1A6UL

B1-8 fv fragment
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
108
structure length
108
Chain Sequence
b'AVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGNKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B1-8 FV (LIGHT CHAIN)
publication title X-Ray Structures of Fv Fragment and its (4-Hydroxy-3-Nitrophenyl)Acetate Complex of Murine B1-8 Antibody
rcsb
molecule tags Immunoglobulin
total genus 22
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1998-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a6uL00
1F4AA 1GZPB 4LU5L 4Z7UE 4LHUA 1ZT4A 1V3KA 2VLRB 2EYRB 1RZKL 4P3WA 5FUCE 1ZHKB 1HYRC 4Z8FL 3O8XC 3L95B 3OG6B 1TQCB 1ED3A 1SYSA 1UWXK 3MLSH 4YXKH 4XXCA 1YMMB 2BY2A 3H2WA 2RHEA 4KRPB 5HYSG 4GKZB 4BUHA 5E5MB 4WFGD 2UZIL 1V7MH 1NBYA 3B6SA 1OLZA 4DKEH 5C0JA 15C8H 2AJSH 2CXKA 1FZOA 2VLLA 5KVFH 5FUOH 5GJTL 2L7JA 3NCYP 4XH2B 4EEEA 4LNRB 1BX2A 1BPVA 2CIKB 3MJGX 4ZFOB 4HUMB 3ECBB 1SJEB 1RUQL 3GSOB 4CDHA 3BRDA 1FP5A 25C8H 1AD9B 3V6ZA 4NZTH 4LLYA 2XTJC 1AHWB 2FB4L 4IRJA 3OKDB 4FRWA 4QXTB 4QRPB 1SEBA 4HWEL 4S1SL 4DGYH 2QADD 3N1GC 4NQDA 3GUTA 1QSEE 1DANU 5FHAL 5DMYA 4HUWA 3V6OC 2YRPA 4MJIB 1B0WA 5C0BE 3DXAA 3WLWC 4LASL 5LAXB 5C6WH 2XKNA 3CVHH 5E5RB 5T3XD 5I71B 1T4KA 4NN7C 4WI7A 3MZTA 4P23A 1OB1A 3HNVL 4N68A 3WMSA 5IB2B 2BNUB 1UWGL 3PWPE 5I15H 3QULA 4WHCA 3JTSA 1T21B 5TQ2L 3P4NB 1H8NA 1Z5LB 5I0DA 1L4IA 2CKBH 2V5MA 4XPHH 4NWTL 2R1WB 5D7LE 3KWWB 5DK0B 3MA9L 1CS6A 4OFYD 2OJZH 4X8JA 5CZXC 3AMKA 2EE2A 2BNQE 3KPLB 4IDLA 3RUGF 4WENB 3W0WD 3QO0A 1IGCL 1RUAL 3EO0A 4HKJB 5B8CA 5KAQF 1TDQA 4JO1L 1FG2A 3G5ZA 3ZE1F 4M3JA 5FYJL 2HMID 1U8NB 3ARGB 5GGRB 1CL7L 5D7KE 4ZNEE 5D93C 1UZ6F 4N0UA 5LG1A 5EPMA 4PJEF 3C6LB 3CH8A 1BQLL 4LKXB 1LE5A 1NCWL 3QIUA 4RGOL 4JRXB 1OPGH 2O5XH 5JOPE 1M7XA 4ONGL 4HPYH 4J4PA 4G6FD 1YN6A 3D25A 1LK3H 4QRTA 1S9YB 5EBWB 2A9NL 5D71L 2H32A 1Q38A 3F7VA 4RRPA 5IMMA 4P5TB 1S7UA 4XVJL 2WUCH 3WLBA 2XPGB 1UG9A 5D9SA 2FO4B 1QKZL 1C5DA 2NY7H 5I18L 2EH8L 4L4VB 1J88A 3B9KC 3VGAB 2UZXB 1H3GA 2NY2D 3VFSA 1BJ8A 3E2HB 4EBQL 1B6DA 5HTSA 3FO2A 4XAKE 3ARFC 3WDHA 2WWMC 3DX6A 5DJ2A 2IAMD 3CFJB 2Z8RA 4L3ED 1JYNA 1MFEH 4X6DA 3T2NH 3VJ6A 1YN7A 2VZUA 1OAZH 2AGJL 4KRLB 2BFVH 3RDTC 5E6ID 4AH2A 4HZAA 2DQJH 4KDVA 4QF1A 3MROB 1SBSH 1IVLA 2CDEB 5HHMB 4C56E 3T0EA 1F4YL 4WV1A 5KOMC 2VLMD 1QA9B 4IRSB 4JFOA 3DMMC 1PX3A 2FX8H 4GRMA 3UTTD 4URTB 2NX5B 4X4XB 2NY3B 2BSTB 3NZ8B 2AAVA 2AEWA 1X5YA 1FNHA 5AG9A 1K6QH 1NCCL 2GTZB 1MPAH 1OP5H 5A2FA 3TH2T 1OAYL 4YAQB 3NVQA 1NUDA 5SX4I 4CVWA 5CD5D 1JWMB 1Q9LA 3NCJL 5CEXB 1RUKH 4PJ5D 4LCWB 3NBNA 1T1ZA 2AV1A 2W9EL 3GSNL 4FFWD 4Z7WF 3L3OB 5T5FL 4X5WA 4NJAL 2VL5A 2BOCB 1TQBC 3GMPB 2YEZA 5CUSH 1FDLL 2DOCA 3ZT6A 1LO5B 1BD2E 2PO6B 3QZWA 1GIGH 5EU5A 1HOCA 4GBXB 4U7MA 3QG6A 4YGAB 4IIQB 4I13B 5BVPH 5GRVK 2B4CL 5ESQB 4I3SH 4X7TA 4MB5A 3VFUB 5I17A 4M62H 4JDVB 4S1DC 3ZE2F 1DR9A 3QEQD 3ZTJH 4GG6F 3QB7C 2A6IA 4GG8B 1F58H 2RIKA 3RY6C 1NMBL 3UDWA 4KUZL 3L7EB 3TH4T 4FTVA 1LO3H 3MFGB 4LLDB 2C3XA 3QDGA 4CGTA 3EOBA 3GO1H 5JW4R 4HIHA 3FT3A 4XBPA 1EO5A 1QZ1A 1QBLH 1QRNA 2B20A 3NGBB 3SKNB 3FB7A 3C60B 1IAIM 3FMGH 4PJ8D 2X4QA 4XPGL 1DBAH 1RPQA 3E8UH 1KC5H 3IDUA 4HKZA 2GTWA 2OMBA 3LKOA 4Q2ZA 3TZVB 5D1QA 5JOFA 3U0PB 1DUYB 1HK6A 3IAGC 3N85H 4W6YB 4X6BA 1A4KB 3CZFB 5EO0A 5HYEA 3MTRA 4AQ1B 2HFFA 5D2NE 4NJ9L 2IQ9L 4X6CB 4YX2L 1IAOA 4P9HL 1A6PA 2HWZH 2VAAB 2X89D 2ZUQB 3RZCC 3IRPX 4UT9H 5DEFA 4CUCA 1QVOB 2GSIA 2E7BA 4YBLC 4ODUB 2G2RA 4JFFB 5FUCC 3MO1B 4OCYL 3SKMA 5FV2A 3WDJA 1U3HA 5IVXA 5E9DB 5IT2L 3UC0H 5CJOH 1JRHI 2NW2A 4HS8L 5D5MA 4N0FB 3SDCC 1CT8A 1RZ7H 4UB0L 5IW1B 5BS0A 5EOCL 3IKKA 4LLQA 5C7XH 2AK4B 2NR6C 1TNNA 1KCKA 3S5LA 3VCLB 1WICA 4W6XB 5C0CB 4J8RB 3P0VH 2FECI 2H26B 3CLFH 4K23L 5DWUH 1QACA 3JV6A 1S9XA 5E8PA 2DM3A 2Y5TA 3G9AB 1BMGA 3DRTB 4PJIB 3O4LA 1BJMA 1PD6A 4FXGA 4WU5A 5DJCB 2QL1A 5JIHA 1IAIL 5F70A 1PG7W 5HGDB 3MUGA 2X1OA 3PGCB 5DMIH 3MV9D 3RVXC 2OSLB 3I50H 1LD9B 1IGJA 3WKML 4CMMB 3QFDA 1A7BA 1FZJB 2VN4A 1JHTA 4PJ7B 5FOBA 2EC8A 3QDMD 2IBGA 3HB3D 3SDDD 1GXEA 3D39D 4M1DL 2V7NA 2HFTA 3STLB 3MLTB 3MRCA 1PG7L 3K80A 2GW5A 2Y25A 1FCCA 1QSFB 4OFDA 4UDUB 4Y16D 3UROR 3TCXA 1R3IL 1GGUA 1G9MH 5EU6E 1CFNA 1P7KA 3IDMB 3LH2L 5DSCB 2VOTA 4HJGA 3KPMB 1JZ4A 3ILPA 1R5VB 1ZVSA 2Y36L 5E4EC 2UVEA 4NUJA 1JYVA 1JI2A 5F1OB 4W6WB 4WUUD 3VI4E 2R0WL 1NGZA 4ELME 4XRCB 4HWZA 4V1DE 3I9GL 3KXFB 5FYLD 2EIBA 3BZFB 3FO9B 1ACZA 5JHLL 4XCCL 3LQZB 4NBZB 5FUZH 1CU4L 1DEDA 4X7FC 3GSNA 5CP3A 4PJAF 2R15A 1M7DB 5D7JB 3SDYL 4U6HB 4Q0XL 5C0RL 3U4AA 4OZGE 3KYMB 2FR4A 5GGUB 4PGBA 3X17A 4LLVA 1NL0L 1JMZA 1WWAX 1FFQA 2VTFA 4PY7A 1HHJB 2R0KL 4Y4HC 1EXUB 1RUMH 2B5IB 5EU3A 1OLLA 5C08B 3ROLB 3ZT5A 1NSNH 1HINL 1HIMH 3H7BB 1NFDE 4GO6B 3L5XH 5LGHL 5E95B 2A77L 5IW6A 4OLZH 1W72H 3WJLA 2DN7A 4F9PC 4G8EB 5IIEB 3JV5A 5F97E 4XP1L 1A7QL 5GS0D 1NGQL 3EW3B 1A22B 2IALA 4LQ1A 4YFLF 1HEZB 1BHGA 4L3AA 1MRCL 2IPTL 3DARA 3D2UB 5A3IC 4BZ2L 1H15A 5D72H 1ZLWH 3U36A 1MIMH 2PYEA 3I02A 1TVBB 3G5YB 4NIKB 4W4NA 4QGYA 1JK8B 3IXAB 4O51B 3U7WL 5ANME 1J12A 4R4BA 4RMVA 5HI3C 1AGCB 5INDA 1EUUA 4U7KA 5I75B 1UA6H 