1A6PA

Engineering of a misfolded form of cd2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
94
structure length
94
Chain Sequence
GTVWGALGHGINLNIPNFQMTDDIDEVRWERGSTLVAEFKRKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILDKALDLRILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering an intertwined form of CD2 for stability and assembly.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion
molecule keywords T-CELL SURFACE ANTIGEN CD2
total genus 7
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a6pA00
2ZUTA 4PRNA 2GI7A 3U2SB 2X4OB 3VWJB 2EH8H 4HQQL 5DJ0A 1IGCL 3V4VL 3RX5A 3U83A 5KSVA 1PLGH 2OYPA 3W0WA 3NMEA 1O5DT 1KF9B 2B1AH 5I30H 5KANI 1XF2A 3DPBA 1MY7A 3MA7B 4J3TA 1FNAA 2QADB 4ZFOL 4QTHB 1EPFA 4ODVL 4FQHA 1MI5E 1SMOA 1YYMH 3QO1B 5FA4A 1LMKA 1I3RB 4PGDA 4MNQB 2Z31A 1HOCB 3OWEA 4R0LC 4U4BA 3PWVB 1P7QB 2ZWLT 3LH2H 2VAAB 4H1LH 3HAEA 4DZ8B 3B2UD 1P1ZB 3L3KB 1XGQB 3WUWG 2GK2A 2P49B 3I6LD 2ZOKB 4HIHA 4Y4HC 5FKPA 3MFFB 4BSWA 4PD4K 3RNQB 3T77B 4NJ9H 4I48A 4X83A 1MLBA 1ZHBA 2B2XL 4M43H 3WIHH 1BREA 1WAAF 3HI5H 4KTYA 1G9NC 3SHSA 1FPTH 5F88A 1MJ8L 1IC7L 4RMUA 1EO8H 1QTYT 5J3HD 4XBGA 5J1AA 4X4XB 1EGJA 1ZA6B 1QPXA 5E2JA 3NN8A 3TIDA 1MAML 5D2LF 4ZUSB 4U6YA 4X6CF 4EN3C 2PTTB 5BVPL 5LQBH 2F53B 4I13B 1J12A 2FATH 2ICWA 3ES6A 3MLRH 5GSRB 4JKPH 4AT6B 4X6DA 2NW2A 2GJ6E 2D0HA 4M1DH 3N1GC 4FNLL 5CUSH 3DO3A 1UH3A 3QWQB 3VGEA 3IDJA 4CU7A 5AYUL 1NGPH 4LPVA 5AUMB 5L9DL 4Z18A 5T5FL 1WBXB 5CZXD 1VGEH 2E7LC 4YXHL 5T3ZL 1KYOK 2BSRA 3S9DB 1SYSB 3FO1B 3D69B 2GJZA 5FKPB 1TVHB 3DVGA 4JFEB 3FHAA 1N2RB 4MLSA 5HBBA 1OF2A 4L4TA 2WANA 4LSTL 1EK3A 1S9WB 2AVGA 1FNEB 2NZIA 4PY8I 1I8LC 3FQRA 1KTRL 5SV3A 1F6LL 1OAKH 3O3DB 1JK8A 3N1QC 1JMXA 1X9QA 3HUJA 5I1CL 3O4LB 2X7LA 3BP7A 1FO0H 2QHLA 3SGDH 4OF6A 3SGKC 3DYMA 1DQLH 3GRWH 5DC4B 4MA1C 4JEGB 3WUZA 1AIFB 4IRSB 3FB6A 1KTDB 3L5XH 4Y5XA 4H20H 5IMOA 1OHQA 5F9OH 1MFDL 2P44B 2X4OA 2FX9H 3HI6L 1VKXB 4KK5C 4XPGL 3ISWA 2ZUXA 4GXUM 5F1KC 2IG2H 1U8OA 2NY5L 1HSAA 2BSTA 4QHLA 3TJEL 2GIYA 3ALPA 3GI9H 3KR3L 4LVNC 4XXDB 4F3FA 4X8JB 5GGTL 1C5DA 3CH8A 4LCWE 3EBAA 3UTPE 3H3BC 4APQA 3TNMA 5DJ8A 2AJVL 4OGAD 3LV3A 1OT2A 3THML 3V6FA 4RMQA 3LSOB 2MCPH 5H35B 1RVFL 2FO4A 1N2RA 43CAA 3GGWB 5ANMB 5SX5H 2ADGA 5EORH 5DD6A 4NN6B 3WE6B 1KCLA 1INDH 1NFIA 3RAJH 1CXEA 1WUNT 2JB5L 4ZO8A 5D8JH 1N5YL 4GG6E 5C6WH 1KLGA 3KJ6L 4OGZA 2IQ9L 1JNLL 1YEFH 2DI8A 3OKEB 2FNBA 4YLQT 4ALAL 3QT2A 4JO1H 4L4JA 1DBMH 1N64H 3SCMA 2IH1A 4BZ1H 1MCBA 2HYMA 4N0YH 4UTBL 3O4LD 1IGIH 3BP4B 5LQBL 3QQ9D 3O41A 1ZWIB 3SDDD 3C09B 1D6EB 4JFXB 4M61B 1EVTC 1WAAE 1CK0L 1UWEH 3VXSA 4ZUWB 3PNWA 5D96B 4F7MB 3AC0A 3QUYC 4MMXC 5IVZA 5CEYB 4KK9D 4NN6C 5CZXC 1LGVA 3L3IB 2YUZA 5T1KD 1MUJB 5I1JH 2BVPB 5EN2B 4Z77B 1EFXB 1KJ2L 3ZHKA 3MLTA 2DQHH 3V6FB 3BZ4B 1OAXH 4PJ5A 1P53A 4DVRH 1YC8A 5GS0L 3GSNL 1KJMB 4XP4L 4PGCB 4WV1B 1A1OB 1J5OH 1CD0A 1MPAL 1NBYA 4I3RH 3QDMD 1T0NA 4I1NB 2CJUL 4NZRH 2R4RH 5JA9A 5KW9L 4MQ7B 4U6YB 5D1ZB 4ZOCA 3X3FL 5ELIA 1K3ZA 4PGBB 1HXYA 3BVNA 4OT1L 2ICWJ 3QQ4B 3MLYL 2K7QA 4ZO7A 5C0EA 4LLAA 5E6ID 1I9IH 3OSKA 5SWSA 3AREA 1CFNA 3N1FC 3JTSB 2EC9T 3EOBB 2R8SH 3QDJA 4HUXA 1BZ9B 5JMRA 4OF0A 2DMBA 3UC0H 1JZ7A 4LQFL 2F15A 1HDMB 3MLXL 5B4MD 1RY7B 1T4KA 2CKBB 5T33H 1BZ7A 3STZB 4S1QH 1WVZA 4L9LB 4TVPH 3F6IA 3AUVA 4YDIL 4YWGH 3NAAL 2OK0L 1QBBA 2UV3A 2R9HC 1MNUH 2W1NA 4OTXL 5M95B 5FB8B 5EWIL 3BKMH 1S9WA 5SX5K 4A6YH 2A1WH 2VSCA 2R2BB 1S78C 5TPWL 3C60A 4KJQD 3RY4A 1AGFA 3VXNA 5F44A 2IGFL 3HE7B 4ZPVB 1KXQE 3RA7H 3IXAA 4MXWL 1UWGH 4F80A 3Q6GH 4PJFE 3IJHA 4L3EA 3FTGA 4PG2A 1NEZA 4RAVA 4NQED 1A9BA 4ODSH 5DZOA 1EO7A 3ZO0A 4EIZC 5E6IA 5F71A 4Y5VC 2YD9A 4ZS7L 4ZFFB 1A2YB 4M02A 3P11H 4N0CC 4ZYKB 3VWJD 4X6BA 3CMGA 4DAGL 4PRPA 3CIQA 2A0LC 4WW2F 2VWEE 4PGBA 2P8MA 5B38G 5DUBA 1MJ8H 5HDBE 5F7FA 3U9PH 2D31B 4BK4A 2Q6WB 1DTUA 1D9KD 2UUDK 5I9QC 5TF1L 1JZ3A 3OKNB 2NW2B 4KV5F 4IMLB 1K8IB 4D0DA 3B2VL 4L8DA 4ZFGL 4MX7A 2M8XA 4G43B 1QSFB 3D48R 1MREH 1HEZA 3V6ZA 2Z31C 1C7TA 2FJHB 1JNHB 4YHYC 5GISL 4GG6F 1QSZA 1RZJL 5CSBA 3VE0A 2Z35B 1I1AC 1R3HB 2B2XH 4F2MB 4LSRL 1INQA 4LSSL 3I84A 3MV7E 4GLRH 1IC5H 4QCIB 3C2AL 3DETD 3V0AC 5LBSL 3QZWB 3WN5A 3KXFE 1XR9B 4UDUA 3HR5A 2FEDC 2GSGB 4UT7H 4JO2L 2AJXH 4P9HH 4NKMA 5E1HB 4EDXA 4YGAB 4P0DA 3SCMB 1X44A 1IM9A 5JOPE 3MZGB 4P57A 3ULUF 4M8QA 2PYEE 1KJVB 4G6ML 4D9QD 2E27H 1WISA 3S8WA 4LPCA 1MRFH 1KXVC 3EYQC 3MC0A 4PJEB 4U3XA 4XCCH 5CEXB 3NPSC 1GGUA 4MQ7A 4WY7L 5E4IA 4RQQA 5KAQG 2VZOA 3MRPA 3WHXA 3SO5A 2X6MA 5DSCB 3HG1B 2N7AA 4KI5E 4H88H 1G7IB 4HKZB 3U6RA 5FOBA 2DM2A 1QFHA 1VB9A 2ITCA 3G5VA 4R2GD 3ARPA 1B2WL 1JWUB 5FM8A 3QHTC 5DC9B 3O6FD 5T5FH 1HSBA 5JO5B 2AXJA 1YMMA 1CGVA 3HC0A 3NAAH 3FT4B 1G7HB 4FP8H 5D70L 3MUHL 4DFIA 4BQ9A 4NRYA 5KVGL 2XFXB 1IEBB 4KRPC 1NKRA 1JF6A 5DTFA 4PRHB 1ZEAH 2IADB 3QEQD 4UT9H 5ALCH 4JG0L 5KVDL 2FH6A 3FONB 5AWNL 4HLZH 4F9LC 4XNUH 2B5IC 2ESVD 5C07E 5GRXG 2WQRA 5LVEA 3QFDA 4Z9KB 5ISZD 2QQNH 5BVPH 4P5TD 4JM4H 1YMHB 5JW3H 5E08L 2OJEB 3QULA 3SDAD 3D85D 4MDJB 4JPVL 2G2RA 1FE8L 4JZJC 5IGXH 3MREB 4BFIB 5BVJA 1FH5H 4CL7A 1JTTA 3KPMA 1LD9B 2CKNA 2QADD 