1A6PA

Engineering of a misfolded form of cd2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
94
structure length
94
Chain Sequence
GTVWGALGHGINLNIPNFQMTDDIDEVRWERGSTLVAEFKRKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILDKALDLRILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-CELL SURFACE ANTIGEN CD2
publication title Engineering an intertwined form of CD2 for stability and assembly.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion
total genus 7
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a6pA00
1DLHB 1JN6B 2BVPA 5CIPH 5K9KA 4H25A 1Q9KB 4LCUA 3MCKA 1EJOH 2V7NB 4P57A 2ICEB 3MZGB 4HXAH 1KTRL 2UWEA 4TQEH 2HG5B 4L8CA 5HJ3A 4CMMA 5BOZG 5GPRA 4M1DH 1GIGH 3GJFK 3QAZB 3WDJA 4FZ8H 4ZOBA 5D70H 1N26A 2COQA 4ZMAT 4ZYKA 1CU4H 4N5ED 2LU4A 3G5VB 5H2BB 4PJFB 3OHXB 5IHUH 3ZO0A 2ESVE 3O6FC 5FYLE 4KK8C 1H15A 3QUML 4P5TC 1A3LH 5T1LB 3DX7B 5ESAB 2G5BB 1TZHA 43C9B 1GC1L 4KK5C 4UV4H 1X5YA 3QSKB 4PTTA 1H3TA 3SKNA 2X09A 2V17L 2E6JA 1FG9C 2W0LA 5AG8A 5GGSA 1LD9B 4O9HL 3QT2A 4LGSB 4P23D 5F1SA 5JPMB 5DJ6B 2NYYD 4OFYA 5T5NG 4OQ1A 3LEYH 5E99H 4UINL 3RKPA 1KULA 3H2WA 5EOTA 1I8MB 1YJDC 3BZ4A 3HPLA 4FG6C 3HNSL 2BVTA 3DHMA 3GMRA 3PUCA 4LSRH 2ICWJ 4WW2A 2BNRE 4CUCA 4CKVX 3QUKA 3CLFH 3SN6N 3V8OA 2FSEB 5EZOL 3P30H 5IJKA 3LB6C 4HSQA 3QAZC 1EAJA 2BY0A 2VKWA 4M8QA 1IGFH 2MNUA 2Z9TA 5E2WH 4P49A 25C8L 3ZKND 3TVMA 2PTTB 4OLVL 4X4YB 3F7VB 3SE8L 4G6JH 3DXAD 4JRYE 4PRIE 3C6LC 1T1XB 1IKFL 3CFKA 4CBPA 4CNIA 3SBWA 2WBJD 3G6JA 1OW0C 2NY5L 2CKBA 2XT1B 4XPGH 1I8LC 3I50L 1U3HD 3O3DB 3ZTNL 1BQLL 2GTWA 4X7DC 4QHUB 4Z7VB 2J6EH 4YGVA 1KSRA 3WMSA 2YUWA 1L4IA 4V2CB 3I02B 4M3JA 5D7LA 2C7UA 1HSBB 3T3PE 2DAVA 3S7GA 2QSQA 3TEUA 4D9RE 5ANME 3BEVA 4GW4A 5DVKA 4PJ8D 4DCQB 5FB8B 2FHCA 3UJIL 3MV9B 3QXWA 1T5XB 1UWXK 2IH3A 1X5GA 2R4SL 4FQXD 4JY6B 3EFFA 2EO1A 4JJHA 3GRWH 4WWID 2OSLA 3IDIA 3M1BB 1QBMH 3LHPL 3T4YB 1XF5A 4XPHL 4UQ2B 5DD6B 4EBQH 3CSYA 4LCIH 5GS3A 1K2DB 5MI0C 2DYPD 4OF7A 1IC1A 2OX5A 4XNMB 4AEIL 5CINH 4S2SB 4QHKI 3DVGA 3KYOB 4ZQKB 2ARJQ 4APQB 4K3JH 4ODUB 3OQ3B 1AQDB 3RVWD 3F6IA 4NBYB 5CEXB 4M61B 4YR6A 1IC4L 2H41A 4M6NH 2VSDA 4POZC 4F9LC 3QDMD 1MCWM 5BMFL 1UZ6F 43CAB 4XNYL 2H45A 3IAPA 4KY1H 4DTGH 3C8KB 3DARA 5B39G 5C0CB 3ARFB 2LU7A 1DEDA 2G5RA 12E8H 1T2QH 2XG4A 1MQ8A 4NO0A 4PBVC 3H9ZA 2EC9U 2NLJB 2FWOA 2CUIA 1B0RB 3CZFA 5JLZA 3MLRH 2YUVA 4NHUB 4PGZA 4X6CE 5FM4A 3QUMB 3C5JA 3RAJL 1A4JB 3BWUC 4OI9A 2GSIA 3RDTB 3UXFA 4HIEB 2AERT 2ATKA 2A38A 3GSVB 4DVBB 5SWZE 4X4ZA 3FONB 5CMAB 3OKNB 4KRMB 2OM5A 5ITBH 5IG7A 4P4KD 4WI5A 4GAJL 1YY8A 2OXHA 3ULUC 1DLFH 3ULVL 4CW1B 2GI7A 3D0LB 4DZBA 2M1KA 4I0PA 3Q3GA 1Z5LB 1MWAL 2CLVA 4APQC 3IKCA 1R3IL 1P4BH 1I7TB 2BOCB 1MRCH 2GT9B 1NH6A 1T03L 1YNTB 3NABL 4JHAH 3D85D 3RJQB 3H9SE 4O4YL 1KXVC 2Z93B 4JDVB 3LD8C 4HJ0D 1ZLUK 4I9WD 4IM8A 3UBXB 5HHVH 5IJVB 3ZDZF 2PR4L 4QRTA 3QUZA 3KDMB 1PBYA 1QSFB 2I27N 5HI4C 3KLAB 3I2CL 1FFPA 3IDUA 4PB0L 2R23B 3ARFC 1FJ1B 2E9BA 3TIDB 2AI0L 1QO3A 3VXSD 1MIEH 4XTRD 1S3KH 2ADJB 2AJVL 2VXSL 3MJ9A 5D6CB 3VD9A 2FEEI 1PD6A 4NHCL 1J8HE 3CCHA 4U1LB 2AV7A 4GG6E 1H5BB 4EN3D 2FRGP 4KUZH 2IBGA 1GC1C 3UX9B 2IAMA 4GLRI 1KCKA 3DV4B 4L4VD 2R0ZH 4IIQA 4DKFH 3BIAX 5FDWB 1S7SA 1EMTL 4L3EE 1LEIA 4PGJA 5K9QG 2RB8A 3KPMB 5C0BE 5DJDB 3NAAH 2WUCL 4OCSH 1G7MA 1YPZB 3TO4C 4N8VB 5IK3A 3HMXH 4HQQL 2YA1A 3MYJB 2XRAH 3QRGL 1YEDA 4OLYH 1UKSA 1YQVL 3FQNB 2EIBA 1JWUB 1NFIA 1PQZB 1A9BB 5GGRY 1DN0B 4OZFB 4QT5A 4CMHB 4NRZA 4BFGA 1T6WA 5GGTH 4NBZB 1JV5B 1IGYB 2QQKH 3GBNH 2NNAA 2V5SA 2O26U 3C60A 4WJ5A 3D2UB 1ADQA 4GG8A 2A77H 4KK6D 2IGFH 4CU6A 1TVBB 3H3PH 1ZHNA 4KKLD 2ZCLL 3NFNB 2D9QB 3WXVL 3QXVA 4WI3A 3RIAK 4DKEL 2R2HA 1CGXA 5A2KH 1H5BC 1DDHA 5BS0A 3KHQA 5E8PB 3DRQB 5FKAA 1M7XA 4GAYB 2XG5A 3U36B 3LIZH 4JZNB 5HI3C 3ZYOA 4NSKA 1B4JH 1OARH 1NFDE 3EOBB 2DTSA 1KB5H 2H1PH 3PWPB 4LBEA 4Z7WA 3U9UB 3QXAA 2OS7A 3QJFA 1DBBH 2HKFH 3LKSA 3NIDE 5C86A 2EDNA 3DECA 2HFGH 3VGFA 4PJAB 4X80H 4BH8B 3IJHB 4RGOL 4U7SA 3VE0B 1DANU 4FS0A 5J6HA 1DBKH 2F53B 2HWZH 2QR0A 3TGXA 3X3FL 1DQQA 1OPGH 1OGAA 4UT6H 4OFIA 3NCFB 2MHAB 1S7VB 5JO5A 4Z0BH 2B0SL 4G8GD 1CFNA 2X89A 5L8KB 1J0YA 3P9LB 1BAFL 3QDJA 3QQ3A 2DQCL 3GGWA 5DHVH 5T3XL 1X5IA 1BVLA 3GUTA 3DRTB 3WFZA 3BP7B 3SCMB 2FATH 2RIKA 3P0GB 5EUOF 1A1OB 4PJFE 4FP8L 3GBML 2B2XL 1UZ8B 4KTEL 4KV5F 1CN4A 4HK3J 1FZOB 32C2A 4NRYB 3NZ8B 2BRRL 3PWJA 4LVOB 4RMTA 4CVWA 4JQVA 4N0UA 4QHNA 1YJDH 4GOSA 3WXWL 1Q9OA 3FHQA 4LKCB 2AXFB 5HDBF 4XPTL 1CDJA 4NJ9H 3U82B 1F3JB 1E0OB 1L7IH 3WN5C 3T65A 4MVBD 3B3IA 4HS3A 2JJTC 3GZKA 4YHNB 5DA4A 3QA3A 3OB0H 1KN2H 2EKSB 3IS1X 3T77B 1PZUB 2Y25A 4NO5B 1FFQA 5B3NA 1AKJB 3U0PA 1EK3A 2GK2A 1DQJA 1H3UA 1LP9B 1J9CT 5D96B 5IOPA 1HNGA 2HFEB 5C0IA 3HHRB 4KTYA 4XHJC 4OB5L 4M5ZL 4TULL 4Z0XB 3VXNA 3VU2A 4M62H 5C0AA 3UYRL 3ULVC 5L88L 5D9SA 2QQNH 5ILTH 3D3VB 4H5SB 3BI9X 1FVDB 2GITA 2J88H 4IRZH 5E8OA 2DTMH 5EIQA 4JM2D 3AAZA 3SCMC 5E7BA 1Q9LB 4YDKH 3UTOA 4NZDA 3O2VH 5TQ0L 3V5HB 3QQ9D 1WBYB 2Y6SC 3CFIC 3MRKA 5BZWB 4R8WH 4FQHB 5BRZA 4V1DD 1IZJA 3QHTC 4LVOC 4HKXA 2P7TB 1A6ZB 2Y36H 1YYLH 3FQWA 3QEUA 4NPYA 4X0KB 4HCRH 4Z7VE 