3BB 1YPZA 1A6WH 2D31A 2H32A 4FFYH 2H8PA 3V0AC 2X4UA 1KNOA 3QNZA 1G84A 2EDNA 3S96A 3KNBB 3EJZC 4JREB 3DTXA 4X99B 4HUUB 1T4KA 3IJSA 3L1OL 3SQOL 3GRWA 1P4LB 4QCIB 3FOMB 4U7MA 3MXWL 4KK6D 3C8DA 3HG1B 1ZTXH 4JFDA 5L8JB 1IGCH 2GTWB 4C56D 2NR6C 3G5ZA 3IKCB 1M7DA 4J1UB 4OCSH 4HV8A 4FQPA 2V5SA 5F9OL 1A7PL 5CJ8A 1NLBL 5J0BA 4Q74A 1TDQA 2G9HA 5MP6L 4M6NH 3V6OC 4L8CA 4Y2DD 1BFOA 4PGDA 4Y5VB 5ANME 2QSCL 1BJ1J 2R0WL 2CKBH 4DZ8A 1IGFL 3ULUE 1SMOA 1EUUA 3S88L 5J11C 3D48R 1JGUH 4E9LA 1J0IA 4HUNB 2XYCA 4YJZL 3RPIB 25C8L 2X9XA 2AXGB 4ZFZB 3MLXH 2Z31C 3VXPB 1XEDA 5T1KB 4I3RH 4K3EL 3H9SE 3GSQB 5HYEA 1MOEA 1YNTA 3SDDD 4BH7A 5DK0A 1OTSC 1F8TH 5IMOA 5CWSA 2JB6A 5GS1A 3N1PC 2DMCA 1QBMH 5F7FA 3TBSB 3QYCA 4PP2A 1R3LA 4GJTB 3MRFA 4QRSA 4Y7MA 2AABL 3GMOA 4XMKH 5JDSB 2Y6SD 1H8OA 3DX6A 1NGXB 1DN0B 3HB3D 3ULUC 3G6DL 3FMGL 1AHWA 1I8IB 4JFQA 2ADFH 3N1FC 1EEQA 4B7LA 1INDH 1HQRA 1O5DT 3FQUB 4Y4KC 2IADB 5FCSH 4XX1E 2FR4B 5D2LE 2DQDH 3U4AA 4FQ1H 4HFUH 4ZG1A 4NFCA 1P7KB 5HHVL 2EIDA 3MCKA 4FQLL 5D8JH 1DQDH 4X4YB 1WAAE 4KZEL 5EUKA 3QCUL 3UPRB 4GS7C 2EDHA 4ISVB 1ZVHA 1A1MA 4X6CF 3VW3H 3MRCA 3IRZA 3QBTB 4MNGB 5DMIL 4EUPH 1MY7A 2DI8A 3KXFA 3E6FB 5D6CB 1IEHA 1BFVH 1CDGA 4UTBL 5C9KA 3MLUH 4ZS7L 4G8IB 1JWSA 2DQUH 1AI1H 4YLQT 5EOCH 2UZXB 4JKKA 1JK8B 4CU8A 4XPHL 5SX5K 4I9WD 2P5WA 1KGCE 2APWA 3B9KB 3PNWB 4RFNB 4BFIB 5IR1A 3PDDA 4J4PC 1LP9A 3TJEH 5MENB 1MFEL 3RWJB 1WFUA 2CD0A 3G08B 2XZQH 1C5BL 4XCFL 4OGAC 1CXEA 2XNAB 1JPSL 1PW3A 3VD7A 5HYSG 3LN9A 3S35L 3BMWA 1CN4A 1CG9A 4YH6A 3U0PA 2W65A 1NBYA 1GAFL 5BVPH 4RX4D 3PIQA 4ZOBA 4DVRH 3BWUC 3TYFB 4ODHH 3C6LA 5J9PA 3Q5TA 2MWCA 2X41A 4ONGL 1IT9L 1IQDB 3CFEA 2ITDB 3BUYA 2C3VA 2BMKA 2R0LH 1BIIA 3CSGA 3NCBB 4NO2B 3MYJA 4NQCA 1QSEB 2OQJA 3O8XB 4PJAA 4GG6F 1D3CA 3O6MH 1UM6H 1RJLA 4Q9QH 3MRIB 1MVUA 4OD2B 4U05A 1WQVT 4NM8H 5AUMB 1KN4H 4KK5C 1C5CH 4JLRB 1KN2H 2FGZA 2D7TL 4OZFA 3KLHD 3QI9C 5FAAA 3S7GA 4H0IA 4F7PB 5M94B 4RGNB 3SKOA 4R2GC 1T20B 4L3EA 4D9LH 4W6WB 1AH1A 3QJFA 2GSIB 3F7YA 1D6EA 3OKNA 3QA3A 5F8RC 3MODH 5I1GL 1AD9B 1NC2D 1Y0LB 2IQAB 3BZFB 4GRLB 4ORGB 3UC0H 5ID1A 2YWZA 5DMGC 4FFZL 4PTTA 1S9KC 4HEPG 3LKSA 4HS3A 3SY0A 1MFCL 1N59A 3H6JA 4PRPE 1NGYB 3LH2L 1WEJL 3TC9A 4IIQA 3BIKB 3MOAL 1A7BA 4OCYH 4P2OB 5I30L 4FQXD 4KGLA 3WIIL 4HFWA 1MREH 1T1WB 3QO1A 4OZGF 4QO1A 3DSNA 4CNIA 2HFFB 4MSWB 4JO4L 3P4OB 5F96H 1PG7L 4YBLB 3OR6A 1UWGH 2F53D 3GMNB 5C9JB 5KOMC 1A02N 3MJ7A 2MPAL 4M6MH 3V0WH 1H8NA 4Y5YB 3UJJH 1KYOK 5TE7L 2DQTH 2YHGA 4HZAA 1MCRA 3CU7A 2VLME 4PJXE 4LHQB 2X1WL 1OTUD 4IRZL 5BO1L 4EUPB 5K9JL 4ODXB 4O51B 43CAB 1B2WH 1I3RA 2GKIA 2D7PA 1IAIH 4UAOC 2EO9A 4ONHA 3QUMA 4I0CC 3ZLQC 4S1RL 5HJ3B 3QG7H 1AGBB 3DUUB 4ERSL 1G7MB 5HGGS 4P23C 3BP4A 1AQDA 3SGJA 5I8CB 5EZJA 1F4YL 3CFIC 3CZFB 3V7AG 4A6YA 4WGWB 1OAQH 2K3TA 5I1LA 3I3DA 4OFPA 5D9SA 3D2UA 5JOPE 2YZ1A 5IEHA 1XR9B 3SPVB 4M9PA 3HN3A 3RVXC 4MHHI 4I48A 2IPKB 2OS7A 5H94A 2BVUA 3DX7B 1BVLB 2XKUA 1DBAL 3FB5A 4K9EH 3NPSC 1RIVL 5TE6H 1MHEB 3P77A 1T22B 3WD5L 3LEYH 1AGCB 1PQZB 1BJ1H 1KC5H 3SDXA 4L9LA 4P9ML 3LOWA 2DICA 2V7HB 3NA9L 1G0YR 4LPWA 4WENB 2ITCA 1UZ8B 1BEYL 4GG6E 4HIXH 1WBXA 2RHEA 2EEAA 3UZEA 5FO8B 3V5KB 1NFIA 5HHQB 3H3KA 3KPPB 4HWUA 4LCIH 1LILA 1D7FA 3O6LL 1NGPH 2W0PA 4M8VA 4PLKD 4K7PH 2C3HA 1E4KC 3AS1A 4X83A 2NX5D 3BPNC 1W72L 3BEVA 4BSJA 2XA3A 3PWJB 4QKXB 3B9VA 4GRWH 4HGMA 4QTHA 3RHWF 1JTTA 5DJ6A 1JYWA 3FFCE 2NW2B 1YJDH 3I6KA 5D7JB 3JV4B 1UKSA 2Q76A 1YEEL 