1UJ3A 1VHPA 4LHJB 3HC3L 2P8MB 3JTTB 1BPVA 5C07A 1JGVH 1FVEA 4XNQB 4Y16B 1J8HB 2G75A 3PWUA 5BS0B 1D5MA 4HWZA 5C0DA 4P4RB 5FB8A 4JHZA 2PYEA 3V7AG 2H9GB 5FHBL 4KK9C 2V5RA 3QUKA 4KKCD 3MPCA 4TSBL 4DEPB 3O9WD 5JOEA 5C0CB 3SO3B 3WFHB 2XQYK 4ZG1A 3SDDA 3FO2B 4XP1H 3LHPL 4K3JL 4LASL 1JGDB 4FQIL 4HV8A 3I6KB 1TMCB 1WT5C 2J4WH 4JPIA 3QH3A 5ACZB 4S0SD 1TCMA 4FG6D 4I5BA 3LS4H 4Z7OF 3MRIA 3QIUD 2DB8A 3DV6B 1T20B 3MXWH 4F8TA 3WNPA 2J88H 3X14A 3WO3B 1OAXL 2R69H 2DM3A 5C0RL 3EYFB 3FFCA 5E94A 2DQEH 1H3GA 3RBGA 3SCMC 3K1KC 3KYKL 4R3SA 2R23A 1F3JA 3R4DA 4GQ9L 4X4MA 2QSQA 5HGAB 4DGIH 1S7QB 3LKRA 1XGPA 5ICXB 3H42L 3QIWD 1H5BA 1QKZH 5AYQA 4OZ4A 2XNAA 4JKKA 3O8XD 3S36H 4ZOBA 1OL0A 1OSPH 1N26A 2B5IB 1UG9A 3VE0B 3ULVH 3NIGE 1XGQA 2HTKD 4NN7B 5B4MC 4LVHC 1G7QA 1KN4L 3JXAA 5FXCH 4D0CB 3QCVL 4F2MA 4J8RA 3AVEA 3MOAL 1NQBA 3BQUB 4LCIL 2Z4QB 3LN5B 3PP3K 4FQLH 4MVBD 4GBXC 4GW1A 3M1BB 3AGVA 4ZFZA 1MHCA 1ORQB 4Y5VA 1FN4A 4U6HA 1BQLL 1GOGA 4HGWA 3G6JA 4BFGA 4J3XA 1G9ML 4DFHA 3F7QA 4WWKA 1JNLH 1YEFL 3CH1B 3VD7A 3GDBA 5DJAB 3CSYA 4H5SB 1NDGA 4TNWF 3V0VB 1IQWH 4KZDH 3HRZA 1T2QL 1I9RL 2W9EH 3DGGB 2XA3A 2BHZA 5FV2A 1NUFA 4JHWH 4GAGL 2VXVL 1MHPL 4R7NA 3QG6B 5F21B 3WHXB 4DW2L 2X9WA 2NPLX 4MCZA 3V5DA 1ZA3B 4F9PC 2G5BB 3DXAB 4LLWA 4LIQE 1YMHA 1CK0H 4F33A 3ARFB 1MIEL 2P5EE 4LVOC 4G3YL 3BRGC 4KKBC 4CGTA 1PY9A 2ZCKL 5DHYB 5I16A 2E9BA 3LQMA 2HJLB 3MR9B 3A67L 3ZT6A 2Y5EA 3FL7A 1H5BB 3REWA 4WU7B 1LDPH 3BX7C 3FT4A 2VR5A 4J6RH 1AXSA 1RZ8A 4YHNA 5CLWA 1AR1D 2HRPH 2VZ1A 5EDXA 3CX5K 3ULUD 1DQTA 1P1ZA 3L3KA 1K5NB 4KH2A 3EYSL 4L9LC 2LAAA 2GITB 3WJJA 3E8UH 5BS0A 4KGJA 5DYOA 1LHZA 1YEEL 1J7VR 5TQ2L 2X05A 1CICA 2WIIA 5F9JA 1C1EH 2ZJSH 1DZBA 2QQQA 4DKFL 1S5HA 5CHNB 3BGMA 5CJXA 4DTGH 3V0WH 3OG6B 2OTUB 3JUZA 3GSWA 3ZDYF 4LLMB 1OQXA 3QHZH 5F97E 2A74A 2CK0H 1UWEL 4HPYL 1D9KB 4MWFA 4YHMH 3U46B 1NAKH 1Q9OA 4KWUA 4MDJA 5J8OA 5KTEH 4PJ7E 5H37G 1VFBA 3J8F7 4FQHB 5L7XH 4OZIA 3DGGA 4L4TE 1MQKL 3MRIB 3HC4H 1AGCB 5CEXA 3TIDB 5E2UH 3D0VB 2CSPA 4G8FB 1M71B 1MCPH 5HJ3A 5FDWB 5FYLE 4I0PB 2CUIA 4XP4H 4RNRB 4GG8B 2ID5A 4R97B 1WLHA 3MBED 4NN5B 1U8KA 1RIVL 2O5XH 3S4SA 4UV4H 4U1SB 5AD0A 3KLDA 5ITBL 1S9XA 4F57H 2DI9A 4P5TA 5EZJB 4X5LA 1UEMA 4OZIE 3FQUA 3N0PB 2IF7A 1OCWL 2DQDH 2NW3B 3L95B 4MNGE 4U1IB 5EU4B 3RVTD 4N1CA 4UDTB 4PRPE 4MVBC 1E27B 4BH8A 4MMZC 2FJFA 3PWPA 1IGMH 3V4PL 1Z9SA 2CDEA 2VUYA 3TPUA 4U0QB 1RJCA 1S7WB 3PXHA 3DIFB 3SGEH 1F90H 3DV4A 3EDDA 1FYTA 3B8SA 4X5WB 2X09A 1URLA 1HWHB 2J5LC 2FGWH 2IALB 1TDQA 3ZTJG 3D3VA 1ZTXL 1A02N 5E03A 3U9PL 1FLRH 3PWLB 3O9WA 2DMCA 2YR3A 6FABH 3I9GH 1CDHA 1FFPA 2ED8A 2ERJC 4PB0H 3T2QA 3X3GL 3NZHL 4N0UA 3U4BH 2PO6B 4Z0BH 4Y19B 2XRAL 1VENA 4QRTB 4Y5XB 4XVJL 4PP2A 2AV1B 1D6VL 3UTSE 4XHJC 1NUGA 4PRIE 1UWGL 1CT8A 4QOKA 5FUCC 1F8TH 4DCQA 1UA6H 2HJKA 1I85C 2WAHA 3I6LE 3KPRA 5C08D 1L0XA 1NC2A 1YN6B 5BW7C 1IEAA 4N0CD 1DN2A 2FSEB 1LE9B 4OGYL 3RWIB 3K4DA 1S9XB 5IGXL 3QQ9C 2NXZB 4XWOD 5JNYB 4PJAF 5EN2A 1WT5A 4L1DA 4ZAKA 5HHMD 5I17B 4W81A 1YPZF 2GTWB 1DVFC 4UNTA 1GPOL 5K9QG 2VLKD 3VGAB 1QBLH 1YNLL 3T0DA 4TUKH 5F7NC 3QB7C 1PFCA 3EHBC 4OZFA 4PRIA 5TQ0H 5EU5B 5TF1H 4N68A 2PO6C 5ACLA 1TNMA 1X7QB 2I9LB 5FHBH 4YR6A 2KUTA 4GXVH 1WZ1L 2N56A 3FT3B 5EO9A 2AEIT 4KKAD 3VFTA 3TO4C 3FB6B 1GIGH 3T1WA 3NIDE 2W38A 4X4ME 2OI9C 4PJ5E 5CJOH 5HHOB 5IVNA 1KLGB 3M45A 1T1XA 2XWTA 2IALA 4IIQC 3VI3F 2LQRA 4L4VD 3WJLA 4ISVA 3BPLB 4AIOA 1SJEB 5T1DL 5DA4A 2D7TH 3I6GA 2EIEA 2M2DA 4JCMA 3TN0B 2IC2A 4S2SB 1GGCL 4LLVA 4WU5B 3R8BB 3CFBB 4LVHB 3C2AH 5IQ9B 1AGCA 1B2WH 5C0AB 2GW5A 3BKYL 3C8KA 5ERWB 1DQQA 1F4YH 1JGVL 1LK3L 4F8QA 5A43C 3GK8H 3GIVB 3OAZH 5JORA 4P2RB 3RI5K 5J11B 4XZUB 3F7YB 4M6OL 1QBMH 4KUZH 3P2TA 5D6CB 5GGRB 4LBEB 1W0VA 4KDTA 2GITA 5IEKB 4U1JA 3ZDXF 1YEKH 2E27L 4OD3L 4NQDB 4D0BB 1LEKB 1BIHA 1LO4H 4P99A 4HK3N 5E99H 1A9EA 1TPXB 4UU9B 1A6AA 3R0NA 1WFUA 3FT2A 2W9LA 3C6SA 3E6HB 4PJCF 3UBXB 4N9OB 2QL1A 3NCJH 1CFSA 3TA3C 2EDKA 4C58B 4NDMA 2PN5A 3IFNH 4DN4L 5A16A 1RUQL 1T5WA 1H3XA 4FFZH 1MCJA 3VXUE 2F54B 2CMRH 3BDBA 4X6BB 4KVNH 1JUFB 5EZIH 2FGWL 4YC2C 4KJYA 4Y2DC 4MA8H 4K7PL 2DYPD 2YPLE 1VPOH 4GRMB 4TN9A 3D39B 3X3GH 1P7KA 4PRID 1F11A 2DLFL 1TTFA 4L3ED 5HVWA 4IRSC 1IQWL 4IRZH 2IAMB 1INDL 3HNSL 3BUYA 5D5ME 3O45A 1INEH 2DWDA 1P2CB 3VXQA 4MA1B 5AD0B 1RZIB 3DRQA 3C87A 4LVEA 2V17H 2EE2A 2W0PA 2HKFH 1SYVA 4W4NA 4AL8H 2AJ3A 1JGLH 1EFXA 4PTUB 4P2RA 3CCHA 3F12B 3LPGA 4JQXC 4XP9H 1ZVSB 3QCTL 3ARWA 4D94A 5C0AD 4DVBA 5D72H 4LRIA 5L8JB 3UTTA 5DJDA 2R0ZH 1NC2B 1A21A 4M5YL 1A7BA 4Z5RA 5DD3L 4G3YH 2G60L 2VDPH 3RNQA 4Y1AD 4AENB 2YC1B 5FUZL 4BELD 2VZUA 2RBLA 1FL6A 1KYOJ 1L0QA 4CVXA 1N4XL 3IDNB 3WXVL 4R0LB 1UM5L 1MJUL 5L8KB 4KXZI 3IXTA 4M62L 4QEGA 1KB5A 3T1FB 4MJIA 5JW4N 5A16B 1JF1B 7FABH 5DO2C 2Q7YA 1J1PL 2SEBA 1L7IL 1U41A 3P0VL 3U46A 3MV9B 1HINH 3F62A 4LKCB 3VXRD 3MJ7A 2I9LA 5DZNA 3BMWA 4LKXA 4P59L 3WUWA 3DUUA 4QKXB 4R4FH 1GGIL 1DVFD 1RUKL 5DLMH 5E9DE 2CO7B 2EH7L 3AMKA 4YXLL 1IGFH 1MPAH 3HE6A 2HKHL 3QUXC 4F7PA 5I2IB 3NACL 2DQIH 3CUPB 3OJ2C 1U3HD 1FZKB 5GS1B 4EVNA 2DICA 5GRUL 2R1WA 2Y07H 3MFGB 5CS7A 3RWIA 3BI9X 4ODTH 4IMKC 4U1SA 