1A6ZA

Hfe (human) hemochromatosis protein
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
272
structure length
272
Chain Sequence
RSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the hemochromatosis protein HFE and characterization of its interaction with transferrin receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Mhc class i complex
molecule keywords HFE
total genus 61
structure length 272
sequence length 272
chains with identical sequence C
ec nomenclature
pdb deposition date 1998-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a6zA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1a6zA01
4M1CC 3W82A 1HILB 3O3UN 4AM0B 1IQWL 4ZNCD 4MVBD 4N0CA 4YHPB 2X2YA 3FCTA 1P4IH 1YECL 5ETUB 4EI5D 1FQ9C 4ZFOL 1MFAH 4N0FB 3ARGD 3P9LA 4JHAL 4U1HB 1I85A 3EFDL 2H6PB 4WI6A 5D5ME 5JW5B 5KVDL 4HPYL 1JFQL 2B1AL 3EYUH 4ZDHA 1FDLL 1K85A 4KKLC 1NFIA 2IQ9L 1FJ1B 1N59B 1TTUA 3PP4H 3GMPA 1YMHA 3ILPA 1YECH 3HNTH 2A6IA 4P23B 5IVNA 3HB3C 4KKBC 2XWJB 1NLDH 5D1XA 4YXKH 3E8UL 4TNVK 3Q6FA 1NDGA 5I8CA 2APTA 4YO0A 1QP1A 2OI9C 4KMTL 4RMWA 5DUPL 4MNQE 5IFHH 1RUQL 4P46B 6FABH 4UQ2A 3ZYJA 3IVKA 1FBIL 4D9QE 3F6LA 2NY3C 1KPUB 3WKMH 4FQXC 1MHCA 1U92A 3TPUA 1R5IA 4OZHB 3IETA 2F5BH 3QPXL 4G9FE 4F7PA 4OLVL 5JHDD 1OCWL 2XICA 5J1SC 2Q1EA 1QQDB 5FV1L 2VSDA 3QQ4A 2FBOJ 3IDMB 1KJ2L 3GSOB 4RGMB 5KTEL 3BZEB 1FE8L 1F4WL 2IMNA 1AXSA 1X4XA 3SDXE 1CE6A 2J7LA 5T3ZL 4E42A 4OZIB 2B4CH 5C9JB 4HXBH 4NP4L 4QHMB 4ALAH 2X41A 4PRBA 5J06A 1HYRC 1SJVA 3OKOA 5EFIA 3NAAH 5ADOL 5C0AB 5HY9A 4QRRE 1NMBL 5CHNB 3AS1A 5C0CA 2B7DT 1AD9B 1IC4L 3TGXA 4AJ0A 4MJ2A 5GSRB 1P5UA 1KCVL 5BV7B 4K7PX 4WJ5A 4XGZB 4J23A 1T4KB 4WW1B 1J12A 3H42H 4MWFA 5ESVB 3A6OA 4WHDA 3MLWL 1OAXL 1PY4A 4LKXB 1XGYL 5AZEH 1AXTL 1OSZA 4CNIA 1S7WA 3U9UA 4HJGB 1NCCH 1VPOH 2D7TH 5GSRA 4JRWA 1VGKA 2MNUA 3SY0B 1K6QH 1AE6H 4UT7H 1ADQA 1DN0B 1SEQH 1WZMA 4PJIA 5GGVH 4FFEX 