1A6ZA

Hfe (human) hemochromatosis protein
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
272
structure length
272
Chain Sequence
b'RSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HFE
publication title Crystal structure of the hemochromatosis protein HFE and characterization of its interaction with transferrin receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Mhc class i complex
total genus 61
structure length 272
sequence length 272
chains with identical sequence C
ec nomenclature
pdb deposition date 1998-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a6zA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1a6zA01
1AGCA 3C5ZC 2IWGA 1B9ZA 2H3NA 3X3GH 1UZ6F 1QEWA 1RURH 2XXCB 4R26H 3GDBA 5FYJU 5HDBF 2LTQC 3C6LB 3OJMB 4OKDA 3SJVB 1MHCB 2Y9RT 5B21A 5C0AE 3RDTA 4CL7A 1WZ1L 4NQDA 2E7CA 5EO9B 4WY7L 1RHHA 4XCFH 3OKNB 2XQBH 1B0GA 1OW0C 1T22B 5ICYA 3GUTA 4D0DA 1IEAB 4LFHG 1UGNA 4NQEA 1FNSL 3LOWA 4QRQA 3QIUA 1UWEH 5HHOA 5KS9B 2HJLB 3CU7A 1YQ2A 4S1SH 4YUEL 2EDOA 4NC1C 5B3JF 4ONFH 4XWGL 3L6FA 3ZYOA 4J7RA 3V2AR 4P2RD 4L4VA 3KPMA 4L9LA 1VACB 4LVOC 2GEEA 1ZAGA 5J12B 1CXKA 4YDKL 5CBAB 1IEHA 3FRUB 1N5AA 2R9HC 5LG1A 2LVEA 2VDNH 4JKWA 4JY5H 4LQFH 4I4WA 4IJ3C 1MNUL 1R3LB 1B4JH 1CFNA 2AK4A 5EZJB 1DEDA 2EECA 2XTJC 4KUZH 3T0WA 3RVVC 2A9MH 4MA8H 2I24N 5DUML 5EPMA 2HVKB 4FFVD 2ESVB 2PO6C 4U6XA 1PY9A 5AZEH 4HC1A 2VJXA 5I76B 3I6LD 3LQZA 1NSNL 5FCUL 3OHXA 4CGTA 4U2YA 3TBTB 1GRWA 1JGEA 2FRGP 3HS0B 4GUPB 5IBUG 3Q5OA 4JFED 1U8IB 2VH5H 4JCLA 4O2EA 4YHZL 1MCKA 3P9MB 5I1AB 4N0RA 4D9RE 5F6IB 1PX4A 4P2QD 1CQKA 1Z9OA 1Z3GL 3V6ZB 1BLNA 1KIUA 4GH7B 3H6JA 3IJYB 1BZ7A 2ZCKH 1NCAL 1J8KA 4X4XB 1RI8A 4Y4KA 3I2CH 2VUYA 2JLLA 3LQAH 4G42A 4X7SH 2EDNA 3VGHA 2Z8VC 4U6HA 4JAMB 3GSVB 2EH7L 3DX8B 4ONGH 4Y5XC 3DROB 4M5YL 3GB7A 2VIRA 4D8PB 2QTEA 3NACL 3MTRA 4AT6A 4G8IB 2XNAB 5C07B 2W91A 1QLFB 4FG6D 5B22A 1JWUB 4POZC 1V05A 5ERWB 4RMUA 2ZCLH 1UQSA 1KJ2H 2V9TA 1H8NA 3T8XB 5D6CA 5DJYA 2IMMA 1WGOA 5T33L 4YIQA 1KCRL 3D85A 4NBYB 4DGYL 3UC0L 4HMEA 3RZCA 4Y2DB 1GXEA 1QP1A 4HIJB 2XYCA 1ORSA 1DUYA 3PWPB 4Z8FL 2Y7QB 1I7TA 4OLYH 1NMCC 5E8OB 4E5XB 5SWZB 1IAIM 4KGLA 1I1FA 4N0UE 1FJ1A 3FT2A 1KLGB 4HUKB 1RJLB 5JZ7C 3F7VA 5GGSY 3CFDA 4YHPA 3MBEA 4KQ3L 4WY7H 5HHXL 3MGOA 3DX9A 2GY7B 2CK0L 1OTTC 4XBGA 1QQDA 3FT3A 2F74B 3ALXA 1H15B 1OAZH 2OJZH 5CEXA 2YC1A 3VCLA 5BS0B 1H3TA 4RMVA 4P3CL 2Q8BL 4YUEH 4JFDA 3FQUB 2N56A 3QUZA 4PJAF 4XWGH 1EFXA 5TF0A 2UWEE 1T66C 1MWAL 2HFFB 3MV9B 5DF0A 4FQXC 4XCCL 1L0QA 4XVUC 3S7GA 4LDLB 1LP9B 3GO1L 1V7NH 1AGFB 4JY4A 2V2TA 4ZFOL 3V8CA 3VWJC 1BFVL 1MNUH 5TDOA 1RVFL 1GZQB 4NGHL 2X41A 3OKOA 1S7QA 2CIIB 3MRIB 3QXAB 4KU1A 1JYWA 4BKLA 1TMCA 5DUMH 5CKGA 4OB5H 2WY3A 3B4NA 1KCLA 1EZVY 2AP2A 5T1LD 4MXVF 5FCUH 1RMFL 5E8EA 3CVHL 2NY5C 1S7UB 5IMLB 1EGJA 4W6YB 3LKPB 1IVLA 1JWSB 5DHVB 1JUFB 2LU7A 1FZKB 4YHZH 1MCJA 4QRUA 4KKCC 2VDPL 1IKNA 3FB5B 3O3DA 1ACZA 4JFFB 4WO4D 2VKXA 3HTLX 1CU4L 4DVRH 4P23D 5GS0L 1Z3GH 5FYJD 4AIZB 2VZTA 4RQQA 5DUBB 5HXMA 5B8CC 1KPRA 2ZOKB 2P1YA 3QXDA 2ZG1A 1NCAH 1E4KC 1G7PA 4F37K 2EYRB 4HKXB 4LSRH 5CP3A 5IBLD 2NPLX 3V5HB 2E9JA 1EHLL 2NY6D 4QHUB 5JLZA 5EUKB 5J6HB 1MEXL 4GW4A 4X6DF 3S3SA 1DSFL 1IMHC 3BPOB 3P4MB 4OLUL 2HLAB 3RWGA 2EH7H 4ONOA 5GGQL 1JZ2A 4M5YH 3SGDH 4U1GB 5L0QB 5IVZB 3NACH 5H35B 1MLBB 1ZVYA 4OLVL 3LIZL 3Q2CA 4K7PX 4QCIB 5JW3H 5E5RB 4KDTC 1WSST 4XI5D 5I1IL 4BQ8A 5FXCH 4JFHD 5T33H 1OQOA 4DGYH 1W72B 1WC7B 2CDFB 2A38A 5BXFA 4G6JL 5D1ZB 5TDNA 2HT4D 5EO0B 5I1CL 5EBWA 4HWZB 4Z8FH 5EBLA 5C0EB 3UDWA 3ZHDA 5F6HJ 4Z78A 4V2BA 5DJAB 5F3BA 5JXED 3WUZA 3QEUA 1CICC 1CGYA 4JPIB 3FCTB 5KOVC 4KQ3H 4DGIL 2A73B 5HHXH 1NJ9A 1N6UA 5HYSB 3L5IA 4F7CA 3BIKA 2CK0H 2W59A 2ADJB 3MGTB 2OTUB 4APQA 1GGCH 4E41D 3ILQD 4YBLB 4LLDB 4P3CH 2Q8BH 5JDSB 1FGNL 4ALAL 3KYMA 2P46B 4GKZB 1ZVSB 3D9AL 4CMMA 3X11A 1MWAH 3SKMA 4XCCH 4KKNA 4HWBA 4ZXBC 1FFNA 3ULUD 1HZHL 4J4PD 4LPVA 4GW5B 1XGUA 4HIHA 1BFVH 3WD5L 4G9DA 4NGHH 1FQ9C 2R0KH 3RJQB 1A4JA 3GSNL 4R4ND 3HG1E 2ERJB 2GQHA 3VWKD 5E1AA 1I3VA 4IDJL 2KKQA 3SKOB 2G9HB 4FFZL 3RY5A 4OZGE 1WTLA 3QNXA 4LGPB 3O9WC 5D6DC 1CS6A 3DX7A 4HIIA 1F6FB 3CVHH 4U3CA 5DJ2B 5FF6A 4HG4K 2K9UA 5DVNA 1DN0B 2JB5L 4NYLB 4F8QA 4YX2L 3CSBA 1WCBA 5DC4B 1MCQA 1LO3L 4WTZG 2VDPH 1TVBB 2ICES 3V95A 1CE1L 3MRBA 5HVWA 1CU4H 2GSIB 3MR9A 3VRLF 4QEGA 5GS0H 4QYOA 2YPKA 4TSBL 5TJWK 2OSLB 4PV9A 2WQRA 1AO7B 2PO6A 1I3RA 4G6FD 2ICEB 2VAAB 5TQ0L 5KSBF 4HDIB 4JEGB 4NN6B 2Z8RA 3OB8A 3DPBA 4N1EA 4YHLL 1IGCL 1MEXH 4L1HA 3UCRA 1KV3A 2LE9A 4OLUH 1U8PA 4OCRL 5HYJB 2R1WA 3R0MA 3I3EA 5DA0B 4HKZB 4UIMA 4MS8D 3IAPA 4OLVH 1SJEB 3RWCA 1JWMA 1CFTA 5KVDH 3HKFA 5MEQA 5MENE 5J13C 1CQYA 2BP3A 3STLA 5EDXA 1YN7A 2FLRT 4Y4FC 2VDLL 5E6ID 1QSEB 5I1IH 3FAWA 4OZGA 2FBJL 5CP7B 3BE1L 5KS9F 1G7HA 5J1AA 3ARVA 2D7NA 1TCRB 4G6JH 3ZKMD 5F1KC 3A0OA 1YN6A 4QTHA 1FIEA 3BWUC 3PUCA 3CD4A 1QPXA 4JRYB 4HK3J 2HJKB 2KQMA 3PL6A 3MFFA 4LLUA 3EOYG 4LSTH 5DRWA 5JW4M 3MRGA 2HT2D 5BV7L 5FUCE 2FX8H 1UVQB 5I18H 3ZHLA 2C1PA 3THML 4N68A 4DGIH 4RAUB 1C7TA 2NY4B 2V2WA 1WFTA 3MLVL 5ADPL 3JV4A 5DLML 2BNQD 3HC4L 1A64A 1FYTD 3DRQB 