1A6ZA

Hfe (human) hemochromatosis protein
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
272
structure length
272
Chain Sequence
RSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HFE
publication title Crystal structure of the hemochromatosis protein HFE and characterization of its interaction with transferrin receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Mhc class i complex
total genus 61
structure length 272
sequence length 272
chains with identical sequence C
ec nomenclature
pdb deposition date 1998-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a6zA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1a6zA01
2XT1B 1AY1L 5C0RH 2RQ8A 4K7FA 1MCOL 1S9KC 4Y19E 1GPOH 5GSRB 5E5MB 4ZUTA 2X9XA 3QUYB 1HZHL 2YD1A 4LIQL 4XI5D 1I3GH 5HYFA 1B6DA 1IKFL 3LEVL 4HMEA 4K7PH 3CUPA 1Q0YH 1R24A 1D9KC 2VLRA 2ESVD 4IRJA 3LV3B 3QZWB 4MCZB 1XF4A 3VXSD 5FKAB 3F7PC 3RDTC 4I1NB 3CFKA 1RK1A 4TSBH 2JCCB 1EO5A 1UH2A 3GSOA 3GUTB 1KSRA 3PHOA 4KJPD 4OUUA 4CU7A 1TVHB 1P84K 3BPNC 1KTLB 5DI8B 3QO0A 4WU7A 4U1SA 2VRAA 3S37H 5IW1A 1EVUA 4JFPA 4EDXB 3Q5TA 4Z7OE 1FVDA 2GUOA 4UUJB 5E8DH 4ZXBA 1S5IL 3SBWA 4M7LH 5I1CH 1IQWL 3EO0A 4OZFB 2HN7B 1UM4H 3N85H 4CRPA 4OFPA 1AC6A 3K4ZA 3P0YH 4H88H 4X5XA 5T1LD 3TLRA 2F74A 3KPSB 5T33H 3H0TB 4JGUA 5GHWL 3QUZD 1ZKAA 3RAJL 4L3EA 5DJAA 2ERJC 5MI0C 3G6AA 5EA0L 5EU4A 2Y4SA 1CK0L 4EXPX 5HHOD 4ZFFB 1R5IB 3O2VL 1CFBA 1IAIM 4TSAH 4F7EB 2WK2A 1CE1H 1HILB 3G5XB 4O9HL 4LRIC 2CLVB 1YPZE 5JR1L 5IG7A 3V5KB 5DJCA 1MCKA 4CN1A 2OTUA 5MP6H 4XCEB 4PIRF 4Y5XC 1J5OL 6FABH 4HHAB 3S4SB 3N9GH 1HSAA 3EOBB 5GXBB 2NXZC 3AS0A 4DAGL 3HE7D 5DQ9A 3P4NB 4PDCE 3KJ4C 4WTZG 2YUXA 5GQBA 3WS3A 1ZLVK 3K7UA 1KPRB 2AV7A 5FYKD 2BNRE 3HZKA 2OCFD 3S96B 4Z78A 3PXJA 4M6NH 1HNGA 2ID5A 4G9FA 1CL7H 4JM2F 5DLMH 5IK3A 2AQ2A 3E8UH 4Q9QH 4HUXA 4PJ8D 4X6EB 3MRFA 3E3QA 5F3BB 1G7QA 5I19H 1QSFD 1T5XA 3DHMA 4ZDHA 1GXEA 3GI8L 1YMHA 1W0VB 5CMAA 5HHQB 3WHE1 1FL6B 4OQ1A 3EIFA 3L3GA 2V9QA 3HMXL 4J1UB 2YZ1A 4QT5A 4N0FA 3HI6L 3QCVH 4KRMB 5HJ3B 4F7TB 1INEL 5IFAH 2Q7NA 2H9GB 4LHUA 5TGBB 3EUUA 4XNUH 4PLKD 3T4YB 3QUXD 4JN2A 4G6JL 5KVFL 1NEZG 5TQ0H 1EGJA 3B5HA 4QOKA 1FNEB 1JWSB 3ULSA 1D7FA 5ECJE 4RAHA 4PJCF 4U6VH 3UTSA 1AD0A 3FTGB 1RJYA 4NBZB 4DGYH 2WSKA 1FP5A 1SM3H 3FQUA 3MA7B 4MX7A 3U7YH 4I2XE 3WMSA 3T0BA 3L3OA 5EU5A 3IGAB 5D7LB 5E8NB 4Y4KB 4FZ8H 2IADB 4ZODA 5BZWA 4YDIL 1CLYL 1OTSD 3QIUB 4YHLL 1CL7I 4NC2B 2YHGA 4JDZA 5IB3A 3SOBH 4IDLA 4R4BB 2OJZL 3JUZA 3V8CA 1WCBB 3DRTB 2LV4A 4PJGE 1RQ5A 5HDQH 5J6GA 3QIWB 2R4RL 1RUKL 1PY4A 1MNUL 5TF0A 4O51B 3GKZA 4GRMB 3O4LB 2Q86A 4RWYL 2AJZA 1XFPA 3E1F1 5HXMA 3VWJC 1UVQB 3DXAA 5CWSB 2FJHB 4GXUM 4FQJH 1FJ1B 2VB5A 3MRLA 4OIBA 3KYMB 1DVFC 5DRZB 4PJ7E 4IOSD 4PJ5E 3DVIA 3TP4A 2HKHH 2BVPB 5E4EB 3TBTA 1LEIA 5BS0D 4C56A 4J3SA 32C2A 4JFFA 1KELL 1KJ3L 4PJFA 1ZS8B 4LSDA 4XZUA 4P9MH 5E6YA 1NBVH 4ZD3H 3FQNA 1UYWH 3UJIL 3CLFH 2E9JA 5CEYA 1N6VA 3RWCA 4RMUA 3PDOB 4G6KL 5JLZA 2V2TB 3GSNB 4OLYL 3CVHB 3RZCD 1A3RL 5DZOA 1CLCA 3DO7B 5A40E 5FYJD 2W1NA 3TZVD 3AY4C 2GJ6D 5IVOA 3SDAA 4DGVH 1VACB 1FGVL 4YHPA 3VWKA 1KENH 1XGRB 1XF2B 4M48L 1RMFL 4OAWB 4PJ9A 4WV1B 5DJDA 3SDCB 1M05B 1J12A 3QP3A 4NZJA 3TPUB 3NCEB 3IJSB 4QRPE 2GTZA 4WW2A 3TJHA 4TUJA 1QHOA 2E7LA 4NM8H 1JWMB 3ULVL 2ITDA 4NIKB 4FTVB 1EEYB 4Z9KB 2MSPA 5KAQF 4P46C 4ODXB 1MJJA 3BKYL 4WO4C 4FQ1H 1LE5B 3FZUC 1GHFL 3FN0H 3MRBB 4M61A 2LVEA 2X6MA 3QZWG 3QWOB 2IBZY 3EYUL 5GGSB 4LLUB 4NKOB 3V5DA 2CDFB 5AZEH 3ETBF 4Y5VA 2RCSH 1M71B 1X4ZA 3F6LA 5GGVH 2CLZB 2H2SD 4HUNB 2DQHH 4P23C 3ME0A 3T0EA 1J05A 1DQJA 2AK4D 5KSBF 1OQOA 5JPMB 4Y88A 5ALBL 3ARQA 4XMKL 3WDJA 4BKLB 5DUPH 3OKDB 3O4OC 3DECA 3M8OL 3WDIA 4OCYL 4PLNC 1AHWA 2EKSA 4HKJA 5C0RL 3IVKB 1VEOA 1I8MA 2V5TA 1GPOL 1HH6B 3OKEA 2ZUQB 4XB8A 3VXOA 5E2JA 3VD9A 3B2VL 3D9AL 5KSAB 1OTTC 2DMKA 4PP8C 4XWOD 4K7PL 1G1YA 4Z7QE 3QXAB 1TMCA 4P3CL 3RL2B 1FFNA 3HZVA 3K2MC 4ZSOE 4W6XB 3TGXA 1D9KA 3KPQA 4NZRH 4TSBL 5DHXB 5K33A 3TVMD 3MRPA 5F71A 3FB7B 4OF3A 4KKNA 2NY4C 1HOCB 1QQDA 4Z7UF 2Z35B 2VIRB 5SWZD 35C8H 3TNMB 3S37L 3S4SG 1DLHA 4Z7VE 3V4UL 1WT5C 2D7NA 3RTQD 5CIPB 5E8DL 2F58H 4JN1L 5TH2A 5JIPA 4M7LL 1TIUA 5I76A 2FGZA 4CW1A 3OXSA 4CMHB 5I1CL 3EDFA 1UM4L 2EDKA 2IH3B 1MCSA 3N85L 3ZKND 2H32B 1GOGA 4K8RC 1P7QB 1EAPA 1EK3A 2AXGB 4L4JA 4X8XA 5C6TH 4H88L 4POUB 3TO4D 3GSWB 1IAOA 3UJJH 3DRQB 1ED3B 3RVVD 3QHZH 5CJ5A 4EXKA 2HT4D 1CXKA 3C5JA 2FJGA 5FIEA 4AIZB 3EBAA 2JELL 2Y9RT 4WWKD 5FM8A 1FG2B 4XNYH 1S5HB 1FZKA 4JJHA 2GAZA 4TSAL 4MJ6B 1ZHNA 4BH7B 1CE1L 1X5ZA 3SGKA 5GGTA 1SJEB 3RY6C 3MV8A 3FFCA 3GM8A 4LSVH 3VXTA 5I6XC 5MP6L 1AGFB 4JQVC 4KK9C 5D1QB 4NT6B 3IKKA 4TSCH 6FABL 4I48B 4LRIA 3N9GL 4IOFD 5AAMA 5ICZA 2VL5B 5ACZA 4Y5XA 3G5ZB 4PY8J 3IS0X 3KPOB 4OB5H 4YEFA 4WFHE 3BT2H 3KYNB 3MX0A 3CSPA 2W0LA 4M6NL 3HG1E 4U3XA 4CDGC 1CL7L 5DLML 3E8UL 3V4PL 4ALAH 4Q9QL 2IG2H 4EUPG 2NY3D 2XPGB 3NIDE 4YHIB 3BIKA 4WI8A 3F5WA 5EZLB 4C59B 1JYVA 1OM3L 3VFWA 4U1HB 5IBUB 1D5BB 4LF3A 2A73B 2ICEA 2J2ZA 1J0JA 3MRGB 3SKOA 4DKDC 2CR6A 5I1AA 1CXEA 4A2MA 1XF1A 3MYJA 5BQ7B 1MCLA 2DYPD 3QCVL 5CBEA 4OIAA 2A38A 3MOBH 2BNQD 4GG6F 