2XFXB 5E9DB 1E4WL 2IG2H 5C0NC 3DUUA 3UPAA 2GSGA 1H0DA 1GJIA 3FHAA 5HVGB 5IF0B 3SGJA 3FB5A 4R3SA 4Q6YA 1WEJH 5E7BA 4Y7MA 4K71B 1LMKA 2NMSA 3SOBH 3TFKC 4XMLL 2YPKB 3B8YA 1BF2A 2XKSA 3KAAA 1UWGL 1U3YA 4JHBA 2VLRA 4Y4HA 4J7RA 5LCVH 4IOIA 1R0AH 3BT2L 1ZLVH 3JWOL 4FFZL 1WVZA 5DJAA 2YPLB 4DKDC 4Y5XA 1TCMA 4EIGB 3SE8L 5C0IA 3GI9L 3K74B 5EORL 2NXYC 4GAGL 4Y5VB 5DUBA 2W92A 3NTCH 4X8JA 2BK8A 1OP9A 3E0GA 2Y23A 1CU4L 4HWUA 2AQ2A 4ZFZA 2CO7B 4FQ2H 2W9LA 3VMNA 3HZMA 4MLSA 3I85A 1AQDA 2FCBA 2UV3A 5E5UB 4P59L 4UT6H 2C3VB 3EW3B 3V0VA 5FECA 4TPRL 4LP5A 1YPZF 5D71L 4HH9A 4FQXA 5HVWA 1A6WH 1A4JB 1C16A 4QRRA 2V7HB 4GXUM 2ED8A 3FKUS 2Z31A 1CGVA 3MACL 4PGBB 3PUCA 4MQXD 1ONQA 2AI0H 32C2B 4JM2D 1QLRA 4LLVA 4OF6A 5I8OH 1G9MH 4MAUH 4KPHH 1P2CB 5E95B 1QRNA 2W0KA 1JRHL 4JREC 4XMPL 1KV3A 3LKRB 2YC1A 4LSUL 4R7NA 1MCWW 4FHBD 4XPGH 4PLJD 3DUSB 3QUYD 1KIRA 3FO9A 1CXKA 1AFVL 1BFVH 3HG1D 3MLUH 2EECA 4DQOL 5DRZA 1T66C 4YLQT 5DEFA 4PJDE 3VH8A 3UROR 2JELL 5GGRY 5A2JH 1U3HD 4BFIA 2ATKA 2UUDH 1T04A 4J1UA 5CUSH 4OF3A 5HGBB 4AENA 4HWZB 4LLQB 2LFGA 5CEYA 3MRRB 3F65A 4NDMB 3O6FC 1KELH 3VFWA 2JB5L 1AKJD 3GSNL 2FX8L 1AHWA 1OPGH 5DS8B 1GSMA 4ACPA 1LEKB 1G7QB 3VWJB 5D1QC 4C4KO 1WBYB 4QRRD 3MYZA 4MB4A 1BBDL 4LSVL 2NY2C 5F9DC 2G75B 2B2XL 5GGRB 1AGBB 2IEPA 2BJMH 2AJ3A 2I9TB 3MLUL 1QBLH 5LGHH 4FQCL 4PRHB 4OBRA 3CSYA 1OAQL 3DECA 3UC0L 5IW1A 3BOVA 3SHSA 4J3UA 1S9YA 2P43B 1MFNA 3ZKNC 3NCBB 2XQBL 2H26B 1BZ9A 1YYMH 4GRLA 4QRSB 2B20A 2DDQH 1A1NA 2G9HB 1NGWA 1G9ML 4PB0L 4Y4FA 1EBPA 3CSYB 1AGDB 2AI0L 3VXRA 1DUYB 5C09D 1JNHB 1CLYL 3HZKB 1T5WA 5DR5L 1ZT7B 2H26A 2A77L 3RWDB 1OGAA 4AIOA 2W9EL 4JFDB 3TJEL 2XZZA 4JO3H 3OB0H 5BW7C 2UZYB 3MXVH 1IM3B 2EDHA 1QFOA 3RVVC 1WBXA 2R2EB 1J86A 2R4RL 2NR6C 4JY4A 1F42A 1J11A 3KYOB 3BN9C 1INDL 3OX8B 4HS6A 4ZS6D 1NEUA 1WBXB 4OKVA 2YD7A 3OR7B 4LHJB 5TFSL 4KDTA 1D5MB 5IR1A 2ID5A 3S4SA 2D4FA 1JPSH 5IJVB 3SE8H 5F3HA 4CU7A 