3S36H 1PJ9A 3OXSB 4OM0H 4RMVA 2B4CL 4QRUB 4F7EA 2BCKA 3STBA 3ZTJG 4NNPL 4IDJL 4YC2B 3L5IA 3TV3L 3ZTJH 1GZPA 4ONHB 2QHLA 5HTSA 3O45A 4NC1C 4Z78A 4JVUA 2VDKL 2ZOKB 3MV9E 4MNGB 4ZSOB 3UTQB 2F54D 1EHLH 3MRIA 5ITFA 3QCUH 3FRPG 5B8CA 2DQTH 5D96C 3QO0B 1T22A 4HDIA 2PYEB 4NO2A 1M7IB 1RJYB 5ICXB 4EI5A 3MZTA 1G7PB 2VQTA 2JIXD 2E7BA 4KDTC 2D4DA 3UJJH 1ROWA 2XNAB 3OAZH 4U0QB 4I4WA 5CJXA 3FO9A 5TQ2H 4YO0B 3DLQR 1KTLA 1HHGA 4HKBA 3NFSL 4X7CC 3QUYD 4HK3N 3BO8A 2H9GA 2DQUL 1LO5A 2HMID 2G2RB 4JR9H 3X12B 2YD9A 4XZUB 2DQJL 2JKXA 2VLMD 4IJ3B 1QLEH 2C4FT 3L3HA 2Q6WB 5JORB 3DIFB 2CR3A 5JMOC 4Q9RL 1SBBA 1M05B 3IDJB 3MRRB 3QISA 5DYOB 3SE3A 3DMMB 1KJVA 2IAND 1N7MH 4LMQI 1MQKH 5C0CE 1U91B 4TUKL 5BO1H 2L7UA 4QHLB 1BVKA 2O5XL 1IKNC 3BWAB 1SJVA 4FZEL 2K1MA 4PRBB 4JHZA 2CSPA 2OMNA 4E41B 4D8PB 1GZQB 4YC2C 1EAPA 3IFPA 1MCSA 3DV6A 4WFHD 4L5FH 3C6SB 3MACH 3D39B 4WHTB 4KMTH 3UJTL 3ULUH 4AM0A 5GRZA 2G75B 4YHKH 4O2FA 4YXLL 3PNWB 2AKRA 2PW2A 3BISA 5GGUA 3MJGX 4LSTL 3ZSTA 2P5WB 5TDOB 4U1HA 3IU4L 4P46B 1OT2A 1R3JA 3TA3D 5IVZB 3PABA 5JOEA 1G6RA 1NKOA 2C1OB 3RUGB 3VXMB 5IQ9B 5D5MB 1GOGA 5CJQL 2YKLL 3ABZA 3FOLB 4IJ3C 5D1ZB 3WBDA 4MJ6B 5CUSL 2VH5L 1NBYB 2ITDB 3BRFA 5DS8A 4WO4C 2JJVA 2WP3T 5IB1B 3MV7D 5TFSL 3EZ8A 1I3GL 1UENA 4HS6B 2XKSA 3QUMH 3STLB 5F97E 5BXFA 2NXYB 3I9GL 4Y19B 1I85C 1GC1H 2H26A 2XZAL 5IBLD 4W6WB 1SMOA 5I16A 2V17H 1NDMB 4ZUSA 3RBGA 1HYSD 3V5KA 4LSDA 1FN4B 4O9HH 1PY4A 5MP6H 4XPBL 1S9VA 2P49B 4RDQF 1MCKA 5CGYC 1U42A 5DK2B 3TZVD 5GZND 4UINH 5JHLL 2PTUA 4IS6B 2A74A 3RWFB 2Q20A 1M6OB 3HNSH 5D7IA 4C56D 3OGCB 2AEQL 3FB5A 4MDJA 1IM9B 5IGXL 1XGUB 2VXTL 2VERN 1QSZA 1K8DB 3O41B 2A6JA 3UBXG 4YHOL 1VADB 4BSWB 1JF5A 1YPZE 4MNQA 3P9MA 3TBYA 3L95B 3T2QA 2CRYA 2B5IB 4JE4B 4QXUL 4X4ME 3WUWG 3T04D 5CIPA 2FJGB 25C8H 3PHOA 4OLVH 5IMOB 5D1ZC 2BK8A 3SE8H 1T1WB 1P5VA 3TNMB 2YXFA 5CLWA 4JPVL 3UAJD 2NY5H 2KDGA 5JNYA 1XGTA 3HE7A 1AR1D 2NXYC 3I50H 1Y0LA 3ZTNH 3CPLB 4YNYA 1WBXA 3QIBA 2OTPA 3VXQA 1ZV5A 1FZKB 5CSGA 4Y2DB 3VFTA 5F9OL 3EW3B 5FXCH 2V7HB 3ELAT 5E4EB 3MR9B 2DOCA 5HXMA 3VXRD 2R0WL 4YHYB 4N8VG 1IAKB 3ILPA 4PJBF 4B0MM 3IJYB 1CGTA 1A7PL 3BPLB 2R15A 5HYIA 1I9IH 1A7OL 3O0RL 3ARGA 3LPGA 4S11A 1P9MA 1JGEA 2VZ3A 5IW1B 3PWPE 2HTLC 2V6HA 3LHPH 3BMWA 5CEZE 1P5UA 1BMGA 4XPHH 3DBXA 4DZ8B 4ODWA 2DWDB 4PJAE 4AEIH 2FDBP 3QXUA 5CBAB 2B5IC 2W60A 5EBLA 5JQHC 3TIEB 1IC4H 3CUPB 3BPCA 4I3SL 2WUBL 5BMFH 3AB0C 5IB3A 1FGNL 3CFJA 5HGGS 5E94B 5GJSL 2EH8L 1GPOL 1X5FA 1OP5K 5JIKA 1U58B 3KPSD 3S5LG 2AW2A 1BJ1J 3RWHA 4QWWD 4LSUL 3D25B 1D5XA 3GEWB 5EPMB 1UM4L 3L6FA 2ZCKL 1FC1A 3L1OL 3QFJB 2OR8A 3HFMH 4NCDA 3O8XA 2EE2A 2MKLC 4PJ7B 5E4EC 3O9WA 4YHYC 3BP4A 3OJDB 4NZRL 4HKZA 3SDXF 2Q87A 3QG6A 4NQCB 5I1HL 5L0QB 2J6EA 1H3GA 2KQNA 3BPLC 3VXUD 3BGAA 2BC4B 4N5EC 2VISB 3DXAB 4D0BB 1AGFA 3GHEL 5TE4L 4ZAKA 1SJEB 1TXKA 1I7ZA 1EERB 3BGFC 2WBJB 4QF1A 4GAJH 4UDTB 3F62A 4HUVA 3IXTA 1QLFA 5TGBA 1OSZA 3ULVH 1CE6A 1I9RH 1QFWH 4G6FD 1JGLL 4QLRA 1MWAH 3GSWB 4O02H 4O2CB 1LP9E 1R3IH 3FQRB 1HQRB 3DX9A 4P23C 3NABH 4PRIA 2NYYC 3D48R 2VO5A 4O4YH 2WAHA 4PLNC 2A1WL 1LMKA 1FNEA 1PKQB 4G8FB 3GM8A 2PW1A 3BIKB 4P2RA 2EE3A 5D72L 3O3EA 3I2CH 3D3VE 4PB0H 5JW4R 5T1KA 1ULVA 1RZIB 3H8NA 2X4UB 4NM4L 1D9KD 3DYPA 3MV8D 2HLAA 1P7QD 4ONOA 2AI0H 4H1LB 3CDFA 5L2JB 1L9MA 5HVGB 4WUUA 2AJVH 2VXSH 2FR4A 2CRZA 1A4KA 1JMXA 3LSOB 1TTGA 1TJIL 1JUFA 3GJFB 5DRNA 5DJ2B 1XR8B 1LO4L 2E7HA 4O2EB 5L0QC 2MMXA 1T1YB 3TCLB 3ZKNC 3D0VB 2VNCA 3BPOB 4ZFOL 4X9GA 3QJHB 4LCCC 1EMTH 1W0VB 2WBJC 3ARBA 4D9QD 4UUJB 1IGML 2PF6A 3VFWB 3DX8A 1U3HC 4MNGE 4ZSOE 3C9NB 3T0EA 3VMOA 2C1PA 4HQQH 3CFBA 1CLZH 3BHBB 1CLOL 4U2ZA 3QRGH 1FYTD 1YQVH 5IKCA 1U8QB 4XCYA 5EORL 2PYEE 3MNVB 1RZ7L 3WIHA 2X41A 3KYMB 5D2LA 4BFIB 4OLWH 1INQB 4YPJA 1QR4A 4M1GL 2XPGA 4PJ8C 4U1JA 5IVXA 3FFCB 3EDFA 1N59B 2FZ3B 5JA9A 2OJEB 4FQXC 4HIHB 1FORL 2HAZA 3GSNL 3QPXL 4P4KB 5MERA 3GSRA 1YMMB 1MIML 2ZCLH 3O3BA 3HG1D 4MA8L 1L0YA 5DRXA 4DKEH 4HGKC 5DJ0A 3LMJL 4ORGB 2WANA 3GSQB 5DGQA 3RVWC 1RJZA 5HVWA 5A2IH 5INDB 4XP6H 5CD5D 5AUMA 5L8LB 3BZEB 3FQXA 5DJYB 4X5WB 4JFDD 5C8JB 3FO1A 4Z7NE 5E6ID 4E41E 4UNVA 5E00A 3EOAB 2HKHL 4CL7A 3ZE0E 1D5MB 2NY3D 2F58L 3D39E 1BZ9B 5ISZA 1NL0H 3MRQB 3EO1A 3AGVA 4Y4KD 2NX5D 4MSWA 4TSAL 4QOKB 3VXSB 4HIIB 1S9WA 1RAMA 3X3FH 5LWYL 3ARED 3RVTD 1K8IA 2P1YA 5IB5A 2YMXL 2B0SH 3CVIL 5C7XL 2P5WE 1WLHA 2IALB 4EN3B 2J8UF 2E7MA 2X4SA 1BAFH 3U7YL 3HMXA 2DQCH 1QZ1A 5T33L 5T3XH 1PZ5B 2VQ1B 3RUGE 2ZSVB 3VXME 3L3GA 5D5ME 4P5MA 4TN9A 1BBDL 5C2UB 1VESA 1K85A 4P4KC 5FA3A 5J57B 2CK2A 5IB2B 4FP8H 3GBMH 2B2XH 4RQQB 4X7TA 1CD9B 4KTEH 5GGTA 5I75B 5DWUL 1HZHL 2V2TB 4DQOL 2BRRH 3PHSA 4UAOB 3LKNB 2DRUA 4Y19E 3SDCA 3WXWH 3WFHB 4PTUA 4C4KT 2JB6A 1T0MA 4XPTH 5GZOD 3OAYH 5C09B 1QACA 4HJ0C 2YRPA 4KAQL 4K7FB 3O4LA 3DVFA 4YPGB 5GIRA 3S35L 2WNGA 3HI1A 1S7RB 1EBAA 3IGAA 1MVUB 1YQ2A 1M4KA 3ISWA 2P46B 5I1EL 1KB5A 1WIPA 1MY7A 3MLTB 4JDZA 3NIGE 4X7EC 5FHAL 5HY9B 5EA0L 5EU7C 3GSUB 1INEL 1IVLA 5DK0B 2BSSB 4EN3C 5C70A 1RFDL 4M5ZH 4TULH 1N2RA 4WTWA 3G5XA 4NNXB 4X5XB 3RX7A 3HI6L 3UYRH 4ZO9A 4BKLA 1BECA 4M4PA 5A16A 3H9HA 4NQVB 4XBPB 2UWEF 4Z77B 