1QEWA 1I7ZA 3ILQC 5SWQB 4HC1A 3OHXA 1YMMB 1HEZB 1WBXA 3W2DL 3W9EB 4PJHB 4JY4A 4XVUC 4GO6B 1I9JH 3HAEB 1NBVH 4PJGE 4PLJC 4O02L 4PD4J 1X7QA 3FRPG 5EUOE 1NAML 4Y4HB 5MENE 4WW1A 4PB9L 4Y8AA 2NY0C 3IDMB 5CBEA 3TA3D 2EDXA 3WNMA 4URTB 2Q86A 1J0HA 3CLEL 4IOFD 3GI8H 4S1QL 4TVPL 5F8QC 3SDXA 3BSZH 4PRPB 3HNTL 5JPNB 2GT9B 2VLJB 5DJ0B 3O4OC 5HGGS 1H0DA 4NC2B 2WZPD 1IGYA 4PJCE 4X6CB 2E9JA 1CYGA 4M7JL 5KTEL 2SEBB 3K46A 4KVNL 5MERB 1FL5B 1OAUL 3L5HA 3OKDA 3C5ZB 1JYVA 1IM9B 3HZMA 4CN6A 4F9PA 1P9MC 4M6NL 1A4JA 1TJGL 3RTQA 4WTXA 3VG0L 1B3JA 1PZUB 4P23C 3QUMA 5GGSB 4Y5YA 2CR3A 5MENA 3LKSB 1BMGA 3VXTA 1PKQE 2QJDA 4CN1A 5GS3A 1KTLA 2BCKA 3GSOA 4GSDL 4Y2DA 5SWZA 4EQ3A 1MFAH 4NQCB 1GXEA 3SO3C 1AJ7H 4EBQH 5IESL 5F9AC 3WFBL 5IB4B 1U42A 4WEBH 4YHIB 3H3PL 4EI6A 5F1NB 2VXTL 1DLFH 3BAEH 4RCAA 5HHME 3ARGA 1WZKA 3QCTH 4QCIA 3QEGH 2XRAH 5SWQA 4XMLL 3BRFA 1SYVB 4APQD 4OLVL 4NQSA 3AS1A 4RISL 2VXVH 4MA7H 2YXMA 5JO5A 1PQZB 4HKBB 2YKLH 3KYOA 5C86A 4WI5A 2AEQH 2B0SL 1RIHL 3EJYC 4YK4C 5HHNB 4ETQA 1HYSD 4RGNC 5GJTH 2ZOLB 2EC8A 1U93A 1T04B 1X5ZA 5EOQL 5D7IA 1RMFL 1UB5B 1XF4A 5IHZA 3CXHK 4KJYB 3OPZL 3SDAC 1J8KA 1ODAA 1RHHB 1QRNE 3GO1L 3B5TA 1YY9D 2RCSH 4P48A 3TYGL 4QGYA 1W72A 2JELL 3P9LA 4K3HA 2F5AL 3U9UA 1T1XB 2A6JB 2JCCA 2Q76A 4NQCE 5ADOH 1IARB 4HK3J 3C5ZA 2Q7YB 3ULVC 1XF2B 3FOMB 4R90L 1U9KA 4NBYB 3K4ZA 3NCEB 4ORGB 3MV11 3DX6A 2HKHH 2DD8H 2ED9A 2MNUA 3P4MB 1ADQA 3PJSA 1X5XA 4DKFH 5ITBH 5EU6D 2HH0H 4XPTL 2P46B 3CCHB 3F12A 1NAMB 1UJ3B 2YS4A 3CK0H 3Q6FB 5FCUH 2BSRB 3IU4L 4KVCH 1R6VA 5J9PB 3P4OB 1X4ZA 1MCWW 4Y16A 4TNVK 3G5YB 4FQIH 4M5ZL 1S8DA 4HJJH 1PYWA 1QPPA 1JNJA 1YC7A 2VITB 3NIDF 4RZCB 3PV6B 1FH5L 5JOFB 3MRLA 4BZYA 3TV3H 4K07A 1A0QL 2NLJB 2JJWA 1A7OL 3BH9A 2OI9B 3QULB 4FZ8H 5E2WH 3QYCA 3MTRA 5C0RH 1KV3A 4HFWB 5B3JF 5HYFA 1KJVA 4IRSA 1MFCH 2WNGA 4NNPL 3WD5H 1T20A 3UAJD 4U7KA 1ND0B 1E4XI 4YQXL 4HWNA 5GJSH 5HSFA 1OCWH 1AR2A 1SMAA 5TE6L 2R2EA 1X4YA 2FEDD 2NR6C 2F5BL 4LFHD 1SY6A 5K33A 3BZDA 5INDA 3E6FA 3W39A 5HYSA 2YXFA 2X5PA 5FKAA 1L4IA 2XQBL 2PYEB 2YBRA 4PJIA 3GUTA 3G5VB 4N90D 1ROWA 1LO0L 3TYFA 1J0YA 5I8KH 2WUBH 3SJVD 4PS4H 4HHAA 4CW1A 3VMOA 3FB8A 3VGBA 4JPKL 5F7WC 3LRSB 2EC9U 4P49A 3QPQD 3EOYG 4PTUA 2ARJB 4GBXA 4KAQL 2B1AL 3IU3A 3P4OA 4NNYB 2JJUA 3HI1B 3VFRA 5DD5H 1MAKA 1NJ9A 4ZXBD 2ADFH 2J8UB 4AEHH 1XCTA 5EULV 1UH2A 1UXWB 1MI5A 3AU1B 1GIGL 2YN3A 4E41D 3QUML 5HGBA 5ESAB 3IYLW 4OCSH 1JZ8A 3CFDB 1U95B 3S36X 3QG7L 2JJSA 5DI8A 1IBGL 3P73B 4J4PA 4WUUD 4POUB 5IVXF 2AEPL 1BD2E 2VQ1B 4LCIH 2IANA 2W91A 3D0VA 5D1XC 2MFNA 4IM8A 3ARRA 3KAAA 2VABA 4J23A 3L3DB 4ONGL 5JIHA 1W72B 5HDBF 1CL7L 2D2OA 4O2EA 4PJ7A 3RWFB 3WNKA 4PJFF 2Z93B 3WFZA 3CVHL 4PJBB 2EDLA 1V5JA 4BQ6A 3HZKA 1U3HC 5JZ7D 5DMGD 5IR1B 1HHKA 4J8RB 3V95A 5C0DB 1CE6B 3EFDL 5FHAL 2DL2A 2ZG2A 2C26A 5I6XB 5EZJA 3V6ZB 3TNNB 4FFYL 3UTOA 1OTTC 3K3QA 3O6FA 2J3SA 3FKUS 2F53D 1C16A 1IAOA 5HY9A 1FGVL 1CFQA 4XPBL 2Y7QA 1KLUB 1A6ZB 5IW1A 5L2KE 1DDHB 3VFVA 1K5NA 5DS8A 3WHE0 5IOPA 3O6LL 3FQTA 3VJ6A 4MDIA 3BGFC 3IGAA 2V5YA 4UNUA 5CUSL 2AJZA 5F7DA 2BMKA 4JJHA 1BJ8A 4L3CB 2X1QA 2COQA 4KUCF 2VITA 4BKLB 1C8PA 4X80H 4FZ8L 4QXGH 1X5GA 1HH6B 3CLFH 1IGIL 3Q5YA 5IMMB 2CPCA 3NCCB 3BEWB 3DOSA 1NEZB 2HRLA 1S7VA 4P4KC 4MD0B 2IH1B 5BRZB 5I0DA 4I18B 1LEGA 1UZ6F 2C1PA 1KJ2B 5E8OB 4YXLH 4QO1A 2D7OA 3BT2L 3G6AB 5EB9A 4DJMA 3ROOB 4Z0XA 1XZ0B 4HK0B 5D9SB 3MLSL 1LEIA 3GKWH 2AQ1A 4QTIL 3TN0D 3PQYB 3TCXA 4HS6A 4P5TC 2NY6B 4LNRA 1CFBA 4MD4A 3GHBL 5KZCD 5CD5C 4NYLB 3PNWB 1M7DA 4XTRC 1JWUA 1U8KB 3ROLB 3L3IA 4XNZB 4K94C 4W6WB 2E8ZA 2GTWA 4UILH 4MA8L 4OLZH 4XAKE 3L3GA 1TCRB 4QY8A 4KMTH 1UFUA 4MHHG 5CINH 2FWOA 4N1EA 5IG7A 4OKVB 2EIZA 3L9RB 3OZ9L 2VUOA 2ZOLA 1UYWH 1GZQA 3MOBL 3GNML 5L2KD 1ZHNA 3BE1L 5GGSY 5TJWK 2X4RA 1ZXQA 4YBQD 4KHTH 2BP3A 1NLDL 4RGNB 1RHHA 2XWTB 4JGUA 5DVLA 1IGFL 5TQ2H 3K0WA 1MHHB 4G7YH 4MAYB 3ZTNH 3QDAA 3D3VB 5HGDB 4PG9B 5IROC 1JRHL 4JRXB 2BNRE 5DEZA 3KPNA 5EC2A 4HDIA 5KVFL 4NO5B 5EFIB 3GJEA 5CD3A 4FQCL 4HGKC 4MQXD 1A5FL 1YUHB 2FBJL 5JXAH 2IH3B 4MJIE 3O2VL 1Y0LB 2Q3AA 5DR5H 2EYTA 5I8EB 2OSLA 3T2NL 1MNUL 3ZE0E 4OGAC 1J8HA 5KOMC 1P69B 3CZJA 1A6WH 3MLZH 1W0YT 4JRYA 4KJPD 4HIHB 1EUTA 3PQYD 2X89D 1F4XL 1RJYA 1ZANH 5EO0B 2FSEA 1LE9A 1AC6A 2D9CA 4JDZA 4YHPB 1LILA 1LP9E 1SJXA 3QIWC 2NY3B 5C0CA 3FB5B 1J88A 2BY1A 2FIKA 3CFEB 1F3RB 2XI9A 1J1OH 4IRJA 4Y1AB 5ESAA 3TBYA 5I76A 1DDHA 2AXGA 4LEXH 3GBMH 4DAGH 4HJGB 3QXAA 1G7LB 5E6IB 2CLVA 1AD0B 2RCSL 1RK0B 3MNVA 5DQDH 3OX8B 4Q0XL 4N0FB 4MCYA 4MS8C 3EDKA 3GKZA 2ZZUT 3CDCA 3W0WB 3RFZC 2Z93A 2ZNWA 4MQSB 4WO4B 2JF1A 4NUJA 4NSKA 4EBQL 5IESH 3FN0H 1JE6A 3FCTB 4JY5H 3P4NB 1BFVH 1P4LA 4KQ3H 1S3KL 3PABB 1YUHA 3U1SL 4Z7OE 4EUPB 5D7JB 5F6HI 3IETB 3LAFA 3FB8B 15C8H 3RWGB 2OSLB 1SY6L 43C9A 3PGCA 1HYRC 1KLUA 3BPCA 4KJQC 3JV4A 2IAND 4HEME 1F5WA 1B4JH 4WUKL 4R2GC 3KPLB 4DGYH 1ZHBB 1YN7A 4NC1E 5T3XE 4NQUA 2EE6A 1F45A 2QEJA 2UZXB 4Z7WE 5HHOA 1P6AB 1UYWL 3HUJB 4ONHA 1OQOA 3B4NA 3PWNB 1PKQB 4X7SL 1JI1A 4HUWA 4YUEL 3QNXB 4OKVA 1RK1B 5ADOL 4G6FD 1EZVX 1IAIH 2JB6B 1NLDH 2Y23A 3KPRE 1AD0A 1NFKA 4MAUL 4M8QB 4FXGB 3ET9F 4WEUD 5JHLL 3TP4A 1TZHA 