5IG7B 2VABB 5IB2B 5HPMA 4XCYB 3NZ8A 2CLRB 3HAEG 2R1YB 4HK0B 1TVBB 4ZFGH 2AV1A 4XHJC 5BVJA 4WU7B 4EI6B 2BSRB 2WINA 1FVEB 1TVDA 1MCOL 5KVEL 2QADB 3WJLA 4OZGE 1JCKA 2DBJA 3HAEH 4PRHE 5T5NF 3UYOD 3RTQA 3DRTA 2VDML 4PJ9C 5DC9B 2FLBT 4H1LB 3ZO0A 4P5TA 4U1JA 5ISZD 4JFEA 3S36L 4DOHE 3VFRA 5ENWB 4LQ1A 3DROB 4LGRB 4OBSA 4NWUL 1NAKH 4PR5B 4QHLB 1ZHKA 4PS4L 1JUFB 3TYGL 5GS2D 2OL3A 1S9YA 5D7IB 1CGSL 4JFOA 4G6JL 4XPAL 5AZ2L 3AAZA 3OGCA 3MREB 2O5YL 1HINH 3BPOB 1S9XA 5B8CC 4D2NA 1N5AB 1BBJA 2CO7B 4LLVB 4M62H 3UO1L 1RFDH 2YZ8A 3FB6A 4G8GB 4JDVB 3EUUA 3FO9B 3MYZA 4F80A 3MRDA 5GGSY 1QLEH 3F12A 3QDJD 4U1MB 4YHOH 4APQA 2PO6B 3A67H 1EO5A 3UBXG 3O2DA 3I02A 5HBBA 3DX9A 3TT3H 2JLLA 3HPJB 4OFIA 5C0RH 2C26A 1TXKA 2DTSA 4JHWL 5EOTB 3BPCA 4FABH 4WGVB 1BJMA 1R3IL 4YDVA 3GK8L 4KROD 3KJ4C 1H8SA 35C8H 3ARBB 2FX9L 4Z77B 2CXKA 4DN3L 2DF3A 1BQHG 3HKFA 2B4CC 1VDGA 1OW0A 5L9DH 4FXGB 3DIFB 3SCMD 4KUCF 4M7JH 5JLZA 3HHRB 5BOPA 3GGWA 3L3IA 3L5XL 1SEQL 3NCYS 4KPHL 2PYFA 2HRPL 4YXHL 1JGEB 1A5FH 3MO1B 5AYUL 2VDLL 1S9VA 1OAXL 4JGUA 1CE6A 5I1JH 1F4WL 4GKSB 3S6CA 5K59F 1UVQA 1CFQB 3ROOA 1CFNA 1KCUL 4Y4HA 5I8KH 1KIPB 4XZUB 5TQ2L 3D6GA 2VO5A 2NY3D 4Y16B 2CXGA 4CAGA 4TUJB 2WK2A 3TV3L 1W0VA 5IESH 1NAMH 3RIFK 5IIEB 2WWMC 3VFNA 4PD4J 1ORQB 3HRPA 4P4KB 2MNUA 4XCEA 4HBCL 1A1NB 5FUZH 3PJSA 5GJSH 3TIEB 4DTGH 4NRXB 4GT7A 1EA9C 4X7FC 4S1SL 3RVXD 3VXUE 3SE9L 2KQMA 1R3HA 5E4IA 5TF1H 3KLDA 4OFYD 4F2MB 2B0SH 1DVFC 1CXKA 4CADA 5DSCA 3VRJA 4G5ZL 1L7TL 3OSKA 4PJGE 2VLKE 5F1OB 4Z18A 5LCVH 5ADOH 1HYSC 2CJUH 1QFWM 3ARVA 5J6HA 3TM6A 2VNCA 2CLVB 3CIQA 3JWDH 3VXQB 5IVOA 3H3PH 1AO7E 3GJFA 2R23B 4YDJB 1DANT 3HAEB 4EZMA 2GCYA 1FNSL 5T1LB 3WO3B 1BREA 4LVNB 5IQ9A 3UX9B 1TJGL 2VL5A 3GUTB 1L6ZA 3U48A 2HP4A 2ZSVA 4RRPA 3AMKA 4Y5XC 3W0WA 2XICA 4L4TA 5F7UA 4RISL 4OV5B 1CICD 5AEAA 3ZDZE 5L2KD 4OZHE 2X2YA 4C56A 4MJ6B 4CDGC 1JHLH 4KQ4H 2H32H 4OIAA 1HXMB 1QKZL 1II4E 2MHAB 3WS3B 3LEVH 3MLSL 2VZ1A 3GRWH 4WEBL 4PJBA 3Q1SL 5DHVH 1PZ5B 5AAMA 1NKOA 3RL1B 2DTMH 5A16B 1EEZB 4V1DD 5HYJA 1LEIB 4XCNB 4HPOH 1EV2E 4TVPE 1MRDH 4HWBA 3UBXB 1JBJA 4OCXH 5FCUH 1KJ2L 1BECA 1TCRA 2J3SA 4JGJA 3EBAA 2AP2A 5EBLA 1G7LB 4CBPA 3BGFC 5I8EB 2A74A 1OP5H 1GGYA 2P46B 4U1SB 2OTUB 5HGHB 4HZLB 5IHZA 2NTFA 2F15A 4OLXH 5DLMH 3KWWB 2VRAA 1OWWA 5T1MA 3IVKA 1U91B 3FQTB 1D5MA 2G60H 5BXFB 1NFDE 4N9OB 5EIQA 5HHNA 1CTNA 4X9FA 4JQIL 5CHNB 1FAIL 2AERT 3DPBA 5K59E 4X5XB 3FL7A 5C0GA 3VRLF 4MAYC 3BD5A 3HNSH 4WDIA 2W92A 4XP9L 1TTGA 2HN7B 4WI5A 3TVMD 5FYLE 5ESVA 5J7CC 4UUJB 1HKFA 3IDIA 2GT9A 4X4MA 4PGCB 4QRRE 5DR5L 2YUXA 3CX5K 3VWJA 5GJTL 3JUZA 1NAMB 1ND0B 5IGXL 4P5KB 4WFFE 1KOAA 2HVKB 3ARDD 1NSNL 3A0OA 4LCUA 4OKDA 2PR4L 3I6GA 3IYLW 2DQHL 1J8HB 5E7BA 4KJYA 4GAYA 5GRWA 1XF3B 3TCXA 2V5YA 3TZVA 4RDQG 4RIRB 1KF9B 2VN4A 4NHCL 5CJQL 1JTPA 3BXNA 1MH5A 5EO1A 1H3GA 4XAKD 5BZDA 5CEXA 3EHBC 4J3WA 3CVIL 3LCYA 4MNQA 1S7QA 5D1QD 5D7KD 1J1OH 1HHJA 4KKCC 1MCLA 2JCCF 4AG4L 4HJGA 4FQQA 4QWWC 4G6MH 1YDPA 2FECI 4R90L 3E6HA 4MX7A 4ALAH 4GH7B 3RWDA 4TNVF 4JY6A 3AU1B 4OM0H 3H7LA 4GQPH 1GGBH 4W6XB 1I7ZB 1JN6B 3QQNA 5E5MB 5F7EL 5H35B 2BC4A 1UXWB 2NXYC 4WEUD 2ZJSH 3E8UH 2WWMD 4QYOB 1WZ1H 1C5DB 1PAMA 2VMFA 4GUPB 3UTTA 1NCTA 4F8TA 2FDBP 2A1WH 1DLHB 3MJ9L 1ZLUK 3VGFA 3EYFA 1NDGA 3QCVH 2NY2B 3QUZD 4OGXL 3BP5A 2BOCA 3UP1A 1TJIH 1ZVSB 4PRBB 3VXRD 3WNOA 5JHDA 3EOBB 3TBTA 5C07D 2R69H 4JM2B 5L6YH 1YPZB 2D31B 2H32B 3QXVA 2H8PB 2X4UB 1KNOB 3QNZB 3X3FL 