1A6PA

Engineering of a misfolded form of cd2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
94
structure length
94
Chain Sequence
GTVWGALGHGINLNIPNFQMTDDIDEVRWERGSTLVAEFKRKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILDKALDLRILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-CELL SURFACE ANTIGEN CD2
publication title Engineering an intertwined form of CD2 for stability and assembly.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion
total genus 7
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a6pA00
4ODWA 5D96B 4F7TB 5E2TL 2AXJA 2GK0B 4GW4B 5LCVL 2HWZH 4D9QE 8FABB 1OSZB 4PB0L 4AM0B 5I18H 1BFSA 3FCTA 3CVIL 5I2IB 5I8CB 4MNQB 1FFRA 5LG1A 5K9JH 3M45A 3GIVB 3FRPG 3TCLA 3ARFD 4AEHL 3QUYD 4WW1B 3RY4A 3OB8A 4Y5YA 3JWOH 1ACYL 3KNBA 4ZS7L 2WIIA 1FGNH 5EN2B 5C08A 1RZFL 4HGWA 5D5ME 2WWKT 4Z7VE 1URLA 5ESVA 5TDNB 3BKCH 3U9PL 2CSPA 4WV1C 3VFWA 3O3AB 2FB4L 4FQIH 4NQCD 2VXSH 5E08H 1NMAH 1LEKA 4J7RA 4XAKE 5DEGB 5DHYA 4YHZL 1U3HB 1DBAH 3EGSB 3RDTC 2SEBA 1VADB 1WLHA 3HR5A 3QFJE 3HE6C 3F7VA 4MDJA 4X7TB 1LE5A 4G7VL 4MJ6A 1U8LB 2UZIL 1GYAA 3DBXA 3O2DH 4P49A 1J18A 3MRDA 5J11C 5JPNB 1G7HA 4QYOA 3BP5A 4R3SA 5FYKH 2NY2D 3L7EB 5AD0B 4P5TD 1KULA 2CKBH 5TQ2L 1NGXA 5C0AB 1JGLL 4Y4HB 3SKMA 3HZKA 3TBYA 2CLRB 5JPMB 3MLSH 4JHAH 5B39B 3UEZA 2JJTC 3VGFA 4NM4H 3FT2A 4MXQC 3T2QA 3V6OA 2E9IA 5CBEB 2PW1B 4GKNB 1IC4L 3MFGB 4WO4A 4HAGA 4CMMB 1U95A 3KYOB 3ZT5A 5CP3H 3D69A 2AK1L 4N0UA 5KAQG 2AEQH 2IGFL 3TA3B 1R3HA 3DOSA 3MRJA 5ITBL 5AAWA 3QUXA 4L5FH 4OD2A 2Z31C 1DQJA 4PJEA 2CDGA 3I02A 3JV4B 3TIDA 1R5IB 4YHKL 3C5ZB 2XZAL 4PTTA 5IEHA 3QIUC 3FB5A 5ISZA 5F3HA 3VGAB 5CEYA 1LDPL 3HC4H 3ARZA 3IETB 1MCKA 2VLKE 4C4KT 4DWHA 5ADPL 3JV6A 5JHLH 2E6JA 4G6MH 4OZFG 1JNJA 3TO4D 5IBUB 1O0VA 2OSLA 1J8HD 2CXKA 2H26A 4PRPA 4D9QD 5JHDA 3CCHA 4NQVB 4ODXB 1UB5B 4JM2A 1IFHH 5L8JB 1MCHA 5K9KB 2Y36H 1S3KL 3LQAC 1KPRA 1OHQA 3FFDA 3QDHA 4OFYD 2ZUWA 2AV1B 3L9RB 5L0QC 1MEXH 3V6FA 5EZOL 3L3KB 4AK1A 2Q8BL 4EVNB 5D70H 4HUWA 2DI9A 3ZDXF 3WIHL 2C3HA 3AM8C 1KTDB 5I1DB 3QUMH 4X5WA 5JNYB 4NKQB 3IXTB 3OXRB 4YHOH 1CDCA 2A1WH 1BVLA 2YPKB 1UG9A 2GUOA 1A02N 4L4VE 1UZ6F 3SGEH 3ESUF 5TF0A 4M5ZL 4Y2DC 3GBLA 2X7LA 4LQFL 2X4SA 4RAVA 4KZEL 4U1MA 4KJWC 3UPCA 5SWZB 4ZFZA 3NAAH 1DQQA 1PBYA 4Y4KB 2A9NL 3VWJC 4P4RB 2PO6A 1KNOA 4K8RH 1T66D 5DK0B 1R5WA 5C0IB 1HHHA 4Q74A 1A2YB 2VL4A 5ENWA 3VFNA 3DV4A 4ONOA 1FL5A 3SE8L 1BFVH 1QZ1A 3GMLB 3NBNA 1ZMYA 3VXSB 1FVCB 1INEL 3Q1SL 3QUZB 4XTRD 4NNYA 5HVHC 2A77L 3IDIB 1OAKL 2VQ1A 4JANA 1JUFB 3MJGX 1JFQH 3MV9A 3NVQA 4OCWL 4JQXA 1YEHH 4NDMB 1DFBH 1H5BA 2VDKL 3AB0B 3F5WA 3S4SB 5IGXH 1Z0NA 4NHCH 4ETQA 1IL1B 2R39A 4M7ZC 4UQ3A 3T4YA 2M1KA 2F19L 5FM5O 1NUNB 2A83B 1I1FB 4PPTA 3WXVH 1WFTA 2AKRA 2P5EA 3DYMA 1HI6B 3ARGB 4JB9H 3D87B 1CFNB 1KBGH 5J3HD 4BH7B 5MENB 1X5IA 5F70A 4IRZH 5MEPA 4GKSA 2YEZB 2AJUH 4Z5RA 1CE6A 2OL3L 3FAWA 3K8LA 1D5BA 3J8F7 1E4KC 5EBWB 1RUQH 1BIHA 4PP2B 4ZPTB 2PUQT 1LO5A 3LAFA 1YZZA 4MA3B 2H2PC 4JZOB 1RVFL 2H1PL 4JY6A 1YEJL 3RX7A 4CN1A 3MLPA 1EEYA 3GSWA 4JZJB 5HDLA 3QQ3B 4EZMA 5IMMB 3X13A 3BJ91 2BC4B 4OLXL 3S35H 4JDZB 3ILQC 5D71H 2YN5A 3GSNA 4FQHB 4QRPE 3CX2A 3P9LB 4NZTL 4I2XA 5GZOD 2XN9D 1CICC 4M6OH 2P8MA 3TCXA 3U2SA 5FYKU 4MAYC 1FHGA 3WS3B 1I1YB 3TPUA 1BOGA 2O5YH 4KTDL 1RUPL 4LPXA 1HXYA 3VFUB 1IGCH 2P47B 2IPTH 4HCRH 5KVFL 4PRIA 5FUOL 4J3SA 4FQ2L 5EIIB 4LAQH 3GJFK 3M1BB 5HHXL 5IVOA 2MKWA 3RUGA 3VGHA 4E41B 3RU8L 1F97A 3EO1A 5JXAH 2DAVA 2JF1A 4HIHA 4MX7A 5ILTL 3T2NH 4M1CC 4F9PA 2XZCH 4H5SB 3ULUC 2VDNH 3Q2CA 4DW2L 3L5XL 2APFA 4JY5H 2PYFA 5C92A 1IEBB 5CLWA 2BOCB 2VDPH 3FOMB 4L4VD 4ORZC 4W6YB 4XVSL 1N6UA 1A1OB 4HH9B 4X5XB 5CJOL 3UBXI 2GSGB 4A2LA 1N2RA 4XC1L 4R90L 2ARWA 5LGHH 3I84A 4YHIA 3SGKA 4Y2OA 1IT9L 3QXAB 3P30H 2DBLH 3VGGA 1REIA 2F5BH 1A21A 4AH2A 4XBEH 3DSNA 1W0WA 1TPXB 3W0WA 1LDSA 2AK4B 4D0CA 2BHUA 3QRGL 1PDKA 4LSVL 1PKOA 1PY9A 2AV7A 3RNKA 1DL7L 2CR6A 2W65B 4RCAA 3F7YA 2V2WA 2W60B 5T33H 4BSJA 2OJZL 3FTGB 4R7DB 1YNLH 2PTTA 5ALBH 2VUOA 3OXSA 3EO9L 4PREA 4GAGL 3MV8B 2IWGA 3IGAB 3MLWH 4DZBB 4B53A 4OTXH 1FVDA 3PGFL 4NM8H 1A6UL 4LVOB 5GIRA 2BERA 4PJ9A 2V2XA 5H37G 1OLZA 3O6LH 5DJ8A 3WIFB 2LAGB 4M7LH 4X6CB 1RK1B 2WUCH 1OP3H 4HUVB 1MY5A 1N0LA 3QXDB 3WKMH 1DVFC 4HWEH 3V5KB 4X6CF 1ZS8B 4NGHH 4IEFB 2WIMA 3KXFD 3ARBA 4F58L 4ODTH 2QSTA 1T83A 1YMMB 1UGNA 1RZ8A 4M5YL 2EKSA 3MXWH 3OTTA 1MCNA 3N85L 2NY3C 3EAKA 4U4BA 5ACMA 3U0WL 4Z95L 3NTCL 2G9HB 3U7YL 4JR9L 3MODH 5GS2H 1J0JA 2J8OA 4OQTL 4XX1E 3SKNB 5E94B 1TETH 1J1OL 2XA8L 4ZAKA 3N0PB 2GJ6B 2BSSB 1X44A 1CE1L 4K2UH 4LSDA 3EJZD 4Y5VC 1K8DA 3UTQB 4NRYA 3KPSB 1W8OA 5BV7H 2FWOB 5DMKA 2ESVB 3WJLC 1HHKB 4PB9L 3FL7A 1VSCA 2OK0H 3PHSA 1E4WH 3PDOA 4NP4L 1I9IH 1ONQA 2RFXB 3TH4T 3S6CA 4X4YA 5E00B 3CSGA 4IM8A 3LEYL 1KIQA 2B5IB 1XIWA 4K71B 3JV0A 1F4XL 4F2MA 3ZKNC 1KC5H 3WDIA 3WNKA 3U7WH 5F8QC 4JFDA 1KLFA 1CFVH 1E27B 4P59H 4UBDC 4K7FA 1CFBA 2ITDB 4XRCB 5EO0B 3WO4B 1NAMB 3U46B 5D1XC 1NANH 3IU3A 2WWMD 3MOAL 4WFFE 1ZHNA 2X4OB 4WFED 3NCYP 5AUMB 4OLWL 3OPZH 4X9BA 4XMKL 3RWIA 1B0WA 3AROA 5SWQA 3TVMA 3WFCH 5ICZA 2V5TA 5C7XH 3MUJA 4GKOA 