1T0PB 2DS4A 1R3LB 1KEMH 3GBNH 1IE5A 1MI5D 1AGEB 5JDSB 5I71B 2HKFL 4Y7MA 5BRZE 5DUPH 2QR0B 5GJTL 4GRWB 3SKJL 4AK1A 1A1NB 4U1JB 2EDEA 5D2NB 4P4RA 2HTLC 2K9UA 2KPNA 2LU3A 4J3VA 3GSXB 2WWKT 3MBEA 5SX4I 4N5EC 3OGCB 3IETA 1D5IL 3BDYL 3VFUB 4H20L 3W9EA 3O6FB 4YNYA 1NMCB 2FX8L 1CLYL 4O00A 4XI5C 3BIBX 1YDPB 3BFOA 1OAZL 2XTJD 1S7RB 3DWTA 1NKOA 5C3LD 3L5WA 3MOQA 4OCRL 3HNSH 1JPTL 5IK3A 1U58A 3ARDD 4CU6A 5E2VL 3LQAL 3RL1B 2O5YH 3RWHA 1ZLWH 1IMHC 3RGVB 4R0LA 3X14B 5C0ND 4IRJB 5GGVL 1HH6A 4OLUL 1OAYL 4WWKB 4NGHL 3ALXA 1UXSA 3SPVB 1CICD 1NSNH 2DQIL 4ODXB 4RIRA 1MCPL 3CFJA 2ATKA 3HKFA 4WO4D 4ZNCD 5D7IF 4NP4H 2EIDA 3DX9B 4HS8L 2ZUYA 5HD8C 4U6XB 5E2TL 2AJ3B 1Q9WA 4C56B 5HHQB 3MRDB 5SV4A 2O93L 1MCQA 3DARA 2AS5M 3UTZA 4NQVA 3MRMB 1NLBH 3S4SB 3BJLA 5HPOA 3GSXA 1D5MB 5BW7A 4YE4L 3L5JA 4I2XB 4WFEE 2XXCB 1P5VA 5GGRY 3ROLA 4U1NB 2P1YA 1MLCB 4JN2A 5KSBB 1OP3K 5IHLB 2DQUH 4YX2L 3OF6D 5EU4A 3VXSE 1O7SA 4LPXA 3OR6A 1KEGH 3MRCA 5IWLC 3HNVL 1RZGA 5T5NF 4IHOB 1FIGH 3EOTH 1EIBA 2UWEF 4O2CA 5ICZA 1CLZL 1NMBL 1HQ4A 3O2WL 2VLRB 4XP9L 2E7MA 4KXZH 2E7CA 1X5JA 2MCPL 3U79A 1S9VA 5C3TA 3INUL 4FP8L 3X13A 5BQ7A 1FLRL 4R9HA 4OFYD 1KJ2H 2LTQB 4ONHB 2UZIH 4XRCB 1CU4H 3WIIL 3UBXI 4MXQD 3KNBA 4PJDA 5I1KH 1BJMA 4P46C 3GMPB 4B41A 1KIUA 1GZPB 2GTZB 3T0EA 1FZJB 1KBGH 1DBML 1N64L 3S3JA 5DK3A 3DXAE 4PP2B 2A0LD 5DJYB 5E1AB 2EDFA 3OKYA 3QJFA 1MHEB 1TETH 1Y0LA 5BOZG 4DCQB 1KTLB 3CFKA 2VDNH 3D1MC 3MRMA 3ULVD 2D03L 3LZFL 5T3ZE 2XG5A 5IB4A 2GJZB 4Z76A 5KVFH 1UACH 2J8UF 3AFLA 2AAVA 2V7HB 3ZE1E 3QDJE 1BZQK 4BFBD 2P5WD 5D1XD 1MFNA 3ARGB 4S1DD 4DKAA 2FZ3B 5CGMA 1FBIL 3L3JB 1N5AB 1WEJH 3UC0L 1TTGA 1L9NA 1U91A 1LO3L 4HIJA 1RZGB 5I1JL 3DMMA 4KQ4L 4HUWB 5IP4A 4P3CH 3F8UB 3P30H 4C83A 2C3HA 3VW3H 3VFTB 1YEJL 2X42A 1A4JB 4PJ9C 4APQC 3PL6D 3U2SA 3DUHA 5EO1B 2BK8A 5MI0B 3VI3E 3QG6A 1MREL 3TJHD 2CJUH 4NZRL 2MTPA 4OSUL 4D9QE 2CIIB 4PJBF 2B0SH 3RHWK 2I07A 3CK0L 4XPHH 1TTUA 2R56L 1VA9A 3MV9E 1ORSB 1BQHA 3G5ZA 4PJAB 4WTWA 4R4NC 4OZFG 3DSFH 5J6GB 2G9HA 1XIWC 5EA0H 2HRPL 3MSPA 4WI7A 3LS5H 25C8L 4JQVA 1EO5A 1FSKC 4BQ8A 1B6DA 3QQNA 2XV6B 3UTZB 4JM2B 5K9JH 2H6PA 4FXKB 2LTQC 1IEAB 1JPSL 3FO9B 1MRCH 2L7UA 4KQ3L 1QVOB 3TFKC 3WEXB 2GAZA 4PJAE 2A9ML 1WC7A 1KIQA 3MCG1 4NT6B 3SDCB 1XCQA 2MHAA 3TO2A 1Q1JL 1ES0B 5LWYL 4ENED 4XX1E 1O7VA 5C0BD 2C4FT 4N8VB 3E3QC 3PWLA 5BJTA 4UQ3A 4RFNB 4NKDA 5MP6L 3QEHA 4HUKB 3RU8L 3NBNA 4CDGC 3P73A 4DGYL 2ZNXA 2XN9B 1FZOB 1DBAL 1FO0L 1KN2L 4XCFL 4TTDD 1NCNA 4OGXH 5BRZD 1N7MH 3ARGC 4KHXH 1XGRA 3EO1A 1QACA 5TE7H 1T4KB 2CKBA 1F13A 5IB3B 2KZWA 2BNUA 4NQDD 8CGTA 4GW5A 3U1SH 3VXMA 1RZKC 1QNZH 4LLVB 4WU5A 1WAAA 3T0EB 1FZJA 3G5XA 3IDJB 1TVDA 2D0FA 3OGCA 5TFSH 1MHPH 1PBYA 2D03H 2GKIA 1TZIA 1FFNA 3JV6A 1KCUH 5E5MB 5JXEA 3KYAA 4YQXH 3EO0A 4KKBD 3QI9C 3VRJB 5FO9A 3G9VA 4IRJC 2CKBL 1R5VB 4MHHI 2EH8L 4HFWA 4HQQH 3P0GB 4QWWD 2GAZB 1BVKA 1HQRA 2X40A 3IAQA 3O9WC 4D3CH 5ABDE 3PUCA 5IB1A 3VXPA 3IF1A 4GMTL 2R2EB 3DMMB 3W5NA 4EDXB 2Y5TA 4X98A 4PJ8C 1I3GL 3BH8A 3EZ8A 3EJYD 5JQ6H 2GSIA 3E8UL 5L2KA 3SE3C 3QEHB 4UOJA 1OPGH 1YEIH 3PE9A 4LQ1A 2APWA 4FTVB 4JANB 4Q6IB 5TE4H 3REVA 5MHSD 4HHAB 1TQCC 3AM8C 4QHNB 4QWWC 3UTSD 1I7TB 4ZUSA 4QRUB 4NNXA 5JZ7C 3ULUL 2Y07L 5CWSB 4N0YL 2XTJB 2VOTA 2FB4H 3BESR 1P5UA 3RKDC 2BVOB 4HWZB 1W2KT 1VADA 2JCCF 3TC9A 5FUCE 3HAEG 4GRLC 3QUKB 3MJ9H 2F5BH 2DQFB 3GMLB 4X9GA 4F15B 3VH8B 1BX2B 3I3EA 4XC3L 4PYHA 3R8QA 2QV2A 3T3PF 1G7HA 1EX0A 4H0HB 4DUVA 5DT1L 3NCBB 4JPIB 3RJQB 1FCCA 2D7PA 4TQEL 4A6YA 4CVWA 3ILQD 4YR6B 1GSMA 4QHKI 2ZUVA 4Z7VF 1ZT1B 4U7MA 4K2UL 3K74B 3NN8B 4ZYKA 4L3EE 4TSCL 4FQJL 1EEZB 4WFHE 5IBUB 4XVTL 4NWTL 1XGUA 4D8PA 3IFLL 2XTLA 3KPQA 4Y88A 3QUZD 2VXQH 5LG1A 1UJTA 3RGHA 4MJ5B 1RI8A 5FM5O 1KGCE 3VFWA 1WK0A 3CZFA 2FH8A 3W39B 4GKZB 1RFDL 3EUUA 3UYRL 4U1LB 3AY4C 3GMMB 5LGJA 1AJ7L 4RMWA 5HTSA 4PJCA 5DURD 1Q72L 3DECA 3HI5L 5DK0B 5E1AA 2O61A 2BCKB 2P8PB 2GJJA 1QBLL 4ZUWA 1FDLH 3F7VA 4BZ2H 4EIGB 2XFXA 1FGNL 3D69A 4OLVH 4KK8C 1VADB 3JWOL 3MBXL 3ARBA 3BP6B 3I3DA 4MAUH 4L8BA 5GS0D 2VDML 2EE3A 2PO6D 3ELAT 2YMXL 3SDCA 5C09B 1BOGA 4GFTB 1CFTA 3DX8A 1Q9KB 4DKEH 4PJ9A 4RA0C 3ZKND 4ELKB 1FYTD 3O2WH 1K8DA 4PP1D 4ZD3L 4XHQA 5TDPB 2X1XR 5J1AB 3L7FA 2F54A 2YA1A 2JE8A 3QRGL 3MNVB 2PXYB 4K7FB 4NQCD 4RAUB 1BQSA 1DBJH 5IFAL 4GRLB 1OB1A 4S1SL 5EBWA 2NNAA 2RFXB 2YUVA 3EFFA 3MODH 5D6DC 4IMKA 3QUYD 5CFHA 2J6EH 2J8UE 1P2CA 4KTEL 4M93C 5IROA 5KSAC 5ISZE 3MXVL 5CD3B 3QDGD 3VG9B 1F4XH 1ZANL 4Q6IC 3OHXB 1I7TA 2FLBT 4X4YA 1OAKL 3O6ML 4HPOL 1A6PA 5IMLA 3Q6FA 5DC0A 4IJ3B 1HIMH 2XWBA 4D9LL 5DMIH 1TVBA 1EXUB 1CXIA 1V7NH 1BZ7B 1SJVA 3WNOA 3LQZA 3TCLA 4I3SL 1HI6A 1T1YB 1HCFX 3U7WL 1Z2KA 5ID0A 3GJFK 2X41A 3K81A 3BKYH 3IRZA 3G6DH 1JBJA 3HLAB 5J57B 4OUUA 3S5LA 1NH6A 2X4QA 3G6JB 3S35X 1P4BL 5I1EL 4K71B 5KAQF 3S34L 1QSFD 5I1LB 2LVEA 4LSVH 4GBXD 4KI5D 5LAXB 2NTFB 2CR6A 4QLRA 5D7IB 3ZDZE 3MRNA 1OGAE 3AAZA 3DTXB 4P9HL 5TGBB 3TH2T 2B20A 2VXQL 1U2CA 4MJ4A 1BVLA 2CDGB 3SDXE 1ZSDA 4U2ZA 1NCUA 1GYAA 5LWYH 3KWWB 1K2DB 2XNAB 4JREB 3RVXD 5GRUH 3O8XC 5HDOA 3CUPA 1T22B 4JPKH 2R0ZL 3DSFL 3K8LA 2G75B 2BSTB 4QHLB 3NCYP 5F1NA 2R4SH 4OBSA 