3S96B 5I9QC 3S37L 4JRXA 3DTXB 1T4KB 5CZXD 5DF0A 3IJSB 5I76A 1LO0H 3SDAC 3ZT7A 5IUSA 2AEPL 4R4NC 4JFDB 3OAUL 1OAYH 2HFGH 4PJFE 4OZFG 3G5ZB 1M7DB 3OBAA 3T0EE 4HV8B 4GQ9H 1FG2A 3D9AL 5D72H 2APTA 1TCMA 2VXUL 3BH8A 5BJTA 4OZFH 1IVLA 2G9HB 3VXME 5IWLC 4XNYH 4BKLA 1CL7L 4L8CB 2HTKC 1JPTH 1BFOB 4PGDB 3RY5A 4KTEH 3C08H 3NA4A 4HWEL 4ELKA 1EJOL 3SO5A 1DSFL 3OWEA 4DZ8B 5IJKC 2B5IB 4S1QL 2OZ4A 5IVXF 2O5XH 1OAUL 3UEZA 2YD5A 4Z95H 3QG6A 4KK9C 4U3HA 2Z8WC 4FZEL 5CINL 4ZO9A 4H20H 2BXYA 2CGRH 5LWYH 1VEMA 1HHGA 4JEGB 1QNZL 1JTOA 1RIHH 3QEGL 3T0EC 2LVEA 1YNTB 4BH7B 3P0VH 1V3JA 3EO9L 5DK0B 5IMOB 3VRLE 5BS0D 1QRNE 5CWSB 2JB6B 1U8QA 5E2TH 5C0BB 5GS1B 4C58B 2R29L 4KKBD 1A6ZA 1R3LB 2UZIH 4PP2B 3MRFB 4Q6YA 3V6OA 4CUCA 5KVGH 1ZE3C 1KLUA 4QRSB 5D4QA 1DANU 3GMOB 1FNFA 3DX6B 3BQUB 3VI3F 1YEGH 5JHLH 4O58H 1U3HD 1AHWB 2QLVB 2LTQB 3BX7C 4JFQB 4JVUA 4QRPE 1CYGA 5E9DD 1XF5B 3RUGF 1HQRB 1ZGLA 4IS6A 3GI8H 4AL8L 1RHFA 2Z31A 3T0AA 3OPZH 4OLZH 3MCKB 1EERB 5EUKB 2XTLA 1HNGA 1JRHL 2C4FT 4YQXL 1FYHB 1S5IH 3FQRA 1A1MB 2H6PB 3X11A 4C83B 2VOTA 4Q7DA 4DCQA 2JCCE 1XIWD 4U6TA 3KXFB 2EYSA 5ANMA 1JHTA 3BGMA 4HDIA 2HMID 1QBAA 2WV3A 1CD9B 5F9AC 2GUOA 1JWSB 3LQAH 5DXWA 4F9LC 2E9WA 5CP3A 3HE6D 4Y4KA 1NGZA 4LFHD 4MAYD 5J3HD 1T7WA 3FO0L 1KJMA 4Y89A 1BIHA 2IPTH 3GMPB 4KVCL 1HYRC 2YS4A 3VCLA 5IR1B 4IOSD 1BZQK 1LP9B 4FXKA 1XZ0A 5B3JF 4PPTA 4LHUD 1BGXH 3H9SA 1W8NA 1FN4A 4A6YH 3CD4A 1LK3H 3WLWD 4RWYL 5GGRA 2QQKH 5HGBA 1PY9A 4WCYL 4NQUA 2HYMA 3T04D 1RSFA 2C4XA 5GGUA 1CG9B 4UT9L 3QAZC 3U0PB 2W65B 1NBYB 4LKCB 3R06A 1H0DA 3GSNL 4TQEL 2BRQA 3PIQB 3RKPA 5T3XD 1U93A 2OR9H 3C6LB 5J9PB 3D3VE 2R9HC 2IPUK 3EHBD 2WWKO 1AY1L 3CXDH 3DWTA 1IGIL 2MQCA 1OD9A 4MDIA 4J4PA 1HH9A 3BUYB 2C3VB 3OXSB 3KR3H 4EOWH 2BMKB 5IBLC 1BIIB 4D9QE 3MYJB 1WAAA 3ESUF 4NQCB 4YXKL 1KTLA 2OQJB 5CCKH 4KTDH 4ZYKA 3D39E 1N2RA 4PJAB 5CGTA 1S7XA 1RJLB 4KMLB 2VDRH 3WXWL 5JW4N 1LO2H 15C8H 3SQBA 2Y4SA 3CFCH 3B2VH 1CLOH 3SKOB 3HZMA 3LB6D 4L3EB 4LVOB 4M4PA 4HUWA 5BW7C 4DUXA 3QJFB 3F7YB 1D6EB 2IPUG 3OKNB 3QA3B 2ZUVA 4M7LH 5AG9A 1T83C 3BIBX 2WLZA 5IVXE 1F00I 5ID1B 1T04A 4PTTB 3LKSB 3OKKA 1ODAA 4HS3B 4JO3L 4KUZL 3SY0B 3U46A 3CU1A 4RGMB 3QUKA 3BN3B 3O6FC 2ADIA 4WO4C 4IIQB 1QFWL 5ISZA 5D1XC 2VXQH 3QI9A 5BV7L 5ITBH 3SDAD 2F8OA 4GMTL 4HFWB 3VXSD 3BDYH 3VI3E 3QO1B 1CXHA 4CNIB 4M7ZC 5LJYH 2MCG1 1J87A 3RUGE 4TVPL 2XKNA 1I85C 1VCAA 1ZLSL 5JQ6H 4P2QE 5LBSL 1VB9A 4ZD3H 3MJ7B 5DZOA 3RKDD 3SKJL 3MNWA 4EN3D 2VDNL 2WP3O 3QWRD 4ZFOL 5E95B 1EMTH 5CSBA 3DVNA 2A77H 4LSRL 1KBGL 4XPBH 4M93B 4RSVA 1FFRA 4NZUH 3G6AA 5EA0L 4FZ8L 5A3ID 4Y19D 1I3RB 2VLRD 2DM2A 4ONHB 3O9WC 3QUMB 5E2WH 3C60C 4QHKJ 4E5XA 2HT2D 1A6UL 1JZ4A 2AXJA 3O3EA 5E4EB 4HMCA 5GGTA 1EBPA 1LO3H 3BP4B 3FRUA 1J7VR 1AQDB 3VE0A 5B3JE 1BWWA 4HIIA 4PRPA 5GGQL 3H3BC 4F7CA 5EZJB 5FKPA 2FX7H 4A6YB 3GSRA 1MCDA 1Z9LA 3WLBA 1MF2L 4F8QA 5I1LB 5C08E 5D9SB 3D2UB 4OLUL 4QXWA 5EH1A 3VMPA 5IEHB 5I1CL 3GSUA 4RQQB 3IFLH 4PRIE 2NY6B 2GY5A 3IJYA 4I48B 5H94B 1GOGA 2AJSH 1ZLWH 3FB5B 3IXTA 1HXYA 4UB0H 2Z9TA 3TGXA 3T8XA 1KCVL 3P77B 4P23A 1MJJB 4XVTL 5FGCE 5LXGH 3SDXB 4L9LB 3W9DA 3WV0A 2ITCB 2Y7QA 1CQKA 4BZ1L 1G9ML 4DK3A 5AWNL 1QFUH 3B9AA 1A21A 1GGCL 1WBXB 4X6CA 2BY1A 4HCRA 1T1YA 3GIZH 2FBJL 4PJEE 1HN1A 1NFIB 4WTZG 4LK4A 1NL0L 2G2RA 4PJXA 4P3WA 3LMJH 5FO7A 1WFTA 2ERJB 2ZUQC 4OFYA 3PV6A 3P4NA 2ED9A 4GO6B 5E2UH 3GKWH 3VXNA 4N8CH 1H3PH 2ICWI 4G43A 4IEFB 4FQCL 3BEVB 12E8H 3MRPA 5EOQL 2C4FU 