3SGEH 2JJSA 5E8NB 5T3ZD 2JCCB 3OR6B 4PJ9D 3KPOB 4PJEA 2SEBA 3SJVD 4M03A 1KJ2B 5TQ0H 5CZVL 4R7DA 3MJ8B 3DO3A 5I75C 5DHVA 2ZP0T 3I6KB 5DTFA 3SY0A 4UAOC 3RTQA 2H2PD 3PGCB 5H94A 5JW4M 2UZIL 1AXSA 4CDHA 4HZAA 2XFXA 4I48A 1OLZA 3GSNB 2W59A 4JRXD 2ZUTA 1EEZB 1TDQA 4HWZB 1HHIB 2B4CH 4G8GB 3S88H 5F88B 3IKKA 4LPWA 4NNPH 5IEKB 5KANG 3S35X 3VWJA 4IDJH 5IROA 3WNMA 5FCSH 3KJ4B 3HZKB 4LPXA 4XVJL 1R5VB 5DLML 1J1OL 3O3AB 5J89A 2VDKH 5SWSD 4OT1L 2VZVA 4KK6C 4YWGL 2DBLL 4KKLC 3ZKXB 3LKPB 1UQSA 3VJ6B 3C08H 3MUGB 4N0FA 5DC0A 3ZE2E 4JLRA 4AT6A 5HYEA 3A0OA 1R5IB 1JNHA 4HMCA 4WW2F 3VRJA 3FAXA 2YD1A 4GW5A 5FUCC 2A83A 3NFSH 1KIQB 5KOVC 2DQUH 4LLYB 5SX4H 4OD3L 2EXWD 2DQJH 4RRPG 3SKMB 3OWEA 5H2BA 4DOHB 3C6LA 5FAAA 4FABL 1EEYA 4JPKL 5ERWB 5DFTA 3BE1L 4Q9RH 1YNLL 1I1CA 3WS3B 4FFZL 4Y8AA 2R1WA 5T1LA 1X5AA 5JOFB 2VLRB 3FCTA 4TUKH 2XWJB 3G6JF 3UPRA 5L9DL 4XRCB 3SPVB 1EH9A 3V7AE 2O5XH 1R0AL 2NTFA 1LD9A 5IWLC 8CGTA 3P0YL 3ES6B 4FZEH 3HMWL 1HNFA 2OK0L 4MCYB 3KAAA 2X40A 2KL6A 2F5BL 3O11A 2Z31A 4PJ7E 1ZHLA 2BNUA 3KJ4C 1DQDL 5JW5B 2P5ED 1VPOH 4LKXB 1N0XL 3B9KA 3UJTH 4HCRA 4NQCE 3TN0A 3FQUA 2LVEA 3WFEH 2VLJD 2ICES 1MAJA 5F89B 3VFVA 3ZKXC 5GSRA 2YBRA 1MJ8L 4LLMA 2BY2A 5I17A 3DXAE 1P4LB 3NCYP 4LSTH 4F33B 2FSEA 3JWNC 3IU4H 4Y4FB 5DRWB 4V1DB 5SWQA 5LJYH 3UDWC 1T7YA 3IDYB 1MSPA 1IQDA 1MCIA 2ARJA 1PSKL 2DMBA 4JAMA 4RA0C 5F8QC 4LRNL 3OF6A 4E9LA 3LDBB 3MA7A 5CJQH 2YKLH 3CLEH 2FYYA 3WNOA 2YA0A 1AIFB 4MVBC 4YDVA 1LHZA 3BT2L 5CUSH 5EU4A 5C07D 1PKQE 2MOVA 2VH5H 3QWOB 5J8OA 5TFSH 1I3GH 1KNOA 3O6ML 2N7BA 1EVUA 2XZAH 1A3RL 1IGJA 5HHOB 4POYA 3IFNL 2JK5A 2WINB 1SHMA 1E28B 4HS8L 3V95A 2P48B 1DUZB 4XPBH 3TC9A 5C6TL 4XP4L 5LG1A 4DCQA 2XQBL 3ROLA 3FHAA 5E56A 3U1SH 5JHLH 4Y16D 3QUYB 5JIIA 1FO0B 2AK4B 4JM2C 3IRPX 1S9XB 4JY6A 2YS4A 5K9QI 4HUUA 2AEQH 2PO6A 1I7UB 3LPFA 3B6SA 3QQ9C 4JFQA 5IGXH 2VXTH 4KVCH 3DUUB 1JE6A 5EBMA 4PREA 3U2SA 4XVTL 4YHOH 3IDYC 1LNUA 1BFVL 4PIRF 4AH2B 4APQA 1J1XL 4WV1B 2W92A 4QXUH 1O7SA 5I66B 3LDBC 3VG9B 2Q8BL 4HWBA 1MAKA 1G7LA 2IEPA 43CAA 5CJ5A 1JZ8A 3PXJA 1UEYA 2VRAA 3FFCE 4JPVH 1FRGL 1FFOB 2H8PA 3GJFH 1MELA 2X4OA 5B38G 3MLVL 1CWVA 4Y8DC 2PKDA 1JPSL 5F9OH 3AMKA 1YMME 2F8OA 2GTZB 5DUBA 4QRPD 4PLKC 5GGVH 4OUOA 2C3VA 3TA3B 1I7RA 3NA4A 3ULSA 4B50A 3QUMA 1FVEA 1P53A 2R0WH 4KC3B 4NNYB 3RPIB 3O3UN 1DE4A 3QUYC 2HMIC 1A7PH 4U31A 3M17B 3BZDA 1F4XL 1A7OH 3O0RH 4H8WL 3DVNB 5ICYA 3MFFA 4G9FB 4I9WE 1EXUB 2VDRL 3AS0A 4R90L 4NZJA 3TO4A 5BJTA 3OX8B 1K9TA 1T7VA 4MCZA 1AC0A 4MQXD 2WM0A 5IMKA 4HC1L 5H35B 5C9KA 3QBTB 4PJCA 3VXSE 4DUVA 4GSDL 3VG9C 1YNTA 1M7DA 3U0TA 1MCOL 4I3SH 2WUBH 5IJVA 4OV5A 2W65A 15C8L 4L29B 2EH8H 3KXFB 2EE6A 4M8VA 1KC5H 1WBZA 4C56B 3WUWA 4FQPA 4LSUH 1OF2B 2GJ6A 3C09B 1NCWH 4OCLC 1UM4H 1XF3B 2ZCKH 2ZG2A 3HZMA 5I19L 3L1OH 4I0CC 2OP4L 2WWKO 3ZT7A 4OKVB 3OGOE 1A0QL 2WBWB 3TA3C 1ZLVK 3L3KB 5FF6B 4NZRH 1NUDA 3CSPA 3FT4B 3ARVA 5I1HH 1R6VA 3UTZB 1MCCA 2CKNA 3UPCA 1SEBA 5IHLB 2R29L 1CFSA 5DQJA 4XVUD 4J8RA 1A6PA 5TE4H 3HC0A 3AFLA 1NCDH 3L3DB 5MEND 2ID5A 1R3KA 1QQDB 3ZZ1A 4Z7WF 5I73B 4MNHB 1UWXH 1UACL 5F7DB 5FM5M 4X4MA 4XNQB 2FBOJ 2YXMA 5IBLC 3QDAA 1MJJB 2BSTA 3CMGA 4I2XA 1HYSC 1LK2B 3BQUB 4RWYL 4ELMB 4RFEB 3P4NA 2V9QA 2X70B 2A1WH 3TZVC 3VXRB 3EOTL 4ZFGL 5GZNC 1G84A 3TPUB 3HLAB 2HRPL 5D72H 4JN2B 2NY4D 4RNRB 4NT6B 5D93C 1CG9B 3QB7C 1PYWA 2JCCE 4NM4H 4PPTA 5CWSB 3VFPB 3VXPA 1D7FA 3B9DA 1B6DA 2H6PA 4F7CA 1TJIH 4J7RA 3JTTB 5JPNA 1WEJL 1LO4H 1QFOA 2I24N 2VN7A 4M7LL 3FOMA 4ZUUB 3S5LA 3V79C 5M94B 4LQ1A 5KSBB 3D6GA 1FCGA 5ICZB 2LTQB 4Q9BA 5EN2A 3V0VA 3BRDA 4J6RL 3WN5A 4G8GE 3QIUD 3QWRD 4HWEL 2JJTA 3UAJC 1SJXA 1IGMH 5ESVB 4ZPVB 1AR1C 1OHQA 1QPXA 3B9VA 4R3SA 5I73C 3RZCD 3CJJA 2XICA 5EO9B 5L2KA 2LVCA 1CLOH 1RIVL 4ODHH 5GRJL 5J6GA 4Z7OF 1S7VA 4MD5A 1QD0A 4WY7L 5GS2D 4N0YL 1I1FB 2IQAB 2EXYD 5EORH 3MUJA 1E4KC 4M1CD 1RZ7H 3BVNB 1CQYA 1B0GA 1NJ9A 4NKMB 2O93L 1FZMA 1QSEA 4M1GH 4KHTL 1F8TL 1OQOA 1AGCB 4PGEB 5E9DD 1HSAB 1MWAA 4DGIL 1LILA 3VXUB 1ZGLM 1MUJA 3OKLB 1FORH 3WJLC 3GSNH 5BCAA 3JUZA 2NXZD 3IAGC 4EDWL 3QPXH 4DOHE 1D6EB 1ZLUH 3W9EA 1MIMH 4HV8B 4MA8H 2NZ9D 4X83A 1F6FB 3NZ8A 1V7ML 5TDNB 4C83B 3S34L 2VLRE 3LMJH 1IEAB 1ES0B 5IEHA 4LKCA 2W9LA 1J0ZA 4FXLA 2RFXA 2E27L 1AGDA 1UXWA 1WFNA 4HIJB 2VLKA 1U8KA 1VACA 2FIKA 1TPXB 3SGKA 2HKHH 1MHHA 5J12C 3T77A 1XGPA 4XB7A 2F58H 3MGOA 4PGBB 2XY1A 1EHXA 3BD5A 1D9KB 3MV8B 3VFMB 1BFOB 4FQ1L 1MH5B 4H8WC 4TSAH 2V5MA 2E7LA 3CVHL 1VEOA 1F4AA 4J3UA 2OR7A 4BH7B 5LWYH 5IM7A 4PG2C 5JIPA 2YMXH 3CVIH 4KDTA 5C7XH 2BVQB 5I1AB 4GXUM 4V1DE 4F37F 3U7YH 2BVYA 5HHPA 3BIBX 1FGVL 3BH8B 4X4XA 5IBUG 5T33H 5GXBB 5B21A 3U4EB 2VAAB 4GAGL 4WU5B 1BBDH 4G42A 3IYLW 5F3HA 4CVZB 4HT1L 3N1MC 4L8DA 5C0EA 3IU3B 4YE4L 3EJZD 1HHKB 3QO1B 1VKXB 4CADA 1HZHH 3LEVL 4OTXL 1ERNA 4DQOH 1FH5L 1RZ8A 4Z6AT 1PDKA 4Y1AA 4QRSA 4G6ML 5T3ZL 3OXSA 5KVEL 5HHOE 1EA9C 4B53A 5K59E 1H9VA 1C8PA 4HUKB 2R2CA 1BBJB 2R0LL 3S35H 1Q9WA 4PGDA 2F19H 2YN3A 1YEFL 4PRPA 4ZSOA 2EYTB 3BW9B 3FB8A 3D69B 1D9KC 3S98A 3E1F1 3IS0X 4XBGB 5I1EH 3UBXI 1QBAA 3WL9A 1WSST 1D3CA 5FHAH 2PYEA 5EA0H 5FYJD 4EVNB 2VUYA 3HG1B 2RR3A 5E8EA 3BZFB 