1MAKA 3INUL 1Y0LA 4PJDB 5DJXB 2HVJB 4ZNCD 4LNRB 3L3GB 3MXVH 1XCQA 1XR8A 2R1WB 1HQ4A 4DVBB 1UB6A 4PJDF 1WFOA 2X4QB 2GQHA 5D7JD 2Z91A 5T1MB 4L3EA 1MRFL 5IW6B 3IDXH 2EICA 2ARJB 3QNZB 3HZMA 4TQEH 5H35A 4PJAB 5BV7B 1A4JA 1NCDL 3ZDZE 1GGTA 3VFTB 4MNHB 5E99H 4WW2B 4GMSH 4QRSA 5ICXB 3RBSA 1UCBL 1WBZA 1G9EA 2PTUA 5FHAH 5IV2A 2Y72A 2ZUUA 4WW2F 2CIIB 3UC0H 5IROA 3EYUH 3L1OL 5D6DA 5I17A 2R0KH 4OM0L 5HXMA 1CDIA 4GXVH 1I1AC 4AY0A 1U41A 2EE3A 1EV2E 4PJBE 1IM3B 2D7OA 3FN0L 2DLTA 4P5KA 4TVSa 2BNRD 5E8DH 4NQSA 5DJ0B 5EUOA 2J8UA 3TN0A 2OXGA 3FFCD 1Q9KB 4P23C 3SCMD 5CSGA 1AR1C 3KPLB 3HNSL 1BHGA 5IWLA 1FJ1B 3TLRA 3ZE0F 3H3PL 3KPPB 4PJ5D 3U30C 2VDMH 3P0VL 1IQWL 3S37X 1PZUB 1IGYA 1RUML 5L6YH 3FO2A 3QP3A 1TQCC 4EUPA 1RHFA 2BCKA 3C09B 3UYRH 4JVWA 3GSUB 3BW9A 5C0CB 4MJID 4U6XA 4H1LA 4NKIH 3T09A 3KR3H 4ZXBA 1OW0A 4PBVC 4X6DF 1MI5A 5IOPA 1VEOA 1LP9E 4K3JL 4TVPE 5DWUH 1XH3B 2APVA 5L9DL 4NPYA 3DJ9A 3UJIH 3BO8B 3CH1B 3ZLQC 1FZOA 3D85D 4UTBH 5GZND 1QG3A 4G43A 3VXRD 4AIZB 35C8L 3P73B 1WWBX 4NC1C 4ISVA 5JXED 2G2RA 4J6RH 3D3VD 3HHRB 4QGTA 4RWHA 3VWKD 3VD5A 2PCPA 5FECA 3ULVE 4Z7QE 5IW1B 1LK2A 3OR7A 5KSAA 4OCYL 1Z6JT 1OLLA 3IJYA 1B2WH 1LO0H 1DEDA 5IVXE 3RL2B 5A2FA 5BS0D 1U8HB 5DUMH 4BH8B 3QZWG 3QEQD 2A6IA 1BZ9A 4QWWD 4HQQL 1T0PB 3RTQC 4MCZA 1FYTD 2IPUK 1A6PA 2NXZD 1A7RL 4WFFD 5I75B 5IHLB 3Q3GA 1B4JH 4FFVC 8FABA 4WY7H 4KMTL 2DQEL 4HAFA 4KROB 1K8IB 4NQDB 1VPOH 4MNQA 1INQA 4M7JL 2C4FU 3GMNB 3OKOA 4OCNC 3LPWA 4PRDA 4QRQA 5D5MB 1JJUA 4P2RE 2QHRH 3C08H 3G6DL 4S11A 2ICWB 3K8KA 1F58L 4YAQA 2W59A 5EN2A 4BZ1H 4PS4H 3GNML 1A7PL 3QDJB 5IR1B 5CJXC 1YECL 4ZFFA 4XGZA 5E8PB 3RAJL 6CGTA 3BD3A 5KJRH 3F7RA 1DJSA 1ZHLB 5TDNA 4HKJB 1EJOH 3LRGA 3LV3B 3FQWA 3QFJB 4K23H 4LF3A 2ZCHL 4M48L 1AFVL 2NYYD 1VA9A 4ZS6C 1L7IL 5IFHH 5I66B 3VXUA 3K2MC 3VXMA 2D2OA 3MA9H 1GZQA 3S3JA 3WLBB 4ZDHB 1G7MB 2VIRB 4HS8H 1AXTL 5D7IE 4BQ8A 2W0KA 1U8LA 1JGVL 4J23A 3GKWL 1EBAA 5A16B 3JTSA 3C8KB 3FJTA 3OKNB 1U58B 5AD0A 5J6HA 3L7EA 12E8L 1BZ7B 1T7YA 2CR3A 5F7HA 1XR9A 2EO1A 1Q38A 2ERJC 2FYYB 1JV5A 2FATH 4W81A 3BP6A 4Y4FD 5IEKA 3NCYS 4L8SB 3BQUC 2HTLD 4MDIB 1AGCA 2G75A 5CBEA 5E5MB 5IJKA 4GKNA 5IB4B 3L5IA 4Z76B 1MQKH 5GGUA 3ROLA 1A6TB 3U0TB 2C26A 1F3RB 5ACZA 1ZA6B 4AEIL 1S9VA 4BKLA 1RJLA 1RIUL 2QQNL 2AVGA 2HRPL 4ERSH 5FK9B 1KB5A 3NA9H 3CDGB 5GJTL 5DUBB 3NCFB 1T20B 4LLQA 4KQ4H 4WFHE 1V7ML 3QHTC 1XGQA 5I1JH 2H3NA 2GHWB 2DIJA 2JIXD 1A7QH 1OB1A 1I8LA 2L7JA 4CVZB 4OLYH 1C5CH 3D39B 1U8JB 4LMQI 2AABL 1FGVL 3B6SB 4R2GC 3TFKC 1G7JA 1QA9B 2F54B 1MQ8A 4YHML 1PGRB 3ESVF 3IFOB 2EDRA 3VXPA 3WLWC 1CR9L 1UB5A 1KLUB 2QTEA 1RIVL 1KPVB 3S34H 4BYHA 1CFTA 2FNBA 3GMQB 2L0DA 4PRAA 1EHAA 4PRHB 5K93A 3TJHD 1HQRB 2APTA 2HFEB 4LLVA 3V0WL 2YOCA 1J0HA 2AV1A 3L9RA 4BUHA 2H32H 4Z8FL 3L3KA 3RIFF 4P2RD 3GJEA 3NFSH 4EVNA 4U1IB 4QOKB 3CD4A 2PXYA 2PYEA 4HK0A 4AIOA 2BVEA 1E6JH 1M7IB 2VLRA 5I1DA 4APQC 2VDRL 4XT1C 4UILH 3OXRA 4GRWH 5IB2B 3RX5A 3ZT6A 3FO0H 2WUBH 4GMTH 1YMHB 4KRPC 1BD2E 1SHMA 4ORGA 3AVEA 4UU9A 1A7NL 2G60L 5DURD 4EOWH 1UKSA 5GGTL 1OTSD 4LLYA 3L3HB 5C0FB 3QUYC 2JELL 3B9KC 2UYLB 1LE9B 1N5AA 1RD6A 2AEPH 5EBMA 2D7PA 2GK2A 3AUVA 2X9YA 3MA7B 5F1IB 5EB9A 2B8OT 4XAWL 2P48B 4WV1B 3GMLA 5HVGB 5HHQA 3QPXL 1YN6B 2FO4B 4LEXL 3HZYB 2XKSA 4NUJA 2H32B 3IDNA 4LCWD 4Z7OF 4UTAH 2FL5B 1A9EA 1VCAA 3RDTB 3BH8B 1BIIA 4LSRL 1ZOXA 5HJ3A 1QKZH 2FD6H 1S5IL 2BX5A 2O5ZL 5SX4I 4WGWB 4ZNEE 1PLGH 2YD7A 4M3JA 4NDMA 2JJSC 2LFGA 3VGDA 1F11B 1YYLL 5E9DE 5I8KL 3S4SA 5J11B 3V6BR 3WHXB 4GRWB 5DMIL 1T89C 4FP8L 3O9WC 4IJ3C 1L7TL 4MQ7B 4GRWF 5C0NC 3ARED 1R3KA 2AI0H 2ZOKA 5FA4B 3MX0A 3BRGC 2GFBA 4PY7A 2BMKB 2Z0BA 3TYGL 1XZ0A 4WFHD 3SE3C 3LQAH 3QIBA 5SWSA 2AJVL 1UC6A 4MA3A 4QRPB 3OKLB 1HSBB 2HVKB 1GVIA 3LN5A 3QQ3A 5IMMA 1AD0B 3GSQB 2ZOLB 2D0FA 3UJTH 2P44B 2FGZA 5K9QI 5B8CA 5ETUA 4QT5A 4V1DB 2Z31B 4X4XB 5INCB 4CVXB 3KYAA 4D3CL 4MLIA 1I1YA 4YR6B 3DGGA 4IOFC 1WTLA 1S9YB 5BVPH 1F2XK 4QF1A 5EU6A 5D7LB 4MB4A 4C56D 3MLZH 3ISWA 4ZTPH 3IJSA 2JB6B 3DVIA 3QIUB 3CVHL 5CGMA 4BQ9A 3M1BA 3D0VB 4K9EC 2VKXA 4E41A 4JFED 1K6QL 3FMGH 5GPRA 4KPHL 1OL0A 2R9HC 3IT8D 4H5SA 1A1MB 5IVZA 2Q7NA 4RDQG 3BSZH 4DGVH 3CXHJ 3TO4C 5GRUH 3BKYL 4CMHC 3QI9A 5EOQH 1DQLL 3O45B 5L0QB 3T77B 5D4QA 4KI5D 3H3KA 1BD2D 1PX3A 2IAMD 3DXAA 1CFSB 4IRSC 2ICEB 1WWWX 3PABB 2PR4L 2C9AA 4QTHA 5DYOB 5DHVH 2UWEA 4OGAC 4X99A 4G6JH 4W4OC 2P8LA 4EBQH 1AJ7H 5CEZE 1Q72H 2AK4A 1IRAY 2VXTL 5CEXA 3CAFA 4R6UA 3QISA 1EHXA 1G7PB 4AYFA 1JNHB 1S7XA 4G9DA 2DMCA 2XICA 2QV2A 5HI4D 1CGYA 2W60A 2EYSA 5AAMA 5E4IA 2BXYA 4LP4A 3ZHLA 3GO1L 4YK4B 4B7IA 4Y2DB 3C6SB 1NCAH 4MA7L 3SDXE 1EEUA 1OT2A 3ECBA 4ZODA 1BVZA 3LZFH 4UT6H 4MHHG 1JWSB 5IFJA 3VWJB 2E7LA 1X3DA 2X41A 1WAAA 3F8UB 3QBTB 4Q9QH 5E9DD 5JDSB 1TCRB 3QB7C 1HDMA 3MNWB 4I18C 4HUVA 3CVIH 3QXDA 3I3DA 3X11A 1YUHB 5HVHB 4AEHH 3MR9A 2B4CC 1YMMA 4Y19B 5DRXA 4Z7NE 2OMNA 5DHVB 4XTRC 1ACYH 1B6UA 4YPJA 5I9QC 5KS9A 3RIFK 1RZFH 5L2JB 5JA9A 4M7ZB 4PGBB 4ZQKA 2HLAB 3VXNB 1EAJA 1LILA 3WSQL 4P4KD 3K1DA 1HSAB 5FUCE 3U9PH 4I0PA 4GQ9H 5DQ9B 2QQKL 3KPSA 1JZ5A 1HHKA 4RIRA 2OZ4L 3ULUH 4LHUB 5J3HC 1J9CT 1BGXH 1KEGL 3WXWL 1GGIL 1ITBB 