4WI5A 4Z7WF 3MNWB 1KJMB 2FYYB 2WBWB 1I7RA 3DIFB 4PS4L 5FAAA 1M7DB 2QQQA 4GS7C 4MB5A 1FGNH 4HFUL 4ALAH 5L2KA 4X5XB 3D9AH 4HC1L 3NZHL 4QRPE 3QNYA 4JG0L 1P4LB 4PJCB 3LV3B 5IEHB 1N4XH 4C83B 5I73C 5DD3L 5BRZB 2CUHA 3MV01 5MENA 4YE4L 4PJHB 3WD5H 5KSAB 3SE8L 1KBGL 1HQ4A 1BX2A 1CL7L 2HH0L 2PXYC 3GSNH 4OQ1A 2P5WD 5IV2A 3H9ZA 5JQHC 4J8RB 3TYGL 1T5WA 4IDJH 4X7TB 4NDMB 3L7EA 1CXEA 2EXWC 1MCWW 3K8LA 4I2XE 3LKOB 5HGGS 1QRNE 1A5FL 1A1NB 2DIBA 2NY0B 4R8WH 1D9KC 2JB5H 4YX2H 3NVQA 4NN7B 2J8UE 3SGKC 3NZ8A 3T0BA 4EN3D 1FNAA 3VWJA 4QHMA 4G6ML 1S78C 1CE1H 1M7XA 3P73A 1DQQB 1WBZA 3JTSB 3MA7B 4JRXB 4TNVF 1U42A 2B5IB 1QSFD 4Q9RL 1IGYB 4GXVL 4TSBH 1ZHBA 4YNYA 1N3NA 5FV2A 5DFVD 1JGVL 3FFDB 4XCYA 5TQ0H 1HDMB 4HUXB 4OV6F 2YN3A 4AZ8A 4TOYL 4ELMB 3B9KC 5GGRB 5ESQB 5IQ9A 4YHLH 4PRAA 2X9YA 1IGCH 1FL6A 2XA3A 2EC9T 2QKIA 4QRPA 2NXZD 3AGVA 1HIML 4FTVB 4MD5A 4JFYB 4GRLC 4X4ME 3KPRB 1AHWC 1I9JL 3IFLL 4WJ5B 1FNHA 4D0BB 4KMTL 4OCRH 3CX5J 4YHMH 4HW6A 3L3DB 4PTTA 1V7ML 4JO2L 3QCVL 1N8ZA 1XGRA 3MGAA 5B8CA 3NCJL 4U1IB 5F7WC 1OTUD 2VDLH 35C8L 1I9RL 3PWLA 5FA4B 2FBJH 4I2XA 5DHXB 1G9MC 1QRNA 3BE1H 1EUTA 4PGJA 3OZ9H 3VFPA 4WW2A 2J8UA 3SDXB 5TGBB 4HULB 5T1MA 1K8DA 4IEFB 3V6FA 4ZG1A 3M1BB 4LVEA 4WDIB 3KPSA 2H2PC 5KANI 3UEZA 5BV7H 3U0PB 1NCTA 3QIBC 3THMH 3D18A 2B39A 5ADPH 3MLVH 4HKBB 4TVSa 5FO8B 5DLMH 1WFOA 4L3AA 3HC4H 2A83A 4JGJA 2EKSB 4PS4H 2CRYA 1WTGT 5FFLA 1G7IB 4X5LA 1MCDA 1Q94A 3C09B 4HFUH 4X4MA 1UWGH 3DVGA 1FV1A 4H88L 4NRZA 4UT6L 2FZ3B 1OF2B 4HC1H 1MJ7L 3TCXA 2CRMA 2DLFL 4JG0H 5J9PA 2ZUQB 1CICA 4NKOB 2Y1VA 3HZVB 1EGJL 5HYSG 3S37L 4M6NH 3WUWA 4YE4H 4JPKL 4AL8L 5HJ3A 1DANU 3SE8H 3CPLB 1KBGH 1CL7H 2HH0H 1F90L 4ELKA 4R4BB 4P2CG 2FHFA 3D39D 4FRWA 4K7FA 3VE0B 2X4SB 2VKWA 1A6UL 3TYGH 3ABZA 3DV4A 1I85A 2DQTL 3ESVF 2GCYA 4MGXA 5AWNL 1A5FH 1QSZA 4OD2A 5HHVL 3KYKH 5C2BH 3KPNA 5FYKE 3T04D 3D25B 4MNQB 1JHLL 4M3JA 2E7LE 5MEPA 1KEGL 5C9KA 3X3FL 4LLQB 4G6MH 4P5TC 2IF7A 4QWWD 1MOEA 4JFXA 4F7EB 4RSVA 4JLRA 2VZOA 4Z7QE 4LNRB 4FQPA 1TJHL 2WK2A 3LEVL 4Q9RH 4FZ8L 4GXVH 4KK6D 4TNWF 5DJDA 1JHTB 1NCCL 32C2A 5IFJB 2VLKA 3KXFE 1OARL 3O9WA 4NQCB 4TOYH 1BFSA 1LEGB 4WWKB 5HYIA 3QBTB 1GZPB 4O51A 3BD5A 1HIMH 4QRRE 3BEWB 1I9JH 3O8XC 1B88A 4KMTH 2WV3A 1OAKL 3BH9B 4UINL 1V7MH 3DWTA 4JO2H 3QCVH 2QADD 1AP2B 3EGSB 4L1DA 3TVMD 3EYVB 4LAJH 3NCJH 1RUKL 3P0GB 3RTQC 1L7IL 4ZOBA 4KHTH 3ZZ1A 2D2OA 3U83A 1I9RH 4O2CB 2XQYK 3AMLA 5B39A 1C1EL 1AD9B 4H26A 3QUKB 2D9QB 2E7LA 5C0CD 5ACLA 1HXYA 3MA9H 1VFAB 1FVCB 4ACPA 4PJBA 5D1XD 1NUFA 3QFJE 3P11L 5HHMB 3ZO0A 5DMKB 1VFOA 3REVA 3HI1A 2VWEE 4Y4FA 2E3VA 4HWBL 2V2XA 4XP6H 3KXFA 2F54A 2AXFA 4XPGH 5F93C 1TTGA 1KJ2B 4GMTL 3STZA 2EYTB 4L29A 4I0PC 4ZXBB 3KYAA 4QRRA 4PJEE 3K2UL 1FL3A 1IAOB 2YD1A 2R56L 1MJ7H 3VFSB 2DLFH 3OR6A 3LSOB 5DC9B 1LWRA 1GHFL 3S37H 5IW6A 1FPTL 1JZ4A 3B6SB 5K9JL 4AL8H 1QBBA 5HGBA 1R24B 4U1SA 1F90H 3NIFF 5KTEL 2Y6SC 4MB4A 1A6UH 3WHXA 2DYPA 2BVYA 1GCFA 2DQTH 5ISZB 5AWNH 3JVGC 3O4LD 1T1ZB 5HHVH 5BZDB 2DLIA 5DUPL 4ODXA 3ULVD 4FXKB 4S1QL 4PJGA 5CP3H 5GSRB 1EO7A 1P1ZB 1ZT1B 1F2XK 3CSGA 1KEGH 1SMOA 3RWIA 4S1DD 3X3FH 4DEPC 2NXYC 3PIQB 4G8EB 4HIEA 3SDDD 4LPCA 1TJHH 3LEVH 2PXYA 4FZ8H 3H9HB 2IGFH 3F8UB 1SJHA 1NCCH 43CAB 3QDGE 1QVOA 4MDIA 3K4DA 3MODH 4EI5C 4X9FA 1OSPL 4TULL 2BNRB 1NBQA 4PJEA 2XPGB 1G0DA 1D9KA 1ZLWK 1IZJA 4KC3B 1MCFA 3U36A 2WBJC 4WUKH 1YA5A 1WFNA 1IM3A 1QFUL 1OAKH 1RK0B 3KYNB 1PQZB 4PJDB 5ALCL 4UINH 3TH4T 3HE7B 1CDHA 4KZDL 4HV8B 1NCWL 3BH8A 1RUKH 3QHFH 5GS1C 1L7IH 1S5HB 1PG7L 1ZWIB 4AQOA 1H3GA 2UVEA 3TP4A 3UTTE 1JN6A 2YHGA 3VA6A 1M71B 4LCYA 4M02A 2E6PA 4Y16C 3AM8C 5F7EL 4HKJB 4GRLA 4OJFL 4WU7B 1AHWA 1CI5A 2XFXA 3VXPB 1X5JA 2H26A 1TETL 4PJCF 2R0LL 3B2UC 1FFPA 1NFDB 4JY6B 4M61A 3P11H 2GKIA 5JIHA 4PJHF 3PNWA 3A6CL 4PRHE 2OQJA 4HWBH 4NKIL 4ZNCD 2Z92B 3QDGA 2X40A 1ZANL 2W0PA 3BQUC 1G7LA 1DQJB 4OIIL 1HH6B 1YMMD 2Q6WA 4XAWL 2PR4L 3TO4D 1HXMB 5DQ9B 2EXYC 3T0DA 5CKAA 2C3HA 3VXME 1ZGLA 1MCNA 1EO8L 3K2UH 3DX6B 4B0MM 2R56H 1JPSL 4MXQC 1WAAA 3R4DA 3ZKND 3QIBA 2R0WL 3MV8D 1GHFH 5DVLA 4J1UB 3RWJA 1FPTH 4OF3A 3GSOB 2IAMB 1N0LA 1A1OB 5CJOL 3V0WL 1XGTA 2X70B 3FOMB 5C92A 4PLKD 2BY3A 2AQ2A 5E2TL 3KWWA 1OB1B 4CMHC 2DQJH 1A6TB 3C2SA 1KULA 2ZKHL 4RMRA 4Q0XL 5HPMA 5D7LB 2LQRA 1NLBL 4X7FC 3VXSA 3I3DA 5DVOA 3EJZD 2VLJB 5DUPH 1NC2A 3BDYH 3IJHA 4S1QH 3QIWB 4GXUN 3QUYD 3E6HA 1D5BA 1R5IA 1MWAB 4Y4HB 5EUOB 3Q6GL 5FCSH 1ADQA 4JO4L 4LPTA 4JVWA 1IT9L 3IF1B 5J4MA 4NHUE 2ICWJ 3BIAX 3B9KB 3QP3A 2CJUH 5FDYA 1MREL 5BJTA 4ZFGL 4MJID 3HRZB 3X14A 2R23B 3O6ML 2VLMD 4JQVC 4MAYC 1OSPH 4TULH 1LD9A 3PQYE 2UZYB 3VXMA 3SDXF 5IW1B 1H5BB 4KKAD 5AUMB 1I1CA 4OCMC 2I27N 4G80A 3MRRB 4UUJA 4LPYA 5ALCH 2IALA 5KSUA 2X1QA 3DO3A 1EHNA 3LN4B 4ZS6C 3TT1L 4KZDH 2QEJA 4M6OL 1JNJA 1NCWH 1RJZA 3BN3B 1PG7H 5CD5D 1K2DB 2JJVA 1DUZA 3T2NH 5EIIA 1HYRC 4P4RB 4U31A 4X8JA 2NX5D 5SX5H 2IPTH 4ZQKA 5CD3B 1EEZB 2CDEB 1N59A 3HNVL 4OJFH 3WE6A 3C6LD 3SJVD 3N85L 1MCRA 1CT8A 1TETH 1NGXB 2R0LH 2IBBA 2W0LA 4HXBL 1EBAA 4P9HL 1PEWA 3RPKA 4I0KA 2BOBA 5FK9B 4NHUA 4Y1AE 3T4AA 4CVWA 3TBVA 2VC2L 3DVFA 5F89A 3HPLA 4NKIH 4PRIA 5E99L 1XIWC 1IARB 1ZANH 