1RHFA 5GGQL 1RFDH 3WD5L 1WAAF 1NC2A 3ZHLA 3G5ZB 3HI6H 1EGJL 1PW3A 1P1ZB 2VTFA 2ZSWB 4KRPD 3BDXA 5J9PB 3DO7A 4QYOB 1FL6A 1T1ZB 4JFDB 4I77L 4GQPH 4LNVA 2ICWA 5E6IB 3BEWB 5F7HA 5CZVH 3KPRD 4WO4A 1R24A 4WFHE 5C0DB 1MLBA 2NY3B 1DCLA 5T1DH 1G7JA 4G9DB 2CDGB 3L5WA 1KB9K 3QUXD 5I8KL 4Y4KB 1Q0XL 2NX5B 1I3VA 3GO1L 1X5JA 2XTJD 1HKLL 3BKCH 3AREB 4DGYL 1BJ1H 2HJFA 5HHQA 5EZJB 4ZPTB 1MCFA 3WCYA 4BSVA 2CDFA 1S9YB 1BQUA 5JHDB 5H37G 3C6SA 2FL5B 1FNGB 4XVJH 5I30L 3ETBF 3ESUF 4M7ZB 1J1OH 5EC2A 2BHZA 3GBLA 4JFZL 3HZYA 4OT1H 4NQXB 5CHNA 4YWGH 3VXTA 3HNVL 1TTUA 3V0WL 1HOCA 3OKMB 4G9FE 1WZ1L 5IT2L 3RWCA 3UTTD 2ADFL 5DJZB 5D7IF 5TDPB 4WGVB 1KIUA 3CMOL 1JGDB 1MAML 1NUGA 1E4WL 1ZK9A 4Z76B 1G9EA 1G0XA 4KKBD 3JUYA 4JO2L 4GXUN 5D5MA 5DGRA 5CD5C 4Y4HA 1I4FA 2N56A 4OD3H 1DQLL 3QI9A 1S7XB 3V6ZA 5KBNC 1C16B 5E6IC 4QO1A 2CGRL 4FABH 5JZ7D 1UCBL 3C8HA 4F7PA 4JPKH 1AR2A 3BE1H 1YNLH 1P6FA 2NY3C 4FFZH 4K3EL 3KXFE 1G7IA 1OAUL 2P8PB 5DVNA 2DB8A 4Y4KC 1VENA 2HH0H 2M8XA 4C56E 2E9JA 3RX5A 4DWHA 3RWIB 5L9DH 2ENYA 2WK2A 1R0AH 1NDMA 3AREC 3RVTC 1E4XL 3IFLL 3M07A 5K9OB 3P0YH 2W1NA 2DN7A 4FFVD 3HMWH 3MO1A 5D71L 2OK0H 2CJUL 5BV7L 1Z9OA 2F5BH 3QDGA 2UY7A 2FH8A 1DQDH 4YIQA 2DQDL 4M7ZC 3QNYB 4PJ9B 4MJ5B 1NEZB 4XPAL 5DRZB 1IL1B 3RL1A 1Y18B 4EQ2A 3H6JA 1MJ8H 2R1XB 2BNQA 3DTXA 4OZHB 4XWGL 4GKZA 1BOYA 1FL3B 2Q3AA 4UOJA 4OGYL 4BSWA 5KSUB 1ZS8A 4PV9B 3FRUA 1L6XA 4LCYB 5FYLD 3VA2C 1PSKH 4JO4L 1NMCC 4JRXB 4LRNH 4K94L 4LLDA 4RFOL 3RGVD 1FYHB 1ORQA 5GZOC 5A40E 4P9MH 4Z5RB 3K1DA 4ELME 2DQFB 5A2JH 5ACZB 3BT2H 5FHBH 3CSGA 3VXRE 4Y89A 1IM3B 1MPAL 2AQ1A 3INUH 5SX5K 1MJUL 5D7SL 4AIOA 1FCCA 1QKZL 3CPLA 3O6MH 2GFBB 4WRLA 1T21A 4PUBL 1A3RH 1A64A 3V4UH 3BSZL 1HDMA 5IW6A 4DFIA 4TUJA 4HS8H 1WWBX 4EIZC 3TO2A 3H42L 5C6TH 4XP4H 4D0CB 2XQBH 4XHQA 1ZA3B 3KNBA 1RZGA 4LF3B 4U1NA 4PJ9C 5KSBE 1HXMB 1NMAL 2HJKB 4KHXL 3U30B 1U3YA 4WI6A 1VEMA 5KW9L 1EO5A 2HVKA 1HWGB 4XVTH 4MA3B 4MXWH 4FMFA 3VFNA 3SDAA 2H2PC 1S7QB 1BFVH 2X7LB 3MXWL 1W8NA 5F21B 5HSFA 1I8KB 1J1XH 1GYAA 3MODL 2VLLB 2I07A 3HRZA 4W6XB 1RUPL 4LGRB 4P23A 3WHXA 2C4FU 2J7LA 4OZ4B 1DUYB 1W0WB 1U3JA 4MQSB 3ROOB 3QNXA 1EFXD 4OUUA 4YHPA 1FRGH 3FN9A 2AEIT 3HR5B 4PP2A 1JCKA 4WTZG 1U58A 3MCLL 1CE1L 2VLJB 3VXUE 2JELL 2NY7L 3MLVH 1OP9A 5DJXB 3RU8L 1ZXQA 3SDDB 1S7TA 1AGEA 1U36A 1JPSH 1BX2B 2QHRL 1VA9A 4WI8A 1TENA 4BQBA 3QZWB 3V5DB 5KSAA 4KGJA 4OSUH 1GGCL 3IDNB 3Q1SL 2R2BB 4CJ0A 2HRLA 2EXWC 4ELKB 5LKNA 1F4XH 2XXMB 3GFUA 3PWNB 4FQLL 1H3WM 4GMSL 4H8WH 4LCCA 4MA1B 1OP3K 3RHWF 3U30C 4LEXH 3EYOA 5C07B 5BV7B 4KMLB 5I8EB 3FT3B 1J1PL 2VDRH 4K9EL 4R90H 4LLUA 1K4DB 1JZ2A 2PXYD 2P4AB 1U3HA 5JW3L 4XWOD 5J0BA 5ESQA 4YZFE 3P11H 1VFAB 3GSWA 2ICWI 3MV8E 3HZVB 4HC1H 5I2IB 3FQRA 3L7EB 2ZUQB 3NFPB 1JYWA 4GSDH 1KCRL 4F7TB 8FABB 1I1AD 5DC4B 2JF1A 4G8FA 1MCOH 3RFZC 2BMKA 4PJ8A 4Y5YA 1ZT1A 3BIKA 4Y16B 1AD9B 1A6WL 5JMRA 3RL2B 4FQXA 2Z91B 5IVXF 1ETZB 1NSNL 3LH2L 1CXKA 4U33A 4WEMB 2DBJA 3AXLA 3VH8A 3CFDA 1ONQA 4D9QE 5I19H 2DYPA 4PJDB 2OP4H 3WHE0 3WNPA 4NQTA 2VXVL 1A0QH 4U6YB 1NFKA 2KPNA 2EYRB 4O2EA 5HGHB 5B38A 3EFDL 2FB4L 1KT2A 1U8JB 1KCLA 5D1XD 5HGAA 1FYTE 4RCAA 3QDMA 3QJHA 1TIUA 5DR5L 1JP5A 3PQYD 1OAKL 2R29H 3N1GC 3EDEA 5F7NC 2GK0B 1ND0A 4GBXD 5BV7C 1QHPA 5F9WB 3DURA 5GRVK 1XMWA 4QTHA 2I9LB 3PL6D 3BKYL 2X9XA 1UACH 1IAMA 3OMZA 3RY5A 4PP1D 3HAEG 2VDQL 3HG1E 3HAEH 2NY6D 1PLGL 4RWYH 3VCLB 3WFDL 3SGEI 5A1AA 2J8HA 3EO0A 3EOTH 4ZFGH 3QNZB 2HJLA 3QXDA 4Y16C 4AENB 2CH8A 4JPIB 5GQBA 2HRPH 3OKEB 4HX1B 3MRHB 1PVHA 1XGYL 2OJEA 2XA3A 1A7RL 4JFEB 1EX0A 4K94C 5DMIL 3EYSL 5FO8A 4JFDE 1HEZA 5BZDB 2XI9A 3RP1A 4R9HA 1NCTA 5EU6D 1C5BH 4QRQA 3K4AA 4U1MB 1BD2D 3VFUB 1HH9B 3QFDB 4LRIC 1KB9J 5C0BD 1ZA6A 5CSZA 3P4MB 1WEJH 1OP5H 4P4RA 4M7LH 2NX5E 4CVXB 2X4TB 5DJAB 5HHNB 4Y2OA 3K8MA 3E2HB 2BHUA 5KANI 3D85A 4QNPF 4JZJB 1A47A 4J6RH 4J4PA 5EOQL 3UTSA 1CLYL 4W81A 4LSSH 3WV0A 4HWEH 4OD2A 4JVWA 1QRND 3VWKA 1RJLA 5JHDE 4QXTA 2GAZA 5D6DC 4F7MB 1YEIL 1NBZB 1WV7T 1RIVH 5F9JB 1PG7W 4U1SB 3EIFA 1H0DB 2K9UA 5GRJH 2DLGA 4WY7H 4HGWA 5MEPB 4N0YH 1CFQA 1FAKT 2X1PA 2I25N 2X4RB 4LFHD 2CD0A 4EN3A 3ECBB 4KJYA 1MCNA 4AIZB 3UMTA 5SX4I 4KHTH 5EUKB 1JYXA 4F9PC 1D5ZA 1U92B 3W0WA 4FQQB 4L4VA 4G5ZL 1F8TH 1T0NA 1NCNA 3DETD 3O6FD 4DGIH 3LRSA 2ZUUA 1JHLL 4MWFA 2NCMA 4U1KB 4UIMA 3DX6A 4EDWH 3Q2CA 4GRWH 4ZFFB 1KBGL 4L4TB 5MENB 3GIVB 4PJEF 5MEQB 3QIWD 4EUPA 1P7KA 4RX4A 1V7MH 4G3YH 1A1MB 4MQXC 3S34H 3HUJA 3WO4B 3F7RA 1P69B 4QRRA 4DW2L 4JG0H 4ZUWA 4MD4B 2R4RL 4HUXB 2PETA 4K7FA 5GRYA 4HUNB 2E27H 5I1LB 4G80B 1S7RA 4LSVL 2HVJB 5KTEL 1FG2A 5ETUB 3CU1A 4GRMB 1JFQL 1NGWA 3EHBD 2GUOB 5KAQG 4JVPA 4OF3A 5T3ZE 4ZFOA 1ZHKA 2HFTA 1SYVB 4FQ1H 2DLEA 2YPLA 4WNQB 3CVHH 3V9FA 3GB7A 4OZHE 3MA9L 1BWWA 4A2MA 4K9EC 5LGJA 4TVPE 3NTCL 1M71A 1ZWIB 3U79A 3BH9B 2B1HL 1XIWA 3HKFA 3O6KH 4GW1B 1FGVH 4NQVA 1A8JH 3TPKA 4WFGE 3VI4F 4OZIA 1KXQE 3B4NA 3V6OC 2JJUA 4HHAA 4JRXE 4GAGH 4MLSA 4XVUC 3QEHA 1U95B 5FYJL 1WCQA 3QIUB 4HT1H 1OGTB 3ET9F 1DZBA 2X44D 3MJ8A 5D7JA 1BOGA 3PIQB 3ZYIA 4YE4H 1FNHA 1URLA 3LEVH 3RZCB 4OTXH 4X5LA 4JHBA 1FH5H 3PGDA 3WO4C 1BP3B 4G6MH 1H8OA 2R9HC 4HK0B 1NEZG 4ETQA 