4Z78A 5IQ7L 2IBGA 3AFLA 4QTHB 5DJ6B 2GK0A 5F7MC 4OLYH 5C09E 3KYKL 1S7WA 1SQ2N 3I6KB 2COQA 5IFHH 2XQBL 2E9JA 4GLRI 1EJ6A 1EDQA 3QT2A 4RAUA 4P2RD 5HPMB 3NZ8B 1Y6MR 5CILH 1S3KH 1JZ3A 2J8OA 5IBLD 2AV1B 5BVJB 4JFHD 5CZVH 3BOVA 1BD2D 1X5AA 3NCCB 3DMMD 2X44D 1E4KA 3U0TA 2X1QA 5I2IA 3RTQB 3DRTB 3QQ9C 1AQKH 5KS9E 5MI0C 5B21A 1MNUH 2WSKA 4P5TB 4U1JB 1TQBB 1YEKL 4MA3A 4Q0XL 4JFEB 3MUZ1 2IFFL 5BCAA 3VFRB 5K9KA 2VE6A 5JQHC 4GG6A 3IXAA 1FZMA 4BJLA 1HWGB 2DKSA 4XRCA 1YEJL 2MJWA 1NCAH 1ZHKB 3ARGC 2OL3B 1S9YB 3D1MC 4JFOB 1I1YA 3FT3A 5SWSD 4MZ3A 3OGCB 1W0WA 4O2FA 3DBXA 5F9JA 1S9XB 3QXTA 1OCWH 1RMFL 4WI4A 2IWGA 1CR9H 1BBJB 3ZT5A 4OFKA 4PJ9A 3FB6B 4QGTA 4UQ2A 1FRGL 5ITFA 3ZDXF 4IRJB 3MRDB 1MRFL 3F12B 4OCRL 4APQB 5M7QA 5EWIL 4ETQA 3FFCA 3I02B 4I5BA 3DX9B 1FC1A 5D2NB 2BDNL 3BPCB 5C6TH 4LVEA 5T3ZH 4HWBH 1G7PA 3RY4A 2UWEE 2PW1B 5I1AA 1EO8H 4UT6H 1YEHH 1FJ1A 1KB5L 2BSED 1MPAH 2ARJQ 5B8CA 4CN4A 1OARL 4CVXA 4YEEA 2IH1A 4OZGA 2I5YL 1J1PH 4FFVD 5F7KC 3OAYH 5JLZB 3T1FA 1ONQA 3L3IB 1S7UA 5F1IA 2PYFB 4K3JH 4B7IA 4AENA 3JZ7A 32C2A 3DECA 1S9VB 2HA1A 2CDEA 4FQJH 4FOMA 2OMBA 4JCMA 2ZNWA 4PV9A 4JPVH 3VG9C 2R2BA 2B1AH 2OCFD 1UVQB 2LU4A 3KJ6L 2EYTA 3C60D 1QYGH 3ROOB 1CFNB 4Y4HB 1SJEA 2BERA 4OCNC 5B38A 1TNNA 2E9IA 3QRGH 1W0VB 4AY0A 4G7YH 3VFNB 2WBWB 5DS8A 5ALBH 4BSVA 4ZTOH 1F4XH 2GHWB 4QOKD 4XCEB 3WFDH 2I9LA 4WI7A 4H0GA 4DUWA 3PJSB 2Z35A 3I9GH 5EORH 3MLRH 1R3HB 1N6QL 1FO0A 4CADB 3VRJB 2V5RA 5DSCB 3STBA 1OGAE 4HKXA 2ESVD 1UJTA 4JFZL 4OGYL 1VFBA 4MA8L 5DRZA 5J6HB 4KKAD 2UUDH 3HMWH 1KPRA 1NCCL 1N4XL 1U6AH 1YEIL 3GJFB 1U3YA 3TH2T 4ZMAT 2DWEA 1YMMD 2GCYB 4YEFA 4J23A 4ZAKD 5E1HB 3BKYH 1GOFA 5IQ9B 3JWOH 4LIQE 4Z76A 2VL5B 1D5IL 4N0YH 5C07A 3L3GA 1DVFA 2ZSVB 3J7HA 3L3HA 4JFPA 1AJ7L 3W0WB 5FYKE 2L7JA 4L4TB 1SJVA 1YYML 1KSRA 1K8DA 1CS6A 2OSLA 2J4WH 4U2YA 4C56B 1DTUA 1DL7L 1CD0A 1H15A 1AE6L 2YMXL 3QWOA 4K71B 3ZDXE 1J11A 1BAFL 1JYNA 1A0QL 4PJBB 1RULL 4XPFL 1VSCA 3VXUA 2NY0D 2AXHA 4K7PY 1MI5D 2K7PA 3L3DB 2B7DT 4FQ2L 4JO2L 5SWZE 4Y5XA 3EOAB 5HYJB 2B2XL 1MWAA 4MCZA 1FQ9C 4PJGA 1UM5L 2DKMA 4TTGA 4O00A 4CMHC 2XRAL 4YHYC 1B0WA 1TCRB 3V8CA 5EBLB 1PVHA 1BM3H 1OAZL 3FQWA 4PRAA 5D1ZC 5SV4A 1AO7A 5ALCH 2V2TA 2QQQA 2IG2H 3K1KC 3IDXL 2OZ4H 2A74B 1T3FA 1NLDL 4X6DF 3P30H 3ARGD 2R8SL 2FATH 4OM1H 2BOBA 5IHZB 2NTFB 1L7IH 2NY4C 2PYEE 3WCYA 5T1MB 1U8IA 3IVKB 1GGIH 1D5MB 5F9DC 1CL7I 5F7LB 5GZND 5HHNB 1M6OA 2D0HA 2Z0BA 5CJBA 3RBSA 5C0GB 2CQVA 4WDIB 4X9HA 3DARA 4I0PD 5TF0A 5ESVB 4TTDC 4NCC2 3RNQA 4OZHA 3IDIB 2GT9B 2J6EL 2OM5A 2ARJA 1F2XK 3L9RA 3VWJB 1YMHA 1I1FA 3MLPA 4R8WL 1MAKA 2HTLC 4LCUB 3K2UH 5I1KH 4Q58C 4GAYB 3TZVB 5SX4I 5C92A 3VFUA 3BXNB 1MH5B 4HF5L 5BZDB 5CEXB 4MAYA 3KPTA 4XMPL 2BVEA 5EBMA 4MNQB 1S7QB 3MLZH 4ZNEE 3VFGL 1KEML 1HHJB 3VFPA 1KEGH 3GBMH 3IKKA 3EYSL 2OI9C 3IETA 4HJGB 4FQQB 5JIIA 3ULUH 2VDPH 4MX7B 4P46D 2AJUH 5JR1L 4NJ9L 5CP3H 3RWDB 3DVGA 4JY6B 4WFGD 5HHOD 2A73B 3U83A 4PJ7F 3Q2CA 1FNLA 2CH8A 1INEL 3VH8G 3DNKA 2GK2A 1NFDA 1PSKH 1P84J 2MTPA 3O2VH 3UTTB 2CK2A 2IALA 1UCTA 1NDGB 1G9NL 4YK4B 1T6WA 4QRRA 3BP5B 2BOCB 5IMMA 5KSBF 4G9FE 4OTXL 1UYWH 3Q48A 1KTDB 5JHDB 5FHBL 3TBTB 1P69B 2WLYA 1RZJL 2VQ1A 1IZJA 1YNKL 2RBLA 4O02H 4JRXB 2JB5L 2R0KH 3LSOA 2HWZL 5I76B 1V5JA 4M00A 4O5LL 4PREB 3QQ3A 2Y07L 5DVKA 3BRGC 4E42A 4CN1A 4MMZC 5E8PA 4WNQA 1FG2B 5JIKA 3EJYD 3BH8B 5HVGB 5BJTB 2R39A 3TN0D 4DKFH 3QXAA 4M5YH 3X3GL 4BKLB 3BRDA 1GCFA 1I1RA 4ELKB 2NYYD 4X6DE 