2VC2L 3BEWA 2EH7L 4ZYKA 5SV4A 1UADC 3B3IB 5EO1A 5CJQH 4NQSA 3V6FA 3VXNA 1XGRA 5KVMC 2CK0L 4X6FB 1BVKB 2DKSA 3SKOA 4CVZA 1A5FL 3MV7E 4F15C 3CD4A 1M4KA 4Y2DD 5EC1A 5ABDE 4CN4A 4MAYD 4LSTH 4FQIH 3IXTB 2XQBH 5IROC 5FK9B 1G7IB 2EYTA 3BT2L 5EB9A 1YUHB 3KPRD 4P2OD 2BVUA 2VXTL 3AY4C 5I1CL 4H5SB 3ULUE 1FFOA 2ZSWB 4MJ6B 2IANA 3HG1E 4LP5A 1LHZA 4JDZB 1C7TA 5J56B 5MEQB 3O0RL 3IJHA 3A67H 3U4BL 1R0AH 3BUTA 5F8RC 1ETZB 1N0LA 1DCLA 5IGXH 1BQHG 4OJFH 4KJPC 2VNCA 5I9QC 1A2YA 2J6EH 4V2BA 4M1GH 4LQFH 1DUZA 3PV7A 2AJVH 4QHKJ 4OLYL 3CLEL 1R5WB 1A6ZB 1ODAA 2EYSB 3KR3H 5IEKB 4AEEA 3WS6C 1Z3GH 2ORBL 4P3CL 4X98B 5T1MB 2ADJB 4YUEH 1AKJA 3PHOA 3DUUA 2FYYA 2HJLB 4K94C 4K3JL 3KPTA 3U30B 5ERWA 2JE8A 2NTFB 3UBXI 1DQJA 1IAKB 1G0XA 1J0JA 4K3HA 4JFDA 4G9FA 4TQEH 5F6IB 5M7QA 4WUKH 3FB6A 1ORQA 4PJFB 3S3PA 1ZT7A 5DR5H 3QH3B 4MMXC 1AGFA 2Q86A 3FFCD 3I85A 5J6HB 2DYPA 2HLFD 3CX5K 2ZCKH 5D2NC 4WIQA 3S34L 1EV2E 5HI4C 3GRWL 2I07B 3QQ3A 4LVHC 1OARL 4E0RB 2GHWB 2GITB 1KT2A 1RIUL 4BZ1L 1C1EL 1FZKA 4DW2L 1FLRH 4PJGE 4Z7VA 4XNMA 1UQSA 4OV5A 4KKCC 3NABL 2BXYA 3GB7B 4Y5VB 3HZVB 1TITA 5FYKD 4G43B 4BZYA 5E2TH 3KDMB 5EZLB 4JCLA 1XGUA 4GRLB 2AVGA 2EXWD 1NGYB 2VZTA 4UNTA 4YHZH 5T1LA 4ZUVB 5KSAC 4XTRC 6FABH 5ICZA 4RSVA 3U0TB 4EVNA 5K9OA 1C08A 5IP4A 5IESH 4OZHF 5EOCJ 4X9GA 4P9ML 3THMH 4Q6IB 4R2GD 1YEGH 1BJ1J 3MRGA 4DUWA 2Y6SC 1N3NB 4NO0A 1FO0B 3X12B 2FDBP 3L3HA 4Y0GA 5BJTA 2XA3A 4EI5B 1ONQB 5J8OA 1NC2A 4L4TD 4HUVB 2DMCA 5JQHC 3PQYA 3K2UH 3QUXD 4LLMA 4YZFE 3RBGA 4WWKA 2Y1VA 1R3HA 3HUJF 1QEWA 5E2VH 1NGXA 5F7NC 1EDQA 3VWJB 3JWDL 3JV4A 3RWHB 3WV0A 4WFGE 2E7LC 1MFDH 4XP9L 3UPCA 5FAAA 5IMLB 1GC1C 5L0QC 1AFVH 1BGXH 4RA0C 3VFVA 1G0YR 2WNGA 5FB8A 4R7DA 4HLJA 4OGYL 4NKOB 5ID1B 1PAMA 7CGTA 4XVUC 1CFSA 1NLDH 1J8KA 3BWAB 5EU4A 5LBSH 4P2QA 1X5KA 5AD0A 4AK1A 4B0MM 3UJTH 4XX1G 5L2KB 1Q72H 5EA0H 4PD4K 3TVMB 3VH8B 4JM2C 2FSEA 4JZJC 5E8EA 4XNYL 1EFXB 4W81A 1B0RB 3GI8H 3BVNB 1NBZB 2OJEA 4NCC1 4C4KT 2GAZB 3UYRH 4N8CL 4QOKA 4FHBD 4UQ3B 2DKUA 2R56L 5DO2D 3PIQA 2X1WL 4IRZH 5T3XE 3ZTJG 4RGNB 4ZXBB 1BBDH 1MELA 1B6UA 2W92A 1YJDL 3FAXA 3DVGA 3MJ9H 4JB9L 2ARJA 5GGVY 3SQOH 1JP5A 1UENA 1N6QL 1CXHA 1JFQL 2P43B 1QQDA 1CLZL 3ARYA 3V0WL 3IFNH 3H8NA 1A7NL 2X4OA 2PTUA 3OJVC 3WIIH 1NFIB 3RRQA 4RWHA 5IQ9B 4DZ8B 2LU7A 1EHAA 4FXKA 3BKML 1JTPA 4WDIB 1IZKA 4KK9C 3HE6A 3JWOC 2EEAA 4G6KL 4WHYG 5C09B 1TJGH 1GOHA 1PSKL 3MC0A 3MLRH 2P1YA 5TDNB 3W0WE 4LSSH 2HFGH 1WF5A 2WBJC 4FNLL 2BDNH 2PW2B 2W38A 2FGZA 3O2WH 4XZUB 3UZVB 4MJ5A 1AR2A 2P7TA 4J3SA 1CDHA 5EOQL 4YBQD 4QY8A 3DOSA 2LTQC 5IHZB 4HS6A 3H6JA 4I0KA 1KIUA 4QRQB 5IB3B 1T1XB 2AKRB 1ACYH 3GMLB 3D5OF 3WXVL 1WUNT 3UJIL 2EIEA 2VDKH 4KI1A 5K9KB 4DZBA 4GJTB 5IMOB 3GJFH 3QHFH 4PJXE 4QEGA 3IYLW 4BKLA 4LBEA 3ZLQC 4S2SA 5CIPB 4MQ7A 2W07A 4KQ4L 2XN9D 2EC9T 3QO1B 2A6DB 2FZ3A 5GZOC 4L29B 5DQJA 1MNUL 3GRWA 3SKJH 2JIXB 3WCYA 5H35A 2ENSA 4Y4FD 3NCFB 3O6ML 4NZRH 2D03H 5E99H 2YBRB 4L5FL 3NIGE 1RIVH 2YKLH 1CF8L 3PNWB 1OP3K 2DWEB 2J4WL 1KPVB 4XHJC 4Y8DC 1ZHBA 3J8F7 1W0WA 2XQYK 4EI6A 4CMHB 3QPQD 4GMTL 5ADOL 1B9ZA 5KBNC 4F7TA 4M5ZH 4L3EE 5I66A 4HXAH 4H8WH 5AYUL 3CDFA 3PXJA 2DQFB 3M1BA 3CSBA 3OWEA 1RK0A 1FPTH 2HLAB 4I5BA 3H9SA 5AG8A 2Y7QB 4G6ML 1XF3A 2R2BA 3QNZB 1A1MB 2VLME 3QUYA 4PRDB 2IPKA 2H3NB 3UTQB 3UTTE 4PGEA 3MRBA 4D0DB 4N8VG 4JN1H 1E4JA 1H3PH 3U82B 5DJAA 1HZHH 5HYSA 4WEBH 1WEJH 3P4OA 1NGWB 1TLKA 1YECL 2V2XB 1YEHH 2IFFH 3ET9F 5DS8A 1NDMA 3PP4L 3QXAA 3CSYB 4ZFFB 3T0VA 4PJ5E 3T2QA 3LKNB 5CBEB 5A2JH 5F7DA 4PGJA 4LPCA 1FYTA 1T3FA 4M4PA 4LFHD 4OT1H 3KYKL 3RTQA 9CGTA 1WITA 3INUH 3QXTA 3SGJA 5JO5B 3RGVD 2DICA 5F9AC 3I6GB 2VDPL 5ITBL 2OK0H 1OW0C 1SY6L 1VKXB 4PJBB 4HFUH 1JGUH 1S7TB 2ESVD 3MBXH 4ZMAT 3RHWF 5HYJD 4LCIL 2J3SA 3PWUB 2X7LB 5F1NB 3CDYA 3RL1A 3V52H 4PJCE 5C0ND 2XTLA 4RISH 2R8SH 3QEQE 1J5OH 1BF8A 3W9EB 2VWEE 2ADFL 3KPSA 3OPZL 5CWSA 4OGZA 2R1XA 3RVTD 5DRWA 1G7MA 5AAMA 4K3DH 4MA1C 4KKAC 4I9WD 4WO4B 4EN3C 4AIXA 4FTVE 5I73B 1BM3H 1YEFL 1RY7B 5L7XL 3EYQC 3TJEL 1CWVA 3T8XA 4JHWL 3O6FB 3BPNC 3NACL 4PS4H 4X99B 5C0DA 5DUBA 2LU3A 1MJUH 5ADPH 3HC4L 3TBVB 2FEEL 2DKMA 1VB9A 1G7JA 4NP4L 5EU7E 3D3VB 4C83A 5C71A 1T83A 5IJKA 4OIIH 1HSAB 5E8DH 4M7LL 4HT1L 3HI1A 1D9KB 3QNXB 1U3JA 5C92A 3C9NB 4KROC 1N5YL 3QUKA 5I0ZA 4AMKH 3MJ7A 3MLWL 4GUPA 3WD5H 5SWZD 3QA3A 3FQWB 1JYXA 4GOSA 3QI9A 1FHGA 4BSVB 3MLVH 3VXOB 5BRZA 4MHHG 5CCKL 1MHPL 4IM8A 4XT1C 2DB8A 3TPUB 3BPCA 1MCQA 3SDXE 2DQTL 1H3XA 3MRKB 2ITCA 4ZUTA 5HDQH 3RY5A 4DN3H 5L2JB 1A1NB 2DTML 2VDRL 5IVXE 1MAML 1J1OL 4XNQB 5DC0A 4YGVA 1U3YA 1IC5H 3S8WA 4APQB 3VFRA 3ARDA 5CINH 4NNPH 3ARPA 1S5HA 3U1SH 3VXUB 1EBPA 1MI5A 3BUYA 3SGKA 5I30L 1P9MA 4NSKA 8FABB 1U0QA 4L8SC 2FBOJ 2XYCA 3VRIA 3KPOA 5TJWK 4P46A 1OCWL 5C9JA 3SOBL 1U8MA 4GAJH 4H1LH 4YXLH 5LCVL 3AAZA 3N06B 5JUEL 4MXVF 3DX9A 5HXMA 4LHUB 1ZT4B 3B43A 4FOMA 4MA8L 3Q6FA 1OGAA 4K8RL 2YA1A 2J8UF 3MV9E 2BVEA 4TN9A 4M43H 2QADC 5C0GA 1BREA 1TNMA 3L5WB 2VDLL 4ODBD 3P11H 1ED3B 4K3EL 1SYSB 4PRPB 5ILTL 4Y89A 3QDME 2EKJA 2VXQL 1WJ3A 3EOAB 3D39E 1JNLH 1F3DH 4MNHA 3B6SB 4KKNA 5C0JB 1HSBA 32C2A 1CBVH 1BZ9A 2ZSVA 1HHKA 2VLLB 5CSZA 1JF1A 5KAQG 