3FTGB 2W07A 5HGDA 5KVEH 3L3IB 4L1HA 4OFYD 1FVCA 3ZHDA 1PAMA 2ZNXA 5EUOB 1YDPB 2R0LH 3G5YA 2IFFH 4HIXL 5E9DB 4ODTL 1G0DA 1HINH 3O3AA 1WT5C 1BIIA 4LLWB 2YHGA 1L9NA 2HFFA 4FTVA 1MHCB 2W0FB 1QA9B 3BP5A 3GJEB 4MDIB 5GGQH 3OSKA 4NCC2 3UDWA 1R5IA 5J1AA 3WD5H 2W9DL 4DFHA 1U8OB 1EGJH 1K3ZA 1ZANL 1ZVHA 5DD3H 4NQDA 2GCYA 1KELL 2QKIB 3CZJA 2P43B 4NKOA 4JKKA 4J3VA 4ESKA 3VG0L 3QIUC 1F11A 4I77H 2GSGA 3TWCL 4HJGA 4U0RB 3FB6B 4MD0B 4CU8A 3BRGC 4TRPL 1N4XL 1NLBL 3IJSA 2FECL 1HHHB 2ZG3A 4D2NA 1KIPA 3RZCC 4CN4A 2NY2B 1RQ5A 5FO7B 3PE9A 4M3KB 2VLJE 1Q0XH 3GO1H 4JKMA 3MRCA 5FGRA 1W0YT 4YFEA 3MV9D 5D7LD 1NAKH 1IAOA 2EXYC 3MOBL 4M1CC 5LAXA 4LP4A 3B8SA 1OB1A 4IRSA 3ZKMD 4U6HB 2ORBH 4PV8A 3P73A 3PWLA 5I30H 5FOBA 4UILL 4MJID 4JM2A 4JFZH 4WU7A 4IRJB 5EO0A 1JF1B 1G7QB 3KLDA 5BQ7B 2NXZC 4JANB 3HNVH 3V0WH 4ZUVB 5C07E 1WZ1H 5IT2H 2NZ9C 5ID0A 4LASL 4RAVA 3KPQB 2ADFH 3FQTA 1A7BA 3CMOH 4PRNA 3I84A 4MS8C 1L0XA 1MAMH 2GHWB 2IC2A 1E4WH 4G43B 1J86A 4PY7B 4XXCC 5BOPA 4JHWL 4JO2H 5HI4D 2CIIB 1U8IB 3RX8A 3ULUF 3KYNA 1CIUA 5DD0L 2DWEA 4NUJA 4KKCC 2O61B 4U0RC 2CGRH 1UCBH 1KPRB 4HUWB 4WI7A 3QZWG 2XWTA 5E2UL 4R4FL 2CLZB 2F54A 1RIHL 4K3EH 3IXAA 4NO0D 4NOFA 1OAUH 5FYLL 3FB7B 4A6YL 1NGYA 3ALWA 3X3GL 5ADOH 3RDTD 1E4XH 3IFLH 2JIXA 4UI2A 3X13A 3STZA 5F3BA 4Y5VC 3TBVB 5EU3B 4PJDE 4BJLA 1UZ6E 4CN1A 1KJMB 4JJ5B 35C8L 1MCPL 3QPQD 5B3JE 4HKJB 5K93A 5JXEA 4IRJC 5IQ7L 4XPAH 1CGVA 4LHJB 5IV2B 4YAQB 5ENWA 5IHZB 1I7UA 4F8TA 2KZWA 4F80A 4XWGH 3EJZC 3KPRB 2Z35B 3BKJL 5F7LB 2IANA 3V6FA 5AYQA 4I0PD 4OGYH 3WE6A 1HI6B 2JB5L 4P3CL 3S37L 3VGBA 4GJTB 5FUZL 1QSFD 4JO4H 4ZO8A 3H0TB 4K94H 4RFOH 4OIIL 3QUZD 3LEXB 4P3DB 1FNLA 3QR2A 4IHOB 4OV6F 2NY0D 5IF0A 3GM0A 4K23H 3PWUB 4PJCF 1ZT4B 3HNTL 1JZ5A 1MPAH 1F6AA 2A6KB 1MJUH 5E5RB 4DN4L 5D7SH 4JFEE 3ZDXF 1QKZH 1TFHA 4YDJB 4PUBH 4H26B 3UTTB 5JIHA 2EDLA 5DHYA 3LCYA 5FUOL 3BSZH 4GUPA 5EBWB 1NDGB 3GSOA 4P2OA 4TUOB 2IAMD 3GNML 3H42H 4KRPC 3WNNA 3ZDZE 2OTWB 3OXRA 1P7HL 4DJMA 4U3HA 4NGHL 4RA3A 5I1GL 5DEFA 4KHXH 1F02I 5F1NA 5I76A 4XP9L 1P6AB 3CC5A 5KW9H 3MRMA 5DXWA 3MV7A 1F45A 3CFEA 1NMBH 2V2XB 1QLRA 1B6UA 5JR1L 3MXWH 3B5HA 1A6AA 3LZFL 3S37X 3WEXB 2XTJC 4KDVA 5LCVH 4M6OL 4ODXB 4KXZI 4DKDC 2X10A 3VGGA 3K2MC 3EGSA 1UXSB 1RUPH 5CP7B 1RHHB 1MCHA 3OG6B 5IMLB 3TZVA 3OR7A 2BSRB 3BKML 3MRBB 1DEEB 1WUNT 2DIJA 5KS9A 4U7KA 3C60D 1JGUL 2OI9B 1XEDA 2M2DA 2OTUB 1AQKL 4JO3L 2CLRA 4C56A 2IQ9H 3B9AA 3MCLH 1EUTA 3RI5F 2JELH 2NY7H 3RU8H 4IOIB 2VWEC 1TZGL 1C7TA 4Y5XA 3KPNB 4ERSL 4ZFZB 4Y0GA 5BS0D 4L4TE 5MENE 2QHRH 4IMKC 1DVFA 1WC7A 1N5AB 5JDSB 3CNKA 3RNQB 3MRJA 3PWPD 3RQ3A 4R96B 4KKBC 4JZOA 2AXGA 1FNAA 5CEZD 1CFTB 4JY5L 1GGCH 3Q1SH 2PYFA 2D31B 3T1WA 3VI3F 1RU9L 2MSPA 2A9NL 4FQLH 4FXGA 3ZT6A 2F53D 2X4NB 3MRFA 1Z2KA 1J1PH 1FLTX 1HWHB 1QQDA 1T20A 3BGMB 4PG9A 1YN6A 1R3HA 3QQ4A 3EJYD 4XHJD 2NMSA 5JW3H 4PJBB 4LCWB 1C1EL 4RAUA 4F37K 2YK1L 3MRLB 3HPJB 4GRLA 5EFIA 2X89D 3C5ZA 4FFVC 1E4KA 1KCRH 3K46A 3V0AC 2DL9A 2X70A 4UT7L 3VXRA 3S96A 5EB9A 2OI9C 3MPCA 1MFAL 1RK0A 4JN2A 3AS2A 3VXOB 1A6WH 1UFUA 3TYGL 1AD0A 4FXKB 3ULVF 2DI8A 1XFPA 3LH2H 1NSNH 4B41A 1GAFL 1SMAA 4UQ3A 1Q94A 5DVLA 3T3MF 4NO3A 3WJJC 1FFNA 1OL0A 3MRDA 1CT8B 2VXVH 4X8JB 4DK6A 5DQ9B 1J0HA 1KFAL 3EFDH 2FX8H 3KWWB 2YA2A 3RGVC 3VGAB 4NN6B 5IB4B 4GMTL 1AKJD 2AVGA 3KLHD 5GS1A 1T04B 2WWMD 5DR5H 1ZT7A 1OAKH 3I75A 2ATPA 4IOFD 5EUOE 1EFXB 2BJML 3R0NA 4KV5E 3X11B 5FK9A 4RGMB 5E9DE 1XF2B 4S1QL 1FSKB 3KPSA 4NWTH 3SDXB 1QVOA 2EC8A 3BKYH 5JUEL 4QKXB 3L3JB 4N68A 1FNFA 3D3VD 1BFSA 3HC4L 1JHTB 2BY3A 3QHFL 5EIIA 1I3UA 2EDHA 1NAML 1XCQA 5C0GA 4RMSA 3LN4B 2VDQH 5FA4B 1PLGH 3WFDH 4HF5L 3LQMA 1J0KA 1NPUA 3QCTH 4M7KL 3EDDA 1RZFL 3JV4B 1HSAA 1QR1B 4HC1A 1SM3H 5HDLA 1A7RH 2WP3O 3DROA 3GMMB 5LGKA 5DMIH 2P44B 2YD2A 1DBJL 3EYSH 3ARTA 3O2DL 5GS2H 5BRZD 2ITCB 2EIZB 2YPKB 4LPVA 2PNDA 1ZGLP 2XWBA 2H32B 4QGYA 4E5XB 5AG9A 3U4AA 1T3FB 5GISH 3VGAC 4EDXB 2X1WL 1NUFA 1LEKB 4E42A 4LAQH 1I1AB 5A43C 4UDUA 1JHKL 5EOQH 4HLZH 1CLYH 1JNNL 2A6IB 1KLUA 1ZLVH 5AD0B 1JWSB 4KI5F 1LK3H 4RGMC 1RUML 2DLHA 4ALAL 1G7HA 1FSKC 3ARDA 1MFDH 3MV8A 1AHWB 1P7QA 3RY6C 3RVVD 1T89C 1X5KA 4OLUL 1YEIH 5I8CB 4TYUA 4EI5D 1CFVL 1C7SA 3BP6A 1JIBA 1UVQB 5GRVL 5ID1A 3TJEH 4LNRB 4PRAA 4XCNA 2RQ8A 1XGQB 2EDWA 4WWKA 1C5DA 4G5ZH 1V7NL 3DMMD 1ZLWK 4WFED 3V2AR 3C5SB 5TE6L 5C9JB 3PQYB 2FGWL 1JHLH 3VFSB 3HAEA 2Q1EA 3E3QC 1HE7A 1SYSB 2PXYC 1GOHA 4O51A 1CD0A 1C08B 3O81A 2IPTL 3MNWB 4XWOC 4NN7C 3L9RB 4E41D 2D7NA 1OM3L 1CXLA 3IVKA 3MFGB 4URTB 2MKWA 4BELD 1FYTA 4FOMA 4ORZC 2CO6B 1U3ZA 4JFFA 4P59H 4DW2H 3MRNB 1NEUA 2CDEB 1I1AC 2R4RH 2XACC 2NY6B 1YEJL 1K5NA 1YEHL 3NIFF 3MNZB 1TZIB 1N3NA 1VCAA 2KH2B 4EJ1C 4NYLA 1KTDB 4G8IA 4LSVH 5IESL 5GSVB 5KTEH 4FQIL 2I9TA 3VGEA 3N1PC 3Q5YA 1JFQH 4U6TA 3G08A 2P5WD 4P46D 2OL3B 3D69A 1T5WA 1AHWC 4MA7L 4X98B 4YFDB 3REVA 1OSPL 1U93B 2AJXL 3FFDA 3VXMD 5EU6B 3LQZA 5KVMC 1MNUL 3D5OF 1N8ZB 1RK1A 3MA9H 4LEOB 1BD2B 1MFNA 3KPRE 4ZDHA 4OGXL 1EFQA 3NTCH 4ODVL 2B1HH 5J1TC 4K8RD 2RCSL 4KFZC 4LLVB 3PV6A 2ED7A 5D1XC 1NBVL 3Q6GL 1NAMB 2NXYD 3QEQA 5F7FA 4Y19D 4K71C 1UM6L 4GBXC 5FYJH 5D5MF 3WS6C 1QRNB 1T83A 