3LIZH 5DD0H 2P5ED 2QQLL 3PL6D 3C5ZD 3PWPE 1EHNA 5CBEA 1G6RL 3SDAA 3QG6B 3VXSA 1ZSDA 2I9TA 5IFJA 5MERA 1HHGB 4UOW1 5DJ8A 4WW2F 3RY6C 3INUH 3A6BH 3W2DH 1J9CT 4WTWA 1U8QB 2HKFH 4ODSL 2D0FA 4ODWA 1XGTA 2HRLA 1A6ZB 5IWLA 5IROC 2RAMA 1KLUB 1RVFL 5I75C 1CE1L 5DRWA 5IJKA 1JHKL 2A9ML 3KYOA 4XNQA 1V7MH 3LDBC 2ZG1A 3RGVC 1K8IA 1ZGLB 3DURA 4IS6B 5T5FL 5IK3A 1RURL 3UZQA 4NZRH 2Z31B 2E6QA 4OIIH 3WE6A 4PJFA 4YUEL 2JIXA 1DQLH 4E0RA 3F6LA 3DRQA 4PRDA 3T0EA 5GSRA 3QCTH 3RWEA 1D5BA 3MPCA 3O4LE 3X11B 1FNHA 2YA0A 3GDBA 3VXMA 3UAJC 2NY4D 1E6JL 4DCQB 5EC1A 1Q9LA 3QRFM 2XTJD 4HGWA 2EYSB 4N68A 5ANMB 1JHTB 1I75A 5LG1A 4AEHH 3BGMB 2NNAB 4HDIB 3PGDA 1MIEH 4LHJB 5DRXA 1CDUA 5C0CE 3NZHH 3SJVD 2N7BA 1JNLH 2GUOB 5C0DB 4Y4KB 1NGZB 4YFDB 1GXEA 4G6KH 1KJMB 2WUCL 3VMNA 1UH4A 3G04A 5GGTH 5GZOC 1F6LL 3GBLA 3VCLB 1UM4H 1IAII 5IB3A 3F8UB 3N85H 4FXKB 1JYVA 5EBGA 1XZ0B 2QQNH 4UDUA 3H9SB 4R3SA 1FN4B 3JUYA 3A6OA 4GS7B 1M71A 4CJ0A 5GGRB 5HGBB 5F44A 1QRNA 1RPQA 1HHKA 3RI5K 1CGVA 3EGSA 5J1SC 2UYLA 2PYED 2YUWA 5GGUB 3LS4H 2P4AB 2P42B 3R06B 1H0DB 3QHTC 1XAUA 4MJ2A 4X6FA 2X6MA 4F9LA 4MXVF 2XN9E 1U93B 4QRPA 1PLGL 2CKNA 4XTRC 2OK0H 3WFHA 2XXCB 1R5VA 1O0VA 3HC4H 5DUPL 5D2LB 4MDIB 5DEFA 1HH9B 1Q9OA 3D0LA 2YPLE 4TOYL 1KTLB 3A6CL 4OAWA 4WFED 4LPYA 1N2RB 3IDJA 4AT6A 1S7XB 2PUQT 3ZKSD 1J1XL 3FCTA 3C09C 4GW1A 3ILQC 3FRPG 3WFEH 2JCCA 2X4OB 4U6YA 4A2LA 1S7SA 5TH2A 2NY5L 1EVTC 4CMMA 2X1OA 1F45A 4NQEE 3QEHA 1NBQA 1I9IL 1FGVL 5CJ5A 3HZMB 4YHLL 4TRPH 5I15L 4HUWB 1SBSL 5GISL 1QPXA 1QR4A 5GSVA 4KJPC 2BCKA 1RZ7L 2BNQD 3RPKA 4P2RA 2XPGA 3P0YL 3GFUA 3T4YA 2AGJH 1HQ4A 2ZKHH 1RUAL 1T04B 1B4JL 4R4FH 3TH4T 5K93A 3OKKB 1ZHNA 3U46B 3GNML 1YZZA 1MCJA 1OD7A 1R3JA 2W60A 2ADIB 3QIUC 2H2SC 4GRWF 4NKMA 2AEQH 5ISZB 1GHFL 3QI9B 2V2WA 4R2GB 3DOSA 3S8WA 3HE7C 4KVNL 5BW7A 3N9GL 5KW9L 1DR9A 3D3VA 2CK0H 1T83A 4JPWH 1WZMA 3UTPD 1I7UA 5EU6D 1WCQA 1CLYL 4LASH 2XKNB 5HDQL 1U95A 2VDKL 2ILLA 3D39A 5EO9A 4X4XA 5DUBA 1CXLA 4JDTL 3HC3H 2DQEH 2D0GA 3UTQA 3GHEL 3O6FA 4OB5L 4WO4A 4WW2C 1PYWA 4L9DA 5HXMA 3MNWB 4YHZH 5D1XA 1LNUB 4XBGA 1MCQA 3DVNB 3G5VA 3HI5H 1FBIH 3NN8A 2H9GB 3HNVL 4L1DA 4XBEL 5GRXG 5I8OH 1WUNT 3G6AB 1CD8A 5GGSA 4DZBA 4QTIH 1MCPH 3ZKMD 5IVXA 3TJHC 1DBBH 4E5XB 1SJHA 2ZOLA 3RX5A 1I85A 4Z7QF 4JB9H 1UCBL 3UTSE 4G8GE 5A40E 4LKXA 2BFVL 2EDDA 3O3EB 3BI9X 3AS3A 2BVPA 2HT3D 3FRUB 3PE9A 4J3TA 2F74A 2FGWH 3VE0B 1N0XH 4HIIB 4PRPB 2EXWC 5D96B 4F7CB 2P8PA 5FKPB 1XGYL 5FYJE 3GSRB 2KKQA 3WLBB 3GIVA 3SDCD 3B9DA 3WS6C 2E27H 1MIMH 2SEBA 3Q3GA 3GSUB 4JG0H 3K3QA 3T2NL 1NMBL 4F15B 4CL7A 1KUMA 4MXVE 4J12A 3IJYB 3QPXH 4UAOB 1I9JH 1RZGA 3O9WA 3V7AE 3RUGA 3C60A 3IXTB 1HXYB 1F2QA 1MCIA 2X89D 3QFJE 1HCVA 4P57A 3T8XB 4P23B 4P2QA 3WHE0 5JW4M 3T65A 3BE1H 4Z7OF 3GHBL 1EXUA 3DUSA 2OX5A 3W9DB 3ORJA 5TFSH 2Y7QB 1WC7A 4AEEA 4Z7UF 2FO1A 5I6XB 1U3JA 1IAOA 1T1YB 4BZYA 4D0CA 1H3TA 2UY7A 3V8OA 4R0LC 2B4CH 2G2RB 4PJXB 1ZANL 4ELME 1U92A 1N64L 3PV6B 3P4NB 1J12A 5KSVA 1NANI 5DJXA 4WY7L 3VXNB 4LSVL 2BY0A 4V2BA 3NPSB 4G43B 1I9RL 2HKHH 5IMLA 5A2IH 4XP6H 4Z78B 2IF7A 3CVHA 5C8JA 2Z92A 2FEDC 1KTRL 4LAJH 2GK0B 3GMMA 1FO0H 1MFDH 2P47B 3WIHA 2APVA 1S7WB 1TJHH 3TO4C 1ORSA 5C08A 2A83A 4HT1L 4GRWE 5EU4A 4Y4FC 2BY2A 1UWXK 2Z8RA 1OGTA 1T03H 4FNLH 3LPFA 4G6FD 2FB4L 2W9DH 4PRIA 1A6WL 4FFYL 1ZEAH 3CGTA 4GG8A 4CDHA 5ACLA 4R4BA 3U0TB 3BPNB 5I2IB 3MZGB 4GXUN 4DKEH 1UC6A 2EICA 4NQDE 2EEBA 2XZCH 1XGUA 4MA3B 4Z8FL 3EO0A 1ZTXL 1FCCA 1IGCL 