4HKXB 3DGCR 5DHYA 1YY8B 3ARXA 4HUNB 5J12C 1UACL 4HWUA 2BVPA 2FX9L 1JRHI 2X1WL 3ARUA 5FF6B 3REWB 1AFVH 1ADQL 3BN3B 5KVDH 4LLUB 1CU4L 5C09D 3KLHC 5K9KA 1ZHKB 4XVSL 1AXTH 7FABL 4OFYA 5LGKA 4MJ6A 1HINL 3JWDH 1A7NL 4G6JH 3HRZB 3QJHB 2MKLC 2WQ8A 1Q1JH 3PP3H 3WCYA 1HXMB 2LU4A 3I9GL 3GSNA 3ULUC 3UYOD 1CDIA 3L1OH 1H0DB 3W9DB 5JHLH 3SDYL 3GZKA 3VD4A 1RVFH 5A2JH 4K9EL 3VD9A 5HI4C 1D6VH 2XKUA 3BPNB 1NCBH 5DFWH 4NC1C 2UUDH 3DVNB 1RURL 4PRDB 3GIZL 4S1SH 2O5ZH 3UBXG 4UT6H 4MXVE 4JY6A 3TVMD 5D93C 1QFWH 5IF0B 4KPHH 1T22A 1PG7H 4PUBL 5FYKL 4FFYH 1E0OB 4JQVC 1G7QB 1TQCB 5IR1A 1CBVH 5JIKA 4X7DC 3B5GA 4E42B 1YY8A 2MOVA 1KULA 4EI6B 5F96L 3GJFH 4PB0L 1C7SA 1KCUL 5DJCA 1I8KB 1UC6A 2NXYD 1GVIA 3X3FH 4NO2B 1RIVH 2O5XL 2FJHA 1Q0YL 2HLAA 4DGVL 3EGSA 5GHWL 3QO0B 5FYKD 4RMSA 4P2QB 2YEZA 2BSSB 5KBNC 2RAMA 2AJUH 1I4FB 2F8VA 1UCBH 3RY5A 1CXKA 1HILB 1A1OA 3I3BA 4HIEA 3W82A 3G08A 4W6YB 3AB0C 4A6YB 5IVXB 2NMSA 1E6JH 2DN7A 4PJ8B 3GSNB 2VAJA 4J1UB 2VL4A 2L0DA 1KN2H 3VXRE 5GS0H 3C2SA 5ESVB 3TBSA 4OGXL 3BP5B 4H26B 4NKMB 2IMNA 2ZKHH 2X4PA 4ZUTB 1GRWA 3H9HB 3CFDA 3VI4F 2A2QT 5DQJA 5SWZD 1QRNA 2O26U 1KIRB 3B9KB 1OSZA 2BHYA 2KL6A 4ERSH 1NLBL 3C8KB 4H1LB 1EBPA 4LSTH 4X99A 2C3VB 5E0QA 4XBPB 1F42A 2AW2A 2CQVA 1T03L 2RGSA 4CDHA 1EA9C 1BZ9A 4YGVB 4OQ1A 4Y1AE 2OQJB 4XP5L 5C07B 2AV1A 2B4CL 3QCUL 4OF8A 2ZSWA 4KY1L 4U1GB 3RWFA 1AHWA 2XZZA 4U3HA 5DVMA 5T1KB 1U8HB 5J9PA 4HJ0D 3VCLB 2JJTC 4NQXB 1QZ1A 2OJZH 3TVMB 4MNGB 5TDNB 5HHOD 2W9DH 1F3DJ 3VRLF 3RJDA 1QR1A 1EVUA 1NUDA 1V3LA 1WIOA 1Q72H 1Z5LA 2YWZA 3RGVA 4KDWA 1GC1C 3L3HB 3DX8B 1MFDH 3CXDH 1B88A 2WM0A 3LPWA 3S97C 1ZHKA 4NDMB 4TQEH 5IHUH 1VPOL 5F3BA 2B8OT 1CZ8L 3BJ91 4G8IB 5D6DA 1VFBB 1QD0A 3LD8C 2DD8L 3KVQA 3ZKXC 4EUPH 4OFVA 1KPUA 1ZLSL 1JI2A 5J56B 4Z7UF 3MRHA 4YX2H 1WTGT 4MNQE 1M7IA 3LQAH 2KQNA 3KPPA 4RGMB 1RMFH 4OFDA 2Q87A 3TVMC 1J86A 5EFIA 3RZCB 2C1PB 3T2NH 3NPZB 2UWEE 3UTTD 3MBEB 4X99B 5KOVC 2LAGB 5C0AA 3EYSH 1ZVHA 4WI4A 4BUHA 3MJ9L 4M7ZB 4Y4KD 3WFDH 1JHTB 4OZIF 4JY6B 1ZVSA 1NDMA 1R3JA 1JPST 5E8NB 2AQ2A 2HLFD 5F96H 3SDCD 3B9DA 4IHOA 4NP4L 1BBDH 1B9ZA 5ISZB 1RUPL 3PWUB 5I8OL 2YRPA 3BN9C 1A6UL 5L2JB 3MFFA 4BSWB 2VLRA 3UDWC 5DMKB 3SDAB 2M1KA 4J4PC 4XWOC 1HXMA 3RX8A 1SEQL 3JSSA 1S7XA 3GBML 1X5HA 1UKSA 2PCPA 2PW2B 2OXHA 1DQDH 1J18A 4LSDA 1K4CB 1PSKL 5F89B 5IMMA 5JIIA 4WI9A 1NDGB 1CFSB 5E2UL 3V0VA 3KHOA 4NM4H 3NIGF 3QXAB 5D2NE 1SBSH 1GZQB 1VFMA 4M5ZH 1D9KC 4Y0GA 3CVHB 1QFUL 5FUZH 1T3FA 3QUZA 3D3VE 3O6FC 2YHGA 1CE1L 4DKDC 3O6KH 4P3DA 4UV7H 1WEJL 3VFOB 4IDJL 4P2CG 2X2YA 5J1SC 5KVGH 1OD9A 2BNUB 4RMTA 2HJKB 1FDLL 1AXIB 3IS0X 3K80A 1KENH 4PG9A 3TWCL 4AMKL 4KU1A 3TESA 3UTSA 2H9GA 3G5ZB 1S7SB 5D2LE 5K9JL 1C5DB 5FYJE 1OARL 4TVPE 5EU3A 2F53E 2UZYB 2V2TB 4WU7A 5E95B 2DWEA 4HMEA 1AGBA 4FG6C 3LV3B 2J4WL 3KGRA 3U4AA 5TE6H 3OAZK 5DHVA 3BZFA 2PTVA 1E4XH 2P8LB 4JGMA 3A6CL 1R0AL 1IKNC 5JW5B 1UM4H 2BNQE 5FUOH 4Z7VB 1F2XK 3PIQB 1OTUD 1HQ4B 5BV7B 5HYJA 3F7RA 2DIJA 3MQIA 4LCWA 4PLKC 5B22A 1XFPA 1EHLH 1A47A 4P4KD 4XNXL 5A3ID 3WMSA 4NRXA 1PJ9A 1VFAA 3BGAA 4HGWB 1P7HL 4FMKA 4YZFF 3PWNA 4GKSB 4XVSH 5D1QB 5FGSA 1JF1A 3CSYB 4OZHB 4FFWD 2GUOB 5FIEA 4XNUL 4QHMB 3H3PH 4EEEA 3RVXC 1Z0MA 1TZHB 4YHOH 2EEDA 4OCYL 1CD1A 2OQJA 2GK0B 4LRIC 2YPLD 3WIFB 1N6UA 1W8OA 4OFKA 5DJDB 2W0LA 4OF3A 4NUJB 3SDDC 4WO4C 2VLRD 2R1WB 1CLYH 3C8HA 1BLNA 4X8JA 5EPMA 3CPLB 1G0YR 2HFFB 3ARDC 3V7AE 3ULVF 5I74B 4FFVC 1A6UH 3QDJD 4JDTH 5IBTH 1KB5B 3NVQA 1S7RA 2DF3A 1UKQA 2J6EL 3L9RA 1CBVL 1QBAA 2EDNA 2GY5A 4LKCA 1U58B 1U8LA 1NCAH 1AIFA 1ZHNB 1PW3A 2ORBL 1ZA6A 1FYTB 5CBEB 3H9SD 3RZCD 4NWUH 5D1ZA 2EDYA 1WWAX 4HC1H 3NCYS 5E8DH 5LGHH 4P2QD 4U6VH 3ZZ1A 3OKLA 1MY5A 2XQYG 1V8HA 2I60L 5D7JD 3GSQA 5FYKE 1CXLA 1RURH 4R4BB 1A1MB 3KPPB 1YEGL 1G0XA 4PTTA 2JIXD 4H1LG 4KK6C 1DQMH 3DX7B 3B9KD 2ZG1A 4H8WH 4XXDA 1WIUA 3SE3A 4HIXH 1BP3B 1QEWB 4GLRI 3REVB 2B1HL 1W72H 5DJ8B 1RHFA 4Y5YB 4L4VE 4AMKH 4IJ3C 3GO1H 4O5LL 4LK4A 4KROD 3GFUA 2CRYA 1JWMA 1OTTD 4JFXA 1NUNB 2Z8RA 2EYTB 4PJ7F 3WSQH 5F7LB 1JN6A 2XPGB 4I77H 3H9YA 1N8ZB 4GAJH 3RWCB 1ZT4B 1U8IA 4U1KA 3HZYA 3VXSD 1OWWA 4OQTA 4G6MH 4LGPB 4P5MB 4HXAH 4PJXF 4Q2ZA 4QOKE 5L88L 5JPNA 4MSWA 1Q9KA 3GSRA 3D0LA 4JZJB 2FIKB 3CFEA 3TBYB 1RZJH 1CGWA 3UZEA 2CLRA 4PY7A 1S5IL 1MFEL 3CH1A 4LAQL 1NC4A 3O0RH 2AXGB 5DZLA 3CD4A 12E8H 5FCSH 2UZIL 1RIHH 2ZG3A 4P23A 4Q74A 1UADC 3SGJA 5LKNA 5K59F 1KCRL 1YA5A 3B9EA 4N8CL 2VLLA 5B8CB 4DN4H 4QRUA 5EOQH 5JXAL 3IAPA 4Z7WA 2DKMA 4M48H 4LPTA 3O3BA 2AJXL 1M1SA 1Q38A 1FFQA 5SWZB 3H9SB 4V2CB 4N9GB 3QDHA 2R0LH 4XAWH 4KPHL 1PG7L 1KT2B 3R0MA 2J8HA 2ADIA 4ODXA 4Z78B 4JR9L 4J3UA 1ZEAL 1FHGA 5EU3B 3K2MC 3RHWF 1PDKA 3T0ED 5DDHB 4P5TB 3KPSB 3P77B 1Z9LA 1IVLA 4Z77A 3MGTB 1JF5A 3IDYB 1PQZA 3CFKB 1UT9A 4NOFA 4WHDA 5GRVL 2X4SB 1DL7L 2HVKB 4HEPG 1D5ZB 3X11A 4EI5A 3VH8G 1ZGLM 5F8RC 1F90L 2CO6B 5FYKU 1JFQH 4FFVD 4HH9A 4KKCC 5T3XL 3DVIA 4CN4A 2NZ9C 5IHZB 2OLDA 2PKDA 1A7PH 1J1PH 5CCKL 3ZKMC 1EGJL 3FRUB 4ZTOH 5DRNA 4Z8FL 5EPMB 1MI5B 4UT6L 2BRRH 4QRRD 1TZGL 5HHXL 5BS0D 3VXPB 5IB1B 4Z7UE 1FFOB 4JG1L 2A77H 3I75B 4C56E 2X4UA 3DI2B 5FYKH 4P2RE 3JWOC 4MWFB 4EN3A 4XBGB 