3TBTB 3WKML 4BZ1L 5HYSG 5B4MD 5DJ8A 2YEZA 2NPLX 1QFHA 4QXGL 5IMMA 2CDGA 4W68A 4Y4KA 1J0JA 1GGTA 3P4LA 1QUNA 2HA1A 4FA8A 3B2UD 4MGXA 4BQ8A 1JPFB 4LHUA 4RIRA 3MLUL 2VWEE 4PP1C 1VB9A 2CIKB 1CS6A 3UTTE 2NY6C 1OVZA 2BDNL 2CKBL 3SE4C 2VZ1A 4OCXL 2FIRT 1HXYB 1LE5A 2XZZA 1E4JA 3K2UL 4ZOCA 4HIXH 1MJ7L 7CGTA 4ODTH 4JFYA 3S4SA 3FO2A 4HPOL 1FL5A 3MRGA 2D0HA 3VFOB 5DMKA 2Y5TB 2MJWA 4HAGA 5E95B 5HYFA 1ZHBA 3LS5L 4RZCB 2IH1A 2YC1B 3HE6B 1PY9A 3GMNB 5FYKU 4TNWF 4U05A 4MNQD 5TDPA 1BZ7A 3QIWB 5HYJA 3NIGF 2XOTA 5GS0H 3IDMA 5ADPL 2DMKA 2EC9T 4H0GA 4QGTA 3VD7A 3NA9L 2W9DH 4JN1L 4Z76A 2C3XA 5F44A 5E5MB 1ZANH 5T1MB 2EIEA 4IDLA 5CBEB 3CVHA 4D9LL 5DVMA 3RWJA 1CDIA 3Q48A 3HS0B 1ZSDA 3VG0H 2F8VA 4WW1B 5F70A 5I0ZA 3TWCH 4Y2DD 3HE7D 3I6GA 3PWVB 2MTPA 3CXDL 3SQBA 1N4XH 1NLBH 3NCYS 3QIBD 2BVPB 4UU9A 1UB5A 5K9KB 4H25B 4LCUB 1UKQA 3MCKB 5DT1H 4P57B 4HXBL 2UWEB 4L8CB 5HJ3B 1W72L 4OCYL 4PR5A 5IFJA 4CMMB 2D7PA 3KJ6L 3WYRA 5F71A 4RBPH 1HYRC 9CGTA 4YX2L 5C6PB 2MQ3A 4RDQG 3DYOA 2G9HA 3DETC 4UILH 3QNYA 5DZNA 2OQJA 4J3SA 3SJVA 1S9KC 1EV2E 4H20H 4KVNL 3HE6C 1IC5L 4ENED 3T0XA 3TH2T 1H15B 2FH6A 1MHEA 4J1UA 2F9BT 3QIWC 1TZHB 4LASH 3T1FA 4YDLB 2DLTA 1AO7A 4PTTB 5HD8D 3SKNB 2H3NA 1CQKA 2QQQA 3B2VL 5GGSB 4PJBE 4LCWE 4JHWH 1A22B 1U8HA 1LO0H 4BFBD 5DD0H 5EOTB 4XMKL 2ADIA 4NKIH 3BZ4B 3HPLB 1PFCA 3F6LA 3EHBC 5CZKA 4N9GA 1CICA 5DURD 3QEGH 2X42A 3QFJD 4R4FH 5E2UH 5SWSA 1RIHH 2MPAL 5DSCB 3GMRB 5C08A 2GYSA 5FYLH 4WW2B 2YN5A 4A6YH 3QUKB 4Q6IA 3KPPA 1HILA 4GT7A 4NQCD 2ZWLT 3O8XD 1X9QA 2CXKA 3E0GA 3X3GH 4P3WA 3X14A 2YWZA 2VQUA 5EC1A 1J87A 2W9EL 4KRNA 2ED9A 1FNSH 4I13B 3TVMB 35C8H 4FQ2L 1MCPH 3CFKB 4BYHA 4CNIB 5IQ7H 3ZDYF 3G6JB 2Y5EA 2DM4A 2CKBB 3MC0A 1ZLSH 4UV7L 2DKMA 3BKJH 1RURH 4JPWH 2GTWB 1U2CA 4YDLC 4CN6A 1CXEA 3P4OA 3B5GA 3AUVA 2JB5H 3S37H 3SDXE 5FUZH 1XGRA 1WICA 5D7LB 2C7UB 3GSXA 3G9AB 4JREB 4ZNEA 5F96L 4KZDL 3BEVB 1C5CL 3EKCA 3LOWA 4OIIH 3PG2A 3W11D 1H8NA 4P2RD 2IH3B 1B4RA 5T1KD 1P4IL 3LKOA 3HNTH 2P5EA 3EFFB 1KJ3L 1ZVSA 4MJIB 5E24E 2OSLB 4NKDA 4E0RA 4OZGA 4WW2C 4C54A 3D18A 4DN4H 5L7XL 1XF5B 3EZJB 3HB3D 3CSYB 3TT1L 3OV6A 4PJXA 3VFRA 5IJKC 1VGKA 2VXUL 4O5LL 4W70A 4C4KO 4WUKH 3E3QE 5FUOH 1TMCB 3DVGB 5D4QA 3GNMH 4FRWA 4YR6B 4IMLA 2R2BA 3TM6A 4L8BA 2CXGA 4XGZA 1N6QL 2FGZA 1W72B 4NGHH 5I1GH 2VE6A 3LKRA 4XP9H 5INCA 1YEEL 5GGRA 2DMCA 3G6DL 3T0ED 4NO0B 4JG1L 2FWOB 5CEZL 2YR3A 1NGZB 5JR1H 4ZTPL 3FFCD 5I2IA 3LZFH 5JLZB 1JZ3A 2VITA 1ZAGA 4DN3L 1K3IA 3NFPA 4M6OH 3ORJA 4PJHA 2XN9D 4JREC 3NCJL 4B5EA 4P2QA 1DBAL 3VGDA 1IGCL 3C5JB 4LPYA 2GY5A 3ZKMC 2GSIB 4FNLL 3BKMH 2ATKB 4Y16A 2Q76A 1YMMD 2H32H 2IG2L 1JGUH 1S5HA 2DQEL 1AQKH 5IG7B 3ZE1F 4JO3H 4ODSL 4M6AA 3WNLA 1YY8B 4L8SB 4HUMB 3PQYE 1TZGH 4ERSH 2NQCA 2RJMA 4JO1L 4PJDA 4I0PB 4U1IA 3Q3GB 1A2YA 3BN9C 1Q72L 2CLVB 3IKCB 3SOBL 3VGHA 1LE9A 4YFLI 4HD9A 3VMNA 4U3CA 3DVIA 1IRAY 1U8JA 4PRHA 4UB0L 4BUGA 4JY5H 1BQHA 5FGCB 3R8QA 4JFOA 4L4JA 4QRTB 3QUZB 2NY0B 1RU9H 4OJFL 2A9NH 1FFPB 4QOKD 5ISZD 2D9CA 4P5KA 4G7YL 4EOWL 1CGSL 1QO3B 2P8MA 5D6DA 5DI8A 1ZGLA 1T7ZA 4M00A 4ZG1A 1C1EH 2OBGA 4GS7B 4X6DA 3I6LD 4EXKA 2YK1H 5KG9A 3RDTC 2AV7B 3U83A 5EU6E 1QG3A 2OZ4L 4QRPA 2CPCA 1LDPL 1BD2E 2IAMB 4UT7H 1U8LA 2ZPKH 3QPQC 4IIQB 1FDLL 3QH3A 4HWNA 1CZ8L 3BESR 1MFAH 1S7SB 3NN8A 4PGCB 1TJHL 1TTFA 3FZUD 1LEIB 4XT1C 4L8SC 2FLBT 3PP3K 1G7MB 5F9DC 1GAFH 2YRZA 5IK3B 4I0PC 1QRNE 3QFDA 5TH2A 1Y6NR 5C09D 1FIEA 1YEDB 1RI8A 2GEEA 3DI3B 1KLGA 5HHXH 4XCEA 2O5ZL 1NFIB 3P77A 1KFAH 2VABA 3O4LD 4RMUA 1X44A 2VZOA 4QY8A 3QUZC 2N7AA 4GMTH 3VW3L 2NY0C 4QT5B 4HMEA 3CXHK 3HUJF 5TJWK 4R2GD 2NNAB 3ME0A 4HEPG 4EXPX 3MJ7A 1U8NA 3C60B 4PD4K 4WFFD 4WJ5B 5M95B 4GG8B 1RUQL 2BJMH 4AY0A 2NR6C 4S1QH 3GMLA 2ADGA 3V4PL 3LRHA 4GS7C 2BRQA 4FN0A 2R2HB 1ORSA 1MY5A 2F8XC 1DDHB 3HC4H 1OP3H 3QHFH 1BPVA 2R1YA 1AGBA 5BS0B 1NAMH 2DICA 5FKAB 3PF2A 2IAMC 4PJGB 2XY2A 4JFPA 4NSKB 3MREA 3T4AA 2HN7A 4IIQC 3MMEA 4JGJA 3UCRA 4M7KH 1RZFH 4N0CC 3V6OA 2Y1VA 4LBEB 4Z7WB 3QXAB 4M48L 3QJFB 1DTUA 3OAZK 3LKSB 1DBJH 1GGUA 3AVEA 3K8KA 4U6VL 5FECA 3O2DH 4LFHG 4OZIF 5E08L 3DGGA 1XF4A 5F6IB 3IETA 3H7LA 3RTQD 5F1OB 1N6VA 3QDHA 5J6HB 4H0IA 3MOAL 2J4WL 1RUKL 5DEGA 2QR0B 1DQQB 1OGAB 4LLQA 4Q2ZA 4CMHC 1KN4L 1XCTA 5JO5B 5I1JL 4NRXA 5BW7A 5FFLA 1CFNB 2UWEE 3QDJB 3SKJL 3QQ3B 3VWJD 3GGWB 1JHKH 2HVJA 1BVLB 3GUTB 1JNNH 3C60C 4NKQB 5EU5A 4JDTL 2PCPA 1RUMH 1I1RA 4ALAH 5F8RC 2JLLA 3KPLA 2DM3A 4OLUH 3G6AA 32C2B 3CX5K 3MX0A 1KPVA 1CFVH 1WWCA 3PWJB 3MRPA 4NC0B 1ZWIA 4M7JH 4QHNB 4N0UB 2Z4QA 1Q9OB 4UNTA 4GW1A 3NCBB 3WKNA 1YEKL 4N0RA 3DUHA 2BOBA 3A6BL 1YA5A 1HIML 1O0VA 1V7NH 3T65B 1OAQL 2A73A 4J3XA 2AV1B 4HS3B 5TE6H 1XR9A 2VLRD 2FGWH 3QIUA 3QWRA 3QA3B 1QRKA 1OGTA 2FHBA 4KQ4L 4L3AA 1EJ6A 1G6RL 2ZJSL 1DJSA 3U0PB 1XZ0A 3EBAA 2EEBA 1DQJB 5GHWH 3EJYC 4R4BA 5IOPB 2IPTH 1E4XI 1IGTA 1OM3H 5C0IB 5F6HI 4GKNA 3W5NA 3VXNB 4WGWB 5C0AB 4JFXB 2DQHL 4PLJD 2Z31D 5D9SB 1YEJH 2DLIA 3LPWA 2GITB 4G6KL 3B9KD 4NM8H 5IESH 3DUSA 4FQIH 5J13B 3AAZB 1ACYL 3IF1A 4Z18A 3B9EA 5DZLA 3OJVC 3NH7L 4Y4FD 4YEEA 2IWGA 1EDQA 2AGJL 5DMGC 4MA7H 3SQOH 1MREL 1OSPH 2AJXH 2D0GA 5CEYA 3MRKB 1TQCB 3G6JE 