1EO8L 3I75A 1IKNA 2UY7A 1J18A 1Q0YH 2GJJA 2NY5C 3PV6A 1U91A 5IQ7H 3LDBC 2V5TA 4WUUE 2GK2A 4DQOH 4QTIH 1QNZH 1DVFA 3V6ZB 5EBLA 2M1KA 4IRJB 4HIXH 1D6EB 2X4SA 1VFMA 3ULSA 1XF4A 4YWGL 2BRRH 1AXTH 4NQDB 4KK8D 2C7UB 3MGOA 3N50A 3GUTB 1Y18A 2P44B 5F1IA 3RA7H 1F5WA 1SBBA 1B4JL 1IZJA 1PQZB 3DXAB 4LCCC 4Y5YB 3F62A 4FQXD 2XKNB 1CQKA 5H94B 4KZEL 4MXQD 2HMIC 3GNMH 1T4KB 2D9QB 3BGMA 4KKBD 1SY6A 1WAAE 2CSPA 1RMFL 2V17H 4N5ED 4QXGH 1GGBL 5DURD 3G6JA 3QULB 3DBXA 4F7PA 3F7PC 1C5BL 4RZCA 5TE6L 4AEHH 1S7VB 3VXQA 3ZDYF 3OAZK 5KSVA 3TT3H 4NQEB 1YQVL 2BVYA 5DD5L 5AZ2L 3QUML 3Q5TA 4M6NL 2P5WA 4X8JB 4U1LB 1JI1A 1FV1A 4OTXL 2Z31A 4JQXA 3GSVB 3L3GA 5KG9B 2CMRH 3WNKA 3QO0B 3MLSL 2Q76A 4QXUH 2XXMB 1OAXH 3EO0B 5DVOA 5B8CB 3K4ZA 5C6TH 2NY2C 2HG5B 1FG2B 3DSNA 3SE3A 4BYHA 2WIIA 5A16A 4WGVB 4LF3B 5FUOL 4H0IA 5C07D 1KTDA 2IAMC 43CAA 4N0UB 5DZNA 5M95B 3QIUB 5E6IC 5I8OL 1FNEA 3HFMH 2D31B 3T65B 4KI5F 2O5YL 25C8L 3O8XB 3B2UD 4NZTL 2XI9A 1UM6H 1X5JA 2C5DC 3GSXB 2FD6H 3AVEA 4OZIE 3D25B 3QHZH 5TH2B 4UDTA 2BZDA 4A2LA 1RJZA 1I8LC 3F7VB 1I9IH 1RVFH 5IMMB 3B9AA 2GT9B 1J0YA 5CD5C 5D7IA 4TRPH 1C5DB 4RAVA 2CIIA 3CVHL 1ZEAL 4FFWC 4LRNL 1YEIH 1AO7A 1MIEL 4LOUD 1MCIA 3TH3T 1Z9OA 4GW5B 3DTXA 1DP0A 4KDTA 4WEMB 1FL3A 3DX6B 5I15L 2NYYD 4Q58C 4X6DB 4ISVA 3WNLA 5F9OL 3H9HA 3WHE0 3D9AH 2KL6A 1MFCH 4AH2B 4A6YA 3MCG1 3BH8B 5KSBE 3T0EB 3MRFB 4JM4H 4XPHL 5IFJA 4JFOB 2K3TA 1Y0LA 3GHBH 5C0AA 3Q48A 3TYFA 1I1FA 1CR9H 1BZ7B 1MY7A 2PCPA 4JPVH 5EC2A 2R69H 1U8HA 4KQ3H 5GHWL 3BHBB 3ILQD 4RGMC 2VITB 2ZJSL 3AXLA 4XI5D 1VFOA 2OM5A 4R96A 4Z7QE 3DVNA 2YPLD 3KPPA 1LP9A 1CTNA 2CDGA 3ULVL 1NBVH 5KS9B 2V2WA 4PJ9A 4PJ8C 1M71A 2VL5B 3V9FA 2BNRA 1JGDA 3WUWB 2YEZB 5I8CA 1QHOA 5F7LB 5IEHA 1OPGL 2VH5L 3S37H 3QZWB 2EC9U 2O5XL 3BP7A 5ENWB 2AEPH 4X9FA 4HK0A 3TEUA 5EU7C 3O45A 1A02N 1P69B 4HPYL 4JFDE 4G9FE 4M93C 2DLGA 4BFIA 3FONB 4X7TB 2CGRL 2DTSA 4KY1L 5FGBC 3Q1SH 5T1DH 1EZVX 1DEEA 3OXSA 5HVHC 2A6IB 1ZAGA 4FQJH 4RMUA 3VGHA 4HWBA 4MZ2A 1N7MH 4Y4KA 1LO4H 3QDGB 2NY7L 5SWSD 3EOBB 5FYKE 4M8QA 4Y5XA 4HIHB 3V5KA 3FT3B 4Z7VE 4XBPB 3WEXB 3UAJD 1XH3A 4HGWA 3S3SA 1RFDH 1QRNB 2ED9A 2IFGA 3L3IA 2QJDA 3GGWA 4R8WH 4XCEA 1IRAY 4K2UH 2RQ8A 4I2XA 1T2XA 2X4QB 1MFEL 5DD6A 4PV8A 5EZOH 1KXQE 1TZGL 4HKZB 1WTLA 1OAZL 2GTWB 1WLHA 4O2EA 2DQGH 3BPLC 4Q7DA 4Q2ZB 2NXZD 1QP1A 5D1QB 4E9LA 1UC6A 3FKUS 3MUHL 4TSAH 4UQ2A 5JOFB 4YDJA 5HI5D 3EYSH 3TA3D 3CFKA 1GOFA 5EO0B 4RX4A 1RHHA 3WO4B 2VZSA 4X80H 2FX8L 1KCRH 5LKNA 3LY6A 1CGTA 1ORSA 5JHDD 3O6LL 1IAOB 5C6PB 4JR9H 1K6QL 5DEFB 4L4TE 3VDAA 3QUMA 4ZODA 2EDTA 3UTSD 5FKPA 5IVZA 1A0QL 4M7KH 4F2MA 1TCRA 5DLMH 3LZFL 3QQ9D 1RUKL 5D96B 3LEVH 1IARB 3ARFB 5EBGA 4DKFH 5DUML 3U2SA 3ZMRA 1U3HB 3O6KH 4JRYB 5D5MB 1CT8B 3G08A 3RDTB 4XMLL 3EYOB 1SYVB 5BS0B 4E41B 2RJMA 3HB3C 3SDDC 2JJTC 1BFVH 4LLQB 1I4FA 4ERSH 3DMMB 5BVPL 4HPOH 4Y16C 5HVGB 4HW6A 4OZ4A 4HSQA 3V8CA 1MEXL 3TN0D 2VRAA 3DUSA 4M62L 5DFVD 2BMKA 5EUOA 4M8VA 3JV6B 4S0SD 4P2QE 5HY9A 1S9XB 3MMEA 4RBPK 3S96A 1TFHA 5E8PB 1F58L 2Y5TB 2Y72A 3JWNC 4ODVH 4Z95H 3O4LB 1LO3L 3EDDA 2FWOA 3WIHH 3GO1L 5IB5B 2N4IA 4WU5B 2IBZY 3B5GA 3ZHLA 2PTTB 4UTBH 2X5PA 3KGRA 1R5IB 2R1YA 4LPTA 1J8HB 3FMGL 1D3CA 4QOKE 3W11D 1DBAL 3CVHA 1KC5L 1OTUD 5J89A 4PJHE 2XZAH 1BQHA 4HFWA 3K46A 2C1PB 5HGHA 4JO2H 3WE6A 1L0QA 3N85L 2NY1D 3MV8D 4XNZC 3TT1L 5C0EB 5I8KL 4JFHD 2E6QA 4OCRH 4N1EA 2HYMA 4D2NA 5KVGH 4WTZG 3MRNA 2HWZL 5HHQB 4ZUSB 1OAQH 1CFNB 4UT9L 2JJVA 1FFPA 1P7KB 2GUOA 2X4RA 2UV3A 4E5XB 1PFCA 1CL7I 4KC3B 1ZVSB 4JFYB 1G7PA 4OLUL 5JIPA 4QHMA 4NUJB 3GSQB 4PP2A 1ZHLA 1NGZB 1RJLA 4AG4L 4D9RD 2P8LB 4HWZB 5JORB 3BZ4B 1EERB 3UC0L 5CJOL 3PHSA 1XF5A 4PJDA 4NBYB 5GS0C 2Q6WA 4BSWA 4R0LA 2E9BA 1U41A 4A2MA 1T1WA 4Q74A 3NCYS 3VRLE 3MXWH 5D2LA 4UNVA 1HHIB 1G9EA 1FBIH 1ROWA 3MOQA 4PGBB 4UUJA 1U2HA 3WJJC 3CLFL 3VXSD 3ZKQD 5IG7A 5JW5B 4HIJA 3TNNB 4X4YA 4M48L 2P48B 1NLBH 2IGFH 3OB0H 4YBLB 4FFVD 2WUBH 3AGVA 1KFAH 3CXHJ 4P48A 3GEWB 4XCNA 4M6OL 1DQDH 2ADGA 5ICXA 2AJYH 5DMIL 5F7WC 2XIDA 4PRIA 1HI6A 4IJ3C 4MDJA 2WINB 4Y2DC 2QBWA 4XPFH 1KGCD 4MAYC 1S9KC 4GAFB 2WM0A 3L5IA 3EJZD 4H1LG 4CNIA 4HZLA 4Z7UF 1G6RL 3D0VA 3VXRD 1T20A 4K9EC 3PF2A 5JQ6H 4TPRL 2R29H 4K7PL 4P2OC 4NOFA 5GRWA 3U7YH 1H15B 3IVKA 2R23A 3WHE1 2FGWL 2PYEB 3IU4H 2F54A 4ZO6A 2HTLD 3LCYA 5F7EH 1A3LL 3WFCL 1WBXA 5F3HB 4R4BB 1FFNA 4F3FB 4OFIA 5INDB 3DVFA 5IHUH 3BEWB 3TV3H 4F7EA 2DBJA 5EO1B 1WWBX 4NQSB 1IM9A 3D85D 4XP5L 4UILL 5FUZL 5J1TC 4M7JL 3MRDA 4U6VL 1WT5A 5D1XD 5I16A 1K4CB 1MHCA 4U0QB 1FYTE 1G7QA 1AI1L 5I1LA 4QHKI 5CZVL 4UU9A 1OSPH 3BESR 1Q0XH 4YHNA 4U05A 2ESVE 2P8MA 5HYJE 1D5MA 3DGGB 1OP5K 1CLCA 1FFOB 2KH2B 2IANB 1NSNL 3G5XA 3HNTH 4WW2F 3UTPE 2HH0L 3F7YA 1CLOH 1T6WA 3IJHB 3L5XL 4ZFZA 4XNUH 2HLFC 1MY5A 2O5ZH 4HJ0D 2EIZA 5A40E 1D5IL 5EZJB 2GJ6B 2Q20A 3KPSE 5ITFA 4I9WE 2WQ8A 1WFTA 5CSGA 4OLZL 1A2YB 1UZ8A 5CGMA 5BQ7B 1ZHNA 1E6JH 1DUZB 3QEUA 4XBGB 1I8IA 1B2WL 3PP3H 3CAFA 3W2DH 1BQUA 2OTUA 3OJ2C 2IF7A 2EXWC 3HRZA 3PHOB 2FYYB 2VQUA 2B7DT 5IBUB 1B4RA 4UV4L 1DQJB 2DI7A 1A6AA 1K3ZA 3QG7L 1KPUB 1JZ6A 2E6PA 1QFWI 4R2GC 1ORQB 3RPKA 3WNPA 1FJ1A 3C09B 1AGFB 4HWUA 4MQSB 2K9UA 