3L3IB 3DVGB 3KWWB 3X3FL 3RKDD 1BX2B 4XNXL 3TO2B 4F7MA 4Q9BA 4TSBH 4MNGE 4G7VH 4HIEB 4JO2L 5TH2B 4BZYA 1QRNB 3MLXL 4X7EC 3NMEA 2CK2A 1Q94A 2VL5B 1A4KA 4U1LB 1QSFE 3HPJA 4XRCA 5TQ2H 2OP4H 5F7MC 1NAMA 1LK3H 2OTUA 1JGLH 1CICB 2X4OA 3RIAK 4MAYB 1E6OL 3ARFA 1DBML 2BNQB 3SJVE 2QKIB 4RWYL 2Q7YB 1I85A 4HMDA 3C5JB 2C3GA 1ORSB 4MSWA 4Z7WE 1IC4H 3L3GA 4OIIL 4XCEB 3OX8B 1NL0L 4DVBA 1G9NL 4ODVL 2IPKB 2FSEA 3DECA 1HYRC 5T1MA 1JNLH 4W4NA 2AK1H 1CZ8L 4EIZC 2IGFH 3L3JB 4U1KA 1WIPA 2RBLA 4RZCA 4NQCA 5I8EA 2NTFB 3GIZL 5CEZD 3QEUB 1WQVT 3MGAA 4PJBB 2B1HL 4Z78B 3ULUF 1OP9A 4LASL 2ORBH 1UFUA 2CIIA 3VXQA 3TBTA 3V4UL 4G80B 4MWFB 2KDGA 1JPGA 4YHKH 5M7QA 2EDLA 2XZAH 5EO1A 4RBPH 3TYFA 5HYJD 4RAUA 4YPGB 3AU1A 1IM3A 1EXUB 1LDPH 4YDJA 4P5TA 3D18A 4S1SL 4AJ0A 1IC7H 2ADIA 3CLFL 3CSYB 4R26L 3U0PA 2BDNL 3HPLB 1OTUC 3ZHDA 5E8NB 3PIQB 1U2HA 4POYA 3ZE1F 4R4BA 4NBXB 5E5UB 1R0AL 4X4MA 3KJ4C 2W9EH 3CZFA 1S3KH 2F8OA 2HH0L 1OSPL 5MEOA 4ZD3L 1V3MA 3GMRB 5D93C 3Q6FB 1LP9B 1NJ9B 2NY6D 3RI5F 2Q8BH 5C0CA 1OAYL 1JWMA 3PWLB 3V5DB 4BQCA 1XF2B 1ZT1B 2NX5D 3WIHH 3RL1A 3LKNA 5KSUA 5M95B 2HFGL 2XV6B 5F8RC 3C5SA 3FONB 4L1DA 3C6LD 5CP7A 4BELD 1S7TB 1GAFL 4OZIE 1DVFB 5B3JE 3CH1A 4BSWB 1T2QL 2KUTA 4JFXB 4UDUB 3SKOA 3CUPB 4M5ZH 3P73A 1QLFB 5F88A 5T1KB 4LRIC 5IVXB 3DVFA 5FGCE 4OT1L 4LQFH 2NY3B 1A5FL 4KZEH 4NO3B 3PV7A 5E6YA 3P9MA 1WCQA 2MSPA 1XGRA 3NN8B 1CIDA 4D2NA 1CT8B 2A9NH 1AIFB 1WBXA 1J8HA 3OAYK 1D9KD 4ZUUB 1U8HA 4BH8A 1O5DT 5EU7E 4HXAH 2BK8A 3SE8H 4MLSA 3QHZL 5KZCD 2W9DL 1FG9C 2HA1A 4HDIB 2EDXA 4OFYA 2NY0D 4JG1L 3Q1SH 2LVCA 2BJML 1H0DB 2ADJB 1OAKH 3VE0B 1AD9A 4GXUM 3BFOA 4X7SL 1GL4B 3LKQB 4OCWH 2DLHA 4X9IA 5B3NA 2VDKH 1FFQA 1MCLA 5JOPE 3GMNA 4R4NC 5A3ID 3RY6C 3VFVB 3RZCD 1R5VB 1CVSC 2F19H 5D5MA 3MRHB 5T3XH 3UTTD 5KANI 3EDEA 5D1XB 4Z7VA 32C2A 3GRWA 3LPFA 2DMBA 1QR1A 3B5HA 5F9WC 4CU7A 5GS1C 2VAJA 2OL3H 1XCTB 4FTVD 5EH1A 4HX1A 5KVEL 3RNQB 3GI9H 4WGVB 1HXMB 1RVFH 1KIRA 2H1PH 3PWPD 2MHAB 5KOMC 1YEJH 3L7FA 4DGIL 1F02I 3FQXB 3BXNA 5I6XC 1VENA 2P5WE 1M7DA 4OLXH 2EYRA 3DX6B 5D7JC 5FKPB 2HJLA 4LSUL 2CIKA 1NKRA 3V9FA 4LLDA 2CDEB 3C8KA 4S1RL 4NN6C 4KTDH 5CLTA 3JSSA 5KVFH 2FRGP 4FQ2H 2FYYA 5HHXH 1AKJB 3RU8H 5CGYD 5ILTH 4HWZB 5JOFB 5FM5M 4G9FD 4KY1L 3G5XA 5E5MA 4P23B 2OL3B 4POZD 4OZGF 5IB4A 3PWNA 1QBBA 1RJZB 1TNNA 3U30B 1ORQB 3SCMC 4IIQC 3UCRA 4U1NB 1TQCB 1G7QA 4XVSH 4XXDA 1KEML 4JPWL 4XC1H 4R90H 4C59B 1JZ3A 4LP5A 3PP3H 4RGOL 1MCPL 4X5LA 1IT9H 2ENSA 1F42A 2FX7L 5ESQB 1KG0A 2CUIA 1EHLL 1N6VA 2VLKA 2OMBA 2VITB 2DF3A 4JRYB 3QRGH 4G8GB 4DJMA 4LSVH 4M1DL 2DRUA 1OP5H 3REVA 1DL7H 1RHHB 1ES0B 4FQJH 3W11D 4YHPA 1SYSA 3GSOB 1RZIA 2OJZH 4JHBA 4B41A 4EN3C 3MRPB 2A6JA 1G9NC 1P4LA 4ODSL 1QA9A 1HYSC 2AQ2A 4GAGH 3CFBB 3TNNA 1QRKA 3OJDB 1YEIH 5EBLB 1XGPB 1KPVA 4XPBL 3DUUB 1A6UH 1HQRA 1BQHG 2R2HB 3HI1A 3SDDA 5IKCB 5JOPD 2JB5L 2CPCA 1HILA 4RFEB 1QVOA 2R1XA 4WTZA 5DRWB 3TZVC 4UB0L 5GGRA 2BSRA 4OFDA 3RTQB 4CW1B 2HJFB 2BNUA 2MCPH 2P4AB 3CIQA 4L4VA 5GHWL 4F58H 4TUKL 1TTGA 1MPAL 3BHBA 4W68A 3RGVD 2VXUH 3BYYA 5IESL 2X40A 3RVWD 4M5YH 3KPNB 5IB2A 3KLAB 5CILL 3N85H 1SJEB 3PQYE 4WHCA 5HHVL 3NTCH 3RI5K 3U7YH 4JR9H 1MFEL 3U0WH 4KUCD 3T0DA 4PGDB 3MRBA 4U6VH 3LRSB 2MQ0A 4KHXL 4QXGL 4U7MA 4YE4H 4MS8D 1C5DA 5JQHC 2XA8H 1J1OH 5T3ZL 4RRPA 1A47A 4M8QA 2P5WD 2YN3A 1V3KA 3BUYB 1CE1H 1QTYT 1TQBC 2FJFB 4TSCL 4FQXA 2DL9A 2G5RA 2W9LA 4PB9H 3O4LD 4NP4H 3KHOA 2LVEA 3B83A 3MA7A 3LMJL 5F1IA 2ID5A 4KV5F 3LEYH 5FYJD 3V7MA 1F4XH 3DRTA 3LSOA 4HG4K 3NFNB 1AGEB 3ARVA 4KDTA 2FO4A 4TUOA 3BZDA 4U1SB 5HYSB 5IHUL 2E5EA 3QNXB 4NQUA 3PWJB 2NYYC 4M7LT 2OR7A 4Y1AB 4O9HL 1NPUA 5TFSL 1JF5A 1MCWM 1LVEA 5HGAA 3MOAH 2APWA 5F89A 3VXTA 3CK0L 2ZNWA 3MZGB 5T1DL 4KAQL 3EYFB 4OLWH 4XMKH 2ZUYA 5EO9A 4JGMA 3AC0A 1WFNA 1BM3L 3DNKA 5C70A 2VWEE 5B4MC 1JI2A 1KCKA 1JGDB 2ERJB 1ZT7A 5JO5B 1ADQL 4NCDA 4ALAL 3DYPA 4P2OB 1I8KA 2DDQL 2VE6B 3STZA 1P7QA 4LKCA 4N1EA 5I1KH 1UEYA 3BQUB 4X6EA 3MV7E 4N0YL 2OI9C 4P0DA 3VCLB 2ADFL 4RMWA 1GH7A 2ZG2A 1NCDH 4Y4FC 2Z8VC 2A73B 4QRPA 1HKLL 1IEAB 1CFQA 1UCBH 3LEVL 1FH5L 3MJ6A 5BJTA 43C9A 4PD4K 5K33A 3MGOB 2QL1A 4EDXB 4JPIB 3L1OH 1CLOL 2LQRA 4E5XA 2FHCA 1DLFL 3Q0HA 1N7MH 1JPST 1G6RL 3CFKA 1MLBA 1U8MB 4N90D 5INCA 1BJ8A 5TF1L 2B1AL 4YR6A 1SY6L 3WYRA 3SGEI 4PR5B 2YPLE 4R96A 3QIWC 2A6KA 4ZFGL 3MLUL 5KW9L 4TOYL 3H3PH 1IQWH 1RUMH 5HHMD 5DSCB 4R2GB 5T5NF 5GRVL 3JVGA 4LPTA 4F57L 4JO4L 5FO8A 5KS9F 2OS7A 4GUPB 2IADA 1ZTXL 3T4AA 4Y16B 3DMMC 5DD6A 2NTSP 1S7UB 1CDBA 4U7SA 3CFEA 3S5LB 1DQDH 5L9DH 4N8VB 3KPRB 3TJHC 1JI1A 5CD5D 1MELA 4XPFH 4J2XA 2J8HA 1IQDA 5BZDB 3AM8A 3O6FC 2Q3ZA 1FLTX 35C8H 5DVOA 1ZGLB 5HGBB 4APQB 1EK3A 3RFZC 1ZSDB 5FYLD 3SDXB 5C6WH 1DUZB 2Y6SD 2VLJE 1FFPA 3F7QA 5JDJA 3SDXF 4OCYH 5C71A 4KRPB 3FFCA 1K3IA 1W8NA 3TP4A 4HZLB 3B3IA 1RI8A 4JCLA 4UOW1 4WHTA 4OLZL 3KLDA 3B9KB 4HQQH 3GKZA 4MD4B 4G6KH 1FZJB 3GMPA 4HUMB 3U79A 1TXKA 4Z0XA 1MVUB 2QSCL 3BOVA 5FV1L 4KMTH 2F74A 2DQEH 4MJIA 2JJWA 3OJVC 5TJWK 2DLEA 3VI3F 1OWWA 1YC7A 3QHFL 5EULV 1YA5A 2V2TB 5BVJB 4J4PD 4M7JH 2VLLB 1AC0A 2N7BA 4GG8A 3HLAA 4F8QA 5HPMA 3G6DH 5I19L 1QO3B 1RZ7L 1F58H 3D85A 3PWVA 