3OKOA 1ITCA 4I13B 2MWCA 4PPTA 1Y0LA 2GSGA 1GGIH 1HHKB 3RHWF 3MO1B 1QA9B 5TQ0L 3W9DB 4D0BA 2JJWA 4U6XA 4CMMA 2HTLC 5KS9E 4Y4HD 4JZNA 4U6VL 1P4IL 3W9EB 1IEHA 3KLAB 1BBDH 3MRNB 4OFYD 4DGYL 3HC4H 2HJKB 1G7HB 4RRPA 3U7YL 2EZ0C 1RZ7H 2P43B 1IM9B 2Q87A 1B0GA 3RGVC 1BFOA 4FZ8L 4BM7A 4JR9H 3IU3A 4I4WA 1T7VA 5E9DA 1T04A 1P1ZB 1U3ZA 3PE9A 4OCRH 4ZFZB 4UI2A 3GMPB 3SOBL 1EAJA 1R5VA 3AS2A 5D1ZC 3ZYZA 3TPKA 3ARZA 4KDVA 5ID0B 2BJML 3QDGD 4FMFA 5EZJB 3G6JE 1QSEE 4NO0B 4HCRA 1JPSH 3RL1A 4HKBA 5H94A 1UEMA 2EC8A 3BRDA 4MA1C 4Z7WF 1WBYB 1N2RB 4OFDA 1P5UA 3ERYA 1SY6H 4L3AA 1K8DA 5CINL 1YJDH 5IV2A 1XR9B 4H25A 2PYFB 2BERA 4U1JA 3VWJA 1JNJA 4QXTA 4JHAH 4MVBD 1JZ7A 2BSSB 2DM3A 1F58L 5CJOH 4GBXB 1FN4B 4X4XA 4LLWB 4MNHB 3RJDA 5DDHA 4P9ML 3MGTA 2EECA 3EYVA 4MNQE 1JNHA 1NBVL 4PJIA 4ZD3L 3ZYIA 3MFFB 3JTCA 4I8DA 4KHTH 1G9NL 1UYWL 4KROD 4YHYB 4QHNA 1GZPA 3RNQA 2P7TA 2XOTA 2LFGA 4XNMA 4XC3L 1FZMB 3AC0A 2VDLH 2EC9U 4S0TD 5HGAB 1XR8B 4ZFOA 3WLBB 2LABA 4JLRA 1AXSB 2HRPH 1TENA 3AU1B 1ADQH 1I7RB 3GO1H 5LAXB 4ELKA 1OLZA 1G6VK 3WIHA 4BUGA 2HMIC 1G0XA 3MNZB 5IJKC 1KENL 4UNTA 3GSVB 3BP6A 2ARJQ 3W11C 4MA3B 3FJTA 3GKWH 1BAFH 3VXNB 3VE0A 5ILTH 3DTXB 3LRGA 4L8BA 4QYOB 1KJ2H 4M1CD 3RP1A 2PUQT 1W8OA 3OX8A 3OAYH 5EPMA 4NM8L 1VEMA 1X6LA 2O5ZH 1NKRA 5MHSD 3U9PH 1MI5A 2ADIB 3BP4B 4AH2A 2C5DC 4ZAKC 1CG9A 3D39D 4M9OA 4FQ1L 1TZHB 4OV6F 5B4MC 1NJ9A 1IBGH 5I1EL 2JIXD 5EN2B 4P46A 4RMQA 1XGYL 3H3KA 3V0VA 4LCCB 4E42A 2OR9H 2VLJB 1QBMH 1UA6H 3VXRB 5I15H 3HS0B 3FO1A 1MWAB 3LQAC 3QEGH 2CQVA 4KTEH 3CFIC 1RZKH 4Q74A 5AZEL 3VFTB 1MRDH 1XZ0A 1YPZA 2RCSL 1OD9A 3GRWH 4DWHA 1T5WB 3IF1B 4KFZC 5GGVL 2YMXH 3EO9L 2F54D 4HKZB 4B7IA 2D03H 1TVBB 3QAZB 4LLQB 4NOFA 1F8TH 4RNRB 1DEEA 1UG9A 1NGZA 4P23A 3F65A 4P2QD 4XCNB 1YN6B 4U05A 3MZGB 4QHKJ 3B9EA 4LPYA 4CVZB 4POZD 1KIPB 5DFVC 3ARSA 4DZ8A 3EYOB 4J3VA 2HRLA 2B0SH 3V4VH 3BVNA 3T0VA 1JHTB 3G08B 4M00A 2L4OA 2V2XA 2WW8A 3ARED 4YGVA 1U2CA 2IPTH 2GITB 4JKWA 3T8XB 2VXSH 1RIHH 4XTRC 2ZG2A 2O93L 3FO9B 1AKJA 1WZMA 4BFEA 2UVFA 3PWVB 3UZEA 5A2FA 3KYKL 5FA4B 43CAB 1U0QA 3CH8A 2BHYA 2VZOA 4M5ZH 4I5BB 2ICWA 4IHOA 5F21B 4TNVF 4E41D 4X6DF 2IANE 3WN5B 3I84A 1H3XA 1KJVA 3LN4A 3ALPA 4G42B 4MXWH 1D6EA 1VGKB 1VERA 5ERWA 3ZYOA 3EYQD 3WLWD 4LSTH 1I1YB 4ZUWB 5C09B 2UY6A 1QFPA 4UINH 4K3DH 3L3DA 5C07E 2QSVA 35C8L 3GI9H 1F6FB 4IMLB 4K3EH 2IBGA 3BDYL 4XC1H 4XPHH 5KG9A 2F58L 3QNYB 3I75A 5DD3L 1OB1A 3RFZC 4KZEH 1WT5A 1QRNE 4Y2OA 3T65A 2YXMA 5GIRB 4ZTPH 5C0GB 3U0PA 1K4CB 4IM8A 4IRSD 1HN1A 2PXYB 5C6TL 1WAAA 3TIDA 4OLVL 1F00I 2QADD 4WFFE 4XP1H 3UJJL 3MRKB 3FQWA 4PD4K 5AWNH 3THMH 1F3DH 4WW1A 2ZUYA 4X5WA 3KS0H 2BVEA 4H8WH 4TPRH 4JFOA 3WIFA 4X7TA 3B8SA 2CRIA 4DZBA 1NUNB 1IEBB 5IBUG 2FIKB 1KTRL 1RK0A 1QLEH 1HHIB 2OJEA 5LGHH 4LSVL 4WGVB 4PJCE 5D2NE 4PJ7A 4TSCL 5ANMA 4H1LB 3S35H 1Y18A 1YEIH 1L0YA 3HA0A 5EWIH 1E6JH 4YUEH 2NXYC 3Q3GA 1KPVB 4GAYB 3DSFL 3BT2L 2AJSH 3NH7H 5ACMA 3PWJA 3C08L 3KXFD 1XMWA 4G5ZL 3RVUC 3O11A 4LDLB 4KMQA 1DP0A 5DF0A 4RGNB 4ALAL 4RZCA 2IG2L 1QKZH 3HLAA 2HFGH 3ILQD 5I1LB 3S3SA 5IVXA 3GSRA 3OMZA 1M6OB 1S7RB 4YXKH 1FVCB 5EULV 2YA2A 3C60D 4M93B 1A9BA 1XGQB 4ONHB 3ARBB 5E8EA 4MSWA 5D96B 1FYTE 1R5WA 5A3IC 2NTFB 1HEZB 1SEBB 3IETA 3RX8A 2YD4A 4F7PB 1A1NA 1UCTA 4ZUSB 3LB6C 2PCPA 3MOBL 4MNGB 2ZUXA 4N9GA 2MFNA 3ARFD 4NQCB 2AV1A 1U8HA 3UX9B 2I24N 1MEXH 4TNVK 5C0BE 2VQ1B 4M7ZB 4NSKA 5DWUH 4WI5A 4AM0B 4DN4H 3PV6B 3HC4L 5GS2H 4GXUN 3DROA 3ZTNH 1RZ7L 2A6DB 2MNUA 4JR9L 1I1CA 2AABH 3K8MA 4B7LA 4P2RD 2B5IB 4X80H 3WHXA 1X5KA 3PGCA 1IC5H 1QPPA 3RGVA 5TPWH 4UIMA 5DJYB 3N0PB 3CPLA 4RIRB 1JPSL 4LCUB 3UTTD 5BO1H 1U8PB 3OKMA 2IFGA 5D1ZA 3GMOA 4NQEE 1SY6L 4PJDB 4Z0XB 1RZJC 5CJXC 1YJDL 3UJTH 1A4JB 5I0ZA 3H6JA 5D7KE 4MQXC 3GSUB 4JVPA 4E9LA 3CXHJ 1PKQB 5ADPH 1C5DA 2ATPA 1A6UH 3CC5B 1A7NL 3LDBB 3V6OA 3MNVA 3P3YA 3C9NA 3DIFB 1UWGH 3FT2B 5T3ZE 4GKNA 3C87A 3F7VB 3X14A 2R56L 1OAZH 3SPVB 3OKKA 3ALXA 4P2OB 5DHVA 1ORQA 2VDLL 3I3BA 4MWFB 3QR2A 2YPLD 5IVZA 5D7JB 5MEPA 5FO8B 4NNYB 5KSBE 2HRPL 4MS8C 1IGYA 1ADQL 3LRSA 3FOMB 1G6RA 1ZA6B 5IMLA 2MOVA 4P59H 5CEZE 4J8RA 1IGML 2PNDA 4V1DE 4JM2C 4JRYA 5DXWA 1TQBC 3IDGB 3BW9B 5F7KC 5I71C 2IAMD 3FT4A 4Z7VA 4Z76B 2C3WA 1BAFL 3PWUA 3FOLA 5ILTL 5J1AB 4YHKH 5FUZH 3VXUB 3H9SB 4V3DB 1EMTL 4JRXA 1S7SA 1KJ2L 5C08E 1AJ7H 3SE4C 4UQ3A 4R8WH 3B5GA 2O5ZL 2D7TH 3U9PL 1H15B 2FX8L 3OG6B 3PWPE 4MLIA 4ODVH 3P77A 3KWWB 1OP5H 2QQNH 5I8KL 2AEPL 3MV9E 1I8IA 1JPGB 5IMOA 1LE9B 2VLRD 3BZDA 3K2UH 4NNPH 5GS1B 4IRJD 2UVEA 1GGBH 5JHDE 4YK4C 4XBPA 1OGAE 1ZHBA 3O2DH 4LVNB 2OR9L 3DX6A 4Z7UE 4ZAKA 5EU3A 1QBML 1UA6L 5I15L 2R8SH 1K4DB 5HY9A 4V3EB 3QEGL 2YPVH 4JPWH 1F42A 1RZKL 2Z92A 3GSQA 5D2NC 4C83B 4GUPA 1YEHH 1MRDL 1U3YA 2YMXL 2ZSWB 3RKPA 4ENEC 1BD2B 1EX0A 3WO4B 4R0LC 4EIGB 2D03L 3F6IA 1O0VA 1F8TL 3LZFH 4NO5A 1U8LA 1YMMB 4ZXBD 5GS0L 4X98B 4JG1H 3RIFK 3AVEA 4NKQB 2DKUA 3BP5A 4UT9H 2MQ0A 5CSBA 2BP3A 4MXQC 3C09C 3V4VL 5ITFA 4U0QB 2B1AH 4PJXF 3HG1A 4Y4FC 4NQXB 3WBDA 3QB7C 1NCNA 2PW2A 1TDQA 1RJLB 1XH3A 4YWGH 4L8CA 5DEGB 2VXSL 1OHQA 1PX4A 3JWDC 1RIHL 4L3ED 3QA3B 4Z0BH 1FL3B 5HI4D 2FJFA 5BVJA 1IGIH 2DQIH 1AE6H 5IFJA 4M5ZL 