1G7JB 4Q74A 3SGJC 2C4FT 1MAKA 2HFGL 4HCRA 4OIIH 4WHTB 2APFA 5GGVL 3L3IA 4OM1L 3RGVB 3HZYA 4XAWH 3PQYA 3HZKA 2PR4H 5GS2H 2FO1A 5IOPA 1T2QH 3PABA 2G5BB 3H42L 1FZOB 3OKEB 1EO8H 4YK4C 1BQLL 1J0KA 1U8NA 4HWNA 1R3HA 3CNKA 3L3KA 1P7KA 1XGPB 5ITFB 1AKJA 1C5DB 3MBXL 4FQHB 2R0WH 5K9QI 4HK3N 3QQ3A 4Q6IA 1U58A 3VXUB 4O00A 5CHNB 3O3EA 4XPBL 2PTTA 1KCSL 2ESVD 5CJOH 3V0WH 1K4DB 3RVXC 1VENA 4K3GA 2ZKHH 1U95A 4Q0XH 1KXQE 1ACYL 1P4IH 3FZUC 5FKAB 2CKBB 1NLBH 3PWNA 1X5HA 3TF7C 2P42B 5BZWB 4P5TB 4DFIA 3EDKA 3DETC 4LLVB 5CZXD 3SDCD 3IS1X 3KPTA 3B83A 4L3EE 1UB5A 4ZO8A 4Y1AA 2IG2L 3Q6GH 4R0LC 2QV2A 4WNQB 4G8GB 3MRNA 3W0WD 4LSQL 5IROA 2HKFL 3KGRA 3CFJA 2COQA 3DTXA 4XPFH 1MREH 3PWJB 4ZFZB 4L4TA 4NCC2 4ZFGH 2JK5A 3S5LB 1CF8L 2BXYA 3O6MH 3VGEA 5D71L 3MREA 3OGCB 3LAFA 3PGDB 1A6ZB 3OAUH 5L6YL 4JDTL 4PD4J 4CW1A 2XN9B 1HHKB 1INDL 5FDWA 3IDMA 4AQ1B 1CXFA 2X4UB 1QHPA 5AYUL 1FZMB 1YY9C 1LE9A 4ETQB 3JWDL 5C07D 3U7AA 3KS0H 2X4TB 3MRLB 4KKBC 5ID1A 5FYKL 1B4RA 3REWA 1FSKC 2XG4A 2ARJQ 1DQTA 4OT1H 5I71B 3BW9A 3HN3A 3SGEI 4IRZL 3TT1H 1U8LB 5FGCE 3WL9A 4EBQH 3GSRB 4PLOB 3T0EB 3MV7E 4IRSC 4PJXB 1N6QL 4Y2DD 3I50L 4EI5A 4OZFA 4LLAA 2NZ9D 3UAJD 3PWPD 4KFZC 3MXVL 3LQMA 4HIXH 4ZOEA 3HMXH 4NJ9L 4OGXL 5GRUL 3HNVH 2IC2A 3N85H 4R3SB 1S7RB 2ADFL 3FRPA 2YA1A 3NA9H 5GSVA 5AD0B 1YMHB 1VB9A 5LVEA 4HXBH 4P9HH 2Z8SA 3K8KA 1H8OA 3RVUC 1AGCB 3MZGB 3S97C 5ID0A 1YY8A 3T0AA 4LSSL 1VKXB 2H3NB 3CDYA 2VC2H 4I0PB 5E99H 1VSCA 2LAGB 2BVEA 5BS0D 2B4CC 1SYVB 2PKDA 4L8DB 2HFGH 3W11C 5GGVH 4OM1H 4YZFF 3TH3T 4Y16A 5ICXB 1KB9J 1SY6A 1YPZB 1Z9LA 3KJ4C 3WMSA 2CLZA 3HB3C 2YPLB 2OJEA 1B0GB 3H42H 4KJQD 1RAMA 1DCLA 4D0DB 4RISL 3FJTA 4NO2A 3GKZA 4NQEB 3TJHD 2XTLA 3X13A 2ZUXA 3MBXH 4Y4KD 4AH2A 1T0NB 1G7MA 5BV7B 3MV7A 5F1NB 1LNUA 1UWXK 1CZ8L 5C0BE 5F21B 1PYWA 3OJDB 4D9QD 1MQ8A 2P43B 4WFGE 4GG6B 3ZE2E 1KTDB 4P99A 2VUOA 5GGVY 3JBG7 4P4KB 1ACYH 2X4RB 4OLWL 5EU3A 3KLDA 5DFTA 1CFNB 2NY3C 3U7YL 2AK4B 1ORQA 2VXQL 5CIPA 4MXQA 4JFFD 1KB5A 4YPGB 3DI2B 3TT3L 3QXWA 5IWLC 6FABL 1RSFA 2IG2H 4KK5D 1PZ5B 1YYML 3FO9B 5E2WL 4M93B 5I15H 2FJGA 4LSQH 4PG9B 2HKFH 5I74C 1J86A 2A0LD 1E6JH 2M1KA 1C12A 4MNGA 1UACH 4N5ED 3L5WA 3CUPA 5C0AB 4JZJA 1FO0A 3GBML 4LF3B 4MSWA 4WHCA 4MXWH 1CF8H 2D9CA 3BKCH 4RMSA 2YZ1A 4XB8A 4ZUUB 5IK3A 4D2NA 1LE5B 3AREC 5L6YH 2I07A 4JDTH 2C7UB 4PJAE 1INDH 4K8RL 4Q58C 5AYUH 5A40E 5DJCA 3JWDH 1MRCL 2BSTB 5D2LB 5GS1B 2Q7NA 4FFYL 2AERT 1E6OH 1ETZB 4IIQB 5FYKH 1AQKL 3ZYIA 4GRMA 3RVTD 1CDJA 4IRZH 5C0BA 2MKWA 1MCBA 1MFEL 2XWTB 5HI3D 3HNSL 3Q5YA 3OKMB 3MRJB 1XEDA 1S8DA 1N6QH 4MAYA 3I50H 3RHWF 3O3UN 3W9EA 5C08E 4CVZB 5D1ZD 4AT6B 1GH7A 4OCYH 4F57L 4TRPL 3EO1B 3R06A 4CN4A 3AS0A 4IRJB 3BAEH 2PW1B 5E4EB 4JO3L 1J05B 5EO1B 4PJ5E 4QHLB 5GRUH 4R96B 1YECH 4WV1C 5L88L 1KOAA 2D7TL 1F02I 1ZSDA 4Z7VE 3SKUD 3L5JA 4NP4L 2KBGA 2P5EE 3VRJA 3V4PL 3V52L 2WWKO 3HAEB 4EXPX 4IOIA 3BZDA 3WFZA 3WEXA 1XCTA 1WT5A 7FABL 4ZUTB 4CN1A 1MFBL 4QNPF 1FRGL 1EA9C 4U0RC 4Z77B 1IFHL 3IGAB 4JQXC 1BD2E 5DI8B 4PJ9A 5CLTA 1D5ZB 2DWEA 3CFDB 1JTTA 1P53A 1T1XB 4JM2B 1EIBA 2HFTA 4HF5L 1YNTA 2BJMH 4QGTA 3O3BB 5GJTL 4JQIL 4RISH 5CEXB 5ESAA 3QXUA 3VXNB 1AQDA 1EFQA 4I18C 4LGRB 2DQFB 3CLEL 4LSUL 5D7JB 2EYSB 4PRPE 1WWAX 1YZZA 3SGJA 1CZ8H 4X4ZA 3CXDL 1JNHB 4WU5A 1ADQL 5C08A 4RRPG 5IB4A 4TUOB 1YEEL 3DURB 3FQRB 1NAMA 5D5ME 4OLWH 2MWCA 1Z0NA 4PJ5A 3CFBB 2AABL 2FB4L 3T4YB 3WKML 3MNVB 4KUCF 1QR1B 3U7YH 1JK8B 2KDGA 3IFOA 1YNLL 1OT2A 5GHWL 1X4ZA 4AG4L 3TT3H 2P5EA 3LZFL 4WRLA 4W4OC 4OV5B 1S9WA 3U4EA 1AO7D 1VDGA 1S9VA 4URTB 2P8MA 1A6VL 4HAGA 4KVCH 4IOFC 4N0UB 5LWYH 2DQEL 2I5YL 3GBMH 1UXSA 3T3PE 3GJFK 3WFHA 3VI4F 2YD7A 1BD2A 1BIHA 2BFVH 3EO0A 5F7DA 4RGNC 5D8JL 1NKRA 4JGUA 3SCMC 3QWRD 1G0XA 2AJVL 4U6VL 5HTSA 2BNUB 2R29L 5FOBA 3QXVA 4K8RH 5J11C 3QXDB 3KPPA 1G7PB 2W60B 5DRXB 1MRCH 4R0LA 1RJCA 2DLEA 3DUUB 4FFYH 4Y88A 2XKNA 1AQKH 1VFBA 4FG6C 4X4YA 1MHEA 4PRPA 1IJ9A 2UWEB 2IQ9L 3C5ZD 2BDNL 1QSED 2X4NB 1MFEH 2F15A 4G9FE 4WFHE 3S5LG 3RPIA 3RWGB 3SHSA 5KZCB 3B9AA 5JR1H 3O6FB 5D5MA 1NL0L 4F57H 5I0ZA 4TRPH 1OGAE 5DK3A 3HPJB 1S3KL 5I8CA 4HS8L 1A1MA 2AGJH 3LKNA 3JTTB 4JO3H 3MOAL 5I8OL 1MRFL 2DIJA 4HCRL 3EDJA 4IHOA 5L88H 4LBEB 1ZVHA 3AFLA 4WFEE 2D7TH 4NP4H 1A4KB 1CIDA 1ZA3B 3DSFL 2NY4D 4BM7A 1KN2L 3BZ4A 2YZ8A 3V4PH 3V52H 1YJDC 3IB4A 3P0VL 2IBZX 3H7LA 4XAKE 1B6DA 4U1LB 4J6RL 1MCSA 3IDIB 7FABH 1BBDL 1MFBH 4IRSA 5D93C 5F3HB 1FRGH 4N9GA 1D5MB 4Z78B 3EJYD 3O41B 1IFHH 2R9HD 4UDTA 1K5NA 1KTRL 5DEFA 3QEUB 2F5BL 4YR6B 2VABB 3TBSA 1JPTL 4UNVA 2ZPKH 4JANA 4FA8A 1WWCA 4CBPA 1I1AC 1P84J 5ETUB 3RIAK 2XTJD 3QUXA 3BIKB 5GJTH 1YEHH 5HHPB 3C9NA 3RBSA 4JQIH 1QR4A 4N8CL 2NLJA 3VFVA 5KSAD 3FFCE 1HKLL 2APWA 3CLEH 4G9FA 4JO1L 5A1AA 4N90D 1OLZA 4HFWB 4YBHA 3X12A 4PRNA 4BELD 2X09A 5CGYD 3CXDH 5IHBA 2DQIL 4GJTB 1F4WH 1YEEH 3VXRB 2NY0D 4HS3A 5DD6B 3QSKB 2R2HA 3BP5B 1F11B 4LPXA 2AABH 2DJUA 2FB4H 3WKMH 1UCBH 1RZIB 1QSVA 1CGTA 1FC2D 2IQAB 3MJGX 1A4JB 1D6EB 1T0PB 1W0VB 2BERA 4BFIB 3OKDB 1YNLH 2Z9TA 4LKCA 1O5DT 5INCB 4YDLB 3OB0H 2A6JB 3LZFH 3SGEH 3WYRA 3B5HA 4M7ZB 5IW3A 3QH3A 2OTWA 2OI9B 3CFEB 4PTUA 3NIDF 2CXKA 4HD9A 2CR3A 1ZEAL 1ZHNA 