3OAYH 5HYEA 4XVJH 3KJ6H 1U8JA 3MBXH 4WFGE 5GQBA 4G6FB 2ZUWA 5EOCL 3LKPB 4JZNB 5E2WL 4YXKH 4RGMC 4NBXB 3MUZ1 4ZDHA 3WNNA 5DK0A 2C1OA 4O2FA 5CAYB 1ZGLA 4RGOL 2J1KA 3T3ME 4CAGA 5I19L 3WIFA 1RUAL 2WINB 2NNAB 3MV01 2B4CH 3WIHA 4P59H 5IW6B 4KROB 4L9LA 5DQ9B 3MRFA 3L7EB 1BAFH 1IC1A 5GRJH 1MQKH 1CI5A 5DVKA 1JV5B 2C3XA 4Q7DA 1CGUA 3MO1A 1I9JL 3PDDA 4TTDC 3HFMH 2A6IA 2DQCL 5C09A 5F7YC 2YK1H 3LRSA 1U8QB 3WFCL 2FL5B 4K94L 3UTQB 5DFVC 1IAKB 3WXWL 2YA2A 1BEYH 4OCXL 2APTA 1U0QA 3FO9A 4X7TA 5D5MA 3WLBA 4AZ8A 1P4BH 5TDPA 5L88H 3RWCA 5F7DB 3CGTA 3SQOH 5DHXB 4M7JH 3FFCD 3OAUH 3TPUB 1G84A 4MAYC 3P9MA 3P4LA 4BKLA 3RL1A 4WTZG 3LKOB 5ALCL 1KCSH 2C3WA 4FNLH 3BP7B 5HYQA 3H7BA 2IFFH 4AG4L 3LHPH 2VNCA 3UJIH 1NAMH 5H2BB 1K4DB 3HMWL 4LPWA 4PV9B 3Q0HA 3MRQA 1SHMA 3O8XA 3X12B 4OB5L 3MJ7B 4JQIL 5C2BL 3ZYJA 3BKCL 1A3LH 3QNZA 3DO7A 4KRLB 4OV5B 1A4KA 3V6BR 2V5MA 4XNYL 1QSFA 4JPWH 1R5WB 4ELMA 4UIMA 3EKCA 3PHQB 5IMLB 1MHEA 4WFHD 1JNHA 4PJDE 4MD4B 3MRDA 1YNLH 5IJKC 2DLGA 2GQHA 3J7HA 4GRMA 3RPKA 3IU3B 5IB3A 4XNQA 4IBLT 1WFOA 3F7VB 3Q3GB 1QHOA 1M7DB 1UCTA 4NQVB 3ARDA 2MJWA 1N3NB 3QEQB 3BUYB 5E7BA 1VFOA 1P84J 1MLBB 1T2JA 4PBXA 1UXWA 1UZ6E 2OZ4A 5B38A 1AO7B 3V4UL 1REIA 3JWDL 3LY6A 1I1YB 4QTIH 1A6TB 2HFFA 4P2QA 2P7TA 4KHTL 1EHAA 3LIZL 3MLRL 3WFEH 1NC4B 3VXME 3EYUH 1WCQA 1R5VA 3WDJA 1T5WB 1U2HA 1YEHL 3HAEH 2IGFH 2AJZB 1VERA 4PJ8A 4CVZB 4HBQA 4OLXH 1RZ7L 4EI5D 3DV6A 1NFIB 2Y9RT 3FAWA 2XICA 2YPVL 5KZCB 3PL6C 3TJEH 4P5KA 1MRDL 3ZLQC 3ME0A 3GMNA 1ES0A 4PJGA 3VRIB 5H2BA 4MQXC 3EDEA 2FHBA 5TE4L 1U3HA 3GSQB 5E9DB 3B2UC 3CVIH 4D9RE 4KKAC 1X5IA 2YN5A 4WV1C 2OMBA 5CJBA 2B7DT 5H8DA 2Q8BL 1ULVA 5DMGC 2DDQH 3N1PC 1LO4L 4JZNA 5F7MC 5MENB 5BOPA 2KKQA 1CIUA 1LD9A 4M61A 1WBYA 1IFHL 2ZCLH 4NM8L 2V5TA 3BT2H 4X5XA 4KI5C 1CXHA 1SEBB 2P5ED 4F7MA 2VDKH 3HFML 3KPSE 1JRHH 2JCCE 3WBDA 1GAFH 1NFDF 2XTJC 1ZLUK 3VDBA 1A7OH 4L8SB 3FRUA 3ALWA 2VISA 5DRNB 3T2OA 5IFJA 1H15B 3QCVH 4RFEB 4Y1AA 4H0IA 3MUGB 1VSCA 1VCAA 4DK3A 1NGXB 3QFJE 1U93B 1A6WL 2OXGA 3MLZL 5DLML 3QH3B 1G7PB 2V7NA 5ACZA 2Y72A 3GGWA 4C83B 1YMMD 1EFXD 4NWUL 5C0CE 2YUXA 4Z7UB 4HXAL 4P3WA 3JZ7A 3HMWH 1EV2E 3FB7B 5EUKA 4WJ5A 2OR7A 4NKOB 4YZFE 3PQYA 5AZEH 1XIWA 1MCEA 5A2IH 3G6JE 4DUXA 4UTAL 4XC1L 4NYLA 3PV7A 3VFWB 4LEXL 1MFCL 5GS1A 1QFOA 1JHLH 4MNHA 1NPUA 2J7LA 5DD1L 2NYYD 3FCTA 5D7IE 3QXWA 1OW0C 2FX7H 4DN3L 4WFFD 1HHKB 2EO1A 2HJLA 3MR9A 4EI5C 4Q6IA 4XP6H 3MV8D 1R5WA 1QFWI 5D7JA 4Z7VE 5GGSA 5T1LB 3BZEB 3UP1A 3BDXA 5HHPB 4OZ4B 3RGVC 2HG5B 1NFDB 4N5UA 5TH2A 5DRZB 4NQCA 4YDJA 3NFNA 4QF1A 2X4SA 3DROB 4HZAA 1RJLB 1XEDA 3WKMH 4LSUL 4M3JA 5C0AE 3EOAB 3SEPA 1NBZB 3RWJB 1GGBH 1QYGH 1GC1H 2Z9TA 1X5YA 3KDMB 3LIZH 3T8XB 1S7XB 1LQSR 3SDXB 1Z5LB 3RY6C 4CVXB 1H3PH 5JDJA 2OZ4H 2KH2B 2Q7NA 1MFEH 5HYQB 3OXSA 1JK8B 5B21A 5IMKB 3DSNA 2AEPH 4KMQA 5EORL 5J6HA 5L0QC 2WBJB 1BOYA 1KCRH 4RGNE 3AM8A 4ZFFA 4BQCA 3B3IA 4QNPF 1WITA 4YHML 3QUZB 5DMYA 1FNHA 3MV8A 4OJFL 1JGEB 1MF2L 4HWBL 4JRXE 4PREA 2C1OB 4O2FB 1ZGLB 4CMHC 1WQVT 2DQJH 2PF6A 4GQPH 1FPTL 4UOW1 2HFGL 4GS7B 3D2UA 4RWYH 1YQVH 5CGTA 5TPWH 5FYLD 5T5NG 5BV7H 4RX4A 1HHIA 3OTTA 4K9EC 3TYFB 3U4BL 1NCAL 2Y6SD 4PR5A 3RVUC 2WLYA 4G8GD 2WWMD 4H25B 3ILPA 2HFTA 5FK9B 4HLZG 1FC2D 4RGOH 1A14H 1IKFL 3MMEA 1JHKH 5CILH 4LCWD 1NBQA 3PL6B 5HYJD 1I4FA 4R2GB 1OOAA 1G7LA 4Z7VA 5JUEH 1UB5A 2FR4A 1UGNA 3NGBC 4XBEH 4GOSA 2EECA 4QRPD 1QSFE 1U3ZA 4XCEA 2VERN 3MRLB 3MGAA 3D2UD 3RDTA 1FYHB 3IFPA 3FTGB 1V7MH 4P9ML 5I1IL 4WFGD 1ZKAA 4X6EA 2YD3A 4E0RA 2FDBP 3GMQB 4GRWF 3T0WA 2R23B 5CLTA 5FCUL 4PJ5D 3B6SB 3GJEB 1OT1A 2C3VA 1TQBB 5EUKB 4P9HC 1WBYB 5DGRA 3VFOA 5D2NC 3TM6A 4QOKB 4LHUG 1BM3L 2AXFA 4N90E 5C0BB 3STZA 1VGKB 1AGDB 1YJDH 5C0FB 5I75C 4JQXA 1PG7W 2EDRA 1GGCH 5DYOB 2A6KA 2R8SL 2MCG1 1CE6A 1PEZA 4HH8A 3QP3A 4NPYB 4PJXB 2APFA 4JLRB 5HD8D 3TV3L 4N0UE 3GSUA 3WJLC 5IKCA 4KZEL 5C7XL 4TOYH 2HJFA 2ZUSA 2F74A 1C5CH 3WKML 4M48L 4HUMB 3UJJL 4JB9H 5ILTL 4YBQC 2A74B 5DRZA 3TH3T 2EZ0C 1GPOH 5I76B 3G6JF 4MAYD 1E27A 2ZCHH 4FZEL 4CMHB 4TSCH 3HUJE 4OCNC 5KJRH 3SCMD 4NZJA 3RVWD 5DURB 4FQPA 5GGTH 2VDQH 1E6OL 4IOIA 4B7LA 3UJTL 2VC2L 4KDTC 1RUPH 5A2FA 5I8OH 3OKOB 3HR5B 1XT5A 3HHRB 2X1OA 1BFTA 1RUAH 2FLRT 1T83A 3P11L 4KJWC 5FEBA 1EEQA 2NY4B 1XR8A 3F5WA 1A1NA 5T3XD 3IAGC 4PRDA 2OL3H 3VFSA 1IC5L 4HS3B 4XWGH 2IAMD 2DJUA 5I16B 4OIBA 4MX7B 5KS9A 1CFNB 4K8RL 4EXKA 3PABA 3C5SB 4YFEA 4QRTA 2BERA 1YQVL 1MIEH 4LNRB 4C56A 1BBJB 5SWSE 5KS9F 3GSVA 4LCYB 5KSBF 5GGTA 4XZUA 3QAZB 2J2ZA 1YNTA 2E5EA 2P5WE 4QT5A 1OPGL 3RBSA 5HI3C 2WBWB 1ITCA 1ACYL 3CFCL 4TRPL 3MNZB 5EOCH 2BDNH 5DR5L 1ED3A 5I73C 5DJ6B 3ZHDA 1FV1B 2BXYA 2DLIA 5FECA 3HLAA 4OCSL 5D7KD 4HG4K 4RFEA 1IFHH 3QQ3A 4X0KB 3EAKA 3UBXA 3QG7H 1DN0B 3EYUL 2RHEA 2V9RA 3PQYE 3MRCB 2OS7A 2HVJB 1TQBC 4UUJB 3BH9B 3U7AA 4OZFB 4IIQA 1JZ4A 4PGEA 1KEGL 3BW9B 3MBEC 1TLKA 4OKDA 5C9JA 5CSZB 4Z6AT 1FNSL 4DZBB 5I73B 4RBPK 4KK6D 3KWWA 4RMVA 2V2WA 1AQDA 3MYZA 3OF6A 4MB3A 4U1HB 5K9OA 4N9GA 2Y36L 4KQ4H 1XR8B 3F5WB 5I15H 1FAKT 5IT2L 1HKFA 4MD0A 4Z78A 5EOCJ 5HHVH 4XP5H 5HYSB 3N85H 5KS9B 2G9HB 2OX5A 2GTZA 5GZOD 3GI9L 4W70A 4LARH 2FD6L 4CW1B 1GL4B 3OJMB 