4NQXA 5B39G 3U0WH 5K9KB 4PD4K 3B8YA 2VE6B 4KK8C 3REWA 4OCSL 4MS8C 3IXAB 2X9WA 1FZMB 4JKWA 4GG6B 3RIFF 1EEUA 5BRZD 4XRCB 4BQ9A 3RA7L 4PJEA 4G7VL 1EFQA 4Z6AT 5I0ZA 3OKEA 3FT3B 1W0WB 4O2FB 2QBWA 4JKPH 4PTUB 3DBXB 5GRZA 3V4VL 2CKBL 2J8UF 4ONOA 5F9JB 3CSYA 1FDLH 4JDZA 1A6AB 1JGUL 4S0SD 4PJ9B 3NFNA 1RU9L 4LCCC 4KDVA 4UQ2B 5ITFB 3QSKB 5ELIA 3U1SH 2K9UA 4RMVA 5FYKU 3MLXL 3EFFA 2DBLH 4JVWA 3FFCB 4ETQB 1MCKA 3NCYP 4I5BB 4U4BA 5C09A 1MWAH 2HG5A 1F8TL 3ARGA 3KS0J 1G7PB 5JW3H 3MBED 1L9MA 3RDTC 5I1AB 5DJYA 2G5BA 4XMKL 3RWCA 1FJ1B 2YUVA 5CAYB 2FJFA 3WNLA 4DEPC 1AC6A 2YEZA 5B8CB 3CK0H 2XWJA 1JNHA 4TNWF 4CVXB 3QFDA 2IH1B 2FIKA 4OZGB 2C1PA 4OLVH 2ADFL 3NIFF 3VGHA 4N1HB 1P1ZA 1INDL 3T1FB 1ONQB 5KS9A 2AQ1A 4MDJA 1S7UB 5F1IB 4E41E 4KI5F 4H26A 3GMRA 4FQ1L 4AENB 4HFUL 3VI4F 1T1ZA 32C2B 4DOHB 4JFFE 1DQDL 3MLWH 5CUSH 4Z7OE 4BM7A 2CDEB 1RD6A 4PV9B 5F72S 1U0QA 3VW3L 2R2BB 4PJ5E 2C5DC 4Z7UE 3MXVH 1MFAH 2GAZA 2EYTB 1EBAA 2YD3A 3HMXA 2XT1B 1EFXD 1SJEB 3WXVH 2VLJE 3O81A 5B38B 1BFVL 1D5ZA 3MLUL 5DMKA 2DWDB 2DQUL 1QHPA 1RZFH 5EOCL 3OKDA 2EXWD 5DS8B 1FAKT 1U9KA 3ECBA 4BSVB 4WFHE 5TJWK 5J89A 1BQUA 2I9LB 3TJEL 4LFHG 3SN6N 4DGYL 1CVSC 3V6BR 1U8LA 3VFMA 2Z35B 2Z91A 5IW6A 1L9NA 4LHUG 2UWEA 1FO0B 2BHUA 1URLA 2WBJC 4MJID 5FA4A 2VDOL 4XNZC 4HKXB 5BVPL 1Z9OA 3I50H 2Y36H 4FFWC 4DVRL 4XC3L 5H2BA 4U0RC 1VFBB 5DRZB 4ODHL 4RDQF 1XH3A 3B5GA 1KPRB 5FYJD 4PJIF 1CT8A 4ZXBD 2DWEB 1A14L 3D25A 3ULVL 2IAMD 1MHHA 3P9LA 1HNFA 5T3XH 4Z76B 3IAPA 1UM6L 2DMBA 3VDCA 5C07B 4Q9QL 1D6VH 3L3GB 1DVFB 4NM8L 3L3HB 4JFPB 1KN4L 3HS0A 5FYLH 2JJWA 1C5CL 5KZCB 5KSAC 1KN2L 1UT9A 1K8DB 4RZCA 2OSLB 3ES6A 2VZUA 4XPGH 4D9LL 2FEDD 3SE8H 4BYHA 2J8UE 5F3BA 2OMNA 4JRYD 2AJYH 5MEQA 1PKQE 1H15B 1C7TA 2HLFC 3QWOB 3UC0L 4Y4FD 5EDXA 4HMDA 5I19H 3VXUB 3MRKA 4DFHA 1AXIB 1MFBH 1A22B 5DZLA 4Y5XB 5DA0B 1KENH 1MWAB 4EBQL 2P5EA 1OGAA 4MCZB 4OCYL 4PJGB 3DI3B 2DB8A 5FM8A 4MD0A 1WBZA 3LKNA 1A9BA 3V6FA 1ZLVH 1SBBA 4YGVA 3FQWB 4PRAB 1YNLH 4YR6A 1AO7B 4I13B 3OJMB 4XNXH 4BH8B 2V2TB 4FTVE 1JFQH 1T3FB 3LRSA 1Y6KR 5ESAA 4FQHA 4KI5E 4NOBA 3TBWA 2BOBB 4JR9H 2A6IA 1K9TA 4YWGH 5HPOA 2VXVH 1MEXH 1U8IB 1JPFA 4FA8A 1MLBA 4KKLD 4M6ML 1M6OB 1NQBA 3V0WL 3OGOE 1T0NB 2LAGB 3UJJL 2I26N 2DQTL 1OAKH 3ZHDA 2H2PD 3DGGA 3I75A 3K0WA 4J7RA 3BZDA 5IBUG 5DVNA 3RNQB 4OZHB 5D1ZA 3BGFB 1Z9SA 4NO0A 1OSPL 2ARJB 4L8DA 1YMHB 1I1FB 2V6HA 5BV7B 4KI5C 3QG7L 4FG6C 3WUWA 1TENA 3QUXD 4PB9H 3SE3C 5F89A 3RRQA 4KRPD 3VFUB 5C0NC 1GYAA 4MAYB 5FOJA 4C4KT 5EBMB 4L5FH 2Q8BH 1JP5A 1T66D 3VFPB 4JY4A 3LQZA 3IETB 4U6HA 2WAHA 2JTDA 3CFJA 3WEXA 1P7QA 3G5YA 4K9EL 3DVGB 5F9OH 1HCFX 5TE6L 3MGOA 1NLBH 2GJ6E 2PYEA 3IB4A 3LEYL 5T1DH 5CEZE 1KC5L 5MP6H 4X80H 2FBOJ 3O3AA 4PLJD 4Z0BH 1NFDB 1U8NB 2QSCH 2R0WH 3NH7H 4HIXL 2P5WE 3EO1A 4M61A 2DL2A 4WUUE 1P4IH 1RY7B 5HHMD 4LCIL 5CMAA 4WWKD 2IALB 1T1XA 3FB7A 3QDGD 1J5OH 1NGPL 1LO4L 25C8H 4QRRB 3B43A 5IMMB 4OT1H 3ZZ1A 5DTFA 4K3EH 4U33A 3KS0H 3TA3C 1ZWIA 3BP7A 1QVOA 5JPNA 2VQ1B 1R0AH 2BSSA 1IM9A 1IE5A 2AABH 2ZCLH 1Q1JL 3LSOB 5IJVA 2IJ0C 2NXYB 1YJDL 4HGKC 1RZIA 3CLEH 3QQ3B 4XCCH 3G6DH 2Q8AH 3ZE1F 4E42B 3KPRE 4HULB 4PJDF 4XP1H 5E8PB 2DOCA 2FHBA 4WNQB 4ZNEA 4PJAE 4ZFGL 1U2HA 3BDBA 3QXAB 1FGNH 2ZG2A 4ZSOE 4U1GC 3HR5A 4PUBH 4S2SA 4XXDA 4I77H 5EU7E 5I9QB 2ID5A 5A2LH 1E4JA 3MOQA 1G0XA 4HMEA 2NXZD 3QIWD 5CBEB 3SDAB 5CIPH 1KIRA 3E1F1 3D85D 1ZSDB 3ZYOA 2I9TB 5IFJB 5MERB 1Q9KA 4UTBH 1NAKL 3NACH 4MB3A 1HHHA 3FN0L 