3VXRA 4LSQL 2XFXB 4NRXB 4OI8A 4PGZA 5JXEA 1YECH 1AQDA 1FN4B 2GIYA 3VWKA 3O9WB 4IJ3B 3IVKA 4K9EH 2X70A 2HLAA 5DQJA 1TZGL 1X5JA 3MFFA 1U36A 2ZCHH 3MRGB 3T0EE 4M48H 3ZKXB 5CAYB 4TYUA 1JZ8A 4OKVA 4MNGB 4F7EB 4LIQL 4DGYH 4LFHG 4G3YH 5BS0A 4P3WA 2EXYD 4OLUL 4YHYC 1JGEA 1A22B 1QSFB 4FFWD 4NT6A 3KWWA 1XF5B 1AXTH 1T80A 4L8DA 4R4FL 3GKWH 2IALB 5CBAB 7CGTA 4BSVB 3SJVB 4L4JA 4OZFA 1SBBA 3BISA 2EDTA 3CZJA 4QRRD 2DJUA 4WNQB 4K3EH 5CKGA 4Z7WB 4LARL 2EEDA 2BVYA 2GJZA 5ID0B 4GT7A 4H0HB 4Z7WF 2W0PA 3BKJL 2Q7YA 1Q0YH 3ZKSD 4HIJA 4RMQA 4WU7B 2Z92A 1BMGA 1SJVA 2YRZA 5E2VL 3S8WA 2XPGB 3QEHB 4XCEA 4JFHD 4UMGA 5I8OL 1ED3B 1QQDA 3VDAA 2J2ZA 1RUKL 3R8QA 3GGWB 4AEIH 4I9WE 4ZUSB 1RIUH 4Y88A 2QQNH 3MLYL 1Q9OA 1CXFA 3RWGB 4NO5B 5GJTH 5LGJA 5D2LE 3AMLA 5CUSL 4NCC1 2L4OA 1V7MH 5F9OH 2HAZA 1MH5A 3HAEH 1N4XL 3RY5A 4CMHB 3RVTC 2I26N 4EI5C 5I0ZA 2ATKB 2IF7A 1N64H 2HT4D 1CXLA 4FNLL 2B4CH 5IQ7L 4IRSB 5KVMC 5C09E 3ZDYF 5JW3L 4KC3B 2RCSL 2XY2A 1VGKA 3FQRA 5F7FA 2AABH 1M05A 1FGVH 1GOGA 3PIQA 1JVKA 2EH8L 5KOVC 3QNYA 3BH9A 3K7UA 2FJGA 1M71A 1RIVH 1TZIA 3KJ6L 5TQ0L 1MWAL 2OTWB 3EOBA 5J57B 2B20A 1PAMA 4OF3A 5BW7A 3DETC 3FHAA 5F9JA 3ILPB 5DTFB 4JFFE 4GKZA 1UM5L 5HI4C 3BIAX 4Z8FH 4OZIB 1KIUA 3RPKA 3SKUD 1HINL 5F1SA 1NC4D 3BDYL 3W2DL 5GGRY 5B3JF 1E4JA 4PJ7F 1K5NB 2H6PA 2VDRH 4Q2ZA 1M4KA 2WM0A 3RWFA 4JDTL 2VAAB 4QHMB 1A0QL 1OQXA 1TJGH 4I18B 5FGCB 1NANI 3HNVL 1JHTB 1DVFA 1FO0L 3D9AH 5DJCB 3TT3L 4UDUA 1W2KT 2JIXA 4WEBL 3BRDA 1GHFL 1I7RA 4NKDA 5T1KA 5DLML 1WCBB 4ZFOL 1G1YA 5K59E 1A7NH 2G60H 4HLZG 3HCVB 5GGTH 5FO7B 3IB4A 5IK3B 4NO3A 3BPOC 2NPLX 2JELH 4O2CB 4PG9A 3VMPA 1G6VK 1AHWC 1OGTA 1NDMB 3KLSA 2OR9H 4L3CA 4HS6B 4XAWH 4LVHC 3O3EB 2R2BA 1B88A 4HDIA 4LEXH 5E6IC 1EEQA 4TPRL 4MA1B 2ADJA 2ZPKL 5FDWB 1UT9A 1IAMA 1TENA 2F58L 4LSRH 4PJCA 4P2RA 3HKFA 5E4EC 1S5IH 2FIKA 5EPMB 2NR6C 1TZHB 3VMOA 5L8KB 2YXFA 1Q9WB 1QYGL 1N59A 3VFVA 1X5KA 4PJHE 4PLJD 1L7TH 1WICA 3FAXA 4Y89A 3MCG1 4I9WD 3T2OA 3KYKL 1DQTA 3OKMB 2OJEB 2YR3A 3TYGH 5JIIA 2XN9B 1JYWA 1D5IL 1Z9SA 4I1NB 4KVCL 1GZPA 3LEXA 6FABL 1BZQK 2AJVH 1DE4B 2HWZL 1WSST 5D7IA 5T3ZE 4OBSA 1MREL 3V8CA 4WEMB 3OGCB 1HH9B 4JN1L 4LU5L 4XCCH 4EUPG 2AEIT 5LWYL 3VFPA 3BKML 1YDPB 3B9DA 4JZNB 4D3CH 4LCWA 1DZBA 1MCFA 3WS6A 4WUUE 3OHXB 5E5RB 2CDEA 3JWOL 4RX4D 4AL8L 4MJ4A 4LPWA 4NZUL 4URTB 3D25A 4WO4D 3RHWF 5F1OB 2DJ4A 1WITA 2CLZB 3F7PC 4HKZA 3CVHH 4OJFL 4UT9L 1CGSL 4XPGL 3DVNB 1FNAA 4NQXB 1XAUA 2ADGB 3AREA 4FQ1L 3FO9A 3BEVB 4BQBA 4KPHH 3S98A 4FQCL 4D0BB 3SGJC 4FQIL 2HT3C 1NMAL 3QUXD 1P53A 2IJ0C 3KJ4B 5JZ7D 1RJZA 1VFAA 4PJ8D 4XNYH 5EBGA 5FV2A 1DBAL 2WBKA 1K9TA 1G7LA 3NZ8B 3U9UB 1L6ZA 2X4PA 1X7QA 5D93B 5MHSE 1DQLH 1A7OL 2VJXA 2Y07L 3UBXB 4O2FA 3QCTL 5ISZD 1MCWW 1FCCA 4JLRB 2EDWA 1Y6MR 2CKBL 1U8IA 2PR4H 5ESQA 1PD6A 3IJHA 4U31A 4F9LC 1FNEA 2VITA 4XVUD 3MLSL 3DURA 4PRPD 2VXTH 3JUYA 3PL6B 4NM4L 2P24A 5FYJL 5ITFA 5JHDD 4JM2D 1XF3B 3O6ML 1F8TL 3C6LC 5EZIL 5MERA 2WBJC 3OQ3B 4JFPB 5D1ZB 3P4OA 4C56A 3CVHB 1UXSA 4FZEH 3GO1H 3MRPA 5SV3A 5IMLA 4NO2A 4HKXA 1JYVA 1F4YL 4LCYA 3GMMB 3TM6A 4HC1A 3CFBA 4JFEA 3OJDA 2AEQL 5DI8B 1V8HA 2H8PA 4QY8A 2R2HA 4R0LC 1YY8B 3D2UA 1NGZA 2Y5TA 4RFEA 4KK5D 1KTKE 3NCCB 4CU8A 4Z6AT 1D9KC 3RKPA 3BRFA 4M3KB 3QXVA 2RAMA 1FQ9C 4I48A 5I1IL 3NCBB 4YO0B 1IVLA 1BD2A 3AXLB 5E1AA 3V5HB 3IDYC 2IAMA 2NY0C 3HC4L 3FB8B 1P9MA 4C58B 5JHLL 1SJEA 4G6ML 3C9NB 2HT2D 1SEQL 1U8KB 3R0NA 4K55A 3LRSA 1IGIH 4XBPB 3MBXH 4JDVB 2XQBL 1CIUA 2Y36L 3WSQH 3G6JA 5B39G 5F9WB 4LCCA 5A3IC 5GS1B 2P1YA 1FVEA 3TH3T 2QQKH 3SDCD 2R8SL 1CGVA 2OZ4H 1PZ5A 3L3DA 4NHUB 2KBGA 5D70L 3WXWH 1GGIH 1R24B 5IB1A 3X3FH 1YPZE 1L9NA 2DJSA 3QH3B 2FHFA 1FL3B 3FQUB 2WBWB 3PNWB 1AGEA 3QUML 4ZNEA 5TDPB 4PJFE 3MLXH 3QDME 4GBXB 5I6XB 5E9DA 1AXIB 2A1WL 3UTZB 5DFTA 1H15A 3TV3L 2P5ED 4CUCA 4XPHH 4NUGH 2Q86A 1E6OH 4X8XA 4DCQB 1DBMH 1OF2A 2VXQL 4RWYH 4IS6B 1HOCB 2UVEA 4NN6B 5EUKB 4XHJC 3NAAL 4OQTA 4ZOCA 1N5YL 5JO5A 1G9NH 1QBAA 1UEMA 4WWKC 3LKOA 1KYOK 4ODVH 2VYRE 1AXSA 1K2DA 1EDQA 4P2OA 5F7UA 3MYJA 2R23A 2VE6A 1TLKA 4JO1H 1KFAL 5IBUG 1QFWM 4OAWB 1D6EA 4P4KA 4Z18A 1LD9A 4L8BB 4BFIA 4UDTB 3EYOB 4NZRL 5JW4R 1UXWB 2DWEA 3E6FB 1A64A 4K3DH 5FFLA 2B1HH 4ZPVB 5BOZG 2VISB 2YSSA 3I9GL 3J7HA 4IIQB 4LASH 1JFQL 4U1HA 1HCFX 4LIQE 1P5UA 1QEWB 1V3LA 4PJ5B 2YPLB 4J1UB 4KH2A 3RX8A 4GRLB 1A9BB 2IANE 4PIRF 3S88L 5TDOA 4ZOBA 1T6WA 1C16B 5GSRB 3PUCA 2GYSA 4IOIB 4LFHD 1EPFA 1KBGL 3QZWA 5LVEA 3BDXA 3BIKB 3CLFH 4IRZL 4KK6C 4PR5A 4R26H 5BMFL 4RMSA 4LPCA 4YGVB 3BZEB 1K4CB 3ZYOA 5F1NA 1R0AH 2QSVA 1J11A 1UJTA 2HH0H 3R0MA 1OSPH 3P77B 3HUJA 3ZKMC 4EN3B 4NKOB 4ZD3H 1EJ6A 1MLCB 4KXZH 5CZKA 1FL6A 3W39A 2XTJD 1OTTD 4BFBD 1OAYH 1AO7D 2AXGA 5D2NC 3D3VB 3MCLL 5EZLA 4Y16A 3QFDB 5KAQF 5IG7A 2HFGH 3W0WD 2AJZB 1KELH 3S5LA 5HD8C 1BLNA 3TZVB 1GAFH 2X4TA 4UT7L 2DQJL 2VLJB 2BP3A 1T2QH 1HHJA 3QEQB 5GISL 2IPTL 4HCRL 4FQQA 5TPWL 4APQA 1U3ZA 1FE8H 4KKAC 1T0NA 4OZHB 2NY7L 2Q3AA 1T4KB 2FR4A 4I8DA 2F53D 4OT1H 4R9HA 2H2SD 3DI2B 3RGVC 4OZHF 2XRAL 3S4SG 1A5FH 3T2NL 2GITA 3LN4B 1KSRA 2VRAA 5BZWA 5GS0D 4PJ9D 4S1QH 1YYML 1AGDA 1D5XA 3RWEB 5DVKA 1JZ2A 5EOTA 4JY5L 5EU3A 1DANU 