5SWZE 2BVOB 2Q86B 2K7PA 2DYPB 1AGEB 1MLCB 2UUDK 4KJWD 3DVIA 5DRXA 3QUZA 1PKQA 3M17A 1ES0A 4XP4L 4P5MA 1KT2B 2IADA 1JPTH 1CZ8L 2DIAA 3QUXC 1JGEA 1MLBB 4FQIL 1YY8A 3RIFK 2XQBL 3QT2A 4U1IA 1UQSB 4OV5B 5H8DA 1SJHA 3B5TA 3UX9B 1N6VA 4Y1AA 1X5IA 3QCTH 4WI3A 2Q1EA 2AJZA 3RWFA 5C86A 1FSKC 4F58H 1SQ2N 4Q9QH 1ADQH 3C8HA 5E8NA 2BCKA 5E6YA 4EVNB 3NFSH 5D6DC 2ZOKB 4OLVL 1MI5E 4UT7L 4UV7H 3A67L 2AI0L 4R4ND 4U3CA 1VEOA 3MRGB 1R0AL 4NO0B 3VA6A 4F15B 4OJFL 2N7BA 2PUQT 2J5LC 4O5LH 3L3HB 4XPTL 5H37H 5IR1B 3GMNA 4Z76A 3VH8G 4QXWA 4M1GL 3S98A 3TM6A 5I1IL 4G6AD 4TVPD 3PQYB 3A6CH 4P49A 2IWGA 5DRZA 3BQUD 3KR3L 4PRHA 4WWKB 1NUNB 1NGXB 2VAJA 2QHRH 1S7SA 3OKMA 1DFBH 5DO2C 3ZDXE 3JV4B 1Q1JL 3HZYA 4N8VA 4XVSH 3TIDB 3BZEA 3V4VL 2YD1A 4I4WB 4DOHB 4DCQA 1CE6A 3MRJA 4BH7A 2R2EB 2XRAH 1JTOA 4MA3B 4LU5H 4TQEL 4WUKL 5DR5L 4YHYB 3LPWA 5KSUA 2E3VA 5F7KC 1KELH 2LABA 4Z8FH 4XMKL 1CIDA 2ZCKL 4WFHD 1A7RL 1IM3A 3EZJB 4MD4B 5MHSD 1Z0NA 4FZEL 5AD0B 3ARBA 5GGTL 3IAPA 2MOVA 3VXMA 3ES6A 5HDLA 2FSEB 4X4ME 5E8EB 5DA0B 4MNGE 4JREC 1U8QA 1UVQB 1XZ0A 1WBYB 3EO1A 2OJEB 2NMSA 3SJVB 1FGVL 5GRXG 2EDDA 4YBQC 5DMJB 3PIQB 3DYOA 4OZFH 1WIUA 4LNVA 5MEOA 5LXGL 6FABL 3NA4A 3DVGB 5KANI 1RUQH 2YD5A 1P84J 4PLNC 4HBCL 5IESL 1NCNA 4TYUA 2Z92A 1GL4B 1YEGL 2FB4H 3MV01 4ZFGH 4G8GD 1QQDB 3U9PL 2EEDA 5JA9A 4LVHB 5ETUB 2CD0A 4S1SH 2X4OB 4HWEH 5JR1L 1KOAA 4GRWB 3D1MC 3WS3A 4U1GC 3HE6B 5FHAH 3OR6A 2AERT 3O11A 4Y4FC 4FQ2H 5KVEH 5E2VL 3DX8A 4HMCA 4L3CA 2F5AL 3NPZB 4HWNA 3HNVH 4MJ5B 2WMPA 5KSAB 4LP4A 1XR9A 1NC4D 3CU1A 4XBEL 1FAKT 4OD3L 3QIBD 4B7LA 4U1SB 3QPQC 1TETH 3UO1H 1GZPA 4PGDB 5C07E 4GRWF 1W0YT 1K4DA 2MQ0A 1K8DA 2VLRA 5HGGS 5CD3B 1ZHKA 4NC2B 1ZKAA 4DZBB 3TJHD 5LBSL 3HZKA 3MA9H 2IQAA 4C58B 3QIWA 4QRRD 3L95A 4NT6B 1ZLSH 3DIFA 4LBEB 5EA0L 4YDKH 1F4HA 1I9JL 1IGCH 3DJ9A 4MQ7B 1UM5L 1WIPA 1RUAH 3MRQB 1YMMA 4LIQL 2FZ3B 5T5NG 4JO1H 5DQJB 5L8LB 4GKZA 2CLVB 1ZLWK 2DQIH 3IDYC 2NQCA 4KRPD 5FYJH 2YSSA 4L1HA 3TBYA 3HE7D 5GGSY 4CN1A 5E2WL 2DAVA 4XH2A 3MNVA 3REVA 3HI6H 2WZPD 5JTWA 1W0WB 1NCWH 2G60H 3L7FA 4RGOH 3MJ9L 3SQOL 1H9VA 3RGVC 4F7TB 1UB6B 2BHZA 4TNVF 4MAUH 3HC0B 5GSRA 2DQCL 3M1BB 1WZ1L 1I85A 5JXEA 1KYOK 2ILLA 1F6FB 1S7XA 2P4AB 3H9SB 4JM2B 1XF3B 4BM7A 3EGSA 2A9NH 5C0NC 5J13C 3Q3GA 4QRPD 5I76B 2LAGB 4PGEB 1TJGL 3MRBB 3OG4B 5I18H 2X40A 2DD8H 5DJAB 3RVTC 1X5LA 3P4OB 4LSSL 5B3NA 2BDNL 4MJID 1QO3B 3RUGA 5DS8B 3LN4B 5GRUL 3RVVD 3SDAD 1E4XL 1T3FB 4JM2F 2YUWA 4ODWA 2XWTA 3RTQB 1OAUL 3VDCA 2DMKA 1ACYL 4JHZA 4KGJA 5IV2A 3GBMH 3VI4F 1NMAL 5GRZA 2VDKL 4ELMF 3ZKXC 3VRJB 2ENYA 2NY4B 4PJEA 5C3TA 3RKPA 4U1HB 1IC4H 3F5WB 3EFFA 3GSWB 1NCCH 4NNXB 1ZLVK 4Y19B 3BRGC 3QBTB 4F37F 4DUXA 1CN4A 1OAYH 2WBJB 1NCDL 5DYOB 3S35X 2XZCL 5GGTA 4OZGF 4UAOC 5DRWB 2D03L 2W9EH 1G7MB 2AP2A 4OF6A 1U8NA 1RIVL 5GGRA 2LTQB 5T5FH 2XA8H 4NJAH 3CDGA 1EJOL 1O5DT 4X7SL 1SM3L 3C6LA 1AP2B 4LKXA 5TE4H 2Z9TA 3ARGD 1KYOJ 3BMVA 3MLYH 1FDLH 4XAWH 5DK2A 3T8XB 1HE7A 1P1ZB 3U46A 5C0DB 4HXAL 5DUBB 4JRXD 4GQPH 2RCSL 2AEIT 5BV7C 5D1ZD 3Q2CA 3GBNL 1FPTL 3D48R 1G7JB 4WEUD 4C83B 3QQ4A 4FP8H 5BMFH 1MCDA 4P5TA 2QLVB 3X3GL 2PKDA 5FO7A 3WO3B 1HZHL 3G6DH 3QUKB 1CDBA 3MJ7B 4GUPB 2IFFL 4ONHA 1XF1A 3QA3B 4L4VD 4OLXH 2OYPA 1OT2A 4O2FA 4BH8B 3MQIA 3C5ZA 4LHUG 5I1AB 4XPGH 5BRZB 1G1YA 5IOPA 2H2PD 3NCBB 2YD2A 3VA2C 2YD6A 4OT1L 2YPKB 3MROA 3QCVL 2ITCB 1I9RH 2CDEA 4ZUTB 5E08L 4M7ZB 1QA9A 2OK0L 4X9HA 2YA2A 4C59B 4JGMA 1JGUL 2IQ9H 3W82A 4KUCF 2NX5A 4X4XA 3ARDB 3PUCA 2BSTA 3U83A 1S5HB 4IRSD 3SPVA 2EDKA 3V52L 2IMNA 4H20L 4RISL 4NSKB 2NY3D 1J5OL 3PGDB 3NN8B 3F12A 1FN4A 1JWMA 1PGRB 2ZCHH 3VRIB 5CEXA 5C9JB 2YD4A 4GG6A 2VLJD 5I74B 3L3DB 2W60A 2WLYA 5IT2H 3P9MB 1KNOB 2EXYD 3DX9B 4HS8H 4LCWD 2BOCA 1BM3L 4JQIL 3ULUF 4G3YL 2MFNA 1OGAB 3UMTA 1RZFH 5EOCH 1CXFA 1BJ1H 4KK8C 5C0GB 4B50A 3VFPA 4PS4L 2C3GA 1RUPH 2PO6D 5ADPL 1FCGA 4RAUA 5ESQA 4GBXD 5BW7A 3VFUA 3MJ9A 3TCLB 1P7QA 4ZS7H 1E28B 4K23H 4FQXC 3MV8E 4HMDA 4MXQC 4NQTA 4MNHB 4LVOC 4EDWL 3EIFA 4KKBC 4JFHE 4MJ4A 5E8DL 2JB5H 3MBEA 2PN5A 32C2B 2ZSVB 1MVFA 4N5EC 4POUB 1CXEA 5CSZB 1ITCA 4O02L 4AMKL 1JF1B 3VI3E 1IAIH 3MCKA 3QDJA 3OKLB 1CTOA 3WD5L 3I75B 4EN3B 3IETA 4UBDD 3MOBH 1Z2KA 3AB0C 4JY4A 3C60A 4D9RE 3MLVL 3O9WA 1MREH 3GKWH 2MPAL 5EBLB 4YJZL 3BPNB 4R4FL 2X10A 3ZTNL 1IFHL 1HH6A 4JJHA 2HN7B 1WWCA 2ICCA 4U6YA 3ULSB 5FEBA 4OF5A 4DN3L 5IWLA 3MGOB 3CZFA 3RP1A 3TZVD 4UOJA 1F2QA 4PJDE 2I26N 4X6CA 1CICD 3PABB 1NAML 5CINL 1MJ8H 4WFED 2W9DH 1R3LB 3V8OA 4AEIH 3DGCR 5J6GB 3CPLA 3BGMB 3VXSE 2H9GB 4GT7A 2F58H 3NAAH 3GJFA 3DLQR 4PJGF 4LVNB 1MAKA 4ODUA 1K85A 3G6JB 1FAIH 4RZCB 2YR3A 2OP4H 3H7LA 5E9DA 3QQNA 4F57L 1LNUA 4JFFD 3B2UC 4N0FA 3OBAA 4M9OA 3AUVA 4NN5C 3X14A 5HHOA 5JIKA 1X7QA 2P5WB 1UJ3C 3T77A 4MD0A 4Q0XH 1U8OB 5C0RH 1FV1B 5C0CA 4RRPG 2Z31B 4J8RA 3K0WA 4LLUB 3L3GB 4ORGA 4PRIE 5IFAL 2AK4D 1U2CA 2H26A 1NL0H 3Q6GL 1N64H 3VXRE 5H37G 2R0KH 3VU2A 1FL5B 4L8SB 4LOUC 5EORH 2C4XA 4QTHA 4HUUA 1KTKE 4PJIA 1HINH 5DJXA 5FM8A 1MRFH 2P8PA 5A16B 4KJYA 1CDCA 2JJSA 3E6FA 43CAB 2NYYC 4OKDA 4GW4B 5DJCA 4JY6B 4YZFF 2A77H 3QPXH 4W4OA 3SCMD 1Q0YL 2GFBA 1FNEB 3FN0H 5IQ7L 1BWMA 4F7MB 1KJ2H 