5IBTL 4I18B 5BRZB 4MX7A 4JM2F 5SV3A 1MNUH 4OQTH 2WLYA 5BVJA 2XIDA 4HKXB 5FYKE 4JQVC 3FQWB 3QEUB 4OGXH 4NPYB 4ODVH 2Y07L 2VUOA 4XXDB 3RIAF 3OF6D 1NANH 1E27A 2MQCA 4HGMA 2RCSH 1I9JL 5D8JL 4F7EB 2BCKB 1S7UA 5EZLA 5D7LE 3KLHC 1NBVH 1GZPB 2WWMC 3Q6GH 1DR9A 5EOCJ 3QXTA 4ISVA 3O45B 4IOFC 2BHYA 1UM6H 4Z78B 3BFOA 4I5BA 5HHOD 4KQ3H 1TETL 2ZCHL 3MRIB 5ITFB 3S3JA 3WKMH 5B8CB 4BZ1H 3NPZB 4MJIE 4QXGH 5F9AC 4PLKD 1T22B 4HDIB 4NO2B 4ZUTA 4EI5B 5HBBA 2VDPH 4BM7A 3MLUH 3RWEA 2WW8A 2AK4D 2F15A 3FO9B 2BDNH 4Y5VA 4OCXH 5CS7A 5EH1A 3UTPD 1KTLB 1HHGB 4HKBB 4EI6A 3BO8B 2H9GB 3K2UH 1LO5B 3AS1A 4LVNB 4UOW1 4NZUH 1MJ7H 3FMGH 2APVA 5F7EL 3L3HB 1QNZL 2PO6D 2K7QA 4WDIA 1KJVB 4I18C 3VFGL 1OAZL 2BZDA 4O58L 2F74A 1BVKB 4G8EA 5ADPH 1YN7A 3REWA 3NA9H 1A1NA 4IOSD 2GY7B 4JN1H 3WIFA 2YSSB 1XF1A 4UTBL 1F6LL 5E99L 4BSJA 1EAPB 3IFPB 4D9LH 3DV6B 2VL5A 1KEMH 1KV3A 3RI5K 1WAAA 2W38A 4AM0B 5E2VL 4O2FB 4LVHB 3CXDH 4HBQA 2AKRB 2PW2B 3LAFA 3E6FB 5GGUB 1IAIL 4BK5A 3U6RA 4U6XA 3RVVC 1IT9L 4EI5C 4U1HB 4W4OA 2Y9RT 2Y7QA 3M45A 4HXBH 1R3JB 1SVZA 1W72H 2GIYA 4OCYH 3GI9L 5CJXC 3KJ6H 3K80A 3PABB 4J12A 1G6RB 1IGFL 5HYSA 2QLVB 1IBGL 3OKOA 1EPFA 4LARL 4PYGA 4G9FD 4YX2H 1KIRA 4Z7UA 4LVNC 4G6JL 3DMMC 1MFCL 1QSFE 3NACL 4X6FA 2YD8A 3SE3C 5FGCE 3FO0L 4XMLL 5DS8B 4K07A 3IFOA 4KVNH 2A6DA 1S7WA 3KPRA 1OAXL 5BXFB 5JDJA 2H26B 2Q7YA 2X05A 3QUXA 4L9LA 5I16B 5ACLA 1XAUA 4ZUSB 1UJ3A 1YUHA 3B2VH 2AJZA 3V5KB 1P2CB 2VYRE 3KXFD 1YMHA 5AYUL 1S9VB 2LAGB 5EG6C 1L7TL 1QEWA 1SVCP 4P3DA 1D5IL 4MMZC 4X6EA 2A74B 2R2EA 1FLRL 4XMKH 2FJFA 2CRIA 4G7VL 2D7OA 5D7IB 3N1QC 1KACB 2Z8SA 4P46C 5ACMA 4LMQE 3FB5B 2N4IA 2DF3A 5EZOH 1A6TA 2GJ6D 3RKDD 5KS9F 1ED3A 2A6JB 3UZQA 4YBHA 5CINL 3VDAA 4LVEA 4MNQB 2ILLA 2JE8A 3P9MB 4AG4L 3TBYB 1TLKA 2NY1B 4IMKA 2W9EH 5DFWH 5HYQB 4K8RC 5CIPB 1IKFH 3PHOB 1KXTB 3KR3L 4FQ2H 3QRFM 2ERJB 3LV3A 5E5UB 1G9NL 3VD5A 3CXHJ 2FEDD 3SKOA 3WIIL 1BQLH 2VDOL 1JNJA 4N8CL 5FM5O 4PD4J 1FPTL 3PHQA 5JNYB 1XGTB 3HE7B 5B4MC 3BQUD 3E6HA 4EEEA 1JPGA 4YNYB 1WBXB 3QIBB 4EKXA 1OQXA 3VXQB 2KKQA 2WIIA 3VFTB 3B2UC 1AXTL 3WEXA 4MMXC 3UJIH 5DD1L 1RHHA 2C3HA 2NW3A 5F96H 5BS0E 2R4SH 1C5CH 3L3OA 3ILPB 5EO1A 3BDBA 4PJGE 1J05B 1P4IH 5J4MA 1NGXA 3ARGB 4ELMF 1KJ3H 4OZFG 5FKPA 1JGEB 4OZFH 4GQ9L 4Z7WE 3WIHL 5J56B 5L7XH 1MCRA 2RBLA 3EDKA 3DBXB 4ODWB 1KCUL 2F53E 1VFBA 2VXUH 1WZKA 1A21A 4O5LH 2IFGA 3RNQA 4CDGC 2W60B 2J1KA 4X7SL 1J11A 4GO6B 2ESVA 2XZCL 1KG0A 4JHAL 4XNYH 1OGAE 4A6YA 1CFTA 1U8PA 2ERJC 2ZOLA 3RGVA 3BPCB 3HN3A 1X5XA 1RZJL 3T0WA 4HZLA 3BYYA 3HTLX 5IB3B 4XMPL 2QSTA 3VRIB 4LAJH 3N50A 4Y2DC 3HE7C 2H2SD 5DURB 1YEEH 3QIBC 3G6DH 3RWHB 5L2KD 1IEBA 4JG1H 4OLXL 5CEZH 2UYLA 1INDL 1D5XB 3L6FB 1VEPA 4ZTPH 3CX5J 1F97A 3RAJH 1PGRB 4DN3H 1H3VA 3K0WA 3O8XB 4D0DA 3BP4B 3NCJH 4KUZL 4HKZB 1DBAH 3PDOA 4BFEA 1IGCH 2YD3A 3QG6B 2CUMA 1V5JA 2DKUA 2BNRA 3FT2A 4N0UE 3Q6FB 4FNLH 4DKFL 3BXNA 1NCCL 5J1SC 1Q8MA 3HR6A 2IG2H 1IC7L 2DQEH 1P9MC 1AGFB 2BP3A 4KROB 4ODSH 4ZAKB 4FFWD 1I7ZB 4QF1B 2CMRL 4RWHA 1TCRA 4OCSL 3OL2A 4ENEC 3L7FA 4HUVB 3FJTA 3GRWA 3IXTB 1QLFB 5TGBB 3W9DA 1OSZB 5F7WC 5EOCL 2FD6L 5KSVA 1CE6B 4JO1H 4JRYA 1T03H 1X3DA 5IR1A 4F3FA 3MLZL 1Q72H 5HD8C 3HCVA 2ZUVA 4MQ7A 1S8DA 2PR4H 3DX9B 4EQ3A 4OD1L 1AI1L 1UB6A 1MLCA 4UB0H 4MQTB 1FNEB 3K7UA 5C0AE 2PW1B 4PLOB 1X7QA 4P2RB 1FV1A 4OJFH 3O3EB 5E8DL 3F7YA 5T1KB 5FO9A 4G7YH 4EOWH 1CGSH 2B39A 5DFVD 4NHCH 5ANMA 3OAYK 4WUUB 5CD3A 3PDGA 5B39A 2FR4B 1A4KB 1EVTC 2R39A 2XV6B 3O8XC 1HH6A 1JUFB 1CD1A 5DRNB 5BRZE 1S78C 2OZ4H 3G04A 2YZ8A 2AJUL 1LDPH 3DGCR 1OARL 2E8YA 3CH1A 4OI8A 1I8IA 1FDLH 5TF1L 1CZ8H 2BVOA 3WLBA 2WUCH 4OAWA 2G60L 1TJHH 5KN5A 4WENB 1DBBL 3ARBB 3EYVA 4HEME 1SY6L 3DX8B 3S97C 3U46A 1RSFA 4MB4A 4MAYD 3GMQA 4Q9CA 2PXYA 3T0EB 1NGPL 1CGWA 2C1PB 1GGIL 3CFBB 1KJ2L 3CDGA 2NW2A 3AU1A 3OKKA 4Z0BL 1E6OL 5IKCB 3LN5A 4XCYB 2O5ZH 4KI5D 3NCMA 2X4PA 2XN9B 5D2LB 2EDYA 4S0SD 1JVKA 3TYFB 2XPGB 4U1JB 1I1AA 4XPFL 5IVXB 3W11C 3VW3H 2GJZA 2GKIA 4YH6A 2WZPD 1FZJA 1R5WA 1UADC 2EDXA 1HHJA 1JK8B 3WXVH 4TNWK 1JWMA 3VRLF 1RUQH 4X6CA 3H7BA 2VR4A 4WFEE 3RWDA 1G9NC 5MERB 5HVFB 4Q0XL 3GSRB 3O3BB 3HB3C 3V4PH 1A02N 5DRXB 5SWZA 3H3KA 3BPOC 2P8LA 4YLQT 5DJ0B 5C2BL 1OTTC 4MB5A 2P47B 2VC2L 5ECJE 5AUMB 3F12A 4XH2A 2QL1A 3FO1B 5D1XA 2I60L 4M48H 3ARBC 4RGOH 2FX9L 4KUCD 5E00B 3TESA 4NQED 4GBXA 2FECI 2OXGA 4U6VH 3WS6A 5ISZB 5E08H 2XTLA 3EO1B 3H9SA 3T0EC 1X6LA 4R0LA 1Z0NA 4JB9L 4MSWB 4H88L 1B88A 1S9WB 3PL6A 3MOAH 2J4WH 1RUKH 1IE5A 2YWYA 1K8IB 5JHDD 5IB5B 2ZZUT 4GKSA 5I1JH 3SGJA 4N1CA 4JKLA 5I8OL 2X4SB 5ILTL 3SE4A 2Z92A 3SKJH 3ARPA 1KPUA 3R06A 1FQ9C 4QCIA 1QFUL 2IBZY 1U8MA 1RZKL 1JL8A 3L3GB 1J8HA 4GRWF 4GG6A 4DUXA 4JDTH 4NUGL 2GQHA 3O2VL 5FA3B 2LE9A 5HGBA 4HH9A 3W39A 1RZJC 1UH2A 2J2ZA 3FN3A 3ZKQD 4X7TB 3MGTA 2JTDA 4X99A 3RPKA 1G1YA 5F1IA 3SO5A 4YFLF 1NC4D 2C26A 2X9WA 4L3EA 3SDCB 5T5FL 5C0BA 4PTUB 2JB6B 3VA6A 3MXVL 1T0MB 1UKTA 1YEKH 4LDEB 4N5UA 1I3RA 2I26N 3A6BH 1HIMH 3O4LB 4KDWA 5GIRB 4UT9L 1OAQH 3MBEA 3HI1B 5F7MC 4P2YA 3PJSA 3IGAB 2EECA 1A7QL 4R2GB 4JEGB 4KQ4H 1F00I 1Q1JL 1SJHA 3QULA 3TBTA 3GMOA 1J8KA 1BLNA 2D7TL 1G6RH 5D7IE 1KB5B 5E1AA 4OB5H 