4DFHA 3B4NA 3QHZH 4JJ5A 5FCSH 2W9DH 4MS8C 5HYQB 3ARBD 2WLYA 3F12A 4L9DA 3DTXB 3OKYA 1FZJA 2BJMH 1NEZA 1YEDB 5LGHL 3PG2A 1ZVHA 3OKEB 4X7SH 1SYVB 2F5BL 2NX5A 3PGCB 3MUHL 5I76B 2V2TA 3LIZL 4JKPL 4EI6A 4BQ6A 4JFQA 2FIRT 1MUJA 4NNXB 3O3BB 3L95B 5DVNA 5EC1B 1I7UB 3EJYD 2BRQA 5ALBL 2X2YA 3IAGC 5H2BA 2CRZA 4XNZC 1ZLVH 1TVHB 3U6RA 1FNGA 3O9WA 3EYVA 1KJ2H 4PLKC 4HS3A 4QCIB 2BVOA 4ELME 4JRXE 3UAJD 3A67H 2HN7A 3SOBL 3H9HA 3MRQA 4DGIH 3MJ8B 5KSBE 1U8PB 4YDLC 5KSVA 2A9ML 2BOBB 3O6LL 4JFDD 2IAND 3U4EB 1RULL 3O81A 4BZ2H 5CWSA 3WFDL 3QUKB 2NLJA 1MCQA 3WKML 1QSFA 4NQEE 1AY1H 2VLMD 2P46B 3H7BA 2NW3A 3FT3A 2BRRH 1XF5A 2NQCA 2JCCB 1VACB 4LSUH 3UTSD 2JCCF 4HBQA 3VG0H 4M00A 3ZL4L 2EKJA 3IAQA 1NDGB 2Z4QA 4XP9H 1BJ1J 4LOUD 5C8JA 2J5LC 1TCMA 3AS2A 5I1GL 3RZCA 5HGDB 4Q7DA 1TETL 2R0WL 5FO9A 2RGSA 4KQ3H 2KPNA 4MD0A 5EU4B 4KY1H 2GSIA 5ALCL 2XWTB 3WD5L 3QIWB 1I7ZB 4ZO8A 2OK0L 5D2LB 1JPFB 2K3TA 5D7KE 2FJHB 4KJPC 4L9LC 4MQTB 1T1YB 1V7NH 2C1OA 1KC5L 2V7HA 5C0EA 3LS5L 3V6ZA 1KEMH 2AJXL 4JPWH 4GW5A 4RGOH 3PE9A 1MCPH 3ZYZA 2FX7H 3LVEA 5C09B 1U91A 3NCJH 3DMMB 1EHLH 4RFNC 5J1AA 1UH4A 5MI0C 3TN0D 4N0CD 4TUJB 5D2NE 1A3RL 3CFCL 4U1JA 4IRSA 5D6CB 3WFCL 5C7XL 4XPTH 5IB5B 3O6FB 5HI3C 1FLRL 4QXTA 2YZ1A 5L88L 3O8XB 1CDJA 3EIFA 4RGND 4JFFB 2CXGA 1RMFL 1N26A 3EFFB 1KPUB 1DTUA 2IQAA 3NH7L 5TE6L 3GMOB 4X0KA 5CZXD 1F6AA 2Z35A 4XPBH 5DA4A 3ULSA 1IC1A 2B7DT 1MI5D 4LBEB 1CN4A 3UTOA 2JB5H 2VQUA 4PYGA 4PTUB 1MFCH 3KGRA 4WFGE 2E7MA 1FFNB 3FB6B 5KG9B 2ZCKL 4OZIA 4X80H 4PRNB 2EIEA 1QHPA 5CJQH 1T0MA 2RQ8A 5DURB 1PY4A 3C2AL 5SX4H 2GY7B 4MXVF 1HHIB 1T2JA 2D7NA 5IESH 4GW1B 2VAAA 4QHMA 2GAZA 5KVDL 2OBGA 4OM1L 4AZ8A 5HHVH 3LQZB 5JA8B 3SDAD 3NACL 2D9CA 5DJCA 3O11B 5FYKE 2K7PA 4IRJB 1U8OB 3WE6B 4J4PC 5T3ZH 3WFEL 3KS0J 2I07B 1WCBA 5FAAA 1N8ZA 1KN2H 2P8PA 5LXGL 1S8DB 4HJGB 5L6YL 1GXEA 1K4DA 4TSCH 3C60C 3EZJB 3OV6A 1Z9LA 3LMJH 3W81A 4HS6A 5F7YC 5CMAB 4NKIL 3VRIB 4MNQD 3FQTB 3DI3B 2YMXH 5IHUH 1JK8A 3ZDXE 4OBRA 3V7AG 4YHYB 2GCYA 3MRKA 2EYTB 4OV6F 3WUWB 4O9HH 5TFSH 1T1WB 3R06B 4UTBL 1LO3L 2EXYC 1ZLWK 1J86A 3BD4A 2QEJA 3MQIA 3KPOB 4J6RL 3RVVD 4DAGL 3QO0B 1UA6H 1UZ6E 1IM9A 3L5WA 3G5VB 5FF6A 4P48A 3EUUA 1WK0A 4ALAH 4HEPG 4MJ5A 2DDQH 5J4MA 3LB6C 4IMKC 3NIDF 2DD8L 2XT1B 3OAZH 4JAMA 1YQ2A 1IGML 3X12A 5I16A 2P5WA 1DSFL 3CPLA 4N0YH 2ADFH 1VKXB 3HB3D 2WP3O 5JORB 2MQCA 1UM6L 3WFZA 4KKLD 5ID1B 5C07B 4YIQB 1B6DA 3O4LA 3NIFE 1FH5H 1HH9A 4WUUB 3MRRB 4XI5D 5D9SA 4FMFA 1IKNC 3O6KL 5C0AD 1CLOH 3VXSE 4Y4HD 2YZ8A 1DLFH 4Q6IC 1HEZB 1G6RH 3QULA 3VFMA 2GKIA 5TF1H 4OUUB 1BFOA 1I9JH 4LCIH 2QHRL 1SY6H 3C08L 4DEPC 2VR4A 3OHXA 1S7QB 3K80A 2V17L 4EI5B 2X4UB 3LCYA 1X5XA 2FBJL 4PS4L 4RNRB 4NBYB 4UV7L 2VO5A 3W5MA 1UJ3A 4ZFGH 3MLUH 4IMLB 1CLZL 1C08B 5AZEL 4JFYB 3TWCL 4TOYH 5I1AB 4NQXA 5KJRL 4N9OB 2ADGA 2HT4C 1EJOL 3N06B 3TA3D 3BEVA 4KI5F 3TIEB 4NC2B 2DN7A 3EDFA 3FB7A 1FZKB 2HFFB 4I13B 4FQLL 5ABDE 4F57H 4JO4H 3WBDA 5DJDB 1ZTXH 2DQGL 1D5ZB 3IFLH 2YD5A 3Q6GH 4FXLA 4P57B 4E42B 4DUXA 1ZXQA 3MCKB 1B0GA 4QRTB 3MJ9A 3C5ZD 1NGWB 2N1KA 3VXOA 5FYKD 3HS0B 3G6JF 2LABA 4FG6D 3N9GL 2KZWA 2NXYC 3D0LA 1ND0B 2ATPA 1G6RB 3ZZ1A 1S7WA 1T04A 4YJZL 2FATL 4M93B 3PL6A 5HYIA 3DX8A 4HFUL 1P2CB 2XI9A 2LU4A 2EO9A 4HMEA 4NFDA 1I3RA 2X09A 1QPXA 5D1ZA 2H9GA 3M17A 4Y5XC 3MJ7B 3EOAA 3SO3B 2Q6WB 5I74C 3WN5C 3GMMA 5DS8B 3IDMB 4QGYA 1V05A 3CFDA 5F7LB 3BPOB 3RJQB 4KK8C 2PYED 1BVKB 4G8EA 1EIBA 2VLRD 1AHWB 4ERSL 5J56B 3NA9L 1WIUA 5C0RH 3JWNC 4LVHB 5I1JL 1T22A 3W9EB 3QHFH 4C83A 5E6IB 3PQYA 1KT2B 2Y9RT 1UKQA 1UQSA 2A6DB 3GSNL 4XVTH 1C5CL 3AXLA 4HD9A 4O5LL 5I19H 4HIIA 4CNIB 5E4EB 1BF2A 3FB8A 3RJDA 5SWZD 4LSQH 4YXLH 1F45A 4KMQA 4Y4KD 4Y5YC 2EEAA 1U8QB 4LNVA 1NBZA 4N5UA 1QLRB 25C8L 1NFDA 1XGUB 4FOMA 4X6BB 5E2UH 5C86A 1NFIA 1TZGH 3FN3A 5C0BB 3S34L 2C4XA 2ZUXA 1JN6B 1A6VL 3VXSD 1ZK9A 4NWTL 3MROA 3QUZD 4F37F 4PY8I 3OR6A 3QDMB 4NHUA 4X7FC 3MV8E 3SPVA 2BSTA 4I3SH 2O93L 2OYPA 5KTEL 2DYPA 3QH3A 4F15C 3S96B 5TDPA 2I60L 4I3RL 4GBXA 5DXWA 4X6CE 4MA8L 2IG2L 4QKXB 4Q9RH 3GI8L 1L4IA 3ARGD 1XF1A 3GHEL 1JWUB 5MEND 4KWUA 4LARH 2EE6A 5HYEA 2YD6A 3O41B 1R3LB 2YK1H 1YY9C 3DX7A 3VFSB 4XMPL 3K8MA 4XWGL 1ERNA 3TBWB 3BKJH 5GGQH 1A14L 4EOWL 1EERB 3MV7A 4N5ED 5E2VH 5DJ6A 5EFIA 3QQ4B 4K8RD 3UPRA 5EU5A 1DLHB 4LLMB 3V6OC 5I8OH 2E8YA 2BVUA 2CLVA 2QR0A 2GJ6E 1E4XI 1RUKH 4WO4C 1CD1B 2JKXA 3MRCB 1OAZL 3FRUB 3BP7B 2ESVE 3UDWA 3MYZA 2WMPA 5HY9A 3C87A 3E6FA 5CUSH 4PGEA 2VDQL 2VSCA 4ZPVA 2VISA 1N4XH 5EIVA 1RY7B 5E03A 4LVEA 2W92A 1O7VA 3QG6B 3DHMA 1F3JB 3VW3L 4GRLA 5TGBB 4FNLH 2B2XL 5IQ7H 5CD3B 1RZJL 1CG9B 4E41D 4IHOA 4PUBH 5JW3H 2RCSH 5GSRA 1OM3H 5MEQB 3MUGA 3VFRA 1TTFA 3F6IA 3IKCB 3HC0A 1TVDA 4YGVA 2EH8H 4QHLA 4GLRI 2OQJA 1XF4A 5F7EH 4PJDE 2WBJB 1BQLL 5TQ0H 2HTKD 4XHQA 5LBSL 4ELKA 2AP2A 3RWCA 2YXMA 4F3FB 3QCVH 3G04B 4JM2C 2UUDK 4LLUA 1YNKH 1UM5H 2C3WA 4MVBD 5C2BH 4Z7UB 4X98A 2X4RB 3G9AB 4Z7UF 3BDYH 4OLEA 4PGJA 3NFPB 4R0LB 4YHNA 4PFEA 2AK4D 2ICES 4JDTH 4J8RA 3BZ4B 1A0QH 5IB3A 5DEFB 5EC2A 3P9WB 3VG9B 5BVPL 2VLJA 1D9KB 4Z9KB 3T0AA 2AERT 4JY4A 4ZTPL 1UACL 3TT3H 4WEBH 5IFAL 1JHKL 1GHFH 4H88H 5CHNB 4QEGA 5ICYA 5L2KB 