2UWEA 2L0DA 1P2CB 3WEXB 1CD1B 4JFQA 4O58H 3HPLB 3QDMB 5MENE 4AEEA 4FQXC 1T20B 1PQZA 3DOSA 4FFVC 3STLA 2E9WA 3L6FB 4UINL 2QKIA 4K3DL 1M1SA 1ZT4B 2N7BA 3GI9L 4K3EL 5F89B 2AEQH 4WTXA 4XC1L 4XPHL 1KCLA 4H1LG 4B0MM 4PJBB 4P5KA 4N8VA 1GRWA 3FCTA 4KUZL 1T7WA 4U1IA 5EU6A 5T5NF 4ODSL 3VFUB 5AD0B 1I7TA 5C0EB 2QSCL 4KZEL 3S3PA 4HH8A 2X1QA 3CVIH 2ESVB 4ZTPL 1CI5A 3BWAB 3D3VE 3D6GA 5B39A 4L9LC 4G9FD 3VFNB 5EO1B 5F9DC 2VUYA 4XP1L 3THML 5AWNL 3HI1A 5GSVA 2NZ9C 3AM8C 3GJFK 5DJ6A 4M1GH 4M6AA 4D9QD 4G8GB 4H8WL 4TPRL 4KK6C 5JZ7C 1X5XA 3G6JA 5IKCA 5CBAA 3BD3A 1HCVA 3L3IA 1TVDA 3DMMC 4GG6E 5EBWB 4OZFH 2R4SH 4MMZC 1QLEL 5FHBH 4ETQA 1EEZA 2E8YA 1RULH 3KYOA 4XPBH 1RUPH 1BQUA 5LGHL 3QJHB 3HMWH 4AENA 1LD9B 4LHUD 2VISA 5HYQA 5J11C 4CBPA 1AGEA 3TF7C 1Z3GH 2J8UA 2YS4A 1OY3B 5SWSA 3QQ4A 1CGSH 3KPRE 3BZFB 5I9QC 1G7MA 4QOKD 3P73A 5EWIL 5FO7B 1WWAX 3KPTA 3T1FA 4YUEL 1UM5H 4WEUD 4KGJA 3UTSD 1FRGH 3PGFH 3KYAA 4JPKH 4GMSL 3SCMB 1Q9WB 3QULA 1NAMB 2WINA 4MNQA 4R26H 5A16B 3O45B 3NH7L 2DI7A 1HXYA 5DMKB 2YD2A 1IGTA 3HE6C 4Y1AA 3BKMH 5CFHA 4W70A 1IM3A 4XP6H 3QRFM 5E00B 4KDWA 1HI6A 4Z7WE 2OM5A 4LFHG 2AJYH 1QKZL 1A7OH 3VFMB 1MCNA 2HFGL 4ONOA 3IJYB 1QFWM 1U2HA 5GRZA 2DLIA 3SY0B 2FYYA 1CVRA 5CEXA 1W0WB 5IB5B 3SO3C 3DXAD 4XBEH 4QY8B 4GRWB 5FUOH 4U6HB 4TYUA 3GMLB 5AUMA 4PRAA 2X7LA 4JFDA 2P5EB 3NPZB 5EO0A 4KU1A 1DUYB 4NC0B 4Y2DB 1IGJA 4C56D 5DTFA 2NW3B 4KPHH 5FK9B 1MEXL 2FL5A 1JP5A 4JFFD 3VFVB 2DM7A 5DWUL 1FDLH 3L3JA 5F7WC 5DC4B 2X70B 4OZIA 1N4XH 1JK8A 3BESR 5C6WH 3ZTNL 2GK2A 3G6DH 1YUHB 3UCRA 2AKRB 3IFLL 2AABL 1A4KA 3BQUC 3NCJH 5GRYA 3B83A 2FGWH 3KDMB 3OGCA 3HC0B 3HZYB 2PETA 3ARRA 3ILPA 3C6LC 4I9WD 2AI0L 5TPWL 5DJXA 3SDAD 1WBZB 2VDMH 4R2GD 4G8IA 3VWKD 1ZSDB 3D87B 2E5EA 5I17A 1JN6A 3BRGC 5EIIB 2PO6C 4PJ9D 1QZ1A 1QVOA 4MDJB 4P3DB 4XXDB 5F9OH 5E2TH 3BUTA 2WZPD 4XAWL 3TJHD 1T1YB 3KHOA 3MCKB 8FABA 5D1XB 5DC9B 3O3BB 5F6HI 3LOWA 1A6UL 2YD8A 4OLXH 1G84A 4LNRB 1HXMB 3VXSE 1Q1JH 5ESQB 1UWGL 5BV7B 1T2JA 4K07A 3SGDH 5D2LF 1HNFA 1OAZL 3E6HB 1K2DA 2AJUH 2X4OB 4OFKA 1U91A 3JVGC 1I3RB 5IIEA 2C3XA 3HAEB 4EN3C 4XCCH 4ZYKB 2ARWA 5DK0A 4CGTA 2IANA 1R3IH 3BN3B 1CE6B 5HPMB 5ESVB 2CPCA 4JO2H 5D7IB 1EV2E 5JMRA 3T0ED 4P59L 1QR1B 1E27B 4PRPE 1ACYH 4X4MA 2EYSB 4MS8A 3ZT7A 1RUQL 4ZTOH 4XAKD 3UTZB 1CDJA 2PF6A 5C1MB 3IXAA 5GS3A 5FUZL 5JOFA 4HDIA 1B0RA 2ADJB 4JM2A 3QI9C 5FV2A 1RI8A 4R8WL 3O6FC 2D7TL 2I07B 4HLZH 3IFOA 5KSVA 2IMNA 4PRNB 4QRUB 5HHOE 4ELMA 4ODVL 5J6HB 2QQNL 4X6DE 3SE4A 2DQFB 1KB9K 2DIJA 3O3AA 1NGWA 3K2UL 4NNPL 1GGBL 4NUGH 2X4NA 4TRPH 4YDVB 4S1QH 1EO7A 3UYRL 3B9KB 2R8SL 3LQAH 4OQTA 1D9KD 4I3RL 4WNQA 4BELD 4CNIB 5IR1A 4JPWL 2MHAB 5KOMC 4MJIE 3K74B 2OMNA 1YEHL 1A6AA 3OJ2C 3DV6B 1I1RA 2F53E 3QH3A 1ORSB 4X7CC 5D2NA 5FYLH 4UILL 5FYKE 4ODTL 1EBAA 43C9B 4PRDB 3DVNA 3Q6FB 3VGAC 3LZFL 3L95B 3QJFB 3PDDA 3VDCA 4JG1L 3VRLF 1JNNL 3R0MA 4R0LA 5DUBA 4F7CB 2YRZA 1DANT 3OR6A 4FFYL 4UT9L 5EUOA 3VGEA 2XWTB 3SE3C 4D9RD 2NX5A 4HZLB 1KNOB 4KHXH 5E56A 2VDNH 2B1AL 3MMEB 4D94A 1I1FB 4O2FA 1QSFE 2DJUA 4OCLC 4JREB 1WQVT 3NPSB 2RFXA 4NBYB 2P8PA 3KPMA 3V5HB 3CFBB 3T04D 5HVWA 4MXQA 2OK0L 2G2RA 5IEHB 4Y4FA 5C92A 4Z0BL 1X5AA 3ECBB 5EG6C 1A6TA 2C3GA 1EJ6A 1IGIL 2DQIL 1OD7A 1T0PB 5HDLA 4LQ1A 5SV4A 4HPOH 1DTUA 4R3SB 3MA9H 1BVLA 2HP4A 4O58L 4QTIH 4LLMB 1MCEA 3MV8D 1S9VB 1S78C 3FFCD 5E2UH 1U8NB 5IB1A 1BQHA 4NNXB 2YC1A 1T83C 1DQMH 4L8SB 4DUXA 3WUWA 2AEQL 3CK0H 1RVFL 1I7ZA 4FQXA 4HV8A 3WYRA 4R96A 3KPNB 4NDMB 5A2JH 5BVPH 3GRWA 5C0BA 3LN9A 4PGBB 3PHQB 3WS6C 4XH2A 1GC1C 3CVIL 2R39A 3VFSA 1S3KL 4K8RL 2XN9B 1NCTA 2WM0A 4LLAA 1E0OB 2AJVH 3OXRB 4KTDH 4O2EB 3BDXA 4UIKH 2C1PA 2X10A 4UAOB 1PD6A 4OI9A 2A1WL 3ARYA 1U36A 3LKOA 4QHLB 3L7FB 1WITA 2QQLL 4M1GL 4L9LA 3H8NA 2YWYA 2HKFH 2W0FA 2W92A 1DN0B 2COQA 5J12B 4XI5C 2KL6A 4HLJA 4EI5C 3NCYS 1ZWIA 3BYYA 4ODHH 1OF2B 2R4SL 3QNZA 2XWJA 4R4NC 5BS0E 3H9HA 1CFQB 3OKYA 4UT6H 1JYNA 2H32H 2V17L 3TA3B 3S5LB 1RUPL 5KVGL 4LKCB 2JK5B 4JVUA 4YNYA 2R2EA 3DMMA 3HMWL 4KJWD 2HTKC 5C0JB 5L6YH 1IC4H 1Z3GL 5CILH 2W0PA 4P5TB 1CGSL 1ZLSH 1ZLVH 4MD0A 3TO4B 1QLRA 1UM5L 4KJPC 3TF7A 1FRGL 2VN7A 2ORBH 1T1XB 2VDKL 4G8EA 4JPKL 4R26L 4L4TB 4F9PC 5J4MA 2LTQB 2BY1A 5FYJE 3BKML 5IUSA 4WWKB 4XP6L 5K9KA 1PVHA 2GJ6E 2R1WA 4O2CA 1FNFA 2JTDA 5E9DD 4LKXB 3FQTB 3MQIA 2AJYL 5C0FB 3U36A 5GGUB 1U58B 1A2YA 3HE6A 2UZIH 4P57B 3TYFA 4F58H 4HJ0D 5B8CB 5CD3B 2BOBB 4JJ5B 4PJEF 5DQJA 5F9JA 4MQTB 1HHJB 3AB0B 4RMSA 4XBEL 5FUOL 3QUZC 1RAMA 2AJXH 3IYLW 3NN8B 2HVKA 3AAZB 3O41A 4JZOB 3LEXB 1HSBA 3U4EB 4GRLA 4OZGA 3VWJD 1FV1B 5C08A 3SE8H 1W72A 2XKNB 2YKLH 3CFCH 2HG5A 4N68A 3VFRB 2ENSA 2EDHA 4I0PC 4KPHL 3BZEB 4M3KB 4QHMA 1FDLL 1JGVH 1KEMH 1GZQA 4DOHB 2FATL 2NY3B 3OGOE 3T08A 5D9SA 1F02I 5HHXL 2ITCB 3BMVA 1BGXH 2ARJB 1NBYA 2JB5H 3G6DL 5JHDA 2H8PA 2GJZA 3HE7C 3VXQA 5IMMB 1KXVC 3HAEG 4Z7UA 5HVGB 1I8KA 1VCAA 3OG4B 5ISZB 3NCJL 2AK4E 4HWNA 1FZJA 2FGWL 2DYPB 5MERA 1QFUL 3CZFA 2Q8AL 2Y7QA 3UDWC 2I9LA 4X6CF 3BQUA 4PS4H 3LHPH 1DBMH 3VGHA 4JRWA 5EZIL 3C6LA 1ZHLB 4PJ8C 4X99B 2HT2D 1IEAB 4JHZA 4DQOL 1OGTB 5EBGA 1ZVSB 5DURD 1MJUH 1T4KA 4NFBA 4Y4HB 1S7QB 3B9AA 5F9OL 1MCDA 