5DJ8B 5EU6A 4HKBA 3OF6A 4OBRA 3JV6A 4N5ED 3MRNB 4I8DA 3CCHA 4ODWB 1XGTB 1HINL 4DGIH 1Z2KA 2C3GA 2UVFA 5C2UB 5E00A 4G9FA 4XP4H 3OAZK 1RFDL 5DRWB 4R97C 1FYTE 1EGJA 3AS2A 3KYOB 4XNQB 5EU7C 5TPWL 1QLEL 1VFMA 3QEQE 4MQXD 4YHOL 4UT7L 1K8IB 3DURB 4RMTA 5KAQG 5IK3B 3DHJA 4MA1C 1GAFH 3RZCC 3TT3L 5C0RL 3WE6B 3MV8E 4PJFB 4B41A 4FABL 2JIXB 3S5LA 4E0RB 3DRQB 2V9QA 4PRDB 3T0EB 3P2TA 5GSRB 4ONGH 3RWEB 5C0IA 35C8L 1D5BB 5C0AD 1T80A 5IROA 2OJEA 3VXMB 5EC1B 5I71C 1VKXA 1Q9LB 4HGWB 4N8VG 5L9DL 3QHZH 1JV5A 4X6BB 4IOFD 2IAND 5EZIH 2ADJA 4LRNH 1JF1A 3PGDB 5DRXB 3BYTA 4X6DA 1Q0YH 3HFML 3RGVA 1A5FL 3PWPA 1VGEH 1CFBA 1TTUA 1AKJA 1FFQA 2ENYA 3G04B 2PW2A 3KG5A 3QDMD 5IB3B 4N0UE 5I1JL 1H3VA 1MRCH 4GBXC 5D7LD 4JHZA 3FQNB 4UDUB 4R3SB 1RUKL 5MEOA 3U36A 3PQYD 1M71B 3GEWB 2F5AL 1QRNB 1HHKB 5I8KL 3R4DA 3EGSB 4QEGA 2UYLB 3BZ4A 4L4JA 4UBDD 2BNUA 3B5TA 3DV6A 4YZFE 5E2VH 1NAML 2F54E 4X6FB 3UMTA 5C0ND 5IV2A 1MJ7H 2APFA 3MGTA 4QRPB 4D8PA 5DEZA 3FQXA 4L4VE 3WFHB 3QPQC 1R5VB 2WQRA 3CXHK 3Q6GH 3UTOA 3NMEA 4POUB 5FUZL 3O3DA 4JQXC 5GJSL 1RJYB 2Q7YB 4X8XA 2D7NA 5DEFB 1Q72H 2NMSA 5I30H 3WIIH 1UB5A 3D0LB 3LQAC 5TF1L 3EFDH 3U4EA 3W39A 2B0SL 4OAWB 1ZHLA 3C5SA 2X1XR 3PHOA 3IDJB 4OUUB 4AT6B 5IT2L 3ZE1E 1A7NL 4I4WA 4HJ0C 3O4LA 4JO4H 4PJDE 1BJ8A 3FCTB 4LCYA 4GW1B 5LCVL 5ADOL 2JCCB 2CJUL 3QAZB 2R2CA 4U6YB 1GZQA 5IHBA 1S7SB 1OSZA 5TH2B 1FZOA 3OKMA 3LAFA 4CMMB 1BVZA 3JWDL 2QEJA 3QEHB 5ICXA 3H3PL 5C0CA 1VACA 5GRJH 3BZEA 1SMAA 1ULVA 2NZIA 4YXLL 5GSVB 2IBBA 1BQLL 4L3CA 2BCKB 3CUPA 5E1AA 5TE7H 4P2RB 2XPGB 5D70L 4C57C 2PXYD 1Z3GH 4ZS6D 3CVHH 5FGSA 2X4TA 3ARSA 4IRZH 1HQ4B 2X4PA 3RVUC 3CH8A 2W9EH 4PIRF 2P49B 3WIHH 4IBLT 1ZHNB 4HAFA 2NY1D 3BD3A 1R3JB 2W60B 4GSDH 4NKMB 3OG6B 4S1RH 4K7PX 5CEZD 2V2WB 5KSBA 4YHPA 4KQ4L 2XN9A 1CQYA 3D3VB 5EN2A 5CLTA 4D9RD 1CZ8H 3LEVL 4GKZA 3JV0A 3PUCA 5HYSA 4OLWH 3GRWL 3I6LD 1I7UB 1UEMA 4ZUTA 1JWMB 4OLEA 4MXQD 2YPLA 2DTML 1U95B 4IRSC 2V9RA 4ZOCA 4MYWB 4G42A 1SYVA 3D39B 5CSGA 3MOBH 4X4XB 5EO9B 5DUBB 5SV3A 4OF3A 3UTQB 3VGAC 4HH9A 3O6FB 3QIUA 4WO4B 4K3GA 1PYWB 4ODTH 2YD1A 4OCXL 5D1XB 1XCQA 4XBGB 1SEBA 5ILTL 4M1GH 3C2AH 5JXEA 4NQEA 3NN8B 4U0QB 3HE7A 5EFIA 2AJVL 3NA9H 3OB0K 1DQMH 1T89C 4X7DC 3RWIA 1BEYH 4M7ZB 5GGSB 4DZBB 1I8MA 3RBGA 1UQSA 4JN1L 1F3DH 4LOUD 5IVXB 1R5WA 4K23H 1UZ6F 4OLXL 5DLML 4D0BA 1MCWM 1EX0A 1SJHB 2ZOLB 2J88H 4N1CA 3O6LH 2G60L 2Z93A 3MQIA 2VWEE 4LCWD 2BVPB 4C54A 1NMCC 2Z8VC 2F74B 4WW2A 4M43H 1YN6A 4XPTL 2P8PB 4R9HA 3M8OL 3HNSL 4M03A 2E7HA 3MV7E 1GGTA 3KAAA 1W72H 4LMQI 4YDLC 1EHLH 3GIVB 5BZWA 2SEBB 3RZCD 4JFXA 3Q3GB 4K8RC 5JXAH 4UNVA 1UXSA 3ARFD 2DM4A 3L95A 3OKLA 4CRPA 3NABH 4QT5A 1NCWH 1YEEH 1RZGB 3O9WB 3IJHA 3SGKA 3RUGB 3C60B 5L88H 4KZDL 1GC1C 1LMKA 4P57B 4MD4A 1EUTA 4GFTB 3S34L 4P2QB 2VWEC 4YDIH 3T65B 5E99H 1EXUB 3DUSB 5DJZA 3VG0L 3DYOA 1FYTD 4LL9A 2ZWLT 1WC7B 1NC4D 2IFGA 1S8DA 1J1OL 1IAOB 3HMXH 2D4FA 5AD0A 1NGQH 3JXAA 4D0CB 2LE9A 3WS6A 5J4MA 3IFOA 2YD9A 1JF5A 3IDMB 4GBXD 4ALAL 5J6GA 4NWTL 1U92B 5JPMA 5KSVB 1H3UA 4OM0L 5DJXB 4CVWA 3ALPA 4NHUA 4KGJA 3RU8H 4MJIA 3TYGH 3VFTA 1A3LL 3W5MA 2AJXL 3UTSA 2I60H 2O5YH 5IMLB 1QOKA 4Y2OA 2V17H 5C8JB 3CVHB 2Z92B 2ZJSL 3E8UL 1OM3H 3GMMB 1KULA 2XY2A 1IRAY 5HVWA 2FO4A 2L0DA 4HPYH 1K4DA 1ORSB 3PWUA 4P9HC 5C08B 3ZTNH 2A83B 4R0LA 5EU4B 4RFEA 1OGTB 2ZCHH 4JZJC 2IQ9H 1TJIL 2ZUQB 5GRVL 1ACYH 5J8OA 2A0LC 2R69L 4PRIB 1JE6A 4Q9BA 8CGTA 2I24N 4GG8B 4Z7VF 3MFFA 5J1TC 1R3IH 4R4BB 1EK3A 