2OSLA 4ZOBA 4DQOL 1MCKA 4P3DA 2QADB 4XP1H 1LD9A 2CRYA 4HIXL 1PW3A 1YEJH 1ZV5A 5CBAB 5DTFA 2DQUL 4ZQKA 1RJZB 1QHPA 3STLA 3MNWB 4JKPH 1YEKL 4BZ2H 1QSFA 2MJWA 3ILQC 4MNQA 3RA7L 4XI5C 3LV3B 5D7IB 2CIIB 2ICWI 2RB8A 3PG2A 1KPRB 4BFBD 3GNML 3U7WH 2CDFA 4JG1H 2C26A 1AO7B 4XX1E 3KPMA 2A2QT 1R5VA 3RWDB 4D0BA 2YK1L 4QXGL 3DTXB 4Z77A 1DQTA 2PETA 1FL3B 2VC2H 1A9EB 3S3JA 4XRCA 4YR6A 2EH7H 3LDBB 3KXFA 3WUWG 2XT1B 2FO1A 4ISVB 2OMNA 1TJIL 3QZWG 3H9HB 4AIOA 1RJYB 3AREA 3TT3L 4NKDB 2YWYA 3TO4A 4FQCL 1HH9A 2CK0H 4K94H 4OZFG 1A5FH 5IFJB 1QSED 2FEEI 3AMLA 2QSTA 3BKJL 1FNAA 1M7DA 1Y0LB 2I60H 4OF0A 5C0AB 5C0BD 3BT2H 1I1FB 1INDL 2CMRL 5EC2B 1Z0MA 5GGUA 4OV6F 1U8HB 5D7JD 5GRJH 4WI8A 5JDSB 2XNAB 3KJ4C 4RCAA 1O0VA 1FGNL 4WTZA 4R96B 1EXUA 3DVNB 2E9JA 3UAJC 5FXCH 3ROLA 1LP9B 1AJ7L 2CDGB 1RZJL 1XIWD 3O0RH 2V2WB 4PJ9B 4GRWH 4XGZA 5C08D 4P59L 3N9GL 2BNRB 2NXZC 5CEZD 5I8CB 5IEHB 3HI5H 2DRUA 1P5UA 3CFCL 5HI5C 3TA3C 4HK0B 2ID5A 3AS3A 3O45B 3FFDA 3N1PC 3K3QA 1UM6L 3HMXL 4BFIB 2BERA 3FT4B 3CLEH 3NTCL 2PYFA 5ACZA 3QHZL 3S36L 1DEEB 1KIQB 2QQQA 3OXSB 4P3CH 3CMOL 5SX5H 1RVFL 1FRGL 2ED8A 5HDOA 2UWEE 2NY2B 4G7YL 4Y4KB 2NZ9D 4TRPL 1MCEA 4PJXF 3G5YA 3QQ9C 5D7KD 4K3JH 3T1FA 3D2UD 3EZ8A 4Y5XB 3CMGA 3V5KB 2IAMB 1AGBA 1CFTA 4LSDA 1YEIL 4XMPH 3GHEH 1XH3B 5AZEL 4HGWB 3HRPA 1AGCA 4Y1AE 1URLA 3IS1X 4M61B 3TLRA 4RMWA 4I2XB 2F8XC 5DD6B 4PV8B 4QYOB 4O2EB 3NIGF 4GXVL 3S34H 3D9AL 3GRWH 1IEAB 3DX7B 1QUNA 4YDJB 4L9LC 3BN3B 4X6FA 12E8H 5KVDL 1OARH 4NYLA 4JVUA 4PV9B 3TN0C 1C1EH 5J12B 2VDQL 5DFVC 5DJ0B 4H1LA 3GHBL 1ORSB 3X13B 1EVTC 3IXTA 1WFOA 5JOEA 1PZUB 3NABH 1CR9L 4S11A 3QUMB 1R3KB 5HVWA 4KQ3L 2OI9B 1I75A 4XAKD 4F2MB 1TCRB 1HWGB 2C1OB 3TBSA 4H5SA 3WYRA 1YPZE 5CAYB 1Q9OB 4MJ6A 3IKCA 5GISL 4JDZA 5E2UH 4PRHE 4U33A 5T3ZH 5MEQA 2E6JA 3W11C 3R8QA 4NKIL 1OTUC 3SEPA 1ETZA 3V5HA 4DK3A 5F88A 3S37L 4PP1D 3UYOD 4X9BA 2NY1C 3PDOA 1I4FB 2HAZA 2W1NA 3QEQB 1DL7H 1XGPB 5D7SL 4LLAA 3I2CL 4DN4L 1MCRA 4OZ4B 5MHSE 3TO2B 4KMLB 4WW1A 3DUSB 1R5WA 1J05B 2EYSA 5T1DL 1U93B 5EUOB 4Z0XA 4X98A 5HY9B 5T1MA 3MMEB 3S96B 2DBLL 1N2RA 4FQJL 1PKOA 3JWDH 3QFJA 2HJLA 1VA9A 4YFEA 2WLZA 4MD5B 4XP9H 3L3JA 2NTFA 1IAKA 4PJ8B 4PJCF 1BD2D 3JWOH 4NFBA 2R1YB 2AK1H 5FCSH 4KMTL 1KLGA 5BZDA 2F53A 3CVHB 5EZOL 3GI9L 4HS3A 4LGSB 2UY6A 3VXTA 1BQHB 1VFAA 2I07A 1KLFA 1ZA3B 3BFOA 2X4PB 3EYSL 3WE6B 3WFBL 1T7ZA 3TF7C 4X80L 5HVHB 4P4KA 5IVOA 1PVHA 4ESKA 3HZVA 2CLRB 1DE4B 2Z91A 4FFVC 2GUOB 4G43A 5EZLA 2X4RB 3IRZA 2JB6A 1C12A 4FFZH 2R56H 3RJQB 1NGYA 4QHMB 5DLML 2CXGA 1DANT 1DZBA 2MCPH 3LEVL 4GRLD 3U0TA 4JB9H 5CJBA 3HUJA 1OGTA 1N6QH 2F9BT 4Q6IA 4M9PA 4ZD3H 3DRQA 3JTTA 2QEJA 1CLZH 1OD7A 3EJZC 1MFAL 4BSWB 4R0LB 4N0CD 2R4RL 3X12A 3SBWA 1T1WB 2NXYB 4ODSL 3O4OB 5D2LB 4HPOL 2CO7B 4QRSB 2VLRE 2X4UA 3GJEB 1PSKH 3SDXF 2HTLC 3IFPB 4LK4A 2IG2L 4CU6A 5IG7B 4EI5D 2OZ4H 2AABL 2Y9RT 5IVXF 4FNLH 4M00A 1KN2H 3VWJA 4KK6D 3HPLA 3WIHL 3I6KA 2I9LB 1TPXC 4ZAKA 1YMME 4XCNB 3I84A 1A6VL 5T1KA 1Q9WA 4UTBL 5ICXB 5ID1A 2A74A 3UTOA 3LD8C 1VACA 3IDNB 4LSQH 1HI6B 3ESUF 4MDJB 3KJ6L 5D1XC 1NCBH 4U0RC 1N5AA 1DSFL 4WTXA 2XZAL 3UJJH 3KPNA 4HZLB 4JO2L 5L2KA 3WFEL 3D0VB 1T20B 2WW8A 4HAGA 3TVMA 4KQ4H 4LSVL 4ZPTA 5DHVH 2R23B 2JF1A 3K8MA 7FABH 1MNUH 1B0RA 5GS1A 5KVGL 1NBZA 4QRPE 1E27A 2F54B 3HLAB 4N0YL 3VFNB 4S1QL 1OAQL 5EIIA 2GAZA 5ACMA 1EFXD 1DQQB 3JSSA 4L5FH 1WBXB 1CF8H 3H3PH 1FFNB 1ZT1B 4K7FB 4KHXL 4HJ0C 2WWKT 3GMOA 4GS7C 2KUTA 4ZXBA 4L4JA 4MJIE 5LGJA 1OM3H 4F7EB 2IBZX 5IBTH 1IM9B 4N8PA 2AQ3A 3DWTA 4FS0A 4TNVK 5E1AA 1WV7T 3MRDB 3RWCA 4XNZB 1MHCB 1I7RB 1TXKA 1G7QB 5ESVA 4DZ8A 5DJ6B 1A14L 4WDIA 1VGEH 4UU9B 2A6JB 2P8MB 5GXBB 1D5MB 3IFLL 5IBUG 5TDNA 4HG4K 1YECH 5C09D 2C9AA 1VFBB 2PW2A 3D0LA 1A64A 5GSVA 1NLBL 2IGFL 2WUBL 3CVIL 4TVPL 4KRMB 2B1HL 1HXYB 1KFAL 4YHOH 4RDQF 2DQEL 4ZFZB 1I7TA 2QQKL 4YDLC 4KJWC 4AT6B 3R0NA 4NN6B 5ITFB 3KYKH 1WAAF 2AJYL 1T1XA 2AKRA 3GMLA 1AXSB 1UZ8B 1NCUA 4XPFL 3QEUB 5IKCB 1UWXH 1DBMH 4BJLA 4JRXE 2E7MA 5KW9H 1I8IB 4LCIH 2HRLA 3IFOB 1VCAA 1KCVL 3QAZC 2OTUB 1S78D 3U7YL 2W0FA 2A6DA 3HRZB 4L1DA 2GY7B 4MX7A 3C5JB 4AJ0A 2YBRA 1A6AB 5FGCB 4P2YA 2JIXD 4H0HB 4R4NC 2QR0B 1YEFH 5IHUL 5L7XH 1FJ1B 2E7CA 3WNOA 3TV3L 2A9MH 1KUMA 4L4VE 2VE6A 4WNQB 4XWOD 3TJEH 4P2RA 3MRLA 2X09A 1D7FA 4JHWH 5DRXB 1JPSL 1PKQB 1N26A 1JZ3A 4JFEA 5HGAA 3NACH 4MAYB 1VEMA 5K59E 3HC4H 2BSRB 3BEVA 1EJ6A 4G6AC 4P5MB 3P4LA 3MODH 2IADB 4G5ZL 4X5LA 4NP4H 2IEPA 2HLAA 3BQUC 3KPRB 2Y7QA 1YY8B 3P40A 4XC1H 5J9PB 4U1IB 2Q8BH 1M1SA 1P6FA 4M7LH 5HHME 1LO2H 2X9XA 4D0DA 2AJZB 4OZIF 1FFRA 1N5YH 2G9HA 3MLWH 2V2XA 3B9EA 4GAYA 4K55A 2BOBB 2PXYA 2NX5E 4R6UA 2BCKB 3T2OA 3VWKA 3FOMA 1JNNL 4P4RB 4ZFFA 4H0GA 3FB8B 1CGVA 4KUCD 2G5BA 2JKXA 4MCZB 5CCKH 1A7PL 2DJSA 1MHPH 2V2TA 1YNLH 1CQYA 3ARQA 3ME0A 4NZUL 4LCWE 1JTTA 3O3BB 3C08L 3WIHA 2E8YA 2VDRH 1DN2A 1J1OH 1E6JL 4PJBA 2VKXA 1S7TA 1KCSH 4WY7H 1HHGA 1JVKA 5KSBF 2VLKA 3CZJA 4PREB 3W2DL 2C3HA 3ULUD 5I30H 3SE4A 1S7SB 3G04B 3TFKD 1EGJL 3HZYB 4MSWA 3BZEB 4ONOA 3W9EA 3SOBH 4QWWD 3CDCA 1G6RB 3BGFB 4DCQB 1CE6B 3LB6D 3MRJB 4M7LT 3FFCB 3R4DA 4BH7B 2Q3AA 3R8BB 5MENA 5LCVH 4UINH 1S7RA 1IMHC 3WN5C 