5E2TL 3MRMB 4WHTB 2YBRB 2GY7B 2ZNXA 4QNPF 5INDA 3RWEA 2PO6A 2BDNH 3G5VB 4Z18A 3EZJB 4OLXL 4F7MA 1TETH 4ZPVB 1MI5D 3TH3T 1Q1JL 3ZMRA 4GKSA 3L3HB 4JFEE 1P69B 2K3TA 4BSJA 5TDNB 3B3IA 2VLKE 3EOTL 2AJUL 3BMWA 3QUXC 4HT1H 5TDOA 4KGLA 3BH9B 1LHZA 4LRNH 4P46D 4U0RB 1E6OH 4XCCL 2APBA 5IJVB 5SWZE 2EIEA 3FZUD 1EZVY 3FB8A 2EDOA 3OHXB 4WUUE 3JVGA 2E27L 4EN3A 3P2TA 4JO2L 5C2UB 5FO9A 5I75B 3FO2B 5I8OL 1NC4B 1ACYL 3FL7A 3SDDB 1OTSC 5E1AB 4ZTOL 4LP4A 4IDJL 3R4DA 1GH7A 4PJXE 3VA6A 4G6AC 1LO4H 2R15A 1NBQA 5HYJB 4ODUB 4RA3A 1WTLA 2BOCB 4LEOA 1NMCC 4YQXH 5KSUA 1N6UA 4OTXH 4WTZA 3GFUA 3TO2B 4X0KB 3P4OA 5DVNA 3MROB 5DHYA 3QIUC 3QI9A 4NHUB 5A2LH 2Z91B 2D31B 3MREB 3BGMB 4L29B 2R2BA 1A6WL 1NCWL 1KOAA 3QEQB 1AKJD 3QIWC 4OBSA 5AZ2H 4D2NA 4NUGL 1U93A 1OTTD 2HYMA 4YH6A 4S1QL 4BSWB 3LQAL 4Z8FL 4JY4B 2EDLA 2YUWA 1T7ZA 4L4VA 2KQNA 4F2MA 1A14H 2VOTA 4HUVA 2Q6WB 2A0LC 3DYMA 4OGYH 1LGVA 4MJ4A 2OXGA 5E4EC 1KLUA 4QRSB 1FNAA 4YIQB 4ONFH 3F12A 2NY4D 3CD4A 2DL2A 3RZCC 5KANI 2AXFB 1KEGL 3MACL 2O61B 4QRTA 1CXHA 1PJ9A 1WWBX 1MLCB 1NEZA 4HWBH 4YFEA 2Q76B 4CVXB 4FQQA 3SDXB 1PW3A 4QXGH 3SQOH 1MWAH 2I27N 2JIXB 4KHXL 2VDNL 4JO1H 3MBEC 3ZT6A 3O9WC 1YYLH 5I1HH 1OSZA 2YUZA 3SE3A 3PIQB 2VZUA 1LK2B 1PG7W 3LH2H 1BBJA 4PRIE 2HAZA 3DPBA 5L2JA 1S9WB 2XKUA 4WU5A 1PZ5A 3C5SB 5GRJH 1JVKA 1CD8A 2BNQE 4YC2B 4HPOL 2R1YA 3MA9L 2MKLC 5ALCL 4PLJC 4QTIL 2DKMA 4D8PB 2P24A 2NMSA 3QWQB 4G9DB 1MFBL 3FRPG 3S5LG 3BO8A 3HI5L 4KVNL 1UWEL 1E28B 1DQML 4U1KB 5D93B 2ZOKB 4YLQT 2JB6A 3CK0L 1IAIH 5D6DC 1A02N 4X9BA 2DQTH 4KK9D 3AREB 5BVPL 3RWFB 2MCG1 5HHMD 2H2SC 3IFPB 1NL0H 1HHHB 4AT6B 4NGHL 4YX2H 2B20A 4FMKA 2GYSA 4Q2ZA 3W81A 2AJVL 4XP9H 3DWTA 3QDGE 4OI8A 4UIKL 3L1OH 3VGDA 5IQ7L 3WS6A 5E08H 1N0XL 3QXVA 4K23H 4NKIL 3TWCH 5IW3A 4BK4A 2EIZA 1NLDL 3U7WL 2HKFL 2XWBB 3VXMB 3DVFA 5HSFA 2GTWA 4NFDA 2MMXA 1FO0B 1YY8B 4U1NA 4RX4D 1VEPA 4XWOC 4ODHL 5ENWB 1CBVH 2C26A 4K3JH 5H37G 5I1DB 3IU4H 3BOVA 4OLZL 3QEUB 5T3ZH 4RFNB 4EI5A 2AS5M 4KUCD 2Z8VC 1IC4L 3BAEH 2IALB 2HFFB 3WIIH 4HEME 1ZLSL 3CCHB 3TVMC 1ZANH 1KN2H 4MHHI 3HRZB 5KSAC 1JF1A 3RBSA 4PJFF 4N0RA 4OLEA 5L7XL 1KYOJ 5H2BA 1U3HC 5GSRA 5E5MA 8CGTA 4LPXA 1JNLL 5CZXD 1BVKB 3RTQC 1CICC 3OR7B 3KLDA 5CEZH 2QQQA 4F9PA 3LV3A 3C6SB 2GFBB 5JNYA 3QZWA 4MCZA 1L0QA 2EZ0D 2R69H 3U0WH 5F1IB 2X4SB 4H1LH 4F58L 3NABH 3NGBC 2JCCA 2FHCA 4NO3B 3TYGL 3GUTA 1XCTA 2F9BT 4HAGA 2VR4A 3DI2B 3PWLB 4PRPA 1NBZA 5D1ZD 5JHLH 4U1LB 4WEBH 3RVVC 5DI8A 3RX5A 1A21A 5D70H 1LQVA 3EO1B 4ODBD 2AJXL 1FAIH 2X4TA 3WHE0 1WBXB 3N1MC 4OSUH 3D39E 3MODH 5D2LE 4LPTA 3T0AA 1FNSL 3WKNA 3KXFB 5HHNB 3CFCL 3EFDH 3M07A 3AGVA 4NUJB 2DI8A 4JEGB 5GJTH 5INCA 5EOCH 3W2DH 1JGVL 2DQDL 2DBLH 1AP2B 4I0PA 2E9IA 2JB5L 1A7RH 3H0TA 2F54E 5GZNC 1YEDB 3B8YA 4PTTA 3DETD 5DRXB 3NBNA 1IL1B 1X5LA 1DBKH 2HVJB 3E0GA 4ZFFA 4MJIA 4RFOH 4WFED 4D0CA 4I0KA 3HE7A 1MF2H 5T3XH 3TCLB 1LO5B 4P2QE 4FG6D 3D85A 2F53A 4PS4L 2LU4A 3LHPL 5JIKA 1DBML 4JRYD 4HWUA 2XZQH 4FP8H 3ARFB 1AGBB 5FB8B 5E1HB 1SBBA 1OTUD 4HHAA 1Q38A 2HMID 3S4SA 3MV01 1MJUL 1UXSB 4GG8A 4UOW1 4H5SB 4HWZA 4JRXD 3WKMH 4OI7A 1SEQH 5CGTA 4EI6A 4XBGB 3W11D 2DTSA 3P4NA 1B9ZA 3QO1A 3CFJB 3O3UN 1G9EA 3SDYH 4DVBB 2EDQA 1YDPA 3WFBH 2P1YA 2DBJA 1TETL 5DJ0B 3QFJB 4KI5D 3S96A 4ZOBA 5L0QB 5E6ZA 4E41E 1EO8L 3NMEA 4GAJH 2D4FA 4FS0A 2ZSVB 1PKOA 1N5AB 2YSSA 4X6EA 4LRNL 5ETUB 2C3HA 3ORJA 1HYRC 3CSYB 2ZUSA 3VD7A 4ZAKD 2IEPA 5F3BA 3EDJA 3MJ9A 4KRLB 3STBA 5B4MD 3ZL4H 3CLEH 1QBAA 1JZ8A 1GGUA 1HWHB 4HIXH 3ROOB 3PG2A 5D5MB 1C5CL 3VRLE 2H2PC 5HBBA 1FHGA 5EIVA 4J1UA 2R0WH 3GM0A 3X13B 4F7TA 4MAUL 2DLHA 3BPLC 2QR0A 5TGBA 4YAQB 3H2WA 2BY3A 2FO4A 3T4YA 1LEGB 3DSNA 4AL8H 4YQXL 3M45A 4OTXL 1FNEA 1JRHH 1JWSA 2O5XH 1HQRA 1B6UA 4RISH 3QQ3A 2VABB 3IJHB 1JHKH 2Z9TA 1F3DJ 3MA7A 3KS0J 4OQTL 5L2KB 3GMQB 2YPKB 1HKLH 3IGAA 4Y4KA 1X7QA 4JKLA 4LVHC 3QIUA 3IDJB 3GSXB 1X5HA 1BFVH 4EUPA 1IMHC 1VFOA 1FLRH 1JWUB 1A6ZB 4R4BA 5I1KL 5JDSA 2NY5C 4XTRD 5LJYH 1ETZA 2OQJB 3QIWA 1JTPA 3I3DA 4P5MA 4HMDA 5DEFB 2G5BA 1U8IB 1K5NB 4GRMA 3O4LA 2CSPA 4OKVB 3DUUA 2RIKA 4FQ2H 1DUZA 2A6IB 1S7XA 1H8OA 5CWSA 4K7FB 3Q6GL 4OBRA 4EQ2A 3KYMA 4GBXC 3FAXA 2VZ3A 2GJJA 2WV3A 1SMAA 1CFSA 2CXKA 2BVPA 1DL7H 2B4CC 5EU6D 4HWBL 3MFGB 3N1FC 5CS7A 4RDQG 4MD5B 4QXGL 5T1MB 3SQOL 3RZCA 1P7KB 1ZS8A 4F9LC 1XF4B 1JRHI 2K7PA 3MC0A 1YYLL 5I1HL 4JY5L 2VL4A 1QUNA 2XXMB 1NUFA 4H26B 4HIJB 1FPTH 3LH2L 2V2TA 3GSNA 2HJLB 1DQDH 3MBEA 2E7MA 2V9TA 3O9WA 4PV9B 3CVHA 4BFIB 3DO7A 1REIA 5K9OA 5FF6B 1CDUA 1T1WA 2P8LA 1Z9MA 2DL9A 3QSKB 4JFPB 2X4PB 1FVDB 2E6PA 2GUOB 1XCQB 3QPXH 3RWGB 3LEYL 2KZ1B 4JZJB 3EO0B 5JA9A 3EW3B 1R3JB 1TTFA 1XGRA 1XF2A 3M1BB 3QUKA 1BIIB 4OAWA 4PJHB 1JPTH 5SWSD 1VKXB 3SDCA 5TE6H 3TPUA 3V7AG 1RUAL 3IJSA 4FXKB 4HFWA 4WIQA 1H8NA 2C9AA 2DKSA 4LPVA 2BVUA 3MPCA 1JWMA 1G1CA 4P2RE 4MNQD 1NL0L 4L3EB 5DJAB 4FTVA 4QCIA 1EEYA 2GHWB 4YX2L 1MIEH 3UROR 3P0GB 4Y1AD 4ODXA 1ZGLA 2NXYD 4XP9L 5EU4B 4MCYA 2P5WB 3L1OL 1YEKL 4XVUD 5KVDH 1H3TA 2BRRH 5E08L 3UTTE 4PJEE 1V7MH 4RMVA 1MRFH 1ZV5A 3MRBA 4XHJC 1Q72L 2AK4A 5FGSA 5FGRA 3TWCL 3K46A 2PTTB 4LLUA 2HH0H 4NKOA 1ULVA 1HSAB 5JOPE 3QAZC 2D4DA 4GSDH 1JL8A 