1FIGH 4F2MB 2EDLA 1I8KA 2DQEH 4NFDA 4PJXF 5DGQA 5D8JH 1BZ9A 3WFBH 4MX7B 4FTVD 3R8QA 1Y6NR 1U91B 3KPRD 3EDEA 2AJVH 4QYOB 4U6VH 3ISWA 2R29H 3U0TB 4PV9B 5LGJA 2F53B 1E4XI 5HHQA 3VD9A 2CRIA 4ZUWA 1I3RB 1DLFL 5HGAB 3FFCA 3UPRA 2GI7A 3PHQA 1CGUA 3H3KA 1JL8A 4LSVL 3ZSTA 1ZLUK 2CD0A 2ENSA 2AKRA 5L2KD 2BY0A 4C57C 1NL0H 4X7CC 2ZUTA 1UH4A 3AREA 2BMKA 1SEQL 2HT4C 1DN2A 4FXGA 3HG1B 4HS8H 5HDOA 3LDBC 4NCC1 3MOAH 4P2RE 4H25B 2ED9A 1OTTD 2DLHA 2X1WL 3HCVA 5D2NC 1SY6L 4Z7NF 1JF1B 3DSFH 4XTRD 1KN2H 1OL0A 5J1AB 5L8LB 4K7PY 1N5YL 3P0VH 2Q8AL 2AK1L 1CD0A 1A9EA 2X4PA 5A2KH 4J6RH 1T66D 4FOMA 1BBDH 4M1DL 1MPAL 4I8DA 3U2SB 4FQXD 1HINL 3PL6B 5JA9A 5E5UB 4GG6F 4LLUB 1OP3H 5C09B 4EDXB 5GGTA 3I6LE 3RQ3A 3MRGB 1MFNA 3IDNA 2F5BH 1JPTH 2VXVL 1IQWL 4U1HA 4F80A 4L9DA 2X44D 1A7QL 4JFEE 5IMOB 3MLRL 1I9EA 1CBVL 5DK2A 4KROB 2W0FA 5HVGB 2Q3AA 1T20A 3L95A 3UBXI 3HAEG 3RIFK 3ULUC 4J4PC 1OLLA 4P2QE 3ARGC 2GSGA 4N8CH 3WFDL 1HKLH 5H37G 2VQTA 2OMBA 3VG9B 3A6BL 5EOQL 2C1OB 1KB5L 3RNQA 3ARDC 1A7BA 4CADA 2H2SC 2NMSA 1F4AA 2X89D 3GM8A 2ZSWA 2DQIH 4L5FL 4MA1B 3CU1A 1QA9A 2NW2B 2A74A 2BHUA 3NCYS 1XF4B 4P2RA 1BQUA 1FO0L 4MNQD 4ZYKA 5I16B 3NCFB 4PJ7E 1NANI 3BT2L 4H5SB 4ZUSB 3RKPA 4GBXB 3GNML 2ARJB 3D3VE 3OF6D 2GK2A 4LDEB 1P4BL 4P57B 3MRPA 3GMOB 3IKCA 5TH2B 2BVTA 4NQCD 5ANME 4HPYL 4NPYB 1YEGL 5BVPL 1EAPA 4FZEL 4DTGL 4JFEA 1C16B 5DDHB 3U0WL 5DJ8A 3OKKB 3ECBB 2VQ1B 2WIIB 3CSYA 1N3NB 3ZTJH 4OZFH 4P2QA 1HSBB 3HZMA 3MNZB 5FHBL 4XCYB 3LEXB 2Q7YB 1TTUA 2WZPD 4MS8C 5IESL 4JPVH 5IQ9B 2XA8H 4DN4L 3MQIA 5TF1L 4LSVH 5KG9A 4LIQE 4Z76A 1UM6L 4MD5B 5E6IC 3ESUF 1AGDA 4ZUVB 3FB8A 4NO5A 4RNRB 4DKEH 1BPVA 1D5XB 3C87A 3N06B 3LN5A 2P45B 4CVXA 2AW2A 4DUXA 3PJSB 2I9LB 5DEZA 2R2CA 1SEQH 2D4DA 3WIIL 3ZKMC 4ZFFB 1S9XA 5L9DL 4PJ7A 1HHJA 5CLWA 1JHKH 1GIGL 2IFFL 5HHMD 3P4OB 5CCKH 1KCUL 1V3LA 2HT2C 1HHIA 4I2XB 3SKNA 4U0RB 2V5MA 5E70A 1N5YH 1INQA 2AK1H 2Q8AH 3TN0B 4PDCE 3VFPB 4WW2B 5FM5M 5ACZA 3BISA 2JCCB 5K9OA 4M1DH 1CLYL 5E94A 1MPAH 2HJFA 1HINH 5EULV 4TUJA 3ULSB 4MYWB 3MRCB 4ZXBD 3MMEB 3FQNB 1A7NL 1I4FA 2RCSL 2VXVH 2YUXA 4F15B 1L9NA 4HK0B 3GI8L 4MHHI 1A7QH 4ZSOA 1NGWA 1OVZA 4I18B 3EYSL 4UBDD 1CDIA 1NAML 2YD8A 4ONHB 3B3IA 1RZJL 4Q7DA 3PWUB 3WFDH 5CJ8A 3MRHA 1C8PA 1HWHB 4Z7UB 4RX4A 5FYJE 1Q94B 3A6BH 4LKXA 3M17A 5EOQH 1KB5H 3HUJE 3DVGB 3U1SH 1J0YA 1IGML 3UZEA 2JJUA 4LEOB 2B8OT 2HLFD 1IILE 2NNAA 2VR9A 5J9PB 4L5FH 4HJ0C 3V0VB 4KHXL 5JXAL 1AGEA 1KYOJ 3O3AA 2EIBA 5LAXA 5EU4B 5E00A 1E4XL 2FSEA 1JBJA 1BEYL 5HJ3B 1FO0H 1WUNT 2A1WL 3AXLB 1HK6A 1I8MB 2YRZA 2Z31C 2WINA 2IMNA 3BT2H 4X80L 4MCYA 2AXGA 3IDJA 3L3HA 5L2JB 4OZIE 4NT6A 2YEZB 3NFPA 5DK0A 5DD1L 3ROOA 2UWEF 2R1XA 1QLEL 1P4BH 3G6AB 4KWUA 4KDWA 3SCMB 3Q0HA 1TTFA 4Q97A 2ADGA 2BNRD 1YEGH 5T1LA 1FNEA 2V5YA 3F5WB 1REIA 4JFHE 3TA3B 4YLQT 4FZEH 4XPAH 3ZKXB 4DTGH 3DMMC 2WIMA 1FP5A 5DZLA 1DBBH 4U1NB 1J8HD 4NBZB 4FQ1L 1RUQL 3CFIC 5C9JA 2MNUA 2Y36L 3BP7A 4WO4A 4MQ7B 5C6PB 5FHBH 1QUNA 4P23A 5IIEB 2F54D 4YO0A 1S7TA 4EOWL 5D1QB 2VQUA 1KEML 2ZSVA 1T5XB 4DN4H 2FH8A 4M6AA 4N0CD 5TF1H 1EEQA 1BFOA 3BXNA 4ZD3L 3CXHJ 4BZ2H 1OTUC 1UM6H 43C9A 1GPOL 4E41E 4WUUE 3T77B 4C58B 3CGTA 1GOHA 1NFIB 3VXQA 5DGRA 2AVGA 4NFCA 1LEIA 1A6AA 5DMGD 3WIIH 1G1YA 2WLYA 2K7QA 5D9SB 1GIGH 1FAIH 2IFFH 3BP6A 3ULUE 4OZIA 4TYUA 1KCUH 5D93B 5T5FL 4UAOC 1XH3A 5B39B 3T65A 2XWBB 2KQNA 1UJ3C 4H8WC 2GTWA 3WN5A 2EE2A 3TNMB 1CLYH 1I1AB 2MQ3A 1HXYB 4JKKA 4WWID 1A7NH 3I84A 5I0DA 2RCSH 5FKPA 2B4CL 5CWSB 3PP4L 1PDKA 3HI1B 3HLAB 4QHKI 4ZMAT 1KIPA 3GI9L 1M05B 1TVHB 5KANG 5JXEA 3EYSH 7CGTA 2CDGB 2ZNXA 1FGVL 2E7BA 2ZCHL 3S4SA 5I1KL 1RZJH 3RP1A 4M7JL 2IAMD 4CJ0A 1Q72H 3STZB 1I7UB 4JPWL 2LFGA 4L29B 2EXWD 5JPNA 1OHQA 3VFNA 1AH1A 1D9KD 5F9WC 4E41A 3S96A 1IGMH 3UXFA 1GYAA 2FO4B 1TNMA 4PR5A 3QI9C 2BC4A 5J3HD 5T3ZL 3JV6A 1B2WL 3ARBC 5D7LD 4JDZA 5CBEB 4KHXH 1KT2A 1XGYH 4NQSB 1S78D 2CUIA 4DAGL 1H0DB 1E4XH 3QIWD 5AAMA 1BEYH 4HGWB 4EUPA 2A1WH 3WFCL 4Y4HD 5I1EH 2FEEI 2SEBA 3QEGL 2FATL 4J4PA 1KNOA 2EEDA 4X80H 2VE6B 2P8PB 1FZJB 4DZ8B 4D94A 1U3ZA 5EN2B 2DYPB 3RWEB 4I48A 3B9KD 5C7XL 3VD7A 4E0RB 5DD1H 1BOGB 3GIVA 4J3SA 5I66A 1QLEH 3VWKA 2GIYA 5DZNA 1M7IB 1UKSA 3FO2A 4LCCC 3NPSC 1RJYA 1X5YA 2IH3B 5C0RH 4XC1L 2KL6A 3WS6C 3QFJB 3G5YA 3RWIB 4HX1A 1HEZA 1AXTH 4LHJB 4RA0C 1UH2A 4HPOL 2VZ1A 1A3LL 4HIEB 1DLHA 5I9QC 4FQ1H 4EQ2A 2Y36H 3TCLA 3C60B 1CFBA 4OZGF 4LCUA 4EOWH 2KZ1B 3TVMC 1KEMH 5KN5A 2A6DA 1KTLB 2ARWA 2D0HA 5SWQA 5IMKB 2FEDD 2BNQE 2HRPH 1NEUA 1GPOH 3MLZL 1MH5B 3TBWB 3W9DA 4LPWA 1KPUA 3GMQA 1AJ7L 3O2DH 2V5RA 5DHYB 4NUJA 2BY1A 5D2NB 1DQLL 3PGCB 1MFCH 3UYPA 2P44B 1ZT7B 5IVXB 5GGTL 4QRTB 4QXTA 4XNUL 2AS5M 1KYOK 5BVJA 4MS8A 5DMIL 1JN6B 4KRNA 1R5VA 1KJVA 5E6IA 4L8BA 3VFOB 1OP9A 2MTPA 3QJHB 1VESA 3MACL 2P5WE 3RGVD 1HYSC 3SPVB 1DBML 5KSVB 4OD3H 4H1LA 2VXUL 3TNNA 2B4CH 4JHBA 3ARGB 5ILTL 4OF5A 3GI9H 4PB9L 3W39A 1G7LB 1NMAH 2RJMA 3VXUD 5I1KH 3ZL4H 3MRKB 4M7JH 2ENYA 4Y5VC 3VI3E 2H32A 3QWOA 1DE4A 5DEGA 4JPWH 4RFOL 3VGBA 4AENB 2NW3B 3QRGL 2J5LC 2BNQA 4HMCA 3O2VL 1QSFE 4XCNA 1FYTA 1KFAL 4I5BB 4X6BA 2BVOA 2D03H 5DTFB 4K23L 2A6IB 1P6FA 4J3VA 3UTZB 1PKQE 1B2WH 4OFPA 