5FO7A 1XF3A 3GI8L 3Q1SH 3U36A 4P46D 1JTPA 4IOFC 4I2XE 4BH7A 1GAFL 1LE5B 4G9FB 4K23H 4YHOL 3RP1A 3T65B 4U31A 1JN6B 3H7LA 5FGBA 2ATPA 5JW5A 5ID0B 4L5FL 2V7HA 1YQ2A 3HTLX 5CGYC 3NA4A 4YO0B 5C92A 2ZCHL 4K7PY 2WW8A 2BHUA 5DD5L 1VFAB 1Y6KR 2ICCA 2QSVA 5BV7C 4PV8A 1HE7A 1MCSA 4QXUH 5FO8B 2J12B 1CF8H 2OP4H 5DF0A 5IHBA 1IGCH 5HVGB 3VXRB 3ECBB 4E0RB 4X4XA 4JE4B 4A2MA 3IJSB 5EWIH 2IBZX 2R1XB 5JR1L 2QQNL 4P2OB 3QEGL 4HKJA 3FO0L 5B8CA 5MI0C 4WVRA 4U1HA 5J11C 1AI1L 4R4FL 3JTTA 4U33A 2OL3L 1BQHG 5A2LH 1I1RA 3CSPA 4O2EB 4OZGE 4DZ8A 3ARFA 5DD0L 5E94B 2VZSA 5HYIA 2I07B 3I02B 3GBNL 4PRAA 5J6GA 4UAOB 1DBAH 3MXWL 3TZVD 3QIUA 1BBDL 3SKMB 4XNMA 4XPHL 5D7JC 5CJ5A 1NGWA 4MSWB 4PGZA 3GHEH 4TUJB 2ARJQ 4RFNC 3TYGH 1KJ3L 1R3KA 2ZSWB 4KMLB 4PY7B 1K3IA 3WFBH 5CJXC 4NUGL 4RA3A 1QYGL 4JRYB 3O2DA 1A7RH 3F58H 5CP3A 3BKML 2DLHA 2MQ3A 2HT4C 3RDTC 4MJ6B 1PX4A 4L1HA 1J5OL 3LPFA 2NX5A 4K3EH 32C2B 3FQWA 3CXHJ 2ZUQB 5TFSL 4GW1B 5DWUL 1MWAL 3HCVB 1MRCL 4E5XB 4LDOB 3QNYB 1FL3B 4X6CA 5E5RB 5I1HL 2RJMA 2I25N 2PNDA 2K3TA 2ESVE 5C07D 3MOAH 1GZPA 3G6DL 4HKJB 4JKPL 5HYSG 2BY3A 4Z95L 4JFQA 3PHQA 1M6OB 3HE6B 3MACH 1AO7E 1SYSA 3FO1A 1V7ML 2QSCL 4HCRH 2XZQH 1D5BA 3UCRA 4D0CA 4GSDH 2Y4SA 4I9WE 4M6OH 2DM4A 4GAGH 5GGUB 4JM2D 3P0YL 4APQB 2A6IB 2P5WB 2VO5A 2Z92B 5J13C 1A6VL 5FGCE 1UM4L 3L3HA 4LMQI 3WYRA 3BZ4A 4OD3H 1LNUB 5HHNA 3SDYH 4BH8B 2CLRB 3F65A 3QFJD 4H5SA 2DMKA 1JHLL 5BO1H 2NR6D 3VFGH 1RUML 1IEHA 3V8OA 3O3AA 2BXZA 1BVKB 1CDCA 4DQOH 2CGRH 1BQLH 3BIKA 4MNQD 4LFHG 2X4RB 1KTDA 2VQTA 3GRWL 1A3RL 2Q86B 2CDFA 4ZS7H 1YECH 4UIKL 5KVMC 4LGSB 4OF5A 3FN0L 3AMLA 2WINA 1H8OA 3MLWH 4CRPA 2B39A 1J1XL 4YDIH 4M1CD 3VXRA 2DWDB 2X89A 4UT9L 2VLJE 2VLJD 1T3FB 2A1WL 1ZT7B 4PJCB 4KY1H 3HR6A 5I1KL 5ICXA 2OR9L 1Q9LB 1LK2A 2XY1A 2IH3A 3UXFA 1CT8B 1Q0YH 1OP5H 1KCSL 4DGVH 3AB0B 2WWMC 2YRZA 2ZUQC 5C2UB 2AJVH 4AL8L 2QQLL 2H8PB 4FXLA 5EUOF 3SGEI 4JPVH 1KTKE 3DYPA 4JDTL 2FGZA 1IGJB 2FJGB 1AO7A 1LDSA 5DK2B 5JW4R 4GXUN 4Z7QE 2X7LB 1AKJB 4OZHF 1K8DB 4JREC 4WNQB 1Q9OB 1F8TL 2R1XA 4PRNB 1VACA 3WXWH 3D18B 1XH3A 5D93B 4HF5H 3LKSA 4JRXD 3V4UH 2V2XB 1CFVL 4G7VH 3H9ZA 5EOTB 2EDBA 2NY4D 4QRSB 5GISH 1H9VA 3EFFB 4MNHB 3WKNA 3DX7A 4S2SA 1MJ7L 4K8RH 5DQ9A 3MV7D 1H8NA 4WFED 2BZDA 3RKPA 1P4LB 1NGQL 5ICYB 3QPXL 2AK4D 4ZAKD 1P7QA 1CLCA 1ZLVK 1F4WH 1X3DA 2IQAB 4WENB 4LIQH 1C5BL 1V3MA 3U0WL 1RJLA 5C9KA 1NJ9B 4JGJA 4WHCA 2X70A 4KAQH 1T04A 3MRRB 4PRPD 5IK3B 4ESKA 1XCTB 4LSVL 4CVZA 4LCWB 5DUML 2OR8A 3DV4B 3IDMA 4LAQH 4ODBD 5MEPA 3H42H 5LXGH 1MEXL 1DANT 3VFGL 1G9MC 4PJ9B 4PB9H 3SBWA 4N8CH 1J9CT 2XXMB 4KHXL 2ICEB 1D3CA 3KPOB 2H2SC 4IDJH 3GMMA 5LGJB 3CFIC 4U6XA 3SOBL 4X6DE 3WFDL 3QIBD 1QSEA 2YWYA 2P8PA 3OKLB 4PJ7B 5FAAA 3ULVE 2VMFA 1OP9A 2ADIB 4U05A 1IKNA 1RZIA 3VGGA 4NKIH 2BJML 3KG5A 1J0ZA 4TNWK 5FA4B 1W0WB 3BE1H 4K71C 3UPRA 5K59E 3FO0H 3LCYA 4E41B 4JHWL 4LPUA 4BUGA 3EFDH 5HHPA 4ODWB 2CMRL 4JCLA 2WBJD 4B7IA 4YDKH 4JM2A 5CGYD 5ECJE 3PL6A 1ZAGA 4HLJA 4PGCA 4HWEH 5DRXA 2HFEA 4AIZB 2FR4B 4YFLF 1ZMYA 3S5LG 4L3CA 1A2YA 3C5ZC 4KKLD 1LEKA 1X5KA 1XCQB 1N5AA 1G6RH 5BQ7B 1YEIL 1LDPL 3IDYC 2CKBH 3O6KL 1NCCL 1NCDH 3S5LB 1DP0A 4M6AA 1Y18B 4POYA 3O81A 3PGFL 3WO4B 4NUGH 1EEUA 3QXUA 3VD5A 3ULUH 4J4PD 4KZDL 5E8EA 3VXMD 5GIRA 2EYSA 1LEGB 5E8OA 4YE4H 4G7VL 1G6RB 4QRRE 4PJEA 4ZQKB 5DJYA 4P2OC 3QDJB 4HUXB 1BAFL 1DQDL 2PXYC 2V2XA 2ZUUA 5T1DH 5B8CC 4ZFGH 3V5KB 4M00A 4K9EH 1P7KB 3BIAX 4O4YH 2NXYC 2UY6A 4XC3H 2NX5D 4K23L 3PG2A 3OJDA 3QIBB 3EOAA 1NGPL 1JHKL 1RZJC 5CILL 5CJQH 3PWPD 4CADB 3RUGB 1JL8A 2YSSA 4QNPE 5I66B 1U91B 1BOGB 3RIAF 4OLYL 2MQCA 2FWOB 5IMKA 5HY9B 2YD2A 3QZWG 5J4MA 4X7TB 1INEL 4IRSD 4HSQA 3VFVB 2BFVL 5D4QA 3TBVB 5I1CH 3VGAC 1H3WM 1R24A 3BD5A 2QSTA 1I3UA 4K3DH 3O3DA 5CEZL 4JFOB 2F53A 2CXGA 4YIQB 2NY1D 3KYMA 3JVGC 5EZOH 1PD6A 4PV9A 5AAWA 4WY7H 1G7IA 1FZMB 4HKZA 2D31A 1KIRA 5INDB 4HS3A 4X6EB 1BQHB 1A4KB 1KSRA 2EE9A 1YJDL 5HHMB 3O2DH 3KPOA 1F2QA 4L3AA 1XGPB 5IQ9A 1A3RH 4Y4FD 3C5SA 5JPMB 2AKRA 1HSBB 4FQLL 4HFUH 4Y5XC 3SKOB 1NGYA 5IEHB 1G7MA 4IRZL 3EW3B 4KZEH 5I1GL 3O11A 2YRLA 4M8VA 3TO4A 2VAAA 5BZDA 1L7IH 1Z3GH 2BVQB 4WUUA 5JTWA 4F7EB 2X70B 2I24N 5IVZB 4MZ2A 4P9MH 4XCYA 2VKXA 4OM1H 2BMKB 5D1QC 1FV1A 2MKWA 4ZOEA 3GSUB 1WC7B 2BRQA 4ZD3H 1YY9C 5CIPA 4Q2ZB 3V79C 4E41A 3FQXB 3FT2B 4OUUB 1U8QA 2GSGA 4ZSOB 2G60H 4DTGL 5IIEB 4OSUH 2MWCA 2VDMH 3T3MF 4ODHH 1VEMA 2CK0L 4K7PX 1MJJA 1KUMA 2V5SA 2XZCH 1HZHH 1FBIH 4QHUB 2DQTL 5CSZA 2XN9A 1QOKA 1IKFH 2YPKB 1VFUA 4A2LA 2R0KL 3B6SA 4AQOA 1KIPA 3WLWD 1XH3B 4NFBA 3D5OF 1PKOA 1QRND 4J3WA 5E9DD 1DLFL 3O3BB 4QRSA 4NQTA 1FVEB 2NY4C 2CIIA 4NKQB 5IHUL 3D2UB 4NN5C 2IBBA 3LMJL 2IBZY 3MV7B 5HDQL 1T83C 3RTQB 3LB6D 1I7ZB 1UEYA 1HK6A 4PIRF 3UPRB 5E2VH 1ZWIA 2F74B 1FVDA 4OIIL 3VXTB 3MROB 3P0YH 4X9FA 1LP9B 1ZLSH 4PYGA 4OI7A 1LE5A 4HT1H 4O58L 3WNLA 4D9RD 3P40A 4GMSL 2HVKA 2EIZB 4OIAA 5J06A 1NAKL 1EGJH 5CIPH 1BFSA 2JELH 5MP6H 5I9QB 3ARFD 4HH9B 3S34H 2IPTH 4Z7NE 2XOTA 4IOSD 3KS0J 1D5IH 2HT2D 2PCPB 2PW2A 3NFSH 4XI5D 4LLMA 1N7ML 1IC7H 3IXAB 2I9TA 3AROA 2UVFA 1H8SA 4XMPL 3T1FA 4OI9A 3QDGB 1A9BB 3LDBC 1S9YA 4XPTH 3STLB 5JIPA 3R1GH 4NHCL 