3LKPB 4XNXH 4NZTH 1M71A 1CGUA 1MJ7L 1CBVL 5DQ9B 4K3JL 4LCWE 3BZ4B 4M5YH 3KAAA 1DANU 5A2KH 3BP7A 2AV7B 5T3ZL 1Y6KR 1NCCH 2CLRB 3HZKB 4JFDD 1JUFB 5JPMA 5A3ID 3BAEL 4BKLA 2N1KA 1S8DA 3OKDA 2I9TB 1FIEA 3WNOA 3WIIL 1KN2L 3P9WB 3MJGX 2A83B 3QNXB 4HUXB 2ZCKH 4RA0C 3IB4A 1HH6A 4PJIF 2YPLE 4NN7C 3TBSB 4JFEA 5KSAA 2VLKA 5IFHL 1T5XB 3PJSB 5I1IH 1V05A 2FHFA 4QF1B 1U3HA 4X6CE 3X3FL 3RL2A 5DYOB 5CMAB 4RAVA 5CEZL 1KIQA 3ULUC 1ZA3B 4KXZH 1A8JH 3STZB 2R69L 4UB0L 3U0WL 4N0FB 3PQYB 2FD6H 1CICA 3GHEL 4WUUA 1IJ9A 3NABL 4LHUB 5BRZB 1HOCA 4G3YL 3UBXA 4JN2B 3KR3H 2QADC 1W72L 1NAMH 5B22A 2G5RA 2VIRA 3ULSB 3R1GH 3UPRA 3WXVH 4PJXA 3UTSB 2NY2B 3ZHLA 1AD0B 5J13B 5LKNA 4OSUL 5CIPA 1PX3A 1OP9A 4MX7B 4G7YH 3MODL 2VLRE 5DD6A 2G60H 4ZPTA 3EFDL 5EU5B 5IQ9B 5DGRA 5BZWB 5GJTL 2VXVH 1UZ8A 2IH3A 3IRPX 2J3SA 4OF8A 4MQXD 5EOCL 3LKQB 4JDZB 1TFHA 1P7QA 5IB3B 4K71C 3SHSA 5GRWA 1NC2D 3DRQA 1ED3A 1A7RL 4GRWH 2XQYG 2DJ4A 3DXAB 1SJVA 2IAND 3J8F7 2XXCB 3TEUA 5FYKH 1FG2A 1DBKL 1S5HA 2UZXB 2NY6D 4RFOL 4BQCA 5I2IA 4BH7A 5T3XL 1HIMH 1LK3L 3A6BH 4NN6C 3TBTB 5MEOA 4MS8D 5DMJB 1LEIB 3FRUB 2XZQL 4FP8L 1AGFA 5D1QA 3ZSTA 5DRWB 4NT6A 4JFFB 4I48A 1KFAH 3BEVB 4GOSA 2IGFH 1MOEA 4JY6B 4NN5B 4HPYL 3WKML 3QUMA 4KQ4H 5FGBA 1SEQL 3QDJB 3IDUA 4UBDC 3RWCB 5CHNB 3SKMB 2Z93B 3SDYL 3G5ZA 2FDBP 3ZE0F 1F4XH 3KPOA 3WFBL 4HSQA 3HUJF 1G0DA 3KYNA 1E4JA 3D69B 3CX5K 3OB8A 4TULH 1A3LH 1XF5B 4PRHD 1NCAH 4PRIA 4JGMA 3SDAB 5E70A 3K1DA 3CAFA 4N5EC 4R6UA 5F72S 5C0DB 4YHPB 2XPGA 2LE9A 4OKDA 1Q8MA 3REVB 1J18A 4AK1A 4WWID 3ZL4L 3CLEL 1Q9OA 4JB9L 2XNAA 3TBYB 5EZLA 4GKOA 2X1WL 1EH9A 4HIXL 4U1HA 1D5BA 2A73A 3BHBA 2Y6SC 3MRGA 1NCUA 1YNTB 2GTZB 4WW2B 1OW0C 5F6IC 4TUJB 1VGEH 2R0WL 5BV7H 4P2CG 3JV5A 2J12B 4G9FE 4ENED 2YD3A 1KJ2B 4G6ML 4QTHB 1MJJB 4HUUB 3MO1A 3WDHA 4OUOA 2NLJB 5GJSH 3W9DA 1R3KA 3HAEH 2NX5D 1JRHL 3E3QE 1U6AH 1V3MA 1UKQA 4TUKL 4POYA 4D9QE 3AFLA 1CF8H 3P9LA 4RISL 3W9EA 5JW4R 2W65A 1JHKL 3GMRA 2OLDA 3QDGA 1WAAF 4OCWH 4OGXH 2ZCLH 3V5DB 2HJKA 1G7HA 1QBBA 4NHCL 5DZLA 4MXQD 4Y5VB 5EU7E 1JI1A 4Q0XH 4Y4FD 4HXAH 4ZFZA 2XTJD 5IGXH 3JWOC 1J05B 3GMPA 4GFTB 3EYFB 1DQJB 3FONB 5JPNB 1FLRL 4MDIB 5J57B 5HGBB 3MUJA 2QBWA 3BGAA 5EZJA 4J3XA 5DVLA 5E6IB 3JZ7A 4MJ5A 4QOKE 5FV1L 5FYKU 5DMYA 3S9DB 3BFOA 4FQ2L 1C5BH 3WUZA 4HG4J 1ROWA 4HKJB 2EKSB 3C2AH 4XX1E 1JHLH 3TIEB 2HT3C 1I8MB 4N90E 3OKEB 4JFHE 4FQXD 1A6VH 3DV4B 4FFVD 2X42A 3LVEA 3ZKXB 1DL7L 5C0BD 1S7UA 3GHBL 3ARGB 3TN0C 2BSSA 4K55A 1RSFA 1I85C 4GBXA 1FN4A 1X4YA 4P2OC 2FX7H 4MNHA 4QWWC 5IHBA 3U82B 4GW1B 2IAMC 1R3HB 3LSOB 4GKZB 1F3RB 3MFFA 1D9KB 3KPQB 3MRHB 5D7JC 4BYHA 2PR4H 3MRPB 3V52H 1FPTL 1FZMA 1OAUH 1DQDL 1QQDB 3RDTB 4HC1H 5IVXF 4OCSH 1XR8A 3TT1H 4DVRH 2E3VA 1JE6A 3GNMH 3WLBA 3R8QA 1AXSA 5LAXA 5ADOH 1KACB 3K81A 3QPXL 1NQBA 3BPNB 4PREB 1KPUB 4C56E 1NANH 5JZ7D 4CW1B 5C0CD 4JANA 4GAFB 4PJFE 3DMMD 4Q7DA 4EZMA 4QXWA 4NYLB 4MA3A 2PW1B 3LEVH 3MXWH 4KUCF 4LLDB 4RAUB 3VXNA 1EAPB 1JPTL 1LP9F 1MHEB 3D39A 1U42A 5TE6L 1X5GA 4ZQKA 2LU3A 3VA2C 3PF2A 4Y8AA 1IAOB 1GC1L 2ICCA 4GLRI 2OL3H 5GS1C 1MIEL 1R0AL 2VAAA 4I9WE 1AI1H 1IARB 2XICA 1N5YH 3GJFH 3PL6D 1TZHA 1ZHNB 4OLWH 2BRRL 4DCQB 4TVPE 1V7ML 5E24E 1AO7E 1MRFL 3HE6D 2VWEE 2FSEB 3EDKA 2VLJA 3KNBA 3VXTB 4LPWA 3TC9A 1FNHA 2HH0L 1QYGH 3VFTA 1J0IA 4HS3B 4LHUG 2MPAL 3MSPA 4XNXL 5IM7B 4NZTL 4EEEA 4X8JB 2E7LE 4KKCD 4Y5XB 2JF1A 4LLYB 2W9EL 4PYHA 2A6KB 2DM2A 1TVBA 2APVA 4LLQA 4HX1B 2NXZB 5HI4C 1NCCL 4LVOC 3U6RB 4GRLD 1T03L 1Q9LB 1KBGH 1HKFA 2WWKT 3CDGA 4HIIA 2XFXA 1NFDB 1YN6A 1OAXH 3KJ4B 3CFDA 4XCNA 5F96L 3RAJH 3UYRH 4CVZA 1KIPA 2ZCKL 3PWNB 3O2VH 1I7UA 4YXLL 4C55A 4E41A 3I6GA 1L0XA 3EJYD 2HJFB 4CU8A 3BIKB 2N7AA 3WL9B 3MV7B 4IIQB 5ICXB 5JHDD 1T3FB 1FCCA 2GITA 5DVMA 3T0EE 1C08B 3H42H 2ICEB 5C70A 4KRPB 5I1AB 5F7UA 43CAA 4XAKE 1QEWB 3FO0H 2FD6L 1QD0A 1P4LA 4NZDA 1PY9A 2LQRA 1VGKA 2GSGB 3X11B 3KR3L 1MCWM 3C6LD 4ZUWA 5C09A 3S3JA 2W91A 4CMMB 3R1GL 4JZNB 3WXVL 4IS6B 1KF9B 2EDNA 2AGJL 3NFNA 2PO6D 15C8H 4F57H 2G60L 3S98A 1BFOB 3OJMB 3FB5B 4I4WB 3VD5A 5EU7C 2WBJB 5E9DB 2IQAA 4PV8B 5GIRA 4KI5F 4LAQL 5C0GA 1XIWC 1K4CA 2E7HA 3GI8H 3MTRA 4HK3N 2CRZA 4TVSa 4LSSH 5F1OB 3MRKA 3IDXH 5DVKA 1J9CT 4HKBB 5H94B 3HI6H 5H37H 3CDYA 3MLVH 1INEH 2DLFH 3BEWA 2W38A 5FYKL 3CZJA 4E5XA 3SN6N 2DQUH 3UBXI 4EN3D 4LDEB 4X4YB 3CSBA 3NFPA 1IEBA 1HIML 4BJLA 4U1JB 4QXTB 1WFOA 5CP3H 3A6BL 4R7NA 3WJLC 1L7TH 1WEJH 1VPOH 4Y19B 1DVFB 4G80A 1KFAL 4DEPC 5DDHB 1S7TB 5HYEA 1DN2A 4LP5A 4KQ4L 1TPXB 1GZPB 2DLTA 2P7TB 2VQTA 4XNMB 3UXFA 4GAYA 2FCBA 2WAHA 4OGAC 3SQBA 3QI9D 1MHHB 4P4RA 4ZFOB 4UU9A 4TULL 5J0BA 2WQ8A 1KXQE 1NCAL 2FX9H 2Y1VA 1CFTB 3D0LB 3MV8E 3FFCE 4U6YB 1P84J 3HR5B 2QHRH 1MCJA 1T89C 1FVEA 2GK0B 2UWEF 1T22A 2EDJA 4L4VD 1M6OA 2XKSA 1FVCA 1GGTA 4N5EA 1MCIA 1J0ZA 1XGQA 1JGDA 4TUOB 3B9VA 4V2BA 1KELH 1EFXB 2YXFA 2NTFA 1HEZA 5DFWH 4F7PA 1OVZA 4A6YA 2H26A 2X05A 4MNGA 4G6KH 4UQ2B 2R2HA 4P9HC 4RMWA 2Y5TA 5JIIA 1OW0A 4C54A 3K0WA 4R2GC 3C2SA 1KB5H 5GJSL 2JE8A 5DEZA 1NJ9B 1U6AL 3VWKC 3FHQA 5EUKB 1CZ8L 4P46B 2VWEC 1CF8L 1W0YT 4ZUUB 5DMIH 1DJSA 4AM0A 2FH6A 1E4WL 3MZTA 1KULA 4WO4B 4OGXL 4QRQA 4PGEA 2ZCLL 4XNZB 1CTOA 