1SYSA 3VFMB 5DYOB 4P5TD 2D0GA 1XR9B 3EYOB 5IUSA 4DAGH 4ZPVA 4X9GA 2Q76A 1MHHA 3LN9A 2W92A 4GOSA 1T0MB 3DGGB 3DYOA 1Q9KB 1XR8B 2FATH 1YNKL 3UTTB 1ZS8A 4G8GD 2F5AL 3SDDC 1QLRB 1RIUL 2DBLL 2P5WA 2HVJB 3SE3A 4U1JB 1HN1A 2K3TA 3UYRH 5C0JA 4X6CE 3MO1A 3O8XD 5FEBA 1I75A 3E6HB 1R5IB 3ARZA 5IR1A 5F44A 4YHNA 2XN9D 4HPOH 5IJVB 4PRHB 1GJIA 4HZAA 3ZT6A 1NCBH 2R4SH 4LRIA 2Z31A 1GGTA 3VFWA 3S3JA 3RTQD 1RULL 3N50A 1CCZA 3QO0B 4BUHA 2BVPA 1HOCA 2Q3ZA 1CFVL 4M6ML 2GTZB 3V5DA 4M8VA 5T3XE 2FR4A 5GRWA 1QSFA 4LLYB 3VXMB 3T0ED 3Q1SL 5I17A 4WW2F 3KJ6L 4QGYA 2J8UF 1Y6KR 1HSAA 4NFBA 2O61B 1WBXA 1PKQA 3EYQC 4I77L 3MLZH 3LY6A 2QSQA 1V3MA 1AJ7H 4GG8A 3SBWA 3GGWB 3SDYL 4WEBL 4L8SC 4XNXH 1DQLH 3MPCA 2OXGA 4G5ZL 5I1GL 1OSZA 2OR8A 3FQXA 3T2PA 5GGTH 5ENWA 1R3IL 4F58L 1J88A 2ATPB 4XNUH 2Z35A 5DMIH 4S2SB 3K4AA 2CLRB 4P5MB 5CZKA 3E6FA 4I0PD 4ZQKB 1MUJB 2OL3A 3WE6B 2DB8A 1ZHLA 4RAVB 3MACH 4KJYA 5DD0L 3QHZL 4EDWL 1CE6A 2IFGA 3D39E 3MLSL 1DBMH 5SX4I 3VXOA 2YPLD 4P5KB 2FBOJ 5EFIA 4JN2B 3VFRA 4O5LL 3T4AB 4YAQA 2VXUH 4P48A 5CINL 4LVNC 5F89B 4PB9H 4N8VA 2BOCA 3GRWH 5B39G 5I1LB 4IBLT 5JOFB 3WKNA 3ZKNC 5ABDE 4L4TD 1LK3L 4F7PA 3FQTB 3PQYB 3HZKB 5CS7A 1UJ3A 1DQML 4LMQE 3RWFA 2PNDA 3QRGH 2GK0A 3O2VH 5IOPB 1KFAH 4YDJA 4KVNL 4NNPL 4M4RA 3FO1B 5LQBL 3L3KB 4P4KD 1P7KB 2D4FA 3QYCA 5JUEL 2X9WA 3IJSB 1VEOA 1AKJB 4M00A 3QQ3B 2C3GA 4RZCA 3EJZC 12E8L 2AQ1A 4IS6B 5EA0L 5FM4A 1ULVA 4P3DA 5EU5B 1YNKH 1GOFA 5D96C 4RGMC 3CMGA 5DQDH 2VN7A 2XZQH 3ES6A 1A6WL 1OGTB 2DBLH 3IVKA 5IB1B 5C0AD 5GISH 3D39A 1XCQB 2WBJD 4LHUD 3DNKA 2VNCA 5FYJL 1N64L 1U8JA 2YD6A 4F3FA 4PJFB 4R2GB 4PJ8C 1JGDA 4DUWA 3RL1A 5T1DL 3DTXB 4ISVB 1JFMA 4KPHL 5C0CE 2E5EA 4ZDHB 4KKLC 1CFVH 1X5AA 3QUMA 4M6MH 4CNIA 1CFQA 2P8LB 1U2HA 4IOSD 5JOPD 2R2EB 4Y19B 5GGSA 3MLTA 4NNYB 5DJZB 1UA6L 2OLDA 3KJ6H 4OKVB 1T7YA 1J1OL 3QFDA 2VISB 5CD5C 2D31A 1RK1A 4I77H 1LE9B 4D0CA 3GFUA 3KPOA 4IRJD 5ID1B 4Z7QF 4PJBF 3SDYH 4WEBH 3REWB 1T1YA 1NDMB 4U7KA 5EORL 5I1GH 4G5ZH 2Q20A 3WL9B 2NQCA 2B1HL 4OF8A 2H6PB 5C0DB 3QQNA 4F8TA 4F58H 3BQUD 1RIHH 4Z7OE 8CGTA 4OZFB 3C8KB 2AI0L 3ARFC 3KPLB 3TVMA 1FFOB 3S35L 4U1MA 1F6AA 3TYFA 1U8MB 2EXYD 3JWNC 3LH2L 2BSSA 4L3EB 5DD0H 4GMSL 4EDWH 3BPCB 5HYQB 5GSVB 3OPZL 4GO6B 1BVKB 4LIQH 1LO2L 4QF1A 2XICA 4MWFA 2X4OA 5H94A 5F88B 4JM2D 3F12B 3MRMB 3BKYL 4O5LH 4R6UA 2C3WA 3IETA 5ID0B 2NCMA 3O4LE 5CINH 1T21B 5HY9A 5J12C 3GSXB 3FOLB 5C0CA 1PW3A 4L8CA 3ULVE 5GRVK 3W81A 5D1XA 1JZ5A 4HSQA 3WBDA 3MCLL 4HQQH 3KYOB 1LK3H 5D7JD 1ND0B 4AEHL 1T4KB 3QCUL 3ARBB 5FUOL 3ULUL 1S7SB 4LCWD 4OUUB 3DRTA 3K80A 5IGXL 2DL9A 4KVNH 4X6FA 3DXAB 4NNPH 2DM3A 3BVNA 5CJXC 3ZE1E 5LQBH 3OKLA 4XPHL 1G9EA 5T1KB 3RNKB 5MEOA 3PDOA 1TZHA 3BUTA 5FGCB 1J7VR 4F7MA 4U1KA 4PJIE 5F6IC 4NZJA 4PLJC 12E8H 3B8YA 1KPVB 3FL7A 1B0RB 5EA0H 1RZGA 5K9QG 2HN7B 4Y5VA 3PXJA 1HQRA 4IMLB 1FL5A 1A6WH 4M8QB 3AS2A 4PJEF 4RBPK 1JZ3A 3BRDA 3C8HA 1IC1A 3E2HA 4Z18A 1JPGA 2MFNA 1XT5A 1JNLL 4G7YL 5JDJA 1CDGA 5FYJH 4ZPTA 4G6KL 1N64H 3KDMA 5JQ6L 4PY8J 3F6IA 5I9QB 3T0VA 5IM7A 1NGYB 3O4LA 1A21A 4GRWE 3TH2T 4B53A 1W0WA 3QT2A 2FJGB 4ZS6D 3HE6C 4MD4B 4LDOB 1AD0B 2VLRB 5T1DH 3D0VB 4JR9L 3TZVB 4KPHH 3L5WB 5IBTL 2YD9A 1S9YA 2W65A 3SDDA 3KLAA 4AMKL 2OP4L 5A2LH 3T1FB 4JREB 1LMKA 5IK3B 1VHPA 5KZCD 5ECJE 1UA6H 1FCGA 3BX7C 2A6KA 3O6FD 1J1OH 4KRLB 3Q6FB 2RFXA 3OTTA 3LS4L 4RMTA 5DJCB 1YMME 4OUOA 1WBYA 2NZ9C 4LMQI 5DSCA 2YPVH 4PJIA 3NH7L 5E6ZA 5EU7E 5IKCA 4MLIA 1W8NA 3WJLC 3ZYJA 5I2IB 5A16B 3JXAA 1XIWD 4BH8A 1YUHB 2VMFA 4A2MA 3C6SA 1WEJL 3MCKA 1WWBX 3S35H 2MHAA 4O2FB 5JPMB 4YC2C 3I02B 3LEYL 4JFPA 1T04A 3H0TA 4KQ4H 3LH2H 1HWGB 3IU4L 4GMSH 4TQEL 4MJ6A 5ACMA 1QBML 1T6VN 3OPZH 1YDPB 3EFFA 1LO2H 1KXTB 4L8SA 2IPKA 3VRJB 4HLZH 1JF6A 3G5ZA 3ZDZE 1XF5B 2R69H 1XCTB 3E0GA 2DD8L 4RCAA 2ICWI 4LGSB 1F3JA 1A2YB 3ZKQD 1S7XA 1IRAY 2XOTA 1ZHKB 1NQBA 3TJHC 2ATKB 3MCLH 1I8LC 1NDGB 4EUPH 4AEHH 3FZUD 1U36A 3QCUH 3BZEA 2FX7L 3ALPA 3LKSA 4PJAB 5FUOH 4X6EB 3ULUH 4O58L 4XMKL 4CVUA 5IGXH 3VXRD 5J7CC 4OZHE 4OZ4A 3MRQB 4M03A 1M6OB 4MJIE 4NKMB 5IJKC 2VLME 1XF1A 4JDVB 4KK9C 1AQDB 5D7IE 2JJSC 4MCZA 5JHDD 3N1QC 5CEZD 1ZLWH 5E95B 2Q1EA 3P4NA 3OXSB 1I7ZA 4EI6B 3RA7L 3MV8A 5IB4B 4JCMA 2DJSA 3WNPA 1D5IL 5TE4L 4UIKL 4XP9L 1XGQB 4NUGL 4NHCL 1RU9L 2C26A 4LQ1A 1FE8L 2DDQL 1S7VA 3UJIH 3I6GA 1UB6A 3IFOB 1NCUA 4G7YH 1JNLH 4N5EC 5H2BA 3IDGB 4Z7VB 4ZOAA 4O4YL 4G6KH 3W0WE 2P5EB 2NX5E 5JQ6H 3CCHA 1NGPH 1U93A 3P40A 3F6LA 1BP3B 3IFPB 1FVEB 3BPOC 1MIEH 2F53D 1S9VB 4XBPA 3SJVE 3QUYA 4U1GC 5L0QC 5F9AC 4JR9H 1E27B 1Q8MA 2PYEB 4X9IA 5BQ7A 1GC1C 1UXSB 4IRSD 3WFHB 1BD2B 4QOKB 4I3RL 4XNQB 4AMKH 1OD9A 1XZ0B 5JMOC 3RVTC 2OP4H 5IMMA 1GL4B 3QPQC 5AG8A 4OZHA 4X6DB 2L7UA 4PY7A 1YEKH 4MJIA 1I1YB 3VA2C 2GT9A 3S88L 2AJZA 2Y07L 4K71B 5D7IA 3ERYA 3HG1D 1IQDA 4M1GL 4PJ8A 2OL3L 3RVUD 3NH7H 1VFBB 1MHEB 1QTYT 3WJJA 3GMNB 5F7FA 3K81A 1CG9B 3AC0A 2P7TA 3V8OA 2UYLA 4H1LH 5IB3A 3FTGA 2DICA 4MQXD 2AV1B 1WEJH 2NY2B 3W11D 4UQ2A 4YH6A 2YD4A 2CKNA 2DWDB 4UOJA 3JWOC 1Q9WB 4XP1H 1IE5A 1P7QB 1OQXA 3LEYH 4YBLC 4JHAL 5C09D 1QFWL 2NX5A 1T7ZA 4TQEH 5IG7B 1MJJA 4M9PA 2VXTL 2H32H 1QBMH 1K3IA 4XCEB 5JMRA 4K9EC 