1KACB 3IDYB 1J10A 1M1SA 2X1PA 5DLMH 1OPGL 1MHPL 3MNZB 4ZTOL 2GT9B 4I0CC 4BM7A 2WINA 2QQQA 1JNNL 4NYLB 2IH1A 3LN4A 4L8CA 3NPZB 3ZE0E 2J12B 5FKAB 3LD8C 3BN9C 1NUFA 1D3CA 5DK3A 2HT2C 2R0ZH 2PO6C 4TNWF 4XZUA 4LPUA 4LCUB 2G5BB 2C3VA 5IM7B 1IAOA 4PRBB 5T1LA 4TPRH 1YMMD 1WBYB 1FFOA 2ZPKH 4X6DE 4JKKA 1GJIA 5JMOC 4MQXD 3BZFB 4KRMB 5KN5A 3HMXA 4KMLB 4U2ZA 1EH9A 4WJ5B 4G42B 1Q72L 1UYWL 3ARSA 4ONHA 1QYGH 3T8XA 3X14B 4JQXC 1G7IB 5FUZH 2DMKA 2Q76A 1W72H 1H5BC 1FO0B 5GGVY 3TBVA 4OCSL 5CSBA 3EFDL 4Q9CA 1EVUA 3O3BA 4I0PD 2ITCA 3T0EA 4JRXB 1QSEB 3KPSD 1B4RA 1NCAL 3KPQA 2ESVD 5KSBB 3SE9L 3CSBA 3ES6B 4NQTA 4ZFOB 3PF2A 1YEGH 3U48A 1RK0A 1D5IH 3MRNB 4KVCH 4OGXL 3GJFH 2EIZB 4HWBA 4QHUB 4QCIA 5C0DA 4YDVB 4WUKL 4NQEB 3QJFA 4OQ1A 4YC2C 4WWKB 3T3PF 1MREH 4Q9QL 2XNAB 4YFDB 3O3DB 4JN1H 3U4EA 1FG2A 4LU5H 4AIXA 5LWYH 3BKMH 2IFGA 4RISL 3I75A 4NCC2 3V6OE 2EDQA 4PJGB 2CQVA 3HR6A 2FZ3A 5F21B 1E28A 4PJGF 3TBSB 4F37K 5E56A 1KGCE 4NQDE 4AL8H 4BUGA 4NZUH 5GS2D 3HMWL 4N0UE 4GG6F 3SY0B 3PXHA 1CF8L 4OJFH 4UT9H 3HG1E 1CGSH 4XPGH 3QWOA 4LHJB 5HI5C 1BQHA 4RA3A 4FQ1H 4OZ4B 1VFBA 3ARPA 4UQ2A 4NOBA 3KYMA 4GQ9L 4FQCH 4RMRA 3RA7H 3QDJE 4H0GA 1C1EL 4JPVL 1N6QH 3SKJH 1Q9LA 3ULUL 1I7ZA 4UIMA 4F9PC 3GJFB 5D2LA 1BGXL 3PGDB 4KJQD 3VRJA 3EOYG 3MGTA 1CK0L 4TSBL 1A7OH 4H25B 4M6AA 5D1QB 2IH3B 4KGJA 2Y07H 4DVRH 1KLGA 1U8NA 3QCTH 1UVQB 5DRNB 5D2NB 5BRZE 4XBGA 2ZUVA 1W0VB 2OP4L 4F33B 1LK3L 4XH2B 3UTPE 2XTJC 2QADD 4QHNA 3SGKC 5B38B 3DX9A 1ULVA 2LAAA 2R2EA 1JE6A 5FYJH 3C8HA 3G5YB 4G8FA 2CDFA 1H3GA 1X5LA 3IDUA 3O6MH 1RZGA 4J12A 1F8TH 3MV11 1F5WA 4KDVA 4XX1G 5EZIH 4RX4A 1U92B 1I4FB 2ED8A 3O8XA 1RAMA 1M6OA 2KKQA 1QFHA 4JFFA 2BVQB 3ZMRA 3N1GC 1F4YH 3EFFA 1JNLL 1J1PH 5C0CD 4P3DA 3GMOA 1KIPB 5ANMB 1AGFA 3EOTL 1JZ4A 5E2WL 1F3DJ 4LBEA 4N0FB 2XWJA 1RJYA 1CD8A 3QA3A 1F00I 4PJ8A 3IFPA 5GS0C 3BWAA 4L4TE 4PJ9C 4QRUB 4RDQF 2ORBL 4Q6YA 4KUCF 5HDBF 5JQ6L 4WDIA 4F7CA 1T5XB 5CIPH 3OKDA 2UY6A 1N3NA 5IHZB 5I1IH 4HW6A 1HHIA 4GW1A 3MMEA 1SM3L 2V9TA 1RZJC 5D7SL 2CKBB 5AZ2L 3ARBC 3CXDL 3B5GA 3T0VA 3P0YL 1T83C 1V5JA 3GUTB 1IC7L 1SEQH 4XNMA 3GB7A 4P46A 5EZJB 1CVRA 1U93A 4JQVA 4IRJA 2XQBH 3D39E 1BJMA 3WE6A 2W9EL 3WCYA 3G5ZB 1S8DA 4ZAKC 3MV9E 2QQLL 3HI6L 2R8SH 2F54E 2X9WA 4GAJL 4X9FA 2YA2A 2JJVA 4NSKA 5HGGS 3VRLF 4KROD 4PRHE 5IJVA 4NQDD 3V0AC 2FH6A 4YDLB 1DANT 1WC7B 1XIWC 5HHOB 1CXEA 1NC2B 1MHCB 4R7NB 5FOBA 1DQML 4J3OC 4PJHA 4QOKE 3TV3H 2EYTA 5CIPB 1T1WA 3R06A 4M43L 4KZDL 1A1NB 3BT2L 4TNWK 4DUWA 5C1MB 2VXQH 1JTTA 2HMIC 3QO0A 1ZHKB 2Y23A 4XAKD 4XXCA 4NO0B 1OAUH 3QFJD 1MHEA 2DWDA 1I8IB 4FXKB 2MOVA 3TVMC 1N5YH 2BHYA 2J5LB 2AAVA 1JP5A 1DEEA 3QPQD 2JK5B 2W1NA 4I2XE 2OXHA 3ZSSA 3WFHB 1MCOL 4HXAL 5CZVL 5I30L 3SGDH 1KFAH 1C12A 5IF0A 4LOUC 1CQYA 3NIFF 4P2CG 3BAEL 1HZHH 5FYLH 3SDCA 4NZRH 4DKAA 4YIQA 4PRIE 4OGYL 4TRPL 4L9LB 5DJ2A 1JF1B 2LU7A 3I9GH 1T3FB 1SJHB 4WUUA 3V0VA 5M94B 1DBJH 4F7PB 1GGCH 3QUMB 4Z7OE 1Z2KA 1OD7A 2DI8A 5B22A 5C0JA 1ZT4A 4QLRA 5IROC 3S88H 2Z93B 1FSKC 3ARDA 5D6DC 4OUUA 1EAPB 5T3XL 3EHBD 3T1WA 2Z9TA 1KOAA 4RFNB 1ZLUK 2F8VA 2IC2A 5E1HB 5MI0B 4MD5A 5BMFH 2J1KA 2R1YA 1I8MA 4WI2A 4GRWE 1C5BH 3D1MC 4TN9A 5A40E 1MF2H 4H8WL 1JTOA 3TN0C 4ZSOA 4Z77B 4N0CC 4S0TD 3GI9L 3T1FB 1AP2B 1NCWL 1PX4A 2DQFB 1ADQA 5IMOA 5IWLC 3TC9A 1NGYB 1WEJH 5I1LB 1MFAL 1KN4L 2YC1B 5DC9B 4ZMAT 3MCLH 2VLKD 4FA8A 1SEBB 4QRTA 3E6HB 1JCKA 1NFDF 1ZGLP 4ZXBC 1OW0C 4UT7H 3LKRA 3D39D 2DQJH 5FA3B 1EEZA 5GISH 5FYJU 3H7LA 4V1DE 1LEGA 3SN6N 5F7DB 1CXIA 1TJHH 5TPWH 5HVWA 4PJXF 3VMNA 2NY7H 4HV8B 5KBNC 2F54D 2GTZB 3L6FB 2IBZY 5D7LE 1WZ1H 2XRAH 4NKMB 1IGTB 4XNQA 3QXTA 1RFDH 1YYMH 4WCYL 1HWHB 1Z9MA 3SDDD 4LLWA 1QACA 5IMKB 1G9ML 3SDYH 5KSAC 4PJIF 5D72L 1W0YT 3G6AB 4QOKD 3RPIB 3C60B 3T65A 2VQTA 3VU2A 3CFJA 4GFTB 4DZ8A 5FB8A 1JZ6A 4AT6A 1Q0XL 4M61B 4G8IA 1AO7A 2J6EA 2E27L 1IAII 4LKXB 5FDYA 1FP5A 1KT2A 3LIZH 2X44D 4JKPH 3QDGE 5DDHB 3PHOA 4YBQD 4FQJL 3SO5A 3GBML 3W82A 2GTWA 1OWRM 4FQXD 3RWHA 1A6ZA 1YJDL 2E7BA 5J1SC 5IIEA 5ESAA 1OT1A 1QLRA 2F53A 4KUZH 1R3JB 1YEIL 5C0GA 3UZQA 1E4XL 1N0XL 3RVVC 2WQ8A 1YPZA 5DO2D 1CLCA 5CJBA 1FV1B 3SOBH 4QRRB 1CLYL 1EBPA 1Z3GL 2A9MH 4YBHA 3U36B 4PJFA 1ZWIB 2P7TB 1RULH 3RDTD 3WFDH 1U0QA 2V5MA 4YNYB 2VXVL 4OCXL 3VGBA 5C9JB 2MCPL 1MHHA 2NZ9C 4B50A 2A74A 2R29L 4A6YA 1Y6NR 4JE4B 3PV6B 2VXUL 2RIKA 4OF5A 3BPCA 5IQ9A 4BK5A 1ROWA 4ODUA 4HG4J 5F97E 4OIBA 1BFTA 2C7UB 4KKLC 1SQ2N 1C8PA 3DROA 3ZL4H 4WVRA 5HHNB 2NNAB 3KG5A 4K7PL 2VZVA 4U6VL 3F6LA 4XI5C 2FX9H 4Y19E 3STBA 5LGKA 4YE4L 5I1GH 4MXQD 1P7QD 4GS7C 2R0WH 4DEPB 4H20L 4OFVA 4FXGB 4HMCA 2VZTA 2VZUA 3LKPA 4H26B 5ALCH 5CJ5A 1ZHBB 4QRPD 3WD5H 2NY1C 2UY7A 3BP4A 4KK9D 1OGAE 1CQKA 3MLTA 1PKQB 5IJKC 4JFOB 4AENB 4E0RA 2XWBB 4I5BA 3MRCA 4XCNA 2VABB 3MRIB 2B0SL 1TIUA 5F6HI 5ERWB 3LS5H 2VDLL 2X1QA 2AJXH 4V1DD 2YWYA 3S37L 2Z31D 2IANA 1IAKB 1AGBB 1FAKT 1S9WB 5D7LD 3FOLB 1MAML 1BAFH 5IT2L 1QRNE 3QG6A 1B90A 1F3JA 4PD4J 4NC0B 3QIUD 3PJSA 3UTSA 1A3RH 3CFCH 4B7LA 4TULL 4HBCH 1KCVL 2NXYB 1CG9A 4JVUA 4ZUTB 1CDHA 1I8LC 3MZTA 5E8OA 3MBEA 1FLRH 2YD3A 4X7CC 3H42L 1KXTB 4U6HA 5L88H 4RFOH 2DQDL 1L6XA 4P5MA 4FG6C 1NC4B 