4JR9H 1F58H 3RNKA 1KCKA 1KIPB 4UIMB 3T3PE 3X17A 4X9BA 4FHBD 4YGVA 2R4SL 1PVHA 5CWSA 5EU6A 2OR9H 2D7MA 3WL9B 2EDWA 1UQSB 1ZA3A 3W11D 1RAMA 2NY7H 12E8L 1U8OB 1DUZA 1G7JA 4WO4A 2BVEA 2MSPA 3RL2A 1FG2A 4ELME 1JFQL 2EXWD 5GS0C 3VXMB 1LP9F 5KN5B 1AXTL 1QLFA 3NIFF 4G42A 3O3EA 1NGWB 4CUCA 5JHDE 5DGQA 4LIQL 3U0WH 3LN4A 3ZKMD 2HJFB 1G7MB 2J8OA 1NDMB 3GM8A 3MUJA 1CCZA 3CC5A 4KFZC 4RMRA 3JV4B 5CEZE 2F58H 2P8LA 2NYYC 5ISZA 4AM0B 3TWCH 4TUKL 3VMPA 3C6LC 4LU5H 3MJ9A 43CAB 3H6JA 5TQ0L 4X7FC 4WW1B 3QFJB 1J05B 2EDJA 5MHSE 3EO9L 3OZ9H 1FSKB 1JPTH 2R0WH 2OTUA 4IRJD 3C60C 3S37L 3LH2L 1MFBH 5JR1H 3S7GA 4MD5B 5K9OB 2NLJA 1RV6X 1U3HB 1JNNH 4JJ5B 5F6IC 2BNQA 2EO9A 1WV7T 5CSGA 4PJBE 1U6AH 2YPLA 5F1IB 4QHMA 1ZHLA 5EC2B 3CVHA 1HCVA 3OKKA 4LSQL 3L1OL 4N0UB 4R7DB 4W4OC 4FTVA 4I3GA 3RVWC 4BZ2L 4X6CE 4EUPA 1NSNL 1CD1B 4PPTA 3MRPB 4NNXB 1XIWB 4EZMA 2GJ6A 1G9EA 5AYUH 5JQ6L 1D6EA 2ESVA 5DJ2A 4L8CB 3O3UN 2RFXA 4M3KB 4R6UA 3D9AL 4LLYA 3S96B 4BJLA 2A6DA 3JBG7 3WJJC 5L0QB 3BRDA 4QRRB 1N3NA 3QEQA 2IBGA 1QBML 5DMKA 3K8KA 3T04D 2VXSL 1LWRA 1KC5H 4NNPH 3SKNB 3WD5L 5EBLB 2VISB 4OCWL 2A9NH 3I50H 4U3CA 5DUMH 4ZS6C 5IW3A 4XVTH 1AGFB 1TETL 3M1BA 3MUGA 1LP9A 4QXWA 4PLNC 3IDGB 1T89A 4M5YH 3DROA 1D9KA 5IBUG 3MUY1 5GRJL 1RK1A 1EAPB 2W0KA 4HJJL 3S35H 4OB5H 1Y6MR 1UENA 2P24A 4NFDA 1T0NB 2X4TB 1FVCB 1KNOA 3WXVH 4FQXA 3FAXA 3VWJA 5L9DH 3LEVH 1E28A 1JWSA 1RIUH 1WFTA 1WSST 2D9QB 3L5XL 3PDGA 4NO0A 5EZIL 3U7YL 2EEBA 1VGEL 5EBWB 3HI6H 3VXOB 5GPRA 2HWZL 2BNQB 4R4BA 1E6JL 2VZVA 1I1AD 4KUZL 4LCCC 2H1PL 3RIFF 1NFDE 3SQOL 4I18A 5E4EB 2Z8SA 4ZPTA 4M7ZC 4M1GH 4AEEA 1G9NL 3RZCA 2EYRB 4BM7A 3BYTA 4K3EL 2IANB 3BXNA 3B83A 4XT1C 3MROA 4YEEA 4DKEL 3MCKA 3AXLA 4P46B 2Q3ZA 3EIFA 4YDJB 4AH2A 1T1YA 3MGOA 4JQIH 1EFQA 2FJFB 3PWPB 3TBTA 4PJBA 4FTVE 2DQDL 2CRZA 4RFOH 5ILTH 5T3ZD 3PIQA 5IKCB 3HS0A 4L8BB 3QCUH 3O3EB 3JWDC 5J13B 4KROC 1QSED 5C1MB 2N4IA 4AIXA 2JB5H 5D8JL 4AEIH 5KSAB 4K8RD 1NCCH 4MS8D 4KKNA 4I3RL 2NXZD 2HN7B 3GKWL 3CVIL 1GCFA 1AD9A 3TFKD 5JLZA 4HBCH 2BNRB 4S1RL 2NZ9D 2FHFA 2GUOA 3D39E 3STLA 2GFBA 3C9NA 2Y06H 1A8JH 2VLKB 3WS3B 2JK5A 1N0XL 3FFDB 4M1CC 3QUXB 1OD7A 5HHQA 4C55A 2CUHA 4MXWH 4C59B 5GSRA 4X7CC 4R3SB 4KMTL 1JTOA 3MV8E 5BRZA 4QTHA 2H26A 4PJIB 3GUTB 5E24E 4F7TB 3MREA 2VL5B 4CVUA 1YEGH 1HOCA 1MCIA 2CLZB 3MGTA 5BXFA 4W4OA 3VFPA 1T0MA 1B6UA 4GMTH 3V4VH 4FQXD 2VXSH 4JFPA 3LS5L 3MLWL 3HG1D 3DUSA 2BC4A 4WGVB 1R3IH 4JKLA 1WWCA 2QLVB 3KDMA 1DBKL 4CNIB 1I8KA 2R4RL 4B5EA 4JVPA 1C12B 1HHHA 3TZVC 5HI5D 3O4LA 4J12A 4YXKL 3UZQA 3BKJH 1MAMH 2YEZB 4MJIB 4S11A 3FFCE 4GJTB 3GIZH 1JGDA 4EDWH 3T0AA 1CFVH 5CBAA 2VQUA 3T0VA 2YPLB 5F1IA 4F37F 3WLWC 2EKSB 2AQ3A 3ROOA 2DBLH 4PGDB 3OL2A 1DQQB 2H1PH 1VKXA 1TZGH 3EJZD 3QISA 3QJFB 4NO0B 4Z7WB 2IWGA 5I2IA 3HMXL 3GK8L 5E2TH 5DQJB 3D25A 5DT1H 2XPGA 4MA3A 4F37K 5EG6C 5FYJU 2ITCB 3HE7D 4NO5A 3OKMB 3QIUC 5EBLA 4G6AD 3ARZA 4LP4A 4G80A 1WBZA 5GGUA 1B0GB 4XTRD 5KSUA 3QIBC 2NY0B 3GSRB 4BH7B 3TGXA 1Z0NA 3QO0A 3QAZC 5T1KA 1A6ZA 1BIIA 5INCB 1HILA 3UJIL 3KPLA 1B0RB 4R8WH 4GRLD 4UILL 3DVGB 4JFEA 5ICZB 5TDNA 5EIIB 1DL7H 3QJHA 1NMAL 2VDOH 1WZMA 3HE7C 3NABH 2APVA 2E8YA 4XNYH 5FGCB 3WDIA 3OKEA 1UKTA 3PXJA 4JFZH 3RIAK 1F6AB 1FCGA 1TJIL 1V05A 4XMKL 3QPQC 5CD5D 5A40E 4YWGL 4KI1A 4KTDH 3UEZA 4GH7B 3KPNB 3VRLE 3GM0A 4OTXH 1CWVA 1SQ2N 1F00I 1SY6H 3BW9A 3M8OH 4JANA 2VXTH 5HGAA 1M4KA 4M9OA 4LMQE 1AP2A 5B39G 1AGEA 5JDSA 5FYLL 4N0FA 4V1DA 3MRHB 4I0PA 3T0EE 4F7PB 2UWEB 2BVTA 1KBGL 4ODHL 4BQBA 4HT1L 4O58H 1A7QH 4IS6B 3ARYA 3GHEL 3Q48A 1RFDH 4BSVB 3SY0B 1IL1A 3HPLB 4N8VG 3FZUC 4LCUA 1IBGH 3SKNA 4XNMB 1W0WA 4JPWL 5IM7B 5MEPB 4MJ2A 2FJGA 3MA9H 1I1YA 5ALBH 3SJVE 1TCRA 3DETC 1R3KB 2F19L 3IXTB 3EGSB 3UTQA 1NGQH 2K7PA 5EZLA 3OMZA 3QXDB 1QFWM 5DEGA 1M7XA 1MWAH 1I7RA 3BOVA 3K7UA 4OD2A 1I8IB 5ID1A 1S7WA 2WIIB 4YPJA 5F9JB 2RR3A 4ZUVA 5M94B 4W6XB 5IBTL 3IDIA 5I1AA 3QUXA 3SE4A 4WFFE 1KB9J 2R29L 3A0OA 3VXUA 4HIXL 5J0BA 2WBJC 4PJGF 4YPGB 2X4NB 1FGVH 3KLAA 4XPBH 3TZVA 2BOCB 3WDHA 1AE6L 4CU8A 3ZTJH 2DBLL 3MJ8A 1F11B 1WIPA 5EU7E 1OW0A 2EYSB 1U8MA 4LHUD 4PY8J 3DRQB 3DX9A 1XAUA 4KKLC 3CDGA 4HAGA 5EBGA 5GZOC 4WWKD 1BFOB 4QRQB 5E56A 4YHYB 5BMFH 2YZ8A 3KPSD 5TF0A 4JB9L 3S98A 5MEQB 2E9IA 5E6YA 2Z91A 1F3DH 3FHQA 3TBTB 4ZSOE 1CR9L 3QDGE 4NQXA 4AIZA 4UQ2B 3LVEA 1O0VA 3OKMA 1F58L 1HQRB 3BISA 4YC2B 2P5WA 1PZ5A 3QIUB 2VDQL 3SKMA 4JO4H 4M7LL 3K8MA 4HKBA 1FC1A 1LNUA 2LVCA 3EJJX 1S7UB 3P3YA 2QHRL 4L3EB 1QQDA 3V5HA 1T1ZB 3ZKQD 3VWKD 4ZXBB 1KOAA 2OM5A 4I9WD 5GIRB 3L5WB 4OT1H 3EYVB 3MRBA 1U6AL 4QGTA 3WS3A 4Z7NF 5E00A 1Q8MA 2VIRA 4R97C 2CRIA 1J1XH 3OX8A 1ONQA 2Q8AL 3QNYA 1IAMA 4OLXL 2IPUK 5DUBB 2PTUA 3VXSB 2VR9A 4P23D 2YD6A 1UXSB 2AP2A 3SPVA 2FD6H 4NSKB 2Y06L 2JJSC 4P4KB 3U4EA 3CVHH 2R1YB 2DKUA 1MAJA 3MLSH 4WEMB 1WICA 2BDNL 4C54A 1MIML 3BEVB 4FQ2L 4LHUA 5DUPL 1GC1L 1ZS8A 5I66A 1P84K 5C0GB 4OLUH 4J3SA 4NO3B 4R96A 4TUJA 3U36B 4KJWD 4G5ZL 3QUMH 5KVEL 4CKVX 1CQYA 1EDQA 2FL5A 4ODUA 1HI6B 3V6OE 5E08H 4IS6A 4K3JH 4LASH 3VRJA 1N8ZA 1SBSL 5HHXH 3MA9L 5D5MB 3WLBB 1UM6L 5HI4D 5L2JA 4JG1H 4I2XA 3TF7C 2XN9D 1PYWB 1ZV5A 3LOWA 3C60B 1CDGA 4FOMA 5JOFA