5FCSH 4TRPL 1GZPB 1MOEA 4OGYL 4PJDA 2XXMB 3JWOH 3PP3H 1LD9A 4JFXA 5F7LB 3DO7A 3QQNA 1X4ZA 1UGNA 1NQBA 1OM3L 3JWDC 1JYWA 2A1WH 4YE4H 4QOKA 5F1IA 2BSTB 2AKRA 5E2VH 3G08B 1F11B 1U8IB 4G59A 1UM4L 3LKSA 4RFEA 4V3DB 1PZ5A 5GGSY 3TFKD 5MEQA 4U4BA 3ARFC 2EE2A 2YSSB 2HT2C 3C2AH 4HWNA 5TE7H 5I74C 1LE5B 1FNSH 3GZKA 4M7ZC 3N0PB 2AKRB 2IAND 1BMGA 1SEQL 4WGVB 5GGVL 1AE6L 4UT7L 3J7HA 2VXQH 1S9XA 3EYFA 3GMNB 4L4TA 5HYQB 1BLNA 1TZGH 1L7TL 2H32A 3PNWB 1VPOL 2D7TL 4U1HA 1UT9A 4HUUB 1RUPH 3NZHH 1MFEL 1J5OH 3M07A 3PWLB 5D2LB 3IT8D 4D0CB 2V2XA 2NX5A 3TBSB 1MHPH 4IS6B 5D7LA 4P23C 3FT2B 4I48A 3L5XH 5B3JF 1GPOL 2WBKA 3P77B 3OXSB 2QQLL 2V9TA 2YPVH 5EU7C 5JDSA 3FO0L 4X6EB 1QRND 2WANA 4PP2A 5E94B 1MAJA 2HG5A 3MREA 4ALAL 5MP6L 4NRXA 3CSBA 2CUMA 5JPMA 3AM8C 3T3PF 2WSKA 2AJYL 3KPSB 4JM2B 4XAWH 5C0IB 5KTEH 1CDGA 2A6DB 3NIGE 2VYRE 3UTPE 3QDMB 2XZAH 4RGNE 5D70L 2HN7A 4U6HB 4PJ5E 5BV7H 4HK3J 1NANI 4L4JA 5DEGA 5SWZE 4ODHH 3ZKND 1JPGA 4F7PB 3MNZA 4IMKC 4XCFL 1RUQH 1ZLUH 3E1F1 5IFHL 4EBQL 4JZOA 4G8GB 2V9QA 5JXEA 3Q6GL 4LEOA 4G6JH 1QR1B 4I5BB 5ANMA 3SDYH 3QDJA 4FQLH 1UCBH 4X4MA 1ZLWK 2YA1A 4OLWH 5ILTH 3BQUA 4PRHA 4PGDB 1YC7A 1MREL 4PRPB 3RWFB 5IGXH 2DYPD 4POYA 5IW1B 2AJXL 5DURB 2WWKT 2YWZA 3BI9X 1FDLH 3WXWL 4LU5L 1E4KA 5GISH 2J88L 3F7YB 2APFA 3TZVC 3JV4A 2WV3A 2X4NB 1YNTA 3QIBC 1ZOXA 1GGBH 2P5WA 3KS0H 5D1ZB 2FJGA 1J8HA 4WUUA 1NL0L 2X4TB 3V5KB 3CFEB 5IUSA 1JI2A 4JPWL 1UH2A 4CL7A 4H26B 3SGEI 3Q0HA 2NY6C 3V5DA 3VFRB 2F54E 4YPGA 3Q6GH 3G5ZA 4MVBC 3PP3K 4G7YH 4YGVB 4K3EH 4EOWL 4R3SB 4XI5D 1OAKH 1MCCA 2FB4H 3MFFB 1JZ2A 2CXKA 4JY6B 1Q9OB 4Z7WE 3BZ4A 4TUJB 4RGND 5IB2A 1TJHH 4LVHC 4DN4H 5A2FA 1YPZA 3LZFH 4N0UA 1T1ZB 3DMMC 4YFLF 4KRLB 4O4YH 4F8TA 4HS3A 4O2CA 4P9MH 2QSCL 1N3NB 2EDEA 4MCYA 4YEEA 1PEWA 1T21A 4RAUA 3NCJH 4PG2A 4KHTL 3SKMA 2EEDA 1HI6B 2K9UA 2ZKHL 4XGZA 4JDZB 4PJBF 4CN6A 5ACLA 5AYQA 4ZQKA 1A2YA 3AY4A 3GUTA 3A0OA 3OJ2C 4M62H 