2D7QA 1TQBB 1JTOA 5I1DA 1PG7L 5L88H 3FAWA 2VJXA 2FO1A 1N2RB 3G5XB 5DDHB 2DQHH 3OBAA 4MNQE 3HRPA 3DJ9A 4QHMA 4BKLB 2CR6A 2XKUA 3H9HB 1F3DJ 4YBQD 2VIRA 4YGAB 4G6KH 3ARUA 3RBSA 1QLEL 3O6FA 4PJEB 1ACYH 3TBWA 4TVPD 2EYSB 3FZUC 3NH7H 4P5TA 4YHIA 1AP2B 2AGJH 1WCBA 4R7DB 1MREH 5DHVB 1FO0L 4WFGD 3RA7L 5DTFB 4HFWA 3RRQA 3SY0B 1N7ML 5IBTH 1NFDA 2WLZA 5E03A 3F5WA 4LGPB 3QIWA 3RTQB 2Y06L 4R7NA 1AXSB 1K4CA 1R3LA 1Z0MA 2XFXB 4I48B 2EDQA 2UV3A 2Y07H 3GMPA 2YD7A 3TV3H 5T1MA 3MLYL 1I9JH 4PRDA 5D8JH 3RWGA 4WHYG 3VWJB 2E5EA 4KMTL 4R2GC 4JY4A 1DLHA 1JN6A 1J18A 4YHKL 1TETH 2ZCHH 1Q9KA 2V7NA 2ICEA 1JPST 3K1KC 2HG5A 3RNKB 2CK0L 1UQSB 1TQBC 4TOYL 1ZLWH 4HWBL 4N0FB 1PG7X 4JLRB 4AT6B 2D3VA 1JNHB 1J7VR 3VRJB 4ZO6A 4GW5B 3G5VA 5HI5D 1FFRA 4PJFA 2A83B 2JJSC 3OHXA 4JKPL 3DSFL 3QP3A 1OW0A 4Z7QE 3WFCL 1I8LA 2QADD 5F7EH 1JTPA 1BHGA 1QNZH 3C6LB 3DX7A 5ESAA 1EEYB 2G5BA 43C9A 5JXAL 4P0DA 5IVOA 2F5AL 3VFGH 1CXHA 2R1WB 3AMLA 3SDAD 1N64L 3RTQC 3FCTB 1OAZH 3VDBA 4O58H 5JPMA 3UPRB 5DJ6A 3QFJE 3LRGA 3CX2A 2NTFB 4X6BB 1KLFA 5MP6L 1I8MA 4UTBH 1TNNA 1Z9MA 3O11B 4K3HA 3VWJC 5IROC 2Z31B 4OQTA 1ZHLB 2BNUB 3RZWA 5EWIL 4YXLH 4BK4A 4F2MB 3SDDD 3B9KB 3W81A 4ZS6D 3TN0B 3FQUB 5E2VH 4PS4L 3VFVB 3ARXA 5GSRB 2YBRB 5DSCA 4XX1E 1CVRA 4LLMB 5I17B 1IAIH 5HHMB 2VZUA 1IT9H 5FV2A 3FRPA 3SGDI 1O5DT 5SWQB 5MI0B 4Q74A 5IHBA 4OZGF 2PTTA 3V7AG 3GI9H 4X4YA 3F7VA 1IQDB 5KSAD 4F9LA 2ARJB 4JAMB 2QV2A 1IBGH 4LARH 4OFVA 1T1XA 1B3JA 4PJXF 3MA7B 1UCTA 2FYYB 1MFCH 4YDVB 3NACH 5MHSD 5EU4B 3O3DA 3T2OA 4NIKB 1KCSL 3FO0H 3I9GH 5CLTA 4QHUA 4XMLH 4Z7VA 3U48A 4P2RE 3VDCA 2I5YL 1OAXH 1KNOB 1RZKC 3IDGB 4Z95L 1QYGL 3I02A 2APFA 1HSBA 1IGJB 4XX1G 2JK5B 5FB8A 4WUUE 4GXVL 3MV9A 5GRUL 1T5XA 5AYUH 1RULL 4PLJC 2Z31C 1L7TH 3KLSA 3ROLB 1D5IH 3P2TA 1RV6X 4RGND 3RVUC 3B9KC 1FLRH 3M1BA 3T4YA 1I9IL 4PJHF 3TN0C 4G7VH 4UQ2A 4KK9C 4HUUB 5DD6A 4MJIA 4Y4FC 1K2DA 1VHPA 4BUHA 2PO6B 3B6SB 4JFQB 4XNMA 4S2SA 3KYOA 3U2SB 5EBMB 4PREB 4ZQKA 3T09A 5DUPL 2L7JA 1IJ9A 4M7LT 4ODUA 1AQDA 4UOW0 2APBA 1LNUB 4MYWB 1TVHB 4M61A 5CEXA 2E8ZA 4H1LG 1H3XA 4AG4H 4H1LH 3T0EE 1B9ZA 3C87A 1GRWA 2A0LD 1F13A 3C8KA 4PJDF 3KR3H 4YXHL 3LD8B 5GGSY 1G7LB 1G9NH 5C0CA 5J7CC 3ARFA 2XN9E 1W72A 5D2LE 5B3JF 5IVXE 3WIIH 2NLJA 2VDOH 3CU7A 2H8PB 4N8CH 1B0RA 1EHAA 2X4OB 1FPTH 3VD4A 4A2LA 4JQIL 1JRHI 1V8HA 4NHUA 3BN3B 1NGZA 4WTXA 1AXTH 3HFML 1A4JA 5DUBB 5DD1H 3RDTA 1CLCA 4HIEA 2C3VB 1I7RB 3ULSB 1QPPA 3GSVA 4DVBA 4JFED 5DD5L 2Z0BA 1FVEB 3FONA 5CMAA 3LN9A 3OKNA 4M6ML 1IFHL 3OZ9L 1DE4B 4X6DF 3WLWD 2DQGL 4W4NA 4JGMA 5KJRL 2D0FA 3JWOL 2PO6C 5ICYB 5FV1L 1WVZA 3MFFB 5HPMB 4PFEA 3EYFB 4CW1A 2AEWA 3D0LA 4GQ9H 4L8SA 3WIHH 1Z5LA 3MSPA 6FABL 3Q0HA 3TO4B 1I7TA 2BOCA 4WV1C 5BJTB 1UJTA 2GT9A 4QOKE 1KCUH 1I9RL 1QFWL 4MCZB 1FE8L 5ISZE 1JNLL 4YBLB 1E6JL 2Z93A 4JDVA 4O02L 5IMKB 3UBXA 4PJCB 1FGNH 4X7SH 3KDMA 2XZCH 1QSFA 3KLAA 5GJSH 3EOYG 5D1QD 1M7DB 2VDNL 4KTDL 3U0TB 1GPOH 3I6LE 2R23A 1RZJH 2CRMA 1FJ1A 4J4PD 3UTSD 3TIDA 4OV5B 4XMPH 2W65B 3VWKD 5D6CA 2ADJA 4YHML 1EZVY 1WBZB 1G9ML 3WUWB 5I15L 4U1LA 1I1YB 4XNZB 1H5BA 3WNKA 2GJ6B 4OLXH 1INDH 1CBVL 3HZMB 1AE6L 5LGHL 3DV4A 4DAGL 3BD4A 2A2QT 5FDWA 1MCEA 1JF6A 1Z3GL 2X6MA 4QNPE 1EO7A 3W0WD 2RGSA 5C09E 3GHEH 3KPMA 5DJDA 1NCCH 1DL7L 1SEBB 1YPZA 4L4TD 1CFSB 5BVPL 4N8VA 4PGCA 5DQJB 2APXA 1IC7H 4J8RB 3O4LE 1PEWA 3HC0B 4R4ND 3MYJA 2CMRH 2ICCA 4J3OC 1R3KB 1JGLH 4YQXL 3EYQD 1U2HA 4RX4D 3LVEA 2R9HD 4LPCA 3FQNA 1MI5D 5EOCH 2FD6H 1JWUA 2IADB 4YBLC 1PQZA 4U1GB 1CLZL 2QTEA 4WFFE 1A9BA 1FBIL 1II4E 3NPSB 5FGSA 1DN0A 3MLZH 3N0PB 3AROA 2BSTB 4QRRD 4OZFA 4I2XB 4NN5B 1JV5A 1IGYA 4OD1H 1AI1H 2AK1L 4OLWL 3I3BA 3P4NB 3ZYZA 3WO3B 4YHZL 3D2UA 1TVBA 3C09C 3NFNA 5E8DH 3I3DA 4ONFL 1PYWB 4XNZC 4PJEE 5A3ID 1JZ4A 5E8PA 3RKDC 2YPLD 3MV11 1NKRA 3VXPB 3DRQA 4GAYA 3U36A 4JZNA 2NY5C 5AWNL 4PJ5D 4RAHA 2H6PB 4F7CB 3CDYA 3EOBA 1NANI 5JPNB 1XIWD 4PJGA 2AJUH 3X17A 3PWPA 3FOMB 3S5LB 3U9UA 5C0JB 1J5OL 4XP6L 5AAMA 3WSQL 5EN2B 3V0VB 5TF1H 5C92A 3WN5B 4PJAA 2B8OT 3IJHA 1ZTXL 4BH8A 2G60H 4PB9L 2FEDC 3VE0A 1OTSD 5D7JD 2F53A 1NL0L 1SY6H 4DUWA 2MHAA 4R3SB 3BQUC 4PBWD 4U1GC 2PUQT 1NGPH 2Q86B 3NPSC 5L2KB 1GGIH 1KJ2H 1U6AL 3J7HA 3P9LA 1U0QA 4KXZH 3NOIA 4LHQB 4NN5C 5J6GB 4MD5B 1E6OH 1CDYA 1QP1A 3VI4E 1B0GB 1NJ9B 3DRTA 1FZMB 1QSEB 1UH4A 5DUML 4F58L 3BP7A 3KS0J 4XPFH 3SCMA 4YHLL 3MV01 2CO7B 1A1OA 2IBBA 1MWAB 2BSED 3CGTA 2V2WB 1F3RB 1UZ8A 3IB4A 4I1NB 1U41A 5CJ8A 1MUJB 2EDEA 1FZOA 3AC0A 4NRYA 4FTVD 4MS8D 4Q0XH 3W9EB 4WI2A 3ZSSA 3QYCA 2KBGA 3H9YA 2AXFA 1CYGA 2LTQC 1F3JA 2ENSA 2V9TA 5C2BH 5IEHB 1Q0YL 2FNBA 4NQDD 4KKCD 2VC2H 4YHNA 2RFXB 1ZOXA 2EKSA 1FIGL 1AGDB 1TVDA 4TNVF 2AV1A 4NO5A 1UXWB 4CVUA 3SEPA 1AKJA 2I60H 2VLKB 4AQOA 1U8KB 1BM3L 2FX9H 2NY2D 5C0ND 4S1DD 2OZ4A 1VACB 2FIKB 3LKQB 1LP9A 1A9EB 1MHHB 4OFDA 1XGPB 5I9QB 3MGOB 4M02A 2H2SC 2HFEA 2DDQL 4XC3L 4Z0XA 3JWOC 4JB9H 5C0FB 4H88H 4XBEL 5CSBA 4WCYL 5CJOL 5HHME 5IM7B 3D3VA 4H5SA 3C8DA 4MXVE 1WITA 1FVDA 3P40A 3PP3H 4JFXA 2O5YL 5I8OH 3SKUD 4IRSD 5HHPB 4IRJD 4FMKA 3M8OL 1ZEAL 4RMWA 4X4XB 1Q9LA 1QFUH 3V5HA 4KKAD 1WBYA 3GHBL 1RZKH 2Q7NA 3Q5OA 4YJZL 3CFCL 5BZWA 4AEHL