1RMFH 2BNQE 4NZJA 3EDJA 3DO7A 5HDQL 3HRZA 2N7AA 5I1KL 3NH7H 5TE6H 3X17A 3RVXD 5AWNL 4Y5XB 1QBLL 3WKNA 3WJJA 2ZUQC 5I74B 1YNTA 2AQ3A 4ZUVA 4K7PX 4FHBD 2DQTL 5JLZB 2ZCKH 4TNVK 1PG7L 4GAYB 3BVNB 5A2LH 3H9SB 5GSVA 2YKLL 4C57C 3ULUE 4FRWA 3C2AH 1N7ML 5DRZA 4ENEC 4ZUWA 5HGHB 4UAOC 4ODWB 2PXYC 5KVDH 5C3TA 4OM1H 1CXKA 5HYSG 4GRMA 3NGBC 2XG4A 3NACH 1DDHB 3FCTB 3QJHA 2WSKA 1BOYA 5CHNA 4XCYA 4H8WC 3TCLB 3WFEH 2K7QA 4JHWL 5CSZA 2HG5A 2GT9A 4KJWD 4JHZA 3STLA 5LXGH 3KLHD 2FEDD 1HWGB 3ZE1E 4PP1C 3VWJD 1KCSL 4X7DC 3KNBB 5JIHA 5J12C 2WIIB 1EGJA 5C08B 4HGWB 3EW3B 4X6DB 1MWAA 4AMKL 5IM7A 4G6FB 1P7KA 4DKEL 3AGVA 5FEBA 1DQDL 4WEUD 4Y19D 3VFWB 4JRWA 1LEKB 3AAZA 4XPFL 1MFBL 4F15B 1LO3H 3VJ6A 5DHYB 2SEBB 5DD1L 5C6TL 3F7VB 3MRLA 2BZDA 4G42A 1VB9A 4LRNL 4MDJB 4DAGH 2YBRA 1LE5B 1JPSL 2P43B 3AY4A 3DBXB 1FO0A 2DQCL 3MRDB 1G7HB 4QYOB 3BP5B 3SDAA 4ELMA 1MCIA 3DIFA 3B9EA 4JRXA 1G9MC 5L8LB 3ME0A 3SKMB 3HZKB 1PG7X 2DD8H 3TBYB 3V4PL 3ES6A 1IGMH 1A3LH 4PY8J 1BPVA 4X8JA 4KXZI 5DJAA 1MRCL 1DSFH 1KJVA 2BFVH 2EIZA 4YQXL 4UUJA 1OCWL 3FT2B 4P2YA 1AI1H 3PWUA 3B5TA 4F7TA 4G6KL 1UM6H 2GK0A 4GW4A 1CDGA 1OSZA 1NLBL 1QRND 1YEEL 3QIBC 4JREB 2XNAA 2GY5A 2VZ1A 4WO4B 3RWJB 4AM0A 1HE7A 3ILQD 1U95B 1L0QA 3O6KH 5I2IA 5I8CA 1P84K 2R4SL 4N0UB 3GIVA 3OGOE 1OAXH 4MAYD 1MIEL 3HG1B 3MRJB 2BNQD 4WW1A 5B8CC 1IARB 4OD2B 3S5LG 2V17H 1AQKH 4DQOH 1K3ZA 2FBJH 3BGMB 4N8VG 2HLFC 4OCMC 4UV7H 1YJDC 4PJEB 3O2WH 2CDGB 3ABZA 3I02B 2WNGA 1CLZH 3N1PC 5AZEH 4LGSB 3TIDB 3TWCH 4K9EL 4PJEF 4H0IA 4LDEB 4N8PA 4PTTB 2DM2A 3FB5B 4M1CD 5F3HB 5CEYB 5A43C 1HK6A 3HE7B 3O3AA 4S2SB 3JV6B 4WIQA 2D7TL 4DGYL 4G3YL 4KKBD 4FQLH 4OD3H 1MCCA 5DEGA 5BRZB 2OSLB 1U3HA 3EGSA 1DBBL 3C8DA 4PRPB 1WTGT 1VADA 2DQGH 2NY4C 4JM2B 1WIOA 4X7TA 3DSFH 1NCUA 3C2SA 1KPRB 5D1QA 4JM2F 1B9ZA 3QI9C 3FFDB 3O2VH 5JPNA 1FNSH 3N9GH 1NEZG 3V6FB 4FABL 4NJ9L 4K3EL 4XH2A 5C0AA 4Y4HA 4HUWB 2AJYH 3GM8A 2CLRA 5JPMA 4EDWH 5B39A 1C7TA 3QWRA 4HFUH 4X5WB 4LVNC 2DQUL 1Q0YL 2OM5A 8CGTA 4N8CL 5CKAA 4N9GB 2R69L 2PW1A 2XTLA 1BVLB 4KJYB 1Z5LB 2GUOB 2YRPA 2D03H 4CMMA 5T3XE 3KYOA 1DCLA 2BVQA 3GRWL 4TVPD 2O5XL 3U4BL 1UWEL 3MREB 4OZGE 4L4TB 1IC5L 3TA3A 5F93C 2X7LB 2X4SB 3LD8B 4RAVB 3OAUL 4U1MB 1J7VR 4ZFZB 1DQQB 1CL7H 2PW2B 2PO6B 3CU1A 5F9OL 2E7LC 1DVFD 1R5WB 3ULVD 1HHHB 2EECA 5ENWB 3DV4B 1FL5B 3JV4A 3O2DA 1R5IA 1N64L 1ZANL 3C5ZA 3GEWB 3BPNC 3GSNH 5T1KD 2B4CL 4O5LH 2CKBA 1JMXA 4NNYB 3IETA 5DMGC 2VQ1B 3W9DB 1NCCL 2CH8A 2DIBA 1T7XA 4JANB 4JRYE 4RQQB 5F6IC 3MV9B 1X4ZA 1BF8A 4G8GE 5EZJA 4MQXC 5DFVC 25C8H 4NQVA 4ODXA 4ETQB 5K9KA 4PLOB 4C54A 4UQ3B 3T4YB 4NC1E 1HHGB 1KB9K 1A6VH 2V7NB 2AKRB 4NWTH 3S97C 3CC5B 3RRQA 5CP3A 1EO8L 1F13A 5MEPB 1NMCC 1UWXK 5TE7H 4GKSB 4I0PC 4Z5RB 1GCFA 1A8JH 3ZKND 5KTEH 5I73C 4YC2B 1KTDA 5IBLC 4J3WA 2H45A 2I60H 4I3RH 1F6FB 4K71C 4JY6B 4DK3A 5JNYA 4MA8H 1NC2A 1MHCA 4UBDD 3IXTA 2IG2H 1TJGL 5K9OB 3PDGA 1EEYB 3GSWB 4P2QE 2YPKA 3GI8H 4MZ3A 3D9AL 5D1XD 3GHEH 3X13B 2E8ZA 1OAQL 1A1NA 3GSNB 3QSKB 3WO3B 5IUSA 3QG7H 3WO4C 4XMPH 1UKTA 4XWGH 4I2XB 2B39A 1A14H 2P8MB 2E6QA 3U2SB 3ARFC 3GSRB 4Q58C 5F72S 4CGTA 3TPUB 1WISA 3FO1B 1X5YA 1I85C 2D31B 5SWZA 1BOGB 4Y4KA 4P4RA 1HXYB 5DK0A 3ALXA 4PRIB 5C0IA 1VFOA 1A2YA 2OR9L 3TGXA 1OAZH 3RIAF 5FOJA 3RUGB 2VMFA 1EA9C 3WEXB 1FC1A 3EO1B 4HIHB 4MX7B 3VXSA 1JGUL 1F3DH 1FVCA 3QUZA 3RUGF 4KV5E 4KVNH 3A6CL 3P4MB 2VDQH 3IDIA 4YHLL 4E9LA 3HE6B 2J4WL 1TDQA 5GS0H 1JUFA 1SJHA 2R0LL 4XP5H 3PP4L 2PYFB 1OY3B 3VW3H 3O0RH 1IL1A 2B2XH 1AKJD 4Y1AE 1RZJH 2A83A 1I1FA 4ZOAA 1N2RB 4YHIB 1HI6A 3ARGA 1CFNA 4BH7A 5MENA 4P23D 2NY2C 4P5TC 2YEZA 3NCEB 4AH2B 1B0RB 3BYTA 2QADC 5EBWA 2QSQA 1CD0A 5FXCH 3CNKA 4PP2A 5AYUL 1BQLH 1DR9A 4ZPTA 1QR4A 5LBSH 3CX5J 3RNKB 4JZOA 4J3TA 3F7YB 2V2WB 1X5HA 1S5HB 4JZJA 1NGYA 2BC4A 4XCCL 4JDZA 3OXSB 3OAYH 2XXCB 4FQHA 3TNMB 3SBWA 3P9LA 1IAIL 2NY5L 2HP4A 2EDNA 4I77L 4JRYD 3WS3A 5GIRB 4G8GD 2V9RA 1S7RB 5FA3A 5DJ8B 4G6AD 1UACH 2RB8A 3VFUA 3B43A 1RPQA 1JHKH 5IFAH 5EIIA 1DBKL 4HV8A 1OPGH 1MHPH 4ZTOH 3BX7C 1RZ8B 4HLZH 1JNNH 2AJ3B 5I71C 2EKSB 4U1GC 2MQ3A 4M6MH 4BA8A 1WT5A 3D2UD 3EYQD 1SJXA 4U2YA 4XNYL 3EDKA 3FZUD 4NNPH 1IEBA 3RPIA 2BOCA 4ZAKB 3FOMA 2AEWA 3OBAA 5HSFA 3MO1B 3OG6B 3IDGB 1A1OA 4HH9A 4UINH 4X5XA 1QBMH 2GSGA 5KS9E 1K8DB 3CSPA 3QDGB 4M61A 4L29B 3TF7C 3K4ZA 3QXAA 1OOAA 5I75C 3PDOB 3T0XA 1ONQB 2DI7A 4X4YB 1KIQB 1XIWB 4F2MB 1UYWH 5HDOA 3KPRE 5CINL 1QP1A 4CBPA 2W65A 4OCSH 3EFDH 3HFML 5F7KC 3Q5OA 4HCRA 3FTGA 4K7FB 4R7DA 4FZEL 4R97C 1NEUA 3SE9H 1ZHNB 4OGXH 3MV8A 3VH8B 3IGAA 4DZBA 3EKCA 4WUKH 3RWIB 1H3VA 5SWQB 4ZS6D 3TVMB 5ICZB 3BE1L 4EXKA 1Y0LB 1QOKA 2VUYA 3U36A 5C6PB 1XCQB 1XR8B 1HQ4B 1ZWIA 1P6AB 1UB6B 3WIFA 4X6CA 4Q0XL 1RK1A 2AXFB 2Z91B 4EUPH 1T66C 4L3EB 4RISH 3V5KA 5C9JA 1DUYB 1EGJH 1ZS8A 3HZMB 3SE4A 4XCFH 4JQIL 5H35B 3BEWB 3VI3E 1FORH 4H1LH 15C8L 2MPAH 4QRSB 3TPKA 1WBZB 3LQMA 5IV2B 1TTUA 2FECI 1SVCP 2G9HA 3HMWH 1LEIB 1IGIL 1CF8H 1FSKB 3MBXL 3SKNA 1OGAB 4P2OD 5I17B 5E94A 4NQCE 3BQUD 2GJ6A 1UADC 2BSSA 4P5KB 3DV6B 4NQSB 1WZLA 1ITCA 1ZHBA 3UTQA 5HHPB 4PG2A 1C1EH 4JPVH 2FWOA 2ESVA 4KRLB 2XOTA 4HSQA 5EUOF 2J8UF 4MXWH 1CU4L 2RFXA 5E00A 