3ELAT 1GPOH 4K94H 4KRPD 5JLZA 1A1OB 1FL3A 5HI4D 1T1WA 1MFEH 2HN7B 2FX9H 2DTMH 1OLZA 5F9OL 3DUUB 3IKCA 4UILL 4G3YL 5SWZB 3UBXG 1TZGL 1A47A 4QXUH 3RTQB 4B0MM 4NT6A 5KZCB 3M17A 1QLFA 5CEXA 2HA1A 3KPMA 4G5ZH 4OAWA 2DWDA 3DMMD 4MNGB 4G8EB 4XVSL 1RJYA 3PWVA 2APWA 4RGNC 5TQ2L 5I18H 1FVCB 2OR9L 5K33A 2HMIC 1JZ7A 2M8XA 2NY4B 3IFNL 4X4XA 4HKXA 1OM3H 4I48B 3X14A 1EGJH 4M6OH 5ITBL 5IHZB 3RWFA 3ARQA 4CAGA 1HE7A 2I5YL 3BH9A 2PCPB 3IS1X 4G6FB 4LLMA 5ISZE 3C2SA 1N2RB 3DBXB 3E6FA 1FRGH 4EDXB 5IOPA 1UM5L 3CD4A 4HEPG 4YDLB 4LCUB 3K7UA 4OGYH 4PJCB 2OS7A 2PN5A 3LVEA 5CGYC 1MCHA 4PJAE 4YQXL 4Z7QE 5HHOE 2CGRH 2Y72A 3IXTA 1D6VL 4HH8A 2BC4A 4F7TB 2X5PA 4MJIA 4POZD 3DXAA 5D1QB 5D7LE 5JW5A 5I30H 2NY0B 1K5NB 2J6EL 2YEZB 3VRJA 4FZEL 1DBJH 1QSFB 2PO6C 1IEBA 3DI2B 4LOUC 4PV8A 2EE3A 4GBXB 3ALXA 4UTAL 4XXDB 3OR6B 4HKXB 5DT1L 2E27L 3KHQA 2N7BA 4U6XA 5CEZL 4NQXA 1V3LA 2OI9A 3V8CA 4F8QA 4PJGF 3PIQB 5HYJE 4L3EE 3MYJA 2AJVL 3KPRA 3AMKA 3LKNB 1OGTA 5CJXA 3UEZA 3RDTC 3H7LA 4U6YB 1T03H 4KVNH 4JM2F 5D6CB 2AV1A 5DR5H 2YZ8A 3SKOA 1RZGA 4XP6H 1X6NA 2V2XB 5FO7A 3SE3C 4LPYA 1IE5A 4ZODA 2J1KA 4PB0H 1CBVH 1MY7A 3ZYZA 2DDQL 3T0WA 5CJBA 2OM5A 5BQ7B 3H6JA 4JKLA 3MXWL 2FGZA 4UQ3B 3L95B 5T1KA 2PW2A 3M8OH 4KTEH 2LTQC 1LEGA 3QQ4B 2X70A 1FG2B 2XY2A 3HC3L 2VZ1A 3RAJL 3P3YA 4KROC 1FFNB 4GSDH 3HN3A 1SY6H 1U6AH 2E9IA 4YHLL 5DSCB 1JMXA 3S8WA 1CLZH 4B7LA 4JREB 5IMOA 2DD8L 4NZRL 1C5BH 4Q97A 4HMDA 4LGSB 3UPCA 3ZL4L 3LH2H 4PRNA 1CTOA 3BWAA 4NQED 1NUFA 1CFSB 2O5ZL 3LQZA 4P23D 1AGDA 1G7JB 2N7AA 1LEIA 3S36L 3SDXA 5CP3H 2X4UB 5MEOB 4HZLA 4JFHE 1KIQA 3NIGF 1A7PH 3ARGC 3U7YH 3JWDH 4J4PD 4X6CE 1N0XH 2EDRA 1FZJA 3C08L 4M7LL 3QIWA 4LVOB 5F7DA 5D4QA 4I0PB 3BAEL 3VCLA 4ETYA 5C08D 1Q9WA 3KPOA 3VXQB 5GRYA 4M1GH 1GYAA 4IRJA 2OL3H 3BIBX 3RUGB 4JN2A 4P2YA 5GIRA 4FN0A 4HW6A 3E6HA 1A6VH 4XNZC 5GGVY 4YGVA 4XPBH 4UIMB 2DQGH 1BGXL 1JRHH 2A6JB 4OZGF 3T3ME 1UH3A 4EI5B 4M1DH 