5EZLB 3C6LA 3SJVA 4UV7L 3CFCL 4X83A 1KIRB 5JNYA 2DD8H 3ZTJG 5EO9A 4OZFG 3UBXB 3OKNA 1T22A 4OSUL 3LVEA 3OXRA 2FHBA 1IEAA 2YD2A 2P48B 1SEBB 1VGEL 2E9IA 2ERJC 1R3JB 4LU5L 1KN4H 5F7YC 3U79A 2VXSL 2NY3D 3AU1A 2X1PA 3KLHC 1PZUB 3QULB 2HJLA 2N4IA 5KS9A 4XMKH 4XNMB 2VAJA 5DJXB 5K9KB 1L6XA 5F7UA 1I1RA 4UMGA 1VACA 1KELL 2LU4A 2B1AL 3G6JE 5GS2D 1TZIB 3FRUA 4RGMB 8FABB 1K4CA 3KR3L 1FG2B 5EU6B 3CVIL 3HI6H 1R3LA 4WEMB 3X12B 2WW8A 3NTCH 4GBXD 5C07E 5ITBL 5EZJA 3BD4A 4BSVA 3RA7H 3IXTB 4BSWB 1OGAB 5TE4H 4UIKH 4XP9H 2ESVA 2R2HB 4NUGH 1RU9H 3MSPA 1FE8H 2DDQH 2UY7A 4K3JL 4Y89A 4JFZL 1T6WA 3ILPB 3CSPA 5DMJB 3QUML 3TBTA 1F00I 4XZUB 3HS0A 1NUDA 4O4YH 4L4VE 2J88H 4UOW1 1U41A 4OM0H 1HCFX 4ZAKB 1ZK9A 3Q5TA 3P9MA 5FECA 5I1AA 2OTWB 4LOUC 2MCPL 2ED7A 2ZOLB 4OFKA 3SDCA 4XT1C 4Z5RB 4Q9QH 1KCGC 3HNTH 1J0JA 3V6ZA 1OWRM 3NGBB 2CIKB 5KSBB 4UTAH 2VZUA 3IJYA 5C0NC 3W0WA 5B38B 4X4XA 5DT1L 5HPOA 1BZ9B 1A3QA 5I8KL 4A6YB 1WWWX 4KDVA 1CGSL 4OGZA 3GKWL 1NGZA 2VDRL 5BS0E 3CDGB 1DJSA 4FFEX 2DQUH 5FHAL 3S88H 3NPZB 1HI6B 2Y07H 5DJ6B 3WIFB 4JAMA 4XC3H 3QNZB 4OLXH 3G6JA 3S3PA 3DX8A 3F65A 4M1GH 5CGTA 1UZ8A 3DROA 1ZE3C 4XX1G 4D8PA 4LVHB 3D69B 3VFTB 1G7QB 5E1HB 4G8IA 3ARFB 1LP9E 2XNAA 5C07A 3UPAA 3H3PL 5I1HL 1QLFA 2ITCB 1OM3L 1JWUA 3WXWL 2QQNH 5ERWA 3TN0D 1Q9LB 2NY4C 2HTKD 3T8XA 1LO5A 2JF1A 1TJGL 5T3XH 1WCQA 3QISA 4Y2DA 4D9QE 1QFWH 1MCPH 4HIJA 3K3QA 3EJYC 3PWPA 4QRSA 2EDXA 2Y7QA 3CFKB 1MLCB 3VD5A 1ZLVK 2CSPA 1MF2L 3VGAB 2G5RA 4E5XA 5KAQF 3WJLA 4UV7H 4HJGB 2X4QB 2AJUL 1KLGA 3TO2A 1RJLA 4X9BA 1L0XA 3SDAC 2YD3A 5EB9A 4Z7WB 3VG0L 1QYGL 5KSAC 2IBZY 2GAZB 3LB6C 1MSPA 2F74A 1VGEH 1H15A 4LU5H 3CZFB 3TIDB 2VXSH 5BS0A 1VA9A 3AY4A 4LLWB 2QQLH 5CGYC 4V1DD 3L95B 3WO3B 1JFQL 3AAZA 2NY0C 3G5VB 1C5CL 4ODSL 2B1AH 4C56B 1CDUA 1LP9A 3HI5L 4NN7C 1AGFA 1GAFL 5HGHB 3KR3H 3H8NA 1RFDL 3CVIH 2G60L 3TJHA 4ORGB 4IOFD 1GZQA 5ITBH 3KPQB 3TC9A 2UUDK 3QXAA 3H7BB 3ROLB 2B5IC 4DKAA 3ULVL 1AI1L 1Q38A 4RGND 1IC4L 4RGOL 1G84A 3CH1B 3SCMD 4WHYG 1YEIH 4OBSA 5F72S 2N7BA 4P2RB 4JFDE 5BW7C 4K3JH 4ZYKB 3UMTA 4JFZH 1MVUA 1YEDB 3TA3D 5IJKA 3HE6B 5IMLA 4FXLA 3LKPA 2XKUA 1JWSA 1TDQA 5DHVA 1JUFA 3QDJD 1FZKA 2JJSA 2V7HA 4PRBB 3ZKSD 2HTLC 3F7RA 5IHZB 3O45A 4S1RL 4JFFA 2IH1B 4PUBH 1TFHA 3IKCB 4F9LC 3ZE2F 4HG4J 2E9BA 4AIZA 4K2UL 5DUBA 2QR0B 5D1QD 1ZKAA 2ZOKA 5SWSB 3RVWD 1TLKA 1EAPB 4JFEB 2EYRA 4HKXA 4ETYA 1CGSH 3GKWH 3V5HA 4N5EA 1XF3B 1A14L 4MLSA 4QHUA 3QQ4B 1JJUA 4P2QB 5EUKA 4DCQB 5J6HA 5FHAH 1JV5B 3P4MA 3OR7B 1WZ1H 2HLAA 4X7EC 5TDPB 1B3JA 4OGAC 1NEZB 2EIZB 5IVZA 1AXSB 1MLBA 1H9VA 4RX4D 4RMQA 3H3PH 5I1HH 4YC2B 4V2CB 4NO5B 1OM3H 3C08L 3WXWH 1YC8A 1FNSH 2I60L 4QCIA 1BWMA 1N0XL 4XTRC 3IXAB 4EJ1C 2GITA 2IJ0C 3LRSB 3MJ8A 3UYOD 3IAGC 1I1AD 3QEQD 5E5MB 1W72A 1HHJB 1TJGH 1WC7A 3NCYP 4L3CB 2F19L 3GHEL 3BGMB 5CSZB 4YJZL 1UWXH 4M48L 5D1ZA 5EO0A 4YDKH 4OIBA 3GMMB 2I9TB 1Z2KA 3C09C 4HWZA 5C86A 3G04B 3D3VB 2O26U 1MF2H 5C0EA 1V8HA 2IBGA 5HI4D 3SKNB 2C3VB 1RUAL 1CR9L 1INQB 4QTIL 3ALWA 2AJUH 2ZUQC 5ANMB 4JPIA 5K9OB 3CH8A 2A73A 1YEFL 2DI7A 4TUJB 4JZOB 2APXA 5HYSA 3VG0H 1QYGH 2ADJA 1NSNH 3BUYB 3U46A 1AO7E 4YDVB 1I4FB 1J5OL 3ME0A 4LLDA 3OAYK 1NGWB 4UV4L 5JDSA 5TE6L 1CWVA 4Z7VF 4KRPB 1JFQH 3OSKA 4GKZA 1ZVSA 4OI9A 3RWHB 5J0BA 3C5SB 3R8BB 4GAYB 4KTDL 3MUGA 1C5CH 2JJWA 4ODSH 1S5IL 1FBIL 4F37F 3HI5H 4XGZB 3UBXG 1GAFH 4GW5A 3LHPL 1WLHA 5DRNB 1RFDH 3NOIA 4JKPL 4WHDA 3MLUL 3GJEB 4MNHB 2EDDA 4HHAB 1CL7I 2C9AA 3VDBA 5E8PB 3ULVH 1IC4H 4RGOH 1AGEB 3TIEB 4HLJA 5E8NB 3PV6B 1ZV5A 3A67L 1QSEE 3SKOA 2G9HA 2CMRL 4HWEL 3QFJD 1FG9C 2WINB 5DJ2A 3HHRB 4WWKC 1DN0A 4K3EL 4NNXB 1WZMA 4E42B 5F1SA 3F7QA 5F71A 1TVBA 4S1RH 3MXWL 4RFNB 3C60D 2GSIA 3WSQL 3GIZL 3E8UL 5JW5B 1QG3A 4DVBB 1KTKE 2AEPL 2OSLA 2YRLA 5D5MF 2V7NB 1AO7A 1KCRH 3UC0H 1UJTA 3I3BA 4NC1E 2ICEA 2VAAA 4YEEA 4HDIA 1WJ3A 4GXUM 3NCMA 3UTSB 4BZ1L 3EZ8A 2Z4QA 2J2ZA 3D2UB 5E08L 4FABL 3MC0A 3LQAC 3WNOA 5C70A 3QWRA 2EZ0C 4JJ5B 5J57B 3HUJB 3LKRB 3WDJA 4HKZA 2FDBP 2XTJE 4GRWH 3T3PF 2HP4A 1SJEA 5B38G 2QBWA 4P46B 3C08H 1IAIL 2I60H 2NY6B 4J3WA 1N0XH 3C5ZA 1MIML 1QSEA 3HC0B 2D7PA 4N90E 3V4UL 2X5PA 3BEVB 5CP7A 1NLDL 2HMIC 2F19H 3GHEH 3TBYB 1TCRA 4M48H 2Y5EA 5FYLL 4MAUL 3BP6B 2WANA 3GO1H 4OZIB 3L7FA 4YXHL 3ARGD 2HJKA 2FL5B 3T65B 1OW0A 1RUAH 1BJ8A 1CR9H 1RVFH 4QTIH 2DKMA 3ARDD 2H2SD 4UBDC 4JJHA 4RAUA 2VZSA 5FOJA 1RV6X 4ZTPL 5FIEA 1FFRA 4PREB 1N6VA 4M1CD 3DRQA 3TPUB 4OCXL 1RMFH 3MNWA 5FKPB 2AJSL 1J5OH 1U92A 2K1MA 1M7DA 2B20A 4UV4H 4ELME 1BIIB 5TE6H 2HLFC 1X5GA 3EZJB 4X5XA 1OAQL 4KI5D 4MHHG 3GJFH 3W2DL 5IQ7L 4V3EB 4W6WB 3O0RL 4OAWB 3RWDA 5ICZB 4QHKJ 1P4LA 1S5IH 1FBIH 3LV3A 4FMFA 5IEHA 4C83A 3G5XB 4DWHA 2HYMA 3LHPH 4E41B 4WUUB 1T7XA 4PJHA 3MLUH 3M8OL 5KSAA 4JFQB 3ZT5A 1JTPA 2NR6C 4JDZB 3DECA 3DVIA 1EHLH 1II4E 4J8RA 1I9IL 3A67H 4X7TA 1DSFH 4NDMA 4HWEH 5GS3A 5L2KE 3TJEL 4GW1B 2WUBL 2HA1A 3LKOA 5GGQH 1KNOB 2CK2A 2L0DA 4UI2A 4UILL 1A02N 1YQVL 1EVTC 1A22B 1IKFL 2Z91B 2AV7B 3VH8B 5E9DD 4FP8L 4HUUB 2BX5A 3LIZH 1Z5LB 5I66B 5JO5A 3MXWH 3VWKB 1DQQA 1UENA 3JTSA 3GIZH 3WSQH 3E8UH 1R3KB 3HE7C 1INEL 3G5YB 3G6DL 4XPTL 3FFDA 2BCKB 4HUXA 4N0CC 4Z95L 