4POUB 1KYOJ 1R6VA 1RV6X 3MRIA 1CK0H 2XQYK 5ERWA 3REWB 1BQUA 3P0GB 3HZVB 1FIGL 1IGYB 1PSKL 5EORL 3FO2B 2Y7QB 1E27A 1IAKA 4EUPB 1AGBA 1J5OH 2BCKB 2ITDA 5EO0A 3U46A 3BW9B 4XPHL 4U6XB 4NUGL 1EMTH 2ZKHL 4H1LB 2W38A 4ZXBB 3MNVB 5AUMA 2F15A 5IOPB 1AH1A 3R1GL 5GZOC 1DN0B 4PJDA 5DJXA 2EIDA 2HVJA 4LNRA 2R1WA 4R2GD 3TFKD 1FZOB 1GGBH 2X4QA 3IRPX 3O4OC 1P69B 4G43B 3WLWD 4ISVB 5IW6A 4JO1L 4CN4A 2G2RB 2ARJA 3QNZA 2PCPB 5FECB 3EOTH 2WK2A 4PJAA 4Y16D 1F90H 1U42A 5E2WH 3ZTJG 1BBDH 5L7XL 3VFTA 4MNHA 1LK2B 4U3HA 2PTVA 5KSAB 3HNTH 4WW2A 4K3DL 5ICXA 2QHLA 3IJYB 3KPRD 3MOBH 5JLZA 3SDDC 5JQ6H 4MJ2A 4ZYKB 3BVNA 2A6IB 1MSPA 1BZ9B 5HYFA 4APQD 2I27N 4M62L 1SM3H 1PG7W 5D7SH 5AZ2H 5D8JL 3CXDH 1KXVC 1J8HE 3Q3GB 4P3CH 5DJ0A 2KQMA 3FN9A 3P0YH 4HGKC 4KRPD 1DDHA 3ZDYE 1Q9KA 4WHDA 1INQB 5GXBB 3KPLA 3OKOB 1FJ1A 4PRDB 4QRQB 3KPPA 5LJYH 3B9KD 5H94B 2QQLH 4YBQC 4HPOL 3HI6H 1OARH 4YAQB 4GAJH 2ZUSA 4DKFL 3GSUA 2XACC 4FQXC 4X6DA 4YXHL 1SVZA 2DIAA 4XGZB 5F7NC 4ZFFB 2VZ3A 3F62A 1HNGA 2P45B 2NY5C 5FGBA 2L7UA 1P4IL 3FQWB 1KELL 4LF3B 1I9EA 1XH3A 3IYLW 2APXA 1XGYL 1DQMH 5J1TC 1UH2A 2PF6A 3BMVA 5DO2C 4KDTC 3VXUB 3BO8A 3VXMB 4PJ7E 2YUWA 3K0WA 1GZQB 2YWZA 4M43H 1KB5H 4KZDH 5EWIL 3BT2H 4AIZA 4HUUB 3GBNL 4LSPL 1FE8L 3QWQB 4CKVX 3O9WD 4LK4A 5C0ND 3CLEL 3JTSB 3SQBA 5IW1A 3I3EA 5J6HB 2X5PA 4S1QL 1XR9B 4BFGA 4GS7B 3RL2A 1MCOH 2J88H 4KHTH 5CZVH 5I30H 1JV5B 3BP6B 1QSFD 4Y5VB 4BJLA 5IEKB 2NY1B 3BAEH 4KKNA 5DHXB 1AGCB 2G75B 3JTTB 4NIKB 3WIIH 3UO1L 4OGYH 4TRPH 3EJZC 1O7SA 3BWUC 3SJVD 3RWJA 1ZEAH 4KK9C 4YBLC 1K8IA 2YRLA 3ROLB 5DF0A 4NQDA 5GGUB 2AGJL 4HK3J 4TVPL 4YFLF 5ACZB 1S9VB 4BKLB 2YD4A 3NZHL 3ET9F 1RJLB 2NCMA 1J05B 3LN9A 4IOFD 3HG1A 2IFFH 5CCKL 1KB5B 5DZLA 3NPSC 2ICWA 1NGPH 4LLQB 4OD1H 2I9TB 5E8EB 1S7SB 3BGFC 1XGQB 3BGMA 2H3NB 3VFGH 3QDJA 5IR1A 5E8PA 3ULVL 1JHLL 2WWMC 1OB1B 4H8WH 1KJ2L 2FX8L 1J87A 1ZHLA 7FABL 3H9YA 4HKJA 5J06A 5J13C 3QFJA 3LV3A 1NCWH 5GGSB 1FBIH 3A67L 2R9HD 3HE7A 4KI1A 4S2SA 5F6HJ 5I66A 3IF1B 2XN9E 3LS4L 1MCJA 1MFAH 2XY1A 3I85A 3OJMB 1KN4H 3WLBA 4BZ2L 4ZDHA 1G7MA 1G7JB 5BRZA 4XB7A 1AY1L 1UCTA 2VIRA 3JVGC 3VXPB 2YPVH 2LV4A 3G9VA 2BRRL 2ZUQB 43CAB 1CFTB 3RVXC 4ODHL 4PRAB 5A16A 4LLVB 4IRSD 3VG0L 3OKNA 1U58A 3EO0B 4P9HC 1BZ7A 4OGAD 1P6FA 5SX5K 1I1AB 3GJEB 4XP9L 5AG9A 1LO2H 4UAOB 1GC1L 2PXYB 2PYEB 4HK0B 2W0FB 5T5FH 1I1RA 1X4XA 3MTRA 2VLRB 5JW4N 2RR3A 4L8SA 4KQ3L 3NGBB 4MDIA 4OZGB 4N9GA 3ZHKA 4KJYA 4WCYH 1Z5LA 4O00A 1JF6A 1G9MH 4Y7MA 5E24E 4M8VA 4Z76A 1A6TA 3U0TA 5D72H 3MREA 4YK4C 1ZA6A 4L4TA 4ORGB 1V7NL 1P4BL 4UU9B 3UYPA 2CGRH 5J12B 4LLYB 5FK9A 3CDGA 3KLHC 5DUBA 1Q0XH 1T20A 1IBGL 2FEDC 1N5AB 2PW2A 4OV5B 5BO1L 5EBMB 4K3HA 4NN5C 3NCJL 1JRHI 2E27H 2ZZUT 3DUHA 3BUTA 3MRMB 3VI4F 5HHQB 1Q1JL 4CVZA 4NUJB 3IDNB 3D39A 1U8JA 4YH6A 3GBMH 4XPTL 1JTPA 1A9EB 2VN7A 3W9DA 1BIIB 5HJ3B 5J7CC 5A2KH 3B6SA 3IDJB 4RQQA 1YJDH 1QNZH 5GZNC 2F54A 5CS7A 3IFOA 4U49A 2OR8A 3IU4L 2Y4SA 1KLUA 5JXEC 3VWKC 1E4XH 1N0XH 1NFKA 3GMQA 4GH7B 1HHGA 4PRHA 2HFEA 2V7NA 1CLYH 4ZO7A 1R3KB 1Z3GH 3CC5A 3KXFE 2ZOKB 2MJWA 1MFCL 2GFBB 1EUUA 4J3VA 4MCYB 4PY7B 4X80L 2VXVH 4P2QB 4OCXH 4U6TA 4U1IA 4QOKA 2DM7A 2HJKB 5CJQL 2R29H 1XZ0B 1M7IA 3QIBB 4N0RA 1KTRL 5MP6L 5SWSB 4QWWC 4LGPB 2LE9A 1II4E 1IM9D 1L0XA 3N50A 3QR2A 5SV4A 2NXZC 1HNFA 5K9OA 2WW8A 3LN5B 1LGVA 4K7PH 4LDLB 1YMHA 1RZKL 1QFUL 1EFXB 1QFWI 4H20H 5B8CB 5ETUB 4QT5B 2DLIA 3K4AA 4GLRH 1KN2L 3DGGB 3GSRA 3L3HA 5C0FA 3FO1A 1EZVY 2D31A 2UYLA 4QF1B 1LE9A 3HTLX 5EU6B 3IJSB 1XFPA 4MHHI 3L3OB 2B0SH 4WV1A 2D7QA 3MLVL 3WEXA 2VDLH 1YN6A 2YMXL 4HC1L 2Q20A 1IEHA 3HZYA 2H32A 3S37H 3W5NA 4WFEE 2FL5A 3P4MA 3RDTA 2FO1A 3BH8A 3HE6A 1KCRL 3DLQR 5IVZB 2NY4B 3LOWA 5DD5L 1MAMH 2IMNA 4KKBC 2A2QT 5IT2H 3QI9B 1F11A 2YUVA 3WHXA 4TULH 1UA6L 3IXAB 1BBJB 2C4FT 1KCVH 5J0BA 3UP1A 5FGSA 3DGCR 4MQ7A 4QNPF 3DXAB 2WP3T 3H42H 2DL2A 1OTUD 2DQDH 5FA4A 3T3MF 4QTHB 2JJTA 2UWEB 4X99B 5HDQH 4LVNB 2BMKA 1B0RA 2P8LB 2UWEF 4O51B 5AWNH 3VD3A 5CEXB 3B2VL 4JEGB 1QBLH 3LKSB 3RQ3A 1S7XB 4G9DB 2X6MA 1A6WH 2EXWD 2HTLC 3OKLA 1P7HL 2GJJA 2EYSB 1HSBA 2HVKA 2BXZA 5BW7C 1S5HA 2CMRL 1QUNA 2DQTH 3QQ9D 1AD0A 3GSQA 4GAFB 4OF7A 5F9DC 1XGTB 3E1F1 1PG7H 2ZOLA 2BNRE 2HKHH 2YKLH 3TNMA 3ECBB 1H3PL 1EO5A 4DUVA 4V1DA 3A6BH 2Z31A 4X4XA 4CVXA 5IFJB 3PL6D 3FFCE 4LCIL 1I9JL 4Y8DC 1NBYB 1QFPA 1S7RA 4WI7A 1S9YA 2BY2A 4JO3L 5D7LA 1WAAF 5D1ZD 4PJ5E 1HDMB 2JB6A 1LHZA 3BPNB 3WUWG 4CADB 3X11B 3QIUA 4M4PA 4YUEL 3ULVC 4M9OA 1NAMH 3D0VA 4JHWH 3MR9B 2D7MA 4MJIE 5DRXB 3SEPA 1QSZA 1IGFL 2AJ3A 4FFZL 2EDFA 4M1GL 5F6IB 1KCSH 3QYCA 2HKFH 1CTOA 1A1MA 2O26U 5KS9B 3SGDI 3MOQA 1P1ZB 2R15A 3KPMB 1T7ZA 4ZQKB 1YEKH 4AMKH 4NJAH 2XKNB 4ODBD 3IFLL 4YDIH 3Q6GL 5JOEA 3PQYD 3O45A 4DKEH 3T77A 1PW3A 3MO1A 1NMCB 3IDGA 3VXRE 4I0PB 1LMKA 2D4FA 3D3VE 3QDGA 4XP6L 1CFSA 1FNHA 4L29A 2ICEA 4RIRB 3PABA 5I73B 5DYOA 1MFBH 1RURL 5JUEL 5AYQA 5DD1H 3RWDB 1GC1C 5C6TH 2FECL 3QCUL 4U33A 4F7MB 4LRNH 4R4ND 3CMGA 1JPSH 3ARUA 2APBA 5BS0E 1G7PA 2DQCH 1JNHA 5K9QG 3QEQE 2BHZA 1Q94B 1A4KB 1H3TA 2AJSL 3HPJB 4YZFF 3DARA 4OFKA 2OTUB 4Y2DA 3C6SA 4OZHE 1FYTE 3V4PH 2OCFD 3ARFB 1MJ7H 1MRCH 3M07A 3QUYB 4YQXH