2CO6B 1V7NH 1YPZB 5HTSA 2WP3O 1SVCP 4ZO9A 4Q0XL 4XCYA 5IGXL 5EFIA 1RHHA 4YPJA 4Y8DC 1DQQB 3H7BB 1IAMA 4KH2A 1C8PA 4P23B 5D4QA 1U8PA 3ULVH 4U6TA 4LCWA 3F7YB 4YBQC 4K2UH 4X7FC 4PJDA 3C2AL 2BZDA 4Z0XA 1JHLL 2BNRB 1YY9C 2J8UF 5J7CC 1WFTA 5I8EB 4OLUH 3X3GL 1UKSA 1URLA 3L3KA 5JMOC 1A1MA 5FYJL 4YGVB 4MYWB 3IRZA 1PKQA 4H0GA 3NA4A 1MUJA 3D2UB 3CC5A 4C58B 3T0EC 3U9UA 3FKUS 1ES0B 1AKJB 2DQEH 2XZCH 3DIFA 3FT2A 4HIHB 2VZSA 1KCSH 1MREL 3TN0A 3SPVA 4OCMC 1DBJL 1I85A 3IT8D 2PR4L 1IC7H 3MXVL 3ZLQC 1L6ZA 2H6PA 4HKXB 4P2OA 2W60B 5DS8B 4OF5A 1JZ3A 1OAUL 2IAMA 4OCSL 3TT1L 4XMKH 3GNML 1T21A 5D7JA 5FO8A 3M8OH 4NNYA 1JBJA 4APQD 1FYHB 1FFOA 1T7XA 2NY4B 3G5YA 3OF6A 3FOMA 1ZA6A 5TFSL 3L5JA 1P4BH 1N26A 5KG9B 2P47B 3I75B 3SE9H 1BZQK 1AGCB 2BCKB 2Y07H 4XMPH 2YD6A 3B2VH 5HDOA 3D9AH 1WCQA 3LS5H 4EI5D 1MHCA 3ROLA 4ZNCD 3T65B 4PJIE 4OV5B 3MXWL 4CU6A 3QHTC 1CDGA 2VKWA 3U0PB 4R4ND 5J1AA 3LRHA 4P3CH 2RB8A 4MD4A 3VXUA 2SEBB 4I2XB 4XXCA 4FQIH 4FRWA 2OZ4H 4Y7MA 3UP1A 2HTKD 2DI9A 1E4XI 3FQWB 1WC7B 4WW1B 2OL3L 1EJOL 4X5WB 4Q9RH 4OZIF 4PJGB 4YFDB 3KWWA 3MRRB 3WE6A 4JFOB 1AI1L 2MKWA 4N5UA 1BLNA 3MLYL 4X7TB 1LE9A 1Z2KA 1N5YL 4OLWL 2J5LB 1TQCC 5GS1A 1UH4A 3OBAA 5AG9A 3EHBC 3QEHB 2BMKB 3V4UH 1KV3A 1G0YR 2OJEB 5DD5H 2XA8H 4RGMC 5D72H 2VLME 4JN1H 3IDNB 4HQQL 4PJ7B 5FEBA 2AW2A 4C83A 1QYGL 4PJ5B 1YN7B 4N9OB 4PRPD 1RZ8A 1Y18B 3PGDA 5I6XB 2ZSWA 1KCUL 3JTSB 2VH5H 2M2DA 2OMBA 5DK3A 1MI5E 1S7WB 1JGEA 1CCZA 1QFWH 4PGDA 3VFOA 2CKBA 2EDFA 3MUGB 1AD9B 1KBGL 5F7LB 5TE4H 1YMMA 3PWJB 4X98A 1OAXL 2UZYB 5JXEC 2ATKB 3O11B 1GGYA 4YEEA 3SGKC 4UDTA 3TFKC 2JELH 4WJ5B 2ZJSH 4NQXA 3TESA 5I8CA 4I0PD 1FO0H 3I02B 2ZOLA 1RJLA 1JZ4A 3DARA 3O8XB 5HVHB 4KKLD 3H42L 4MSWB 3QA3A 3ZE2F 3MBXL 4HUWA 4MJID 3FO0L 1K8IA 4WRLA 1P2CA 3WEXA 4ORGB 1CD1A 4P4KB 4L8SC 1JMXA 5GGQH 3D85D 2F53D 4QRPB 1H5BB 4N9GB 1J1OH 1P6FA 4MA8H 1U8KB 1T20A 3MOQA 4PR5B 1L9MA 2LVCA 2J7LA 3ZE0E 4MAYB 1ZT4A 3HUJE 4NSKB 2WQRA 4PJBA 3VI4F 2OXHA 3V4PH 1QFWI 4HS6A 5KOVC 15C8L 3L5IA 1ZVYA 2NW2A 4F57L 5EOQH 1J0HA 3VFUA 1YNKH 3EYSH 2A9MH 1CIDA 4ELMF 3BWAA 5L8JB 2OBGA 2QV2A 1OM3H 4G43A 4KJWC 4PB0H 1H3VA 3VFNA 1YEEL 3HRPA 3RGVB 4LSSL 1TZGH 3ZHDA 3CPLB 1AR1C 1BWMA 3IDXL 5J12C 3OKMB 3JV4A 1XIWA 5M95B 3MLVL 2DLFL 3W5MA 4OZHF 4G8GA 3G04B 3FQRA 1ZEAL 1OP3K 2DQUL 2A9NH 3GBMH 1SYVB 3IDYB 4MA1B 3MRJB 3RPIB 5EBWA 1LEKB 5HGHB 3VG9B 4P5TC 1P4IH 3QUML 1L7TL 3O6MH 3U4AA 1WEJL 1VPOL 1BOGA 3ABZA 3QFDB 3MNVB 1JIBA 3C9NB 4GKNB 3OKNA 1WAAE 1VENA 3WJLA 1HH9B 1MIMH 4HJ0C 5EUOF 3B4NA 2BSTB 4DUWA 3LD8C 3Q2CA 3V79C 4W4OC 4G6AD 5DHVB 1S9YB 1ORQB 1SJXA 1OQXA 3SCMA 1Q9WA 3JXAA 1NAMA 2BJMH 5A16A 7FABH 2NY0C 3O45A 4ZSOB 3S34H 5DMKA 2VZTA 5BXFA 1EHNA 1ERNA 1X5JA 1OAQH 5D7LD 4Y4KD 4UDUB 2FX9L 5FUCC 3LRSB 3MJ8B 5EOTA 3QIUD 5B8CC 5IMLB 4K94C 2AEWA 1MH5A 5CINH 3TH2T 2QHRL 3MR9A 2QSTA 3QRGL 5ANME 4Z7VB 4CADB 3QIWD 5F7EH 3SY0A 2XTLA 3PWUB 3RI5F 1NDGB 3O4LD 1F6AB 3NCFB 5IB5A 1F58H 1FBIH 1H3UA 3KLHC 1T89A 1S7SB 4JDVA 5HHME 3RY4A 4LCYB 7CGTA 1RV6X 3BGFC 4HWEL 4U6HA 1G9NH 3GMLA 3BN9D 4GH7B 2FB4H 3PP3K 2A0LD 2P5EA 3MCLH 4F15B 5JW3H 4C57C 4XC3H 1J86A 1DUYA 1I8IB 1KB5L 3NIFF 2NW3A 1D5ZA 3E6FB 4U1MA 4XBPB 4KY1L 5IVXE 1I75A 1ZHBB 1J11A 3DX6B 5DMIL 2HT2C 4ZAKB 5CAYB 2X70A 1CD0A 1UB5B 3CH1A 5FHAH 5KTEH 3GSQB 5IB2A 4NKDA 3ARDC 4LPCA 1AO7A 1V7NL 1YUHA 3MBED 3O9WD 3RIAF 4G8FB 4AMKL 1J10A 2CDGA 1ZT1A 3HC0A 3HZYA 4XWGH 1PEWA 4P49A 1WBZA 1LP9E 4M62H 3ZTJH 1LNUA 1ZSDA 1YC8A 4YHNA 3A67H 1QFOA 5EO9B 4ODWB 3S36X 4K2UL 3JSSA 2MJWA 1CLZH 2CUIA 4PLJD 4PBXA 3SDCD 4OLUL 5CP7A 4MDJA 4P3DA 3HG1B 2CIKB 3DBXB 5I1EH 1XGYH 1EVTC 5D1XA 1MPAH 4F33A 5D8JH 3O3BA 2EEDA 5IP4A 4WHCA 4FTVD 5FYLD 2DQEL 4YDLC 2XZCL 3FMGL 4NBXB 5ESQA 4J3OC 3BIBX 2FJFB 5BVJB 2PTUA 1C12B 5IFJB 1KCSL 2DB8A 4NRXA 2V7HA 3EO9H 4J2XA 1U8OB 3FQXA 4JFQB 1IC7L 3BUYB 1LDSA 1Z0NA 3RUGF 2JJUA 1I3RA 2X4QA 1OARH 4OGZA 4XGZB 5DT1H 4PUBH 4LASL 4ZYKA 2NR6C 5ADOL 2QKIB 3BPOC 3UTPD 3MRIA 1INQB 4OZFG 5ESVA 1P4BL 1QTYT 5C2BH 1NUGA 5JOEA 4DUVA 3SE9L 1QR1A 3FCTB 1E27A 2J6EA 4U1IB 3V6OE 5KS9B 2LU7A 2G75B 2Y07L 4XMPL 4LBEB 3LS5L 3IS1X 1VADB 4OZGF 4JAMB 3OAYK 2R23A 2WNGA 5DD0H 4FQIL 2OZ4L 3UTOA 3KYKH 3NZ8A 2C3VA 4XB7A 4L8DB 3DX9B 4AEIH 2VLLB 3QT2A 1ZGLP 5GSVB 1CYGA 4PY8I 2I07A 3RI5K 4Q9RL 1Z9LA 4JFED 5KSAD 2VLKD 4PRNA 4QRUA 4WFEE 5J6HA 3G6JB 1QSEB 2DWEA 5IKCB 3S6CA 1U3HD 2DQFA 4D3CH 5FA3A 4JRYE 3KPPB 2MCPH 3BDYH 4YDJA 5I0DA 3U2SB 1M7DB 2NY1B 2XA8L 1G9MH 5DD5L 1BP3B 1CICD 5DK2A 5D72L 4WUUD 4CNIA 4S0UC 1RZGB 1UT9A 2X5PA 2HFEB 5DD3H 1AGEB 4FQCH 4JRXE 4LQFH 1BEYL 4J23A 3DV6A 3UO1L 4YBHA 3LN5A 3MLRH 1G7MB 4O5LL 1UWXK 1ZOXA 3DNKA 3P73B 4FQHA 4HK0A 4N1EA 2R0LH 1ORSA 2VH5L 1Q94A 3DLQR 4WI7A 4HC1A 43C9A 4PRDA 5AEAA 1QFWL 4KI5E 4MNQB 3Q6FA 4OLVH 1HXYB 5TE4L 1IGTB 5GRXG 3RIAK 1BVZA 1F4AA 2WBKA 1U8MA 1KCKA 4FNLH 4NFCA 3PABB 1HI6B 1WJ3A 5AYUH 5T1KB 1P7QD 4GW5A 2ZJSL 3S97C 4DJMA 1BF8A 3MMEA 1I1FA 5JXEA 4Z7NF 4AIOA 1FO0L 3TFKA 5CJ8A 2FYYB 3WJJA 4Q97A 4YC2C 3V5HA 5CGMA 3M17B 1MLBB 2AAVA 2B1HL 5IEHA 3JUYA 1OT2A 1MAMH 1A7PH 1YEFH 3GBLA 1TITA 4R4FH 4R3SA 5GZND 5DQDL 5AUMB 2X7LB 5GGQL 4XPAH 