4ELMA 5I1CH 5HI5D 3GSQA 4Y5XA 1ZOXA 5GGRA 5ESQA 2EDTA 5F1IB 3DBXA 5IF0B 2FWOB 4FTVA 4FABH 4YQXL 4JFYA 1NBVL 3LPGA 3QG7L 3KPRA 5DMGC 4WJ5A 4D0BA 3VXTA 5KN5B 4F9LA 3L3DA 2YS4A 4YHIB 2AJ3B 1QRKA 4U1IA 5EIVA 1IAIH 1KPUB 2PTVA 4NUJB 1MIMH 3ARTA 4S10A 3PDDA 1KIQA 5EBMB 5FA4A 5JHLL 5I19L 1I3UA 1LGVA 3ZTNL 4YHYC 1J18A 3KAAA 2AAVA 3PE9A 4KZEL 4Y5YB 3IU3B 1X6NA 1E28B 3KVQA 4MAUH 4RWYL 4Z6AT 5DMYA 4UDUB 1NEZG 1HZHH 3CC5A 5TGBA 5BVJB 4YXHH 3SDAB 3M1BA 1OAYL 4WDIA 1RUML 4MNQE 1BECA 4L8BB 1K3ZA 2DLGA 2FCBA 1ED3A 1S7WB 4L4JA 3VMOA 1VCAA 3ZE0E 5J89A 1ERNA 4HKBA 1DVFC 2IAMC 1U3HB 4PP1C 4NN5B 4ZTPH 5FO8A 4HJ0D 1V3KA 1A9BB 4FFZH 5IHLB 4OCXH 2WP3T 1BVLB 2AJSH 2EKSA 4FQXA 5E2JA 5MHSD 5F7LB 3LRHA 4HEPG 1Y18B 4NQCE 5J3HC 5GXBB 1MJ8L 2X9XA 2Z31D 1GSMA 4J23A 1LO3H 1OAQH 1ZT4A 2FZ3A 4ENED 3R1GL 1OF2A 4XRCB 3W2DH 5IQ7H 4YHKL 4U6YB 3KPSE 4EEEA 5DEGB 3MOQA 1T3FA 1P9MC 3QIWC 2BNQB 4ZO7A 2PW2B 4Y4HC 2HRLA 2YBRB 2BVOB 4XBEL 3M8OH 5D7SL 5IEKB 4NO3B 3CPLA 5CILL 3C2AL 4LL9A 4R4BA 1NBZB 4NO0B 3VE0A 2X4SA 2QHLA 3DMMD 3BO8B 2X89A 1I9IH 1EPFA 4FQLL 5C0IB 3DV6A 4GKNA 1KCVL 1ZLUH 3QEHB 2X05A 3TJEH 2H9GB 2WUBH 3L3GA 4UILH 1YQVH 4R2GD 5HYEA 1IKFH 3S37X 2NYYD 1H5BC 4MNQA 4FP8H 3VJ6B 4TVPD 5FGRA 3QZWA 1K8IA 4LLQA 3GBNL 1E4KA 4F7EA 4LNRA 2YKLL 4GKSA 3DVNB 3MO1B 3T3ME 3LRGA 3OF6A 4Y19D 4DOHE 1JHTA 2W9LA 3G6DH 4LEXL 4YHNB 2A77L 2G2RB 2DQGL 3NA4A 4NQCA 4Z95H 2FEDC 4PJ7F 3VW3L 3BMWA 3VFWB 1LEGA 5F96L 4EN3B 2VL5B 1GZPA 1E4JA 4JFOB 2H41A 3QG7H 4DKDC 3BEWA 2BVQA 2YXMA 1W72L 4E9LA 2FJHA 3EDDA 4JB9L 1KGCD 2XT1B 4QHNB 3BH9A 4KDTA 2XACC 2VITB 3RX7A 1HSAB 2VDOL 5CMAA 1LILA 1DQDL 4J3TA 4U7MA 5DC0A 3PWVB 1RPQA 5DD5L 2VLKE 4O2CA 3DO7A 5JHLH 1N26A 4OI7A 3ZTNH 3RGVC 3NZHH 3JWOL 4C4KO 2YK1L 1AD9A 1CFSB 4RWYH 1R5WA 2Z35B 4B7IA 5DD3H 1WIUA 1EJOL 1EHAA 1OAYH 3OJVC 1VFAA 2EC8A 1RUMH 2PYFB 4X6CB 5HHMA 4K55A 5DMKA 1ONQB 3MOBL 2MOVA 3QI9D 4CDHA 2ADIB 4JZNA 1TQCB 3ARBD 1C08B 3V7AG 2CLVB 3ZLQC 3GK8L 4YAQB 3DXAD 1FVDB 2R39A 3L5XL 4X5WB 4D9LL 1KLUB 2EYTA 2NY1B 4R7NB 3QJFB 1XAUA 5T1KD 4ZXBA 4KAQL 4OIAA 2BNRE 1MI5B 5JORB 2FECI 1MRDL 2DM2A 1IAOA 3R1GH 3RBGA 1IM9D 4OCNC 3VFSA 4F7PB 2E7HA 5IB2B 1CLZL 4PJBE 1BFTA 2GJ6B 2VB5A 3LSOA 2GK0B 3C5JB 3EYFB 1ZA6B 1J8HE 3L3JB 1CTOA 2H8PA 3WO4B 4OTXL 2KPNA 3UJJL 1JGVH 3U9PL 4PJDE 4X99B 3K8MA 1J1PL 1IGJA 3B6SA 2YUZA 1ITCA 2O5XL 3HA0A 3C2AH 1R24A 1PSKL 2AEWA 3PHSA 3QR2A 5CILH 5D6DA 3WS3B 2F54E 1KF9B 4XP5L 2OR9L 3FO0L 4DN3L 5CEYB 1S9KC 4HJJL 2EDKA 4FQLH 5CSGA 4WI2A 2EDHA 2HT3D 1KCVH 3GMPB 3IFLH 5I6XB 1T1ZA 5BZDA 5FGSA 4P2OB 4JVUA 1NAKL 5EIQA 3R0NA 4C54A 5GSRA 3OQ3B 2VLRD 3ES6B 4HLZG 3HUJF 1P1ZA 2QL1A 1ZT1A 3I9GL 3TZVD 1VFUA 4PB0L 3GBNH 3M07A 3PIQA 4G8EA 1NFDE 4K94L 5FB8B 3G9VA 2YKLH 35C8H 4I3SL 4LFHD 5I71C 4HBCL 4J3UA 1PKOA 4GFTB 3HR5B 1XFPA 1OTSC 43CAA 3GHBL 2A77H 3RU8L 3DLQR 3T0EC 6CGTA 1E0OB 2DQGH 1WISA 1U2CA 1QO3A 1SM3L 2FIRT 4ODUB 3VW3H 2BNRA 2XPGA 4LK4A 2PETA 1UT9A 5F96H 5HD8C 4OF7A 3VH8G 4PGBB 4PJGE 4OZIF 2E27L 1PGRB 5LCVL 4CNIB 2MPAL 1E4WL 5GRYA 1H3XA 3BHBB 4KMQA 3VFUB 3BGFB 1J8HA 4JB9H 5FA3A 1AGBA 1RK0A 3KYNA 1PQZA 4PJDA 2V6HA 2X1XR 3QFDB 3MRFB 1OD7A 3E3QC 4MDJB 1RK1B 3BOVA 2R8SL 1HYSD 2KZWA 3RUGE 1DQDH 4XHJD 4GQPH 1S5HA 5DRZB 1ZWIA 2B2XL 4NSKA 4ODVL 5DD5H 4N0CA 3PV7A 5I30L 1FN4B 4TPRL 4I0CC 4H88H 4UT6H 1M71A 1UXWB 2R4RL 2YK1H 2VLLB 4HKJA 3S36L 4MA7L 2FHCA 4WU7A 1FNGB 4PGDB 4NRYB 5J56B 3VXPA 1WIOA 4DW2L 1EGJH 5AEAA 3GMLB 1EJOH 4U1MB 4G43B 2C3XA 4XMLL 5F1OB 4JPKH 4HAFA 1U8QB 1NFDA 2HKHL 4JY6A 1PG7X 1SBSL 1DDHB 2ZG2A 5KOMC 5CZVL 5EUOE 5EOTB 3QIUC 2ICWB 4FHBD 1F58L 3MOBH 1QBLL 3D0LB 3B2VL 4FFWC 3G08B 5BV7C 2X4OB 5GRXG 5HVHB 2BVUA 1OOAA 1DQJA 3GK8H 4L9LC 1HH6A 4NKDB 3L5XH 4OQTA 4D9LH 2G75A 3OX8B 5C0CB 1HXMA 1Y0LA 5DQ9A 2EDRA 4KAQH 3ULUF 4P4KC 3RL2B 1JHLH 5D1XB 4Y0GA 4HUVB 1MRDH 3N1GC 3DX6A 1EJ6A 5FO7A 4P59L 3GSWB 3U48A 1CLZH 5MERB 3FONB 5C0GB 3BMVA 5MI0B 4GQ9L 2DQHL 2PTUA 4X6FB 4J1UA 3RUGA 3U9PH 3UJJH 1J1PH 2IAMA 3BVNB 1A1OA 4M93C 2X70A 3QQ9C 2O5XH 4BZYA 3FOMA 1PSKH 4WVRA 1OARH 5FO9B 4LASL 3QB7C 1HHHB 3PDOB 1OB1A 2OR9H 1P69B 3FO0H 4DN3H 1A6TA 4HJJH 1IL1B 4YFLI 4F7MB 4AEEA 5D7LA 1VEMA 3SGKA 1RZGB 2CUMA 2VRAA 4XXDB 2EEAA 1NAKH 2CRZA 2VLJA 5I8EB 1HQRB 1WAAE 3QIWA 1FL5B 5I75C 5HHNB 2PYED 4Y4HA 3I9GH 5EUOA 5TE7L 3E2HB 1FHGA 3SY0B 3IF1A 4QOKD 5DURB 3ZMRA 4IIQC 1KCKA 4K94H 4F33B 3EYQD 3EW3B 4I3SH 4ZPTB 3B9KA 3KDMB 3EAKA 5IM7B 4BH7B 2PUQT 4Y8AA 3B9EA 3GHBH 4JHWL 3RU8H 2R23A 1C1EH 1CXIA 1W0WB 4DZBB 1SM3H 3U6RB 1KG0B 3VXSE 2X42A 15C8L 1S9YB 4IRJC 3FT4B 5IW1A 1H5BA 5E4EC 2MPAH 1E4WH 3NN8B 1NGQL 5AUMA 2IEPA 3MRRA 1LK2A 3KNBA 1JYVA 2IANB 2A6KB 4NZRL 2ZUUA 2RFXB 5MP6L 1ES0B 3LN4A 4UQ3B 2NTFB 3ETBF 3VXUE 4YHYB 4DKFL 1Z9MA 4GMTH 1VPOL 2B2XH 1P7QD 1U8OB 1K2DA 3EHBD 4ZO6A 4ODVH 3VFGL 2E8YA 5IKCB 3H9SB 4GAGL 4PRDB 3V79C 5I30H 4TPRH 2FECL 4FN0A 5DO2D 3F58L 2R4RH 3FB7A 1EEZA 2CDEA 3S36H 4MA7H 3D87B 4JM2C 2CO7B 3RKDC 4DW2H 4O02L 1L6ZA 4EVNB 1NGXA 4XMLH 3BPNB 3RX8A 1DVFB 3T0XA 5K9JH 3DUSB 2HKHH 3O6KL 4JFPB 1WF5A 2J12B 5FK9A 3H0TB 5CZVH 2W9DL 4TTDC 5KTEH 3TGXA 1F58H 1BM3L 4N0YL 1QBLH 4G8GE 