1UH4A 3MACH 4Z7QF 3MREB 4MA8H 5KSUB 1GZQA 2BJMH 2QSCH 2LAAA 4WO4D 4I18C 1IM3B 1A3RH 3NZHL 3IJSA 3O6FA 5IHBA 2GI7A 3ARBB 1PZ5B 3EHBD 5BCAA 3VXMB 3ES6B 1R24B 3OKOB 1NQBA 1JPTL 5ILTH 2CRIA 2VXQH 4L9DA 3RIAK 1U8QB 1XZ0B 3D3VA 1NCAL 1T04A 5MI0C 3U6RA 1EIBA 1NANH 3EO1B 4KV5E 1G7HA 3QCTL 1VESA 1D9KA 5FOJA 1AR1D 4WFEE 4F58L 4JO4H 2ZNXA 3QIBC 4Q9QL 4X6CE 1ADQL 5MEOB 4DTGH 2PR4H 1J0IA 3FQWA 3RWEA 3FO0L 5HDBF 5DRNB 5FDYA 3MJ8A 3TJHC 3IDIA 2FRGP 1Y6KR 4Z7VF 4NQCA 3TPUA 1XF2A 3MA7A 4JFFE 3BO8B 4YWGH 4O5LL 3MRKA 1OWWA 1JWSB 5L2JA 4QLRA 3QWOA 1K2DB 1RU9L 5E9DE 3WS3B 4JQVC 1B4JH 2MSPA 2BVPA 4I0PD 4KZEH 5CGTA 1N4XL 3IU3A 4KRPC 4P57A 5DEGB 2AK4E 4APQD 4NCC2 3HE7C 8FABA 5C0CE 5TF0A 1RMFH 3VXUD 1T89C 1XR9B 1GGBH 4RIRB 3MRIA 1R6VA 2K1MA 4MS8D 2KQMA 3OB0K 2ZWLT 4Y2OA 1I1AD 2E27H 3OJMB 4F8QA 1YQVH 1K4DB 1EHNA 5FECA 1CD9B 2W59A 4PJIE 1K8DB 5DD5H 4CL7A 5AZ2H 1KELL 3QUMH 2B8OT 4M6NH 2AXGA 4LHUD 1AHWC 4X7DC 2VR5A 3HZKB 2JELH 3L5WA 4HEPG 1CGSH 2IQAB 2JTDA 3QIWB 4OTXH 4OUOA 2XICA 3CCHB 4P2CG 3DIFB 5IBLD 4PRPA 1AC0A 3EOAA 4QT5A 1I9EA 1QR1B 4PJ7E 4QGTA 1CFQA 1ZA6B 4BA8A 3RVVC 1BFSA 3H0TA 3T08A 2YSSB 3TBYB 5I71C 2A38A 3SDAC 1QSFE 3MNVB 3REVB 2V9QA 1KIPB 3L7FB 5I8OH 5CMAB 3QEGH 3SO5A 2O5YH 3PL6A 2JCCB 4ZFGL 5GSRB 1D6EA 1S7XB 3KXFE 1SEQH 4IRJD 2FJGB 5DI8B 2C7UA 3EGSB 4MLIA 5J1AA 3Q3GB 4OCXL 2GCYB 3RAJH 4Z78B 4NQDD 4PJHF 3STZB 1VPOH 3AM8C 1PQZA 3BN9D 4NZJA 4FQ2L 4Y5YA 4MHHI 5KVEL 1ZEAH 5H94A 5F3BB 4LRNH 1U8JA 1MIEH 3DXAD 3RUGB 2JCCF 1UCBH 1OTSD 5CP7A 3ARGC 4R97B 1UYWL 2BY0A 4P23D 1S7VA 1L7TH 5F9OH 4ODWB 1TETL 3UO1L 2XWTB 4NQEA 1W2KT 3DI3B 5C08E 1EGJA 3HMWL 4LLWA 5IV2B 3LOWA 1AE6H 4UMGA 2FJFB 2VUOA 5D1ZC 5CEZE 2P5EA 4PJEB 4FFYH 1EZVY 2XN9B 2V6HA 5E56A 4U1GB 4U1LA 3NA9L 2JJWA 1ZLSL 3GSVA 3E6HA 3EFFB 4YDKL 5KG9A 4OB5L 5I1GH 3P9LA 4NHCL 2QV2A 5KJRH 3VFMA 5GHWH 3PP3K 2ZJSH 2HG5A 1XAUA 3VRLF 1JN6A 3I3BA 5E94A 3AS2A 2DQIL 4J6RL 3ULVH 4JN2A 3VGAC 2NY0B 4U31A 1F11B 2FH6A 4LF3A 5KN5A 3CDGB 5ISZA 2H2PC 3HI6L 1NAKH 4IHOA 3LRGA 5HYIA 2ZG3A 2G60L 3TBWA 2VH5H 2D31A 5DK2B 3T65A 2L0DA 1JRHL 3BDXA 3O8XA 3QIUD 3U46B 4MAUL 5INCB 5ALCL 1ADQA 3GSXA 4DWHA 2CGRH 3BSZL 4KY1H 4OLWL 4IRSC 4OSUL 4J4PD 5TH2A 4DEPB 3C5SA 1L7IL 3QQ4B 5I8EA 1CE1L 2NY3C 1IGYB 2GT9A 1FE8L 5FO7B 1JL8A 2DD8L 1X9QA 3BW9A 1VERA 3AC0A 2VXSL 4BK4A 4ONHB 3CUPB 4HD9A 3EOTL 1LO0H 2JK5B 4GW5A 2EXYC 4YHPA 5L8JB 5K9QG 4O2FB 3C5ZB 2APXA 4XP6L 2B1AL 4KKLD 2BY3A 5IOPB 4R7NA 3DO3A 3RGVB 1TZGH 4QHLB 2N1KA 3BH8A 1YC8A 2PO6C 5ESAA 4Z7WB 3GBML 3MRFA 3TYGH 4GBXC 2XFXA 5FYLH 1RHFA 5C0IA 4IIQC 2Z4QB 2CRZA 3T0ED 1IC4L 4FMFA 4TUOB 3EYVB 3O6LH 5BO1L 3KS0J 5C2UB 1BZ7A 3SPVB 3V6OA 3QR2A 1L0XA 3BHBA 2VITA 3F12B 3NFPA 1A0QH 1FN4B 3QYCA 3HA0A 4QNPE 5JXAH 3LZFH 3QWQB 4WI9A 5DGQA 3QJFB 5DF0A 4UBDC 5DUMH 4GG6B 5KS9A 5GS3A 2D7NA 4WJ5A 2W60B 1N0XL 2XA8L 1U36A 2UVFA 5TE4L 1XGYL 2EDQA 4XMLH 3NGBC 3WUWA 2UYLB 2QKIB 3MLYL 3MUY1 3F65A 4EQ3A 1M7IB 4XAWL 5ENWA 1AGDB 1PDKA 3RU8L 3VFPB 2IH3B 3TZVC 1PBYA 4OZFA 3CH1B 4PJFE 4RAUB 2APBA 1CICC 3FONA 4H88L 1MEXH 4ZUWA 2DL2A 1P7QB 2A6KB 5C3LD 3DHJA 1MCPL 1KULA 4FP8L 4D3CL 5BMFL 2ZUYA 5ECJE 5GS0H 3MBEB 3W39B 2ZUQC 2X9YA 4EOWH 2VN7A 3G6DL 4MWFB 4JPIB 3A6BL 3MCKB 3QDJB 4FTVD 5E4IA 3WEXA 3KYOA 2YXMA 3QDGD 3IETB 4J7RA 4OLXL 1P4IL 4JY4B 1A4JB 3O9WB 4C4KO 1QRND 4WHYH 3F6LA 1IEBA 2UZYB 4ZSOB 5JW4N 1HH6B 1RV6X 4U6YB 3FN3A 2FEDD 4AY0A 5BV7B 3BKCL 1IT9L 1I9RL 2CUMA 3TT1H 4K71B 1T66D 3HZMA 5D1QD 5I8KH 2ZKHH 3RWIA 1LQSR 3N0PB 1EHLH 1ZE3C 5E7BA 3T0BA 1Z9SA 1VHPA 1H3TA 3B9KA 3GZKA 2BVQA 3CPLB 2D7QA 5FO8A 2YD8A 2ZCHL 3GJFB 4JE4B 4OLUH 3SCMC 4AG4H 3ARFA 3Q5OA 2E7HA 4NWUL 3OHXA 4Y7MA 5DQDH 1KEML 1LNUB 4JPWL 1Y6MR 4OCWH 4JRYA 1PX4A 1YQ2A 1JIBA 3RDTA 3AU1A 3X14B 4HBQA 3EYOA 3IJYA 1U3HD 5HHOB 1RZFL 1SYVA 4E41A 1X7QB 5EULV 4UOW1 4J3TA 2MKLC 3T77B 4MD0B 2D7MA 3DMMA 3T3ME 1RUPL 5BS0D 4YNYA 5FYJD 1F42A 4ORGB 1HWHB 3OAYK 4V2CB 2EE6A 3BGAA 4ELKB 2ITDB 4ZS7L 4FQQB 4XC3L 2W9LA 4I77H 4RAHA 4R90L 2XZQH 2GYSA 3NOIA 4M48H 3VGEA 4HGKC 2F15A 2JB5L 4HUUB 4QTHB 5L2KE 5DJXB 2EO1A 2P8PB 4KJYB 3FL7A 3E6FB 5IB5A 2WV3A 3T1WA 3O4LD 1GCFA 4M6OH 1MAJA 1TTFA 2GFBB 2PTTA 3MOBL 1R5IA 3ZDXF 1J8HA 1KENH 1M6OB 1MREL 1YY9D 2DMBA 3GKWL 4P3DB 4RGNE 4WW2C 2C1PA 5DTFB 3LPGA 1G6RH 4ZQKB 2NNAA 4W70A 5HHXH 1KXVC 1U58A 4TPRH 1P4BL 5D7JC 5C0EA 4NC1E 3GMRB 4K7PH 4MNQB 4MCYB 5MP6H 1PEWA 2FGWH 3RY6A 1IKFL 1MJ8L 1X5FA 1MH5A 5HHQA 4ZUSA 2W9DL 1NMCC 2QSQA 4O4YH 4PJAB 5DURB 4AEIL 1A3LH 5F8QC 3WFCH 1XIWC 2CDFB 2NY6B 4E5XA 1FG9C 4JFYA 2F58L 1UT9A 3NAAL 4LRIC 3ABZA 1OWRM 4D0BB 5C09E 1V7NL 3GSQA 4Z77B 3NFNB 4IOIA 5EH1A 1FAIL 2P8LA 4YR6B 3AB0B 2IBBA 3PJSA 2OP4L 5JORA 3AREB 3BZ4A 1IQDA 1TJHL 2W65B 3TO4B 1IILE 1HH9B 3QISA 4XP5H 2OXGA 4UILH 4YEFA 4M7JH 4WI2A 4U6VH 2OR9L 2QTEA 1BEYL 2H8PA 4YDVB 1AI1H 3FRPA 1YDPA 5CZVH 1KTRL 3TP4A 4Q9RL 1HHIA 3LVEA 4TUKL 4IS6B 2NZ9C 3RZCA 1H3VA 4G8IA 4LPWA 2I25N 2VIRA 4ZDHA 1N64L 3IAQA 1ZWIA 2EDHA 5JW5A 2O61A 1P4LA 3TNNA 4G6JL 1QPPA 5EORL 4Z7UA 3BH9A 1SMOA 1MRFL 3O3AB 5HVFB 2HH0H 4DFIA 4FQ1L 5CJXC 4NO5B 4XGZB 2FATL 3QPXL 4L8BA 2EDEA 1LE9B 1D5IH 4PLOB 1J1XL 