1J1OL 4LLMA 3N50A 4MA8L 3DSFH 1IGJB 1U8NA 5DTFB 3DGCR 5D1QD 3R06A 4WY7H 2FL5B 1I9RH 2H41A 3IXTB 3C08H 4L8SA 4G5ZH 1QSZA 2EH7L 3L3JB 4DFIA 1X5IA 1JK8B 3KPNA 4NDMA 3BI9X 2X89A 1NDMB 1E4KC 5EOQL 1R6VA 4PGBA 3PHQA 2QLVB 1YNKL 3EYSL 2A9ML 1A4KB 3BDBA 3MLPA 2VYRE 2UWEE 2D0FA 3OXRA 2NPLX 4O2EA 4OCXH 3ILPB 4PB0L 4ISVA 4PRID 2V5YA 4YXHH 1TZGL 2OP4H 3NVQA 4FHBD 1KCGC 1EGJH 1RJZA 2CMRH 4HH9A 4G8IB 4QHLA 5HD8C 2DRUA 3DYPA 1DN0A 1PZUB 1QVOB 2A9NL 3DUSA 4AZ8A 3K1KC 3GBML 4AEHH 5CZXC 3V0WH 5EU6E 1OF2A 4YFLF 5KN5A 8FABB 1CFQA 2HLFD 4DK3A 3O6ML 1JZ2A 3FRPA 1M7IA 3S5LA 3TA3A 4LKCA 2JK5A 5C0JA 1NMAH 1MRCL 2H2PD 2AXHA 4P5TA 3C8KB 1MIML 2Z4QB 1IC1A 4WFGE 3NZHH 5E2VH 4QKXB 3TT3H 4HLZG 5IIEB 1T1XA 4ZNEA 7FABL 2UY7A 3S34L 2IANB 4M43H 3JV6A 4W4OA 2VSDA 1IM9D 3HPJB 1OAQL 2YEZA 1AFVH 4MGXA 4LKXA 2ZKHL 3FQTA 5GGUA 5C07B 3P4LA 3V6OC 4DFHA 2BSRA 4LSQH 3LIZH 2R1XB 2J8UE 2AEIT 5F7EL 5SWSE 2YN3A 3MLWL 3IXAB 3MGOA 1IQDB 5B8CA 4A6YL 5BZDA 5L8KB 4QRRE 1AXIB 4HDIB 1B0RB 1IFHL 1A7NH 1FBIL 1Z5LB 4JM2B 4YHZH 1TQBB 3D25A 3HMXA 4JKPL 5IWLC 3WNKA 1GJIA 2EE6A 3MRCA 3QDHA 3WFCL 1QRNB 2R56H 1P53A 3DETC 3HNSL 2FB4L 3AAZA 4Y1AE 2IC2A 4JZOA 1LVEA 5FECB 3U4EA 5KSVB 2GI7A 3BXNA 3MCLL 5JW3L 5F93C 3SO5A 2M26A 2XKNA 3VFRA 4FG6C 4PD4J 5ID1A 4QHKI 4GBXD 3BZEA 3OV6A 4EVNB 5BW7C 3W5NA 2Z8WC 2X4NB 1T0NA 5CSZA 1OTUC 2ZG1A 4WNQB 5FCSH 5FHAL 5KTEL 1IGMH 4HS8H 1ZMYA 2ARJA 3QXDA 4YK4B 1A6AB 2MTPA 3CU7A 1QHPA 4I77H 4MA7H 3QH3B 5ISZA 5IOPB 4PJAF 4PJCB 1BZ7B 5D2NB 3BD5A 1EMTH 3ARDA 4JFDE 1G7PA 4XWGL 4KI5C 5ABDE 2XZAL 4Y16B 4NQVB 1W8NA 5FCUH 1G7JA 4M62L 1NUDA 3QPQC 1J1PH 1MFNA 4R0LB 5DUBB 5LBSH 3A67L 5IHZA 3OR6B 2FX8H 1BPVA 4HJGB 4X99A 2DMCA 3WXWL 1ND0A 3BYTA 1CLZL 5I8KH 1ZVSA 2AEPH 4OZIE 5BJTB 4O2FB 3MRMA 4WUKH 3CIQA 2EYRA 3L9RA 3U30B 5F97E 2RFXB 2RAMA 5C9JA 1MPAL 2P8PB 5D8JL 4NJAH 3G5VA 3C09B 2G2RB 3RHWK 4ZPVA 3LPFA 4ZUVB 2PYEE 3O6LL 2FHBA 2APWA 3RVTC 1ZT7B 3UZQA 3L3HA 1TJGH 1BVLB 2ED7A 3LKSA 1FYTB 3DVGB 3MJ7A 5DR5H 3VFPB 4KJQC 1OARL 2VLJD 2XG5A 5DT1L 4PUBL 3T2PA 1BQHB 1J8HE 5IJVA 4IOIB 5GS0H 2JCCF 5FDWB 3WUWB 1YEJH 4XHJD 3OHXA 2G9HA 1I7ZB 3RWIA 4EBQH 5C2BL 4HV8B 1YYMH 2Y06H 1NC4A 3AMKA 1PG7X 5C0BB 5A2IH 1VFMA 3SDDA 3HUJA 5GISH 3BWUC 2CKNA 4U7SA 3GIVA 3VFSB 1QNZH 1UH3A 3I6KB 3GMMB 3QIBC 2NNAB 1FL5B 4BZ2H 5HYJA 3MLZH 5DD0L 2C1PB 2BOCA 2MQ3A 2FO1A 3LQMA 1L8JA 3GBNH 2ICES 1J0YA 4AEFA 4X0KA 2CK0H 4AEIL 4MZ3A 3ZE2E 2CJUH 3MROA 2OTWA 4L9LB 5GRVK 4NHUA 4AG4H 2EDDA 1JGUH 2W0FB 2Z91A 1DQLH 1F5WA 4RSVA 3MREA 4LLVB 4D3CL 3QEQA 1T2QH 4X4ME 1ZWIB 4PLOB 3CU1A 4F80A 2D2OA 25C8H 2MCPL 3QNZB 4NQEB 1KLGA 2FLBT 5T1DL 1G9ML 3DMMB 5J89A 4KUZH 3LAFA 4FQCL 4LQFL 4JE4B 3ULUD 4ODSH 4KKBD 3VI4E 2Q6WA 2QSCH 5DZNA 5C09D 1DFBL 3MLRL 4NO2B 1I1AC 3HNTH 2V7NA 3W39A 1SJHA 4U3CA 4MD0B 2R0LL 4QRSA 1CXFA 5D71H 5J11B 3L7EA 4G8EB 5F1SA 5I73C 4ELME 3JV0A 1BZ9B 3U48A 5I9QB 4PRHE 1VDGA 5A1AA 2O61A 5I66A 1MLCA 4YR6B 2Q76A 4CVXA 3SDXA 5K9KB 2R1WB 3P11H 2C4FT 4O2CB 5GGTH 4FNLL 3ZKQD 5AYUL 1PG7L 3U36B 1MCQA 1CGYA 4OZHE 1A2YB 3HE6B 3C8DA 4NPYA 1I3VA 2X4UB 3O0RH 5KSBB 3TYFB 3OKLA 4DKAA 4G6FB 1ZGLM 3DX7A 3U46B 4LCIH 1K9TA 1LK2A 4MXVF 5DQJB 4V1DB 4CJ1A 1HQ4A 4N0UE 1MAML 4JFZH 1A7PL 1YEFL 2WIIA 4JZJC 3PV7A 3BD4A 2Q7YB 2P48B 1WFUA 4R4FL 2HVKB 3O41B 3SO3B 3QCUH 5C08B 1KN4L 5HHMA 4XPAL 3QXWA 5EUOE 4XVUC 1W72B 4D8PA 4GMSH 2NX5E 4G9DA 4HMCA 4XVTL 1MFEH 1CU4L 4WY7L 1MFCH 1I9RL 2VERN 1E28A 4U1KA 4B53A 2ZOKA 3PWPB 1GZQB 3V6FB 1PLGH 4MB5A 3C5ZC 3MV9B 4EJ1C 1IAKB 1IRAY 2PN5A 3OJDA 4RFEA 1MELA 5DA4A 2YD5A 4NRYB 5JHDB 5IHUH 3VXQB 3VJ6B 3IFPA 1OGAB 2DOCA 2XTJE 4Z7UB 4YHOH 1I8KB 1HHHA 3VI3F 4AT6A 1I9JL 2NCMA 4UBDD 1FZJB 2DICA 2AQ3A 4OCXL 4RX4A 1E4KA 4YXHL 1DCLA 2Y7QB 1MQ8A 4RGND 4CAGA 2OP4L 1MVFA 2H45A 1EGJL 4AQOA 3BQUB 2CMRL 3ESUF 1NGPH 1JGLL 4I3GA 2WLYA 1TJIH 3C6LB 4EDWH 1FNLA 2XWBA 3VXMA 1K3IA 1LP9A 4N5ED 2B7DT 4D9LH 4JFXA 4AEHL 1YY8A 2V5RA 3V0WL 1Z6JT 2YUVA 5KZCB 5INDB 3RWEB 2PO6B 5KANG 1BX2B 5E4IA 3NIFE 4DGIH 2VXQH 1DEDA 3MRQA 3QEUA 2DWDB 1NKOA 1NMAL 3SJVE 2Y6SD 4M8QB 4BQ9A 2IALA 2HFFA 3BH8A 4HCRH 3IFLH 4PBVC 3CCHA 3GB7B 3TJEH 3B3IB 3HRZA 1B4RA 3DGGA 1WUNT 4ZO8A 4U7KA 4UOW0 5TDOB 3NZHL 5E2VL 4TNWF 3TT3L 3RQ3A 3QQNA 1VFBA 1WLHA 2QQKH 4XHQA 2AI0H 3RKDC 5C3LD 3ARWA 4M43L 3OB0K 3W0WE 1T0MA 1BVKA 2FZ3A 4FFZH 1AFVL 3OR7A 3CXDH 1TZIB 5MENB 1K3ZA 5JQ6L 4LFHD 2I26N 5C0CE 3C6SA 2GFBA 1F13A 1A64A 1BFSA 5JOPD 2VN4A 4LSQL 5F1IA 2X4SA 1IILE 3LIZL 4XAWH 5B21A 1MCRA 3NCCB 3H3PH 4LCWD 5J13C 4YHZL 1OPGH 5KSUB 5JW4M 3ZZ1A 4R7DA 4ZOCA 3LS4H 5GGRY 4M6OL 3EO1A 5C0AE 5J9PB 3D3VB 1D6VL 3D0VB 3ZYJA 4XNQA 4OF6A 2RGSA 2BK8A 5IWLA 2NY6C 4RQQB 3WIHH 2HT3D 5DD1H 5HHNA 3WFZA 5T5FH 1HYSC 2R2BB 4NUJA 3O6FB 5JORA 1EHLH 3RUGE 2P8MA 5IF0A 1A5FH 2B39A 5L9DL 3RWDA 4LEXH 2UYLA 1UKTA 1LO0H 3TN0D 1V3JA 1AP2A 2AJ3A 4S1DC 4GG6B 1CFNB 4HIEA 3SEPA 4HS8L 5BW7A 1A3QA 4P2OD 3VCLA 4TTDD 4QWWD 5JW5B 1H0DB 1RUQH 4OM1L 4I77L 5FOBA 1YEDA 4MA7L 5IB4B 3QBTB 5IMKB 1BQHG 5DRXA 5D7JD 3CDCA 2E8ZA 1H3GA 3HHRB 4OZGE 3WUWG 3OF6D 1UQSB 5K9JH 1QO3B 1YJDC 5FCUL 3TCLA 2DDQL 3KPRB 4H20H 1J1PL 4WDIB 4HUKB 5LBSL 4LDOB 