3MROB 3B2VH 5D7JC 3MYJA 1NBYB 1G7JA 3FQWB 5DZOA 3MUHL 4WHTA 3VD3A 3RGVA 1DBAL 4RRPA 2DN7A 5C0FB 1F3JB 5LWYL 3DOSA 1KACB 2NY5L 2XQBL 2G5BA 1FZOA 3OKEA 2MKLC 1SVZA 4PYGA 4JM4L 2EDFA 5EU6D 4P59H 1I8IB 4G8FA 4AJ0A 1XGPA 1UWEL 1C5DA 4FQHA 4ZFOB 5ADOL 1CVSC 1T83C 1UM4L 3KHOA 4GQ9H 2DQHH 1YMMB 5CHNA 3VXUA 4PIRF 1OGAD 4PRIE 1DEEB 3TO4B 5FV1L 5HGDB 4LASH 5CJ5A 1TXKA 2WNGA 5C6TL 4PJ8D 2JELL 4YGVB 5FKAA 1RQ5A 1IKNC 2CKBA 3P4NB 2HG5B 1A6PA 1JGUL 3CVHB 1I7ZB 3WHE1 4ZAKD 2CO6B 4IDLA 1QFUH 3Q3GB 1IAKB 3GMRB 4PGCB 5BZWA 3VI3F 4P5TA 2DRUA 4KKLD 4MA8L 2HFEB 4LLVA 1EEYA 1UM5L 4RFEB 3GJFB 2EEBA 5F9JA 1TCMA 5TE7H 4QT5A 5BMFL 4G8GA 3F7YB 2WWMC 25C8L 2VH5L 4BK4A 1DFBL 1Q1JL 4LRNL 1TNNA 3CCHB 3PWJA 3BPLB 3P9LB 4MJ4A 5J6GB 4MJ5B 2P24B 5F7EH 1BBJB 3RI5K 3O6FC 4OCWL 1JRHL 3QUYB 3O8XA 3OGCA 4NM8L 1VADB 3PGDA 1A6ZA 4X98A 2D3VA 15C8H 1YPZE 3MJ7B 2XN9A 5FGBC 2YPLE 3NCEB 5EOCL 3BSZL 1FYHB 2X4UA 2ZCKL 5BO1L 1FZMA 3TM6A 3ARFD 3RY6C 5C71A 5FYLD 2X4TA 2AEQL 3RTQA 1NC4B 4X6CF 5GGRY 3A6CH 2EO9A 4XWOC 4MJIB 1WVZA 5MP6H 4ZTOL 4R7DB 3D5OF 3GSRA 4L4TE 4DKFH 4XH2A 3QDMB 1VPOH 3T0EA 3QCTL 2E8ZA 4U49A 5EC2B 2XWJB 4PJXA 1JP5A 4YBQD 3V0AC 4KXZI 4UU9A 1HH9B 3LPWA 4X0KB 1JPFB 3L3OB 3GBLA 1JPSH 1G1CA 1HILB 3PHOA 2YSSB 4R3SA 3EYUL 4UQ2B 1FCCA 1YMHA 4O02H 5E03A 2Y5TA 4YPJA 3EJJX 3E3QA 3O6KH 2Z93A 3EOAA 2W9DH 3ORJA 5E2TH 3I75B 2NX5B 1VKXA 2OMNA 1MJJB 1BM3H 4N0YH 4IMKC 4I0PA 4WIQA 1KUMA 4OLYL 3U30B 1CDYA 5JOEA 1SYVA 2DTSA 4L8DA 1CD1B 2I26N 3UTQB 2Q86B 1X4XA 1MQKL 1DBAH 2DKSA 5ICXA 1P2CA 4PLJD 1YPZA 5JNYB 1QZ1A 3L5HA 5A2FA 1SJXA 2YPLA 2NY5H 1PJ9A 1TPXB 5EWIL 4C56D 2ITDA 3OXRB 4YXLL 4JM4H 4JO4H 1U8HB 1IT9H 2ICCA 5ESVB 1OAZL 2OJZL 2YA0A 4NQXA 5HVFB 4YDLC 5DS8A 3WDIA 3AU1B 5D2LE 5A2JH 5ADOH 1PY4A 1UM4H 5INDB 3L9RB 3BWAB 4M7ZC 1T0NA 2BSRB 2OI9C 3QWQB 5F1NA 3GSNB 1WITA 2OYPA 3JVGA 3OJDA 5JOPE 3J8F7 4GG6A 2CH8A 1KTDA 1V7NL 5C6TH 2E6JA 2PCPB 1LEKB 2GUOB 3HE6D 2DI8A 2JELH 3P77A 3U4AA 1K4CB 4P4KA 2X4RA 1JGUH 2JIXB 3UTPD 4PP2B 4BSVB 2FX9L 4HS6B 5DJ0B 4DGVL 4YPGA 4OB5L 1UM5H 4M6OH 1PZ5A 5EBGA 5BMFH 3FO9A 2EICA 4F7TB 1XF2B 5SWSD 1V3JA 2Y4SA 4PG9A 1QFHA 25C8H 1DFBH 4PFEA 1Q1JH 4LRNH 2GY5A 5C0AA 4LF3A 5GGUB 5FECB 4HEME 2WBJA 4LHUA 4NJAL 1WV7T 5D4QA 2Y72A 5SWZD 3SDCB 4OCWH 1JRHH 4NM8H 4ZUUA 4DVRL 1LE5A 1X7QB 2C7UA 3W0WB 5EOCH 1EEUA 3BSZH 5C6WH 1BJ1H 1WIPA 5BO1H 2XXMB 5D2LA 2BSTA 4M3KB 5GS1A 4LSRL 2AEQH 2K7PA 3ARWA 1ETZA 4IIQA 1QEWB 1NGZB 2DF3A 1JMXA 4ZTOH 5GRVL 4MD0A 4MQXC 4PYHA 4MNGE 2XWTA 3RDTB 3G6JB 3OKMA 3AM8A 3MRJA 4NQDB 3QCTH 1UZ8B 3MV9D 4P0DA 3PL6C 1RHHB 4CVZA 4LCWE 3EO1A 5ICYB 1BQLH 3D3VD 3PXHA 4IRJA 3GUTB 1EV2E 2RBLA 2PW1A 5EO1A 1J05A 2L7JA 4QRQB 4QHLA 4AY0A 5JW3L 3QIUB 3EYUH 4R96A 3MFGB 4WI6A 5HHOB 4OQTL 2DKUA 4KROC 4JVPA 1LO5B 2EDYA 3L6FB 4XPBH 1KCSH 2A2QT 3BQUA 3HAEA 4L4VB 3KPMB 4L9LB 3JTCA 4K07A 4QRSB 1CVRA 4JGMA 3OL2A 3VG9C 1N5AB 4ZUTA 4KK9D 4I4WB 4PY8I 4Z77A 3IGAA 4KRPD 1MQKH 1X4YA 3TO2B 1H3PL 4MA1C 5DI8A 4BK5A 4Z7OF 1D5ZA 5EPMB 1T1XA 4U6XB 4JM2A 3X17A 5EWIH 3ZYZA 2FD6L 4OBRA 1A7OL 3LQZB 4YXLH 1T1WA 3O3BA 1GGCL 3OHXB 1JCKA 1JGEB 2VZ3A 3VXNA 4O2EB 4M5ZL 2DQFA 4GBXC 4YXKL 3UPCA 5D7JA 2EYSA 4UT9L 2XZAL 3AAZB 4RDQG 3PDGA 5CJBA 5D71H 1JNHA 4LCWA 4TUOA 3PP3K 3DURA 3N9GL 3FQRA 3ULVF 1BLNB 4S0UC 2VSCA 5FUCC 5I75B 4EQ3A 1BZ7B 3CFBA 4HGKC 3T4YA 3MNVA 1QR1A 4H20L 1T2XA 2R0KL 4Y4KB 2FX9H 1JK8A 4G42B 4XVSL 4DGVH 1UEYA 4U6HB 3QPQD 1T03L 1T83A 4OV5A 3ZE1F 1MVUB 5GJSL 3O11A 4TTGA 4JQVA 3GB7B 5KVFL 2VIRB 1IBGL 1SVCP 4OD1L 2V7HB 3UTSD 2ZUYA 4N0UA 3MXVH 4PJIF 4ZODA 4ZO9A 1MCOL 4NJAH 3O45B 4NJ9H 4OGXH 3D2UD 1G9ML 5GIRA 2ADFH 1UQSB 4PBWD 2R0ZL 4OF0A 1X3DA 3NFNA 5D6CB 5DJYB 2BNUA 3BRGC 2FGWL 4UZGA 1L4IA 3D85B 4YIQB 3RZCB 2W60A 5DRXA 4LSSH 1ORSB 3DUUA 1DUYB 4P46D 3NAAL 4BJLA 1I7TB 2OZ4A 2UWEA 3FB6A 2EDWA 5K33A 1I1FB 2X4NA 4GRWF 2DS4A 3TN0C 2HTKC 1FJ1B 3FT2B 4WW2C 3F7VB 3JUYA 3O6FA 1DBKL 4RDQF 4YHPB 3MBEB 5CUSL 3UP1A 5L8KB 3MGOB 1J0IA 3DX9B 2EKJA 3VXRE 3MUJA 4XBGB 2ZUSA 3HPJA 4XNZB 4G3YL 1QQDB 5FGBA 3FT3B 4H0HB 3BYTA 3JTTA 1HCVA 5KVDL 4F15C 4YFEA 2NY7L 2YC1B 3RY6A 3VCLB 4OQTH 3BZFA 5C8JA 4JFDB 4LBEA 3ARRA 2GITB 3QUZB 5JHDE 1XIWA 3MJ8B 2X1OA 1A4KA 2XKSA 1EFXB 1ZA3A 5CEZE 3KLHD 2YUVA 4U1LA 4LARL 4P9HC 3IDIA 4JY4B 2V2TB 5F3HA 3IDYB 1WFUA 1D5MA 3B5GA 4BA8A 3O41A 4RBPH 5TDOB 4LSTL 3OKOB 1S7QB 4YR6A 2VABA 2VXQH 2FX8L 1H3PH 1TMCB 4BKLB 5I18L 2FH6A 4KI1A 5ETUA 6FABH 1GGYA 2FD6H 1A7OH 1YYMH 3U46B 5E2WH 5HHPA 4WUUD 2CKBL 2F53E 5E8EB 1Q0XL 3AB0C 4M5ZH 1ZMYA 1I85C 4IMKA 4WI4A 4QRUB 1F4XL 4YXKH 3SO3B 1Q9OA 1TQBC 4UT9H 1ROWA 1U8KA 2XZAH 4HFWA 2QSVA 3O3DB 3L1OL 3ZDZF 3MUGB 3TF7A 3D1MC 4LOUD 3VXRA 3ZDXE 3N9GH 4CUCA 2XG5A 4PBXA 1N4XL 4RQQB 5DD6A 5HYJD 1KPRB 3TA3C 1Y6MR 3BP5A 1F11A 1JZ7A 3ZKXC 4FQQA 2E7MA 1RZIA 4WGVB 4H20H 1U6AL 2IQAA 1ZTXL 1D6EA 3ZDYE 1W0VA 5C0ND 4BFIA 3OKDA 2EE3A 2CQVA 2OR7A 4K7PL 4XVSH 5JHDA 5INCA 5JLZB 1MCCA 2A6JA 1CK0L 4OZHF 4OFYD 1T03H 4GW4B 1BHGA 3HNSH 4H0IA 3CFEA 2OI9A 5GJSH 4R8WL 5D1QC 1KC5L 1PAMA 1IBGH 2F8OA 5KVFH 1F45A 5D7IF 3RVWC 3DI3B 4OD1H 2UZIL 4KXZH 4F2MA 1F97A 5BOPA 3BDXA 4JRYD 1MCOH 4UOW0 2Y06L