3SDCA 4RFNC 2WP3T 3L5JA 3B5HA 3FN0L 2V5RA 5EN2A 1KJ2L 2WINA 3FFDB 2VDNH 1RULH 1KB5B 1ZGLP 2CK2A 1JHKH 5FM5M 1YEJL 2FX9H 1AC6A 2PYFB 5ACZB 1B2WH 1VENA 4PBWD 4FA8A 3VMPA 1WK0A 4JKPL 3ZE0F 1CIUA 4GMSH 4LL9A 2HKFL 1T5WA 1DN0B 1PLGH 1X6LA 3T1FB 4C57C 1T80A 4UV4H 3WKNA 1AGBB 1CFTB 1NCTA 2J2ZA 2PYED 4JG1L 5F3HA 3QG7H 3H3BC 4F3FA 1K9TA 1NAMB 3PWVB 1Y6NR 3FO1A 4PP1C 3OX8B 3FAWA 3H42L 4MDIA 4K94L 3LKQB 4NYLB 4XP4H 1WZMA 4FG6D 1CZ8H 3PWLB 1K4CA 4ODTL 4H1LB 1IC1A 4PLJD 1TMCB 2I60L 2N56A 3REWA 1FNSH 4IEFB 4EJ1C 3I6LD 3PWPA 2LVCA 1T1YA 1A8JH 2AXFB 1EEQA 2YPLB 35C8L 1INQA 2KBGA 1KF9B 5GRJL 3DGGA 1G6VK 3TBSB 4PJBE 1EEZB 1FNGB 4UTAL 1QOKA 3IKCB 4POZD 1YEDA 4KFZC 4OLVH 4CKVX 1I3RB 5D7LA 4UT7H 1X5HA 3OQ3B 2IAND 4O2CA 3V0VA 2AI0H 5EZJA 2BNQA 1VADB 1DBBL 2GJ6A 3V5HB 3HI5L 4Z9KB 5F88B 3RL2B 4WVRA 4XPTH 3PDOB 5BQ7A 4U2ZA 1PEZA 5I1IH 4XBGA 1RURH 2J8OA 4LGPB 4WW1B 4GKSA 1R3JB 4HIIA 3KG5A 3ORJA 5SWSB 4ZNEA 4Z0XB 4YE4L 1N2RB 5FKAA 4Y4HA 4Y5VC 3QFJB 1Q1JH 4BQ8A 3LSOA 3V4VH 3L3JB 2XG4A 2DLFL 1AKJD 4GRLC 4J23A 1X5AA 3D3VE 2IJ0C 4XMPL 1KPUA 3GHEL 2C3VB 4TNWK 2VXUL 2BVOA 1KLGB 5BZDB 2P46B 2F53B 4N0CC 4F9PA 1AGEA 4G9FD 1IGFL 1MLCA 4HS3B 4JFDD 4XMKH 1A7RH 3FQNA 3VXTB 1VFAB 4FZEH 4XPAH 5GGTH 3CFEA 12E8L 1KIRB 2DYPD 5JHDB 5DMKA 4OZHB 5CEYA 1NUFA 3C8KA 1MCLA 5DZLA 3UBXA 1GC1L 2R39A 4CADA 3MXVL 2MQCA 2Z8VC 4G9DA 1MLBA 4P4KB 1I7ZA 4EI5C 3QDHA 3UTSB 4CVXA 5EIQA 3WSQL 4KK6C 1FGVH 2Z91B 1NJ9A 3WHXA 4ZO9A 2JB6B 1C12B 3JBG7 1V3JA 4OQTH 4WFFD 1A6WH 3HS0B 1BP3B 2P49B 3P2TA 5EIVA 1O7VA 4NM4H 2NCMA 4X5XB 5LXGH 3MSPA 4C56A 2ICES 3VXUE 5E2UL 5T3ZL 2ZOKA 3HUJB 4Z7OE 4HBCH 1OGTB 4JLRB 5T1LD 3DRQB 3JTTB 1Q9KB 3U9PH 3SHSA 5JR1H 3G9VA 1QYGH 3ARRA 4JFQB 3PWJA 5IR1A 1DL7L 4NO0D 5F21B 2WSKA 2Q3ZA 5IROA 1CDYA 1V3MA 2X4UB 3CIQA 3QRGL 4JHBA 2D7TH 4OCSL 1KJ2A 1UWEL 3VG9C 1NC2D 3X3FL 5J0BA 2F5AH 3AY4A 3DETD 3PQYD 4DVRL 2VR4A 2OCFD 2VSDA 1INEH 3HPLB 3TIDA 4WWKD 2B0SL 1BD2A 3I6KB 4I4WA 4PRPE 5F44A 4XBEH 4ZAKB 4HCRH 4OD3H 2I9TB 1TZIA 5C0FA 2D7PA 1GPOH 2R2EA 4MA3A 1S5IL 5T1KB 1Q9WB 3JWOL 2A74B 2AK1L 3VG0H 3V0AC 1WWWX 1VACB 4UIMA 4FQPA 3RGHA 5TE7H 2NY1B 3PWNA 1N5AB 3EJJX 3U0WL 2VJXA 1WBZA 4MD4A 1SHMA 2A73B 3KPNB 2X6MA 1I9JH 4P2QD 3C2SA 1UM5H 4ZPTB 3WS6A 4NO3A 4DKDC 4LIQH 1UVQA 4QHNA 1WBYA 5GS1B 4IMKC 1SVCP 3E0GA 1QFUH 1E27B 3B8SA 3SJVA 1KEGH 5EIIB 4NQDE 1KB9J 4FFZL 1C5CH 5E2WH 3ZKND 3HR6A 3GMOB 5GJSH 1JF5A 1E4KC 2MCPL 4YHIB 4QOKD 3DXAE 3MRHB 1B0GA 4WHTB 4AENB 5LGJB 4B5EA 1U3ZA 1TIUA 3DUHA 4OM1H 4PIRF 3K1DA 5DVMA 5D2NA 5HBBA 3LKSB 4ZD3L 4LEOB 3BD5A 4YLQT 3HAEB 1TENA 5F9WC 3VI3F 5E1AB 1ZS8A 2DQCH 1WZ1H 5ETUA 4BK5A 2V7HA 2QQNH 5F9JA 2DI8A 3RWCB 3VW3H 2AJ3A 4NRYB 1BF2A 5ESVB 1BVZA 4NQEE 4D0CA 1S78C 2F74A 1KJMA 1X5GA 4N9GB 4AQOA 3EOYG 3HE6D 3BKYL 2OZ4L 3T0DA 1V8HA 1KN2L 4GSDL 3CFDA 3D0LB 5CSBA 5GSVB 5DD0H 2CKNA 1FORH 4PJDF 3WL9A 4KI5E 5BV7H 5GRUH 5KSAA 3GBLA 2E9WA 4PRAB 1P5VA 1E4XH 1I7TB 4XWOC 3BP6A 4U1SA 4LHQB 1AQKL 1QLEL 4PG2C 3ULUL 5DJZA 1QBML 4PGDA 1OAUH 3OKEB 4U49A 4CMHC 2GSGA 3OR7A 5K93A 4LSQL 1NMAH 5CD3A 4RWYH 1NCBL 4NQXA 1LEKB 4N0UE 5IW3A 3ZL4L 3UJJL 3LKRB 1U9KA 3NH7L 5EUKA 4NT6A 4BQBA 1LGVA 3NMEA 1WTGT 3M8OL 4BUGA 3JZ7A 3MRQA 2W0FB 2YHGA 1RK1A 1NCDH 2D4FA 7FABL 4MX7B 2CLVA 2XZCH 4WI4A 3GK8H 1S9VA 1K8IA 2E7LA 1G7LA 4YHMH 3H3PL 1I3UA 3SGEH 4Q9CA 1EJOH 1LEGA 4X7SH 1SM3H 4GAGH 3D85B 3MLUH 2VE6B 1OM3L 4P2RB 3MRLB 5IBTL 4F9LC 5D1XB 4U0RB 1HDMB 1UB6A 3WIFA 4IOSD 3BJLA 4JFEB 5HGAB 3HC0A 3BEVB 2RCSH 4PB0H 5EU6A 3GBNH 4HAFA 4X6DE 4JM2A 4ZPVB 4JZJA 3ULUC 5I76A 5LQBH 1N59A 3X3GH 3TFKC 4XXDA 1VGEL 3T0EE 3H9SD 4ELMA 2Q7YA 4V1DA 4QWWC 3QUYD 2G9HB 3LHPH 3LB6C 4GAYB 2PXYB 1GRWA 3BOVA 3T3PE 2YD7A 1KN4L 1QO3A 3CJJA 3FOMB 3VWKB 3LN4A 5IMKB 2BX5A 1YEEL 4ZTOH 4YHOL 2G5BB 2Y07H 4WO4C 2V2TB 4R3SB 1YZZA 4OZGA 3EHBC 3QCVH 3STBA 3JVGC 5KS9E 1QFHA 4KH2A 1FYTD 3QXDB 5E08H 3VRJA 2CH8A 3RTQD 3V79C 5JIIA 4U1HA 3EDJA 1DBML 3F5WA 1HHGB 1OQXA 5HHPA 5KW9L 5DJYA 2VLKB 2NY4D 3GSWA 3VGDA 4NNXA 3SO3C 4Y19A 4H20H 3DROB 3KAAA 1AR1C 3DPBA 2WBJA 1RI8A 1H5BC 4MSWB 3UTPD 5DYOA 4B41A 4ZOCA 3VD7A 5B21A 3CGTA 5FYKU 5MENB 4UIKH 4YDLB 3NIDE 1RD6A 3KPSD 1S7RB 1AP2A 4JQIH 2DS4A 2NW3B 3ELAT 4G3YH 3QDGE 3GIVA 4IBLT 5CZKA 2A9ML 1GZQB 1VEPA 4PYHA 5JLZB 1CDUA 3IJSB 1P1ZA 1MQKL 1XEDA 1QRNE 1BQSA 2ZUXA 1ZTXL 3MODL 4D94A 5TDOB 4I0PC 5ANMA 2ZUTA 3RIFF 3EBAA 4XC1L 1XCTB 1T04B 2Q8BL 5I6XC 4APQC 3U6RB 3LN5A 4EDWH 4HIEA 1G7HB 1LO2L 2QQLH 3W9DA 4LCUB 5ACLA 4ONFL 4MS8C 4O02H 1KB5H 1I1AC 1YA5A 4HKBB 3RNKA 2UWEF 4LARH 1WCBA 1T6VN 3MV7A 3RWEB 4TOYH 2Q8AH 4BH8A 5I1AA 3MJ8B 2IMMA 2MPAH 2OZ4A 3IDIB 2A1WL 5T3XL 1YNLL 4R4FH 3ZTNH 4NQCB 1IFHH 1XF2B 2EDLA 3MA7B 2EO9A 3QI9D 2YPKA 5BRZD 5JA8B 3QWOB 5IF0A 5IBLC 2D0HA 3S97C 4OBRA 1NDGA 4JRYE 5D5ME 2R0LL 4KTDH 1FVCB 2ZUSA 1KCSL 1NAMH 3HG1A 4WY7L 2J8UB 2NY5L 5BS0E 4XXCC 4E41E 3MGTA 3MFFB 5FYJE 2BVPB 3IU3B 1H8SA 4P57B 4EIZC 4HH8A 3ARDD 3PGDA 3NN8A 4AM0B 5F7YC 1I8KA 2X42A 1MI5D 3MRIB 1MJJB 1GAFH 3L3DA 2EE9A 4P46D 5HYQB 4F57H 4UINL 3GDBA 3P9MA 1KNOA 5DHVA 1NEUA 4U6XA 4XCFL 5B38B 5FECB 3O4LE 4J2XA 3MACL 1YPZF 3KYNA 5GGVH 3QHTC 