5L88H 1AGBA 4XP5H 3VMPA 4KVCH 1KCVH 4NC1E 3VGAB 4MHHG 2YOCA 2WUBL 3VXUD 3CMGA 3H9SD 4H5SA 1S9XB 1HHGB 4LU5H 4WUKL 3CNKA 5K93A 3O3EA 1OSZB 4BH8A 3CFJA 3REWB 4NJAL 4Z7WB 4W81A 4DVBA 4MJ2A 2J88L 4I3RH 5DJ0A 1WZLA 4WU5B 1PZ5B 2KBGA 3QFJA 5IROC 4X6FA 2ZUUA 2CH8A 5DFTA 5DA0B 1TJGL 4NWUH 3EFFB 4UILH 1N5AA 4ODTH 1MAKA 5ETUA 5DR5L 3T4AB 1DQTA 1T1ZA 5GGRA 5ICYB 3BO8B 4ZG1A 3GGWB 5KAQG 1XF3B 1JNNH 5HGGS 1YEJL 2V5SA 4FFYH 2CDEA 2Y5EA 4GS7C 4TNWK 4EBQL 1QBLL 1FNGB 1BD2D 1YYML 2Y06L 3Q48A 5EBMA 2Y72A 1UGNA 1S7VB 1XGTA 2EO1A 5GISL 1FC1A 2XTJC 2BY0A 1QNZL 1YMMD 1BOYA 1N64H 3L5WA 4Q2ZB 4Z7NE 5LGJA 4BZ2L 2OK0H 3MLZL 4JGJA 1LEGA 2BVOA 2AVGA 2I60H 3GBNL 4QXUL 1RU9H 2FEDD 1UJ3C 1CDHA 2CK0L 3QIBA 2CJUL 2VABA 3IJHA 2H3NA 3VG0H 4CL7A 2EIZB 2GIYA 4AG4L 2XY1A 1JGUL 3T2OA 1DQLL 1CR9L 1UB6B 1RZKC 2GTWB 4ZOAA 5L2KA 3AS3A 4OD2B 3R0NA 3G9VA 4ZS6D 1IZJA 1F11B 2HLAA 1T2QL 5KW9H 3IDJA 25C8L 3GSXA 1RVFH 2HWZL 1JWUA 3RVXD 5LCVH 4JPIB 4L1HA 1KCRL 2OQJA 5DEFA 2FR4B 3A6CL 2V5MA 1U8IA 5C0ND 1S3KH 4K8RH 3HNTL 4Q6IC 1Z0MA 3PP4H 2FEEI 2Q3AA 1B2WH 5E8PB 3ARGC 5D71L 3VXSB 5H2BB 2FBJH 4YZFF 4JHBA 2VDPH 2A1WH 1I1AA 4FXGA 1NGXA 5FM5M 3JTTB 1MJ8H 4X7EC 2CXGA 2ICWI 2QQLH 2C4XA 5T1MA 4MD5A 3P11L 5GGTL 2ZUVA 1P7KA 5JNYB 2OYPA 2X9WA 3FB6B 3O0RL 4L4VE 4Y5YB 1VFAA 3IDIB 4LCIL 5IVNA 1N59A 5IESH 1J88A 4H26A 3U0TA 2V17H 3FT3A 1XCTB 4HIJA 1XIWD 5KVGH 2HJLA 4PRPB 1NBZB 3MYZA 4G8GD 3BKJH 4PV9A 4BFIA 1IVLA 4JFZL 4CN6A 5FF6A 4YO0A 4XRCA 2X4TB 4QRRA 2X4PA 3QCUL 2X09A 1XCQA 5SX4H 5T1LB 4N0CA 2YR3A 2CO7B 3RWGA 2VDKH 3PL6C 3QUZB 3HZMB 4JZJA 1U8QA 4N90D 1R3JA 4PP2B 1MFEL 4JFHD 1YECH 5INCB 1MFCL 3M1BA 4ERSH 1BIIA 2OTPA 4PJHA 5HHOB 1VKXA 4JO4L 1PLGL 4DW2H 5HYSB 4X6DB 2RHEA 4FXKA 1KB9J 4I0PB 4U1GB 3O3DA 1J1XH 4MQ7B 1U92B 5IHUL 3SCMD 1HINH 1OT1A 4YHOL 4KKCC 3V0AC 3C5ZA 5F70A 4PTTB 1TCRB 3E2HB 4H8WC 2DLEA 4MJIB 4GRLC 4LGSB 2P5WA 4OGAD 4D0CB 1A9EA 2QL1A 3HE7B 2R9HC 3DX8B 4IBLT 4JFYA 3D85B 3V7MA 2F53B 1NGPL 2PTTA 3ZKMD 1TJIL 4EDWL 2D0GA 4NC1C 5EC2B 2KDGA 3RWJB 2A77L 3EJYC 4GG8B 1HDMB 4K9EC 3UTQB 4D9LL 3LKPA 2ZZUT 4HWZB 1ZXQA 4EI6B 1K6QL 4PJ8B 3QO1B 2FATH 1L9NA 5SX4I 1ONQA 4DGIL 5HHXH 2E6JA 2VXQL 1YDPB 5DJ2B 3BZ4A 2CLRA 4LOUC 1JUFA 2P5ED 4LPUA 1QSFB 4S2SB 3ES6A 4MQSB 1GVIA 1JV5A 2I9TA 4Y2DD 4HCRL 4CDHA 3TJEL 1EUTA 4IIQC 3V6ZB 5M94B 5J56B 2A83A 2PYEA 3QNXA 2YSSB 1J7VR 5E95B 4MZ2A 4EQ3A 2QQKL 1QFUH 2Q8AH 3TBSA 4PJAE 4KRPC 3BPCA 5HHPB 3PJSA 2CUHA 4TVPD 1TJHH 2VDOL 1U95B 3NA9H 1AO7D 3QUXB 5EZIH 4FFZL 5EIQA 3CXDL 1V5JA 4QF1A 5FGCE 4DQOH 5DYOA 4K94L 1J8HA 4NQDE 1ZA3A 3Q0HA 3QG7H 3STZA 1SHMA 2YA0A 2DQCH 3PQYA 5E8OB 1WFNA 5F88A 2DTMH 2QR0B 2NZIA 5BRZA 2FO4B 4AYFA 3H3PL 3A6OA 1OPGL 5DHVH 1A7QH 3D18B 3LS4L 4ZFOL 1HQRB 1A7BA 1CVSC 5C71A 4E0RB 3QQ3B 2WBJC 1NGQH 3BRFA 1NC2A 5I16B 3EOTH 1I9EA 4YBQD 1NMCB 1G6RH 5D1XD 3WIHL 2YZ8A 5DD1L 1YY9D 2X4RB 5IQ9A 5T5FL 4M8VA 1EHLL 1X7QB 1A5FL 5GPRA 2EIDA 3LKQA 4EUPB 4LEXL 5FKPA 1LO0L 2E27H 2ILLA 4WCYH 2JCCE 3B5TA 5JDSB 4NRZB 5JO5A 4LARH 3IDMB 4KJYB 1ETZB 1MFAL 2FWOA 3LCYA 4P5MB 5I8OH 5E2WH 2G5BB 5F7DA 3HNVL 5BS0B 3DUUB 4IDJH 4X6BB 1DUZB 4P3WA 1S7XB 2CRMA 4NM4H 3C8HA 3KPLA 1KIRB 2R29H 2P4AB 4MMXC 3OL2A 4NQSB 5K9JL 3K80A 1CFSB 1BF2A 4H20L 3SKJH 3VDBA 3UPAA 1DBAL 1SY6A 2CIIA 4JHWH 3FRUA 4M7JH 1KUMA 5L88L 4XP5L 1TPXC 4KVCL 1KCVL 3RZCB 4TTGA 5DRWA 5C8JB 3BEVA 3K8KA 4PRHA 4FXLA 2I5YH 3UMTA 4JY6A 1A6WH 1NCWH 1KGCD 3TZVB 4LU5L 1F97A 3DO3A 3KPSE 3INUH 4CN4A 2GJ6B 5F7MC 3QDJA 4R97B 5CHNA 1NGYB 1CDBA 3SKMA 4BA8A 2Z93A 4LHJB 4Z8FH 4X9FA 1SYSB 2VUOA 3MBEB 4OZHA 1AIFB 4BQ6A 3O9WB 3DURA 1YNLL 4OFIA 1EBPA 3D69A 4FOMA 5F3HA 1XF5A 1G7IA 5K9OB 1DLFL 1T1WB 2P8LB 2WWMC 4FABH 4NWUL 5F7NC 5E94B 1WIPA 4HULB 2FH8A 5IROA 3I3EA 4N0UA 5C0DA 3B9KD 3KJ6H 1KEGH 3REVA 3UEZA 3MACH 1ADQA 3QUKB 1EEQA 3AXLB 3TBYA 3ULUF 2VKXA 3EHBD 1F2XK 4K7PX 2FEEL 1T80A 4HFWB 5F9WC 1YNTA 3T3MF 3MUZ1 5MEQB 3WNLA 5EBLB 2Z31C 4QCIB 3LKRB 12E8H 1N64L 1KJ2A 1ZGLB 4QTHA 3EOAA 4HUUA 4MCYB 2NLJA 2I60L 2Q3ZA 4XNZC 4GO6B 4MXVE 1RU9L 1ZHKA 2OL3B 5C0IA 4GMTH 2UUDK 4PBWD 4IMKC 1A47A 2AK4B 3S37X 4RBPK 5JXED 3VG0L 2VDQH 4WI2A 3F8UB 2VITA 5ALCH 3TFKD 3GJFB 5DUMH 2BNUB 4L9DA 1UJ3A 1MFBH 3HI5H 4KVNH 1UWEH 2OI9B 4N1HB 5HHVH 5KW9L 4JM4L 4PRBB 4GQ9H 3EYFA 3FONA 5JPNA 4MDIA 5HGBA 5LCVL 4WTWA 3BP7B 1I4FB 3X17A 2FIRT 5CJBA 1S8DB 5E6IA 3CFEA 3GJEB 2M1KA 1FH5H 4NGHH 1Y6MR 3T3PF 3PP4L 2K1MA 1B2WL 1D5XB 3TIEA 3SJVA 5IW6B 3GMNB 3VI3E 1LO3H 2FBJL 5IQ7H 2E9BA 2VDPL 3DV4A 5HYSG 4L3CB 1GAFH 1N0XH 2CGRH 2EICA 4JFEB 1I3GL 5J3HC 4PFEA 3TVMB 4Q6IA 5D7LE 4APQC 2VLKB 2X89D 5GZOC 2DJSA 1MJ8L 3MCG1 3ARGA 4NKIH 3OZ9H 1Q0YL 1NLDH 5A43C 3U7WH 1U3HB 1YQVH 4RAVB 2XN9D 1XGUB 3LQZB 5SWZB 1KIQB 4GW1A 1R3HA 3LSOA 3W0WA 4GKZA 3RTQB 4I18B 1CICB 1KTKE 4WUUB 3MRHA 3O4LE 2EIBA 4QEGA 5IESL 1I8LC 5C0CA 3FFDA 4OLZH 3UBXB 1FFPB 3RDTA 3BKJL 4Z5RB 2KUTA 3NGBB 1AR1D 3UPRB 1X4XA 3QUYC 1UFUA 4PJXB 3N1QC 1NSNH 1KG0B 5L7XH 2IFFH 4PREA 1KPUA 5DD6B 4ZPTB 3TA3D 4EIZC 1JNLH 5C0AA 3MNWB 2A6JA 1UZ8B 5BOZG 1YECL 3X12B 4NYLA 4ERSL 2HA1A 2PW1A 4PTUA 1JFQH 4LLDA 4RAUA 4P5TD 1MHEA 4DW2L 3OAUH 3P0YL 3PL6A 1RIUH