5HVHB 5F3HB 3KPSD 3QFJA 4DVBA 2FX9H 2WMPA 4J3VA 1XGUB 5FGCB 3ZHLA 1A7RH 3EO0B 1OAYL 1TPXC 2HFGL 4NQXB 2HJKA 5I66A 1WISA 3REWB 1X5XA 1C08A 4GQ9L 5D72L 3F7PC 3L5XH 4TN9A 3TO4A 2AK4E 4PJEB 2DQIL 3O45A 4Y4FA 2DD8L 4XXCC 3TF7C 4XNYL 4XP5H 3OKEB 1T2XA 1JPTL 4ELMA 3C08L 4JZNA 2KL6A 4NQVA 1SM3H 5B22A 4JDZB 3H0TA 1GVIA 3NFNB 3NCFB 5MI0B 1KCUH 4Z95L 5GIRA 4X98A 3PXJA 2H1PH 5L7XH 5E24E 4GW5A 4HG4K 1CI5A 2KBGA 3EFFB 3F7VA 1MCSA 3OKOB 3TV3H 5C09B 3U7WH 1NMAH 3WL9A 5DURB 2HG5B 3P0VL 2XA8H 4GLRH 2QJDA 5E2TL 2E3VA 1P6AB 5C0JA 5KVGL 3GI9L 2UZIL 3MJGX 1ES0A 2Q20A 2YUZA 2G5BB 2Q86A 3B6SA 1I7TA 5DJYB 4LMQE 3T08A 4MXWH 3STZA 2FJFB 2Q7NA 1FFPA 1YEGL 2YEZB 2BRRH 5FFLA 3O8XC 2XWJB 1JNHB 3QFDB 2FIKB 4O58L 2C1PB 1QP1A 3LD8C 1YYLH 1DP0A 1NPUA 4KK6C 4LCCA 1P1ZB 4U1HA 5KS9B 4MDJB 3GI8L 4NQDA 1G7HB 1KIQA 3NIDF 4H26B 2DKUA 4LIQH 3GMRB 4NQTA 1T1ZB 2VSCA 1F42A 4OLZL 3IS0X 1JGLH 4NC2B 2ZUTA 3MV9D 5DQ9A 4Y2DC 5DDHA 4DAGH 3RDTA 1J05A 4GRLC 4XGZA 2YPKA 3PABA 2HT4D 1YEDA 3MCLL 2GAZB 1E4XI 4YHKL 3R8QA 4LLAA 3SBWC 1J0KA 5EOCJ 1T5XA 4EI5D 5DMKB 1BHGA 3QUML 4NGHH 3OKDB 1A3RH 1QHOA 1LE9A 3I2CH 3ECBB 5F71A 4X4ZA 3N1GC 4LARL 3MRQA 3SDDC 5DGRA 4YAQA 1UFUA 1U8LB 3HG1D 4KHXH 3VFMB 3RVVD 4A6YL 2CRMA 1LK3L 1A7OL 3SKMA 1QKZH 2Z91B 3VG9B 5IW6B 2Y6SC 1AXTH 2UWEB 1JJUA 2FYYA 3RNKA 3HB3C 5FA4B 1OLLA 4QRUA 2HAZA 3TBVA 4GXUM 4I9WE 5H2BB 3TESA 4BK4A 5JTWA 2RIKA 1XH3B 4Z7VE 1CLZH 3AUVA 5JIHA 3CXDL 4E41A 1CT8B 1OTTD 2X40A 1QSFD 1UKQA 4KMTL 1JI1A 3KR3L 4EOWL 5DFVD 3D25B 2UY6A 4JFFA 3P9LB 1MHHB 1J0HA 4M7LT 1BQHA 5CCKL 5T1KD 3PDOA 4PJ5A 1CBVH 2VDRL 4Z7UA 2WBJA 3B9EA 4ZOAA 3NPZB 1LO2L 3C5JA 1DLFH 3DV4A 3ILPA 3HS0B 3SKUD 2EDJA 4P99A 4JPIA 3BO8A 2VLJA 3CFCL 3B2VL 4RZCB 1CLOL 4HKJB 3ES6B 5FA3A 3DSFH 4OJFL 1IGMH 4XT1C 4ODUA 3LN5A 5F3BB 1AC0A 5MEQB 3MJ8A 1RQ5A 2VXSL 2VC2H 5CD5D 4X5WA 2APXA 3PHSA 3MRKB 5DR5H 1YY8A 4ETYA 1BBDH 3N0PB 1ZKAA 2CUMA 2P5EB 1OGAB 5D5MF 1NSNH 3TEUA 5KSAA 4LQFH 3LZFH 5JZ7C 2VXQL 4H0HB 4MD0B 5ITBL 1WBZB 3LKNB 1A9BB 3V6FB 3D85A 4EQ3A 1QBLL 2UZYB 1P84K 3MRHA 4YGVB 4KY1L 1U8MA 2RCSH 4YR6B 3ZKXC 1MCBA 3CVIH 3LRSB 5FKAA 1JIBA 1U8OA 2CLZA 5ESAB 2EH8H 3B9KD 4FQHB 5I18H 3W5NA 3TBWB 1ZGLM 5I17A 1JNJA 2A6IB 5MEND 3H7BA 5JQ6L 1YECH 4P2CG 2XIDA 1JPFB 4R90H 4P48A 4ZD3L 1MLBB 2OL3L 4NNYA 3T09A 3KLHC 1QRKA 1NGWA 1EMTL 2BVQA 4JN2A 4PLOB 4CMHB 2BVTA 3I75B 2J12B 1ZGLP 5F7EH 3NCEB 4XPBL 2J8UA 3WKMH 4NZUL 1WJ3A 2JELH 5D1ZB 4I3SL 3K8KA 1OP9A 5E6IC 3FTGA 1EGJH 4NO0B 5HTSA 4L8DB 1PKQA 2GI7A 3BMVA 2F53E 1NCDH 5IEKA 3S5LG 4JHBA 3O2DL 4HEME 2NY4B 3VD4A 3WUWB 4NP4H 1LO3L 1QSED 5IW1A 3O8XD 5SWZB 4YFEA 5DHVA 2FX7L 1X5FA 5F89B 4FQXC 3FZUC 2IC2A 4UILH 3TFKD 4K94C 3S37H 3GSWA 1WWWX 4ZDHA 3VFWB 4DJMA 1KYOJ 4OD1L 1TZGH 1FL3A 5CGYD 3IFLL 4JY4B 2EIBA 3LQZB 4U6HB 5D7LA 1OVZA 4OSUH 3OJDA 4FTVA 2VAAA 3CFJB 3WEXB 1P7QB 3G5YB 2NPLX 4UB0L 1YQVL 1IJ9A 3GO1H 4GRLD 1K2DA 2OJZH 2VXUH 1R24A 3MGOB 2PYEB 1AIFA 1NBZA 5LXGL 3SE3A 1CL7H 1JF6A 4F7TB 3O3AB 1EAJA 1OQXA 3P11L 1QFUL 4HWEH 1DSFH 3EO1B 3GIZL 1OTUC 4M61B 1F97A 1FL5A 3P73A 3NGBC 3D69A 5CMAB 4NNXA 3FB7B 3FT2A 4P2OD 2OI9B 4FZEH 1FIGL 5CINH 2EDRA 5E2UL 1QNZH 3W81A 1A3QA 5DTFB 3VWKA 4N8CL 1X6LA 1ZWIB 3BP7B 1QVOB 12E8L 4BQCA 5JPNB 3CDFA 1HH6A 2DIBA 2BSSB 1IM9B 1H3WM 1RZKL 2I25N 4HSQA 1ETZA 3O6KL 5SX4H 4RMWA 4OLYL 1K4CA 2XFXA 1RZIB 1MHPH 2EO1A 5IFHL 4Q6IC 3TIDA 1BOYA 3OMZA 5D5ME 3T3PF 1KB9K 5CILL 1S3KL 5I74C 1IBGL 4QXUH 5CZVL 4