5DHXB 2BJML 2QSCL 1QLFA 4RMQA 1IE5A 2AXGB 1OAKH 4IRJC 1A3RL 1KJVA 4TSCL 5KZCB 1OW0A 3VD4A 1OGAD 1MWAL 1CD0A 3B8YA 4WTWA 1T7YA 4WGWB 1J8HE 4X4ZA 1I1CA 2G75A 5IFAH 1LEIB 3BN9C 4ZS6D 3TCLA 2VDOL 1M05A 1E28A 3Q6GH 4QT5B 5BXFA 4OI9A 3ARUA 1H5BA 3S35H 4KMQA 2YPVL 1CFQB 5DD1H 2IC2A 1OTSC 1Q94B 3H0TB 2MNUA 4P23C 4JO4L 1EVUA 3OZ9L 5E5UB 3OKLA 4GLRI 3T09A 4EN3A 1XCQA 4DTGL 2PR4L 4OAWB 4G8GB 5FFLA 1J7VR 4PRNA 4JY5L 3KLSA 2YRZA 4I18B 3PL6B 1FVDA 5C2BH 5EOTB 4PJGA 2AQ1A 3IDXH 3OV6A 3IDJA 4ODHL 1LK2B 3QWRA 2XQYG 2HN7A 2JLLA 4PGZA 2DQUH 1DVFD 1OF2A 3FB5B 4KU1A 1MHEA 5J1AB 1YEKH 1NH6A 3LMJL 2ERJC 1CFVL 1SJXA 3OF6A 3PABA 4KJQD 1EMTH 3V5DB 1R3LA 4XWGH 3PHQA 5B8CC 1OT1A 2XWBA 5J6GA 1E6OL 1U8JB 3CC5A 4M6MH 3QIBB 5FHBH 1KBGL 2H9GA 4I3RL 2YK1H 2YXFA 5CP7B 3VFTA 4BQCA 2E27L 1TJIH 3BD4A 3F7RA 2H1PH 3QIUC 4FQCH 4LLWB 2EICA 5I1JL 3BDYL 4JG0L 4F80A 2F8OA 4LEXL 5J06A 4QRRB 4L8DA 5EZIH 2P5EB 5GRVL 2FIKB 3BKJH 3RWGB 4AL8H 4J4PC 5FF6A 3ZYZA 3U9UA 3WFDL 2JELL 1CGSL 1U8OA 3ARXA 1GGTA 2VABA 2R4SL 4CVUA 4LLUA 3E6HB 1INDH 2P5WD 4RBPH 2APWA 3P9LB 3VFMB 2Z31D 3HE7B 3VXPA 1FGNH 1FL6B 1FL5A 4L8SA 1JN6B 3G6AA 5E94B 1RIHL 1AJ7H 1HNGA 4JN2B 1RZJH 1DLFH 3R1GH 2DIJA 3MOAL 5TGBB 4LFHG 4KKLC 4YXHL 4OF3A 5KN5B 4GW4A 5ISZB 4JY6A 4P59H 1HQRA 3N9GH 3CX2A 3QP3A 2PYEE 4IHOB 4LDLB 2J12B 3UXFA 3LEYH 3TBWB 4F7MA 5SV3A 3CFCH 4DGIL 3QEGL 4JPKL 4DAGL 1VGKB 4S10A 3U4EB 3T0EC 3HMXH 5CBAA 4WV1C 1SEQL 3NTCH 3CNKA 3S36H 2X9WA 3C5SB 1AXIB 2QHLA 5I8EB 3CMOH 3MNWA 1FRGH 2MHAA 1QBBA 3RAJL 3DNKA 5CHNA 4G7YH 3LV3A 1RZKC 1VPOL 2R2HA 4TULH 4ZO7A 3BW9B 1MCOH 3I6LE 4HJJH 1VFUA 1KPRA 3SDAB 2HFEB 1WIOA 4DK6A 1HCFX 5AZEH 3ZT7A 1UCBL 3FN9A 3RWDA 4YHPB 2HT4D 1A9EA 1X4ZA 4NKMA 1AO7D 4ENED 4R7NB 1L7TL 4GXVH 1RJYA 1MF2H 2XTJB 4NKDA 1U92B 4NNYB 2IANE 5ALBH 1OSZB 5ESAB 4OFYA 5KVDH 4ETYA 1AE6L 1JNHB 1AY1H 1Z6JT 3EYFB 4LGRB 43C9B 1WCQA 2XFXB 2ZUWA 3O3DA 3GM8A 2VDQH 3W0WA 4E42B 5C0IB 4FFYL 1MCJA 4K7PY 5GIRB 2GJ6E 4ZUUB 2VWEC 2AXJA 3DSFH 1AD0A 2VZOA 3TIEB 4LCCA 5I1GL 5KJRL 5C0AD 4NN7B 5JDSA 2XNAA 3NFPB 3UDWC 3HAEH 3W5MA 4K8RD 1MWAA 5GISH 1QD0A 2BP3A 4Q6YA 4WJ5B 4FZ8H 3EO9L 4NKIH 1NAKL 3ESVF 4PJXA 2FLRT 2HT2D 1S7QB 4PJ9D 2FEDC 5D1ZB 3UPRB 2BNRD 5LWYH 1T66C 4OZFB 5D1QC 5D7SH 1EHXA 3I2CH 5AAWA 4DN4H 3BYYA 3FT4A 1ZANL 4ZUWB 4Z7NE 2MKWA 4Y8AA 3WO4C 1PG7X 1KIQA 2DBLH 1F6AA 3SQBA 1NFKA 3AS0A 4U1JA 1JZ2A 1TVDA 2IAMA 5D93B 4Y4KD 4L3EA 3KYOB 2VERN 1T2QL 4WFFE 5D96C 1LO0L 2CQVA 3MLXL 3V4PH 4M61A 3P4MA 5E6IA 5I1KH 4KDWA 1HHHB 4KMTH 1U3HC 4QYOA 3GI9H 3RFZC 1IEBB 4G7VL 3MLZH 3TESA 3BIKA 5DJDB 1IEAA 3DX7A 4KPHH 2DM2A 3UTTA 1S7WB 3CXDH 2R2CA 3TYGL 2HRPH 4PV9A 3WFBH 1J1PH 1K3IA 5FYLL 3HZMB 5DJ0A 1BOGA 3LPFA 3RZWA 1HILB 1I8LA 3RWIB 3X13A 5FA3B 1EEYA 3X11A 4RX4D 5K59F 5A43C 1C8PA 3VE0A 4PJ5A 1R3KA 2APFA 3B9KB 2BVQB 2VLJB 5FO8B 4DVBA 3VGFA 2C1OA 5JXAL 1Q9OA 4EKXA 3E3QE 3PQYE 2AJXH 4J3UA 5HPOA 5A1AA 3F58H 3QCUH 1HYSD 4ALAH 2DQDL 2ZG1A 3OHXB 4OD1L 2PTVA 1ZLUH 1BZQK 1YY9C 2OR8A 3V95A 2QSVA 2FL5A 4PGCA 3AU1B 5I1EH 5HD8D 4KTEH 4YFDB 3IJYB 1QFWM 1MFAH 4DOHE 2R4RH 1HKLL 4JJ5A 1LDPL 4PJCA 4ODSH 2Z35A 3QEQA 1XGPA 4GXUM 4YNYB 3TO2A 1OOAA 1J05A 2M8XA 3KYAA 3UZQA 3EDEA 1U93A 1W0VB 2IG2H 4HDIA 2YN3A 5F96H 2AABH 1H8OA 1E4WL 5GS0L 1XR8B 2EDRA 3KLDA 3TC9A 4MD5A 2HVKA 4EOWL 4KXZH 1DBKL 4PJ8A 2FJHB 2APVA 1A6VH 2BHYA 2X70A 3SJVE 1TQBB 2UUDH 5CILH 1F13A 2W0PA 5JNYA 3KJ6H 4XNXH 3CXHK 3NPSC 4XHQA 1T03L 1DSFH 4YC2C 2Y23A 2CJUH 1ZVHA 2VISA 1ZA3A 4YQXH 4ODXA 2X4PA 3WFEH 1CICB 4FQHB 2NNAB 5FGBA 1IC7H 4LAQL 3HPJA 1U58B 1JZ5A 2X89A 3P0YL 4LSVH 1A6TA 2ZKHL 4D9QD 1G9NL 1A1OA 2MTPA 1EHLL 3C6SB 3EDKA 4N0YH 1MH5B 2CPCA 4S1QH 2CLRA 1DE4A 3DO7A 2HKHL 5D70L 4GRWE 1DDHA 4KHXH 2B4CC 4HQQH 3SDXA 4IOIB 4TVSa 4QO1A 5F7FA 4KV5F 1GSMA 3PJSB 5E00B 4OCLC 5JMRA 4K9EL 5DQDL 1QFWL 3T4AB 1IQDB 2IPUG 4OCWL 4X6CF 3WJLC 2H45A 2EE3A 5GGRY 2RGSA 3CFBA 5LJYH 1BFOA 2H8PB 1YNTB 1YDPB 1A14H 1T22B 3ULVD 4QRSA 4CRPA 2NXYD 3SGDH 3VD5A 3GJEA 4PBVC 3RZCB 4G8IB 3IFPA 2VIRB 4ZDHB 3IFLH 4I77L 1ZWIB 2BXZA 2XZQL 2O61B 1P4LB 4JZOA 5CKAA 4Z7UB 5CJ8A 3BH9B 4PY8J 3H3KA 4HUXA 3CVIH 3SCMB 4TVPH 4MA7H 1CD1A 3F8UB 2B1HH 1MOEA 3MV9A 3P9WB 2I9LA 3OTTA 2DQEH 2QQKH 4GLRH 4L8BB 1F3RB 1G9NC 1FNFA 3SDCB 1T5XA 4P9HC 3QEHA 1KENL 2P45B 3IDNA 5EN2B 2EKSA 3QDMA 3L9RA 1EBAA 1CGXA 4ZO8A 2JJTA 5DJ8B 5DT1H 4YPGA 3SDDA 4FG6C 3D39A 4PRID 4WWID 4PLJC 5CJ5A 1U95A 4Y16A 3VFWA 4F7CA 3LS4L 4PJIF 4NHUA 5HHXL 1KCVH 1JGVL 5J57B 2FH8A 1T5WB 5MP6L 1PY4A 3DI2B 3HLAA 3HNSH 3VFNA 3WXWH 3ZKMD 4POZC 4O4YL 5T3ZE 4WUUA 3H9SE 1DQQA 3WNMA 4FABH 4XCYA 1RZGA 2F54D 1ZT1A 2ED7A 4K7FA 4U1MA 4BQ6A 2AJUH 1KCLA 3MRMA 4YDIL 4PJ7F 3T2PA 3FO1B 5FYKL 5L9DL 1KLUB 1QSEB 2DWDA 4PTUA 1JPSH 1NEZA 4MDIB 1BAFH 1S9WA 3OGCB 1JGLH 3C8DA 4WW2B 3O3EB 5C0BB 5B39B 1IM9D 4PLKD 3HR5B 4G5ZH 2X1XR 4YEEA 1I7RA 3LQAL 5DJ6A 1WAAA 3REWB 1EA9C 4J1UB 3OL2A 3PWPB 1T1YB 2A6JA 5DD3L 1S3KL 1INQB 1NMCB 1J11A 3HC3L 1F90H 1ULVA 1XIWB 4OI8A 1GGCL 2ZNWA 1VFBA 5E4EB 1JNNH 2LE9A 1MCSA 1CI5A 1YEDB 4Y19E 1HXYA 5D7LB 1IGML 4O2CB 1A7PH 1YYMH 4B53A 2BNQB 4AT6A 2DQHH 4NZUH 3C09C 2P24B 4JFPA 3C08H