4H1LA 12E8L 4QTHB 4LHUG 1IAKA 4KPHL 5ERWB 3VFSA 2EE6A 4W4NA 3W0WA 3FMGH 4JY4B 2GFBA 4KJPC 5IFJB 4PBVC 5E2JA 1JNJA 5IHBA 2DQCL 2OTWA 3QUKA 4DKEH 3HUJA 3V7MA 4G8GE 2ERJC 2UWEB 3TBVA 4YDLC 1KCUL 2EYSA 2O61A 1EPFA 2EXWD 3FQXB 4TPRH 4WW2C 1RIUH 5F72S 2DS4A 2DM4A 5EUOF 4M5ZH 3QPQD 4PTUA 5JR1H 1G9NL 5SWSA 1KPVB 5CWSB 1YJDC 2VLRE 4S1SH 1P7KA 3V4PL 5F9AC 5KS9E 4URTB 1T7VA 5C0CD 1CU4H 1WK0A 4UB0L 4KZEH 4OBSA 1B6DA 5AYUL 5IBUB 4OCRL 2WQ8A 4X7FC 4JFPA 2K1MA 4OFKA 3MNWB 4P3CL 2PTVA 4LK4A 5C8JA 5JXAL 4YXLL 5L8JB 1YMMD 4HJJH 4JG1L 5FCUL 3WN5C 5E9DE 4P9HC 4ONHB 1LO5A 2Z31C 3IXAA 1A4JA 3EDJA 3W9DA 2DWEB 4Y1AB 4ZUSB 3QIUB 2XZCH 1EAJA 2IC2A 3BT2H 1CS6A 1X7QA 2BNUA 2H1PH 3SGKA 3KNBB 4G6AD 4KMLB 1JYXA 2VQ1B 4IRZL 4NHUA 1KJMB 4Y4FD 4G9FA 5IFAL 4JQXC 1DZBA 4F9LA 1MF2H 1A1OA 4GS7C 2MJWA 3O3BB 2D7PA 4L4VA 4CN1A 5DO2D 5DYOB 3KYKL 4HV8A 4JY5L 4LNVA 5HJ3A 1SBBA 4ODBD 2XA8H 5INDA 4XNMB 25C8H 3WS6C 4PJ8B 4FABH 2IFFH 5HGAA 4MA8L 4EI6B 4PJXA 1HDMA 4IS6A 4LLUB 5HHQA 3UPRB 3ULSB 1QPPA 2J12B 3O4LE 5K9OA 4PJCF 5DJ6A 4DVBA 5CLTA 1AXTH 2XZQH 4JQVC 2CJUL 1PLGH 3UBXA 1OTSC 3S96A 4DTGL 2YPLE 2W0FB 2M2DA 4JO1H 3H9YA 4PJEA 4S1RH 3MFGB 2PR4H 1JNLH 3ET9F 3NAAL 4JFZH 3RVUD 5CEZE 3KJ4B 3MRQA 3EYSL 3VFRA 1TVBA 3WFHB 4HJ0D 4PJ7A 3S6CA 1R5WA 3QUYA 4YWGH 1KJ2H 3HZKA 3PL6D 1YMME 2BSED 1HDMB 3MV01 2WP3O 4JZJC 5D6CA 5TDPA 3PGCA 5GZOD 3PHOB 2YD1A 4CDHA 1J1PL 4YXHH 2WK2A 3U1SH 3MCG1 3QQ3B 2X4NA 3TA3A 3B3IA 2Q6WA 3IYLW 5FUZH 1A9BA 3U79A 2DQTL 1HH9B 5DD1L 2IAMA 4ONFH 1EEQA 4RRPG 2CKNA 3RL2B 3ZYIA 4ZYKB 4OD1L 2ZOKB 4H8WC 4PRPA 4K9EC 5EN2A 3KXFA 1Q0XL 2AGJL 4LEXL 5L8LB 3C9NB 1FZMB 3RWGA 1TETL 4U1JA 1EAPA 1F8TL 1F4HA 1UACL 5TPWL 4JFQA 3JTCA 2ITCA 3S34H 2OMNA 2DQHL 1AO7A 4YR6A 1N5AA 5LG1A 1I3RB 4CVUA 3QIBA 5KS9B 3LV3A 3MJ9A 3HTLX 1T0MB 1DQQA 3DVFA 3EYOA 5CJOH 3IRZA 5KVDH 4GRWF 1GH7A 3JV6B 4IOFD 3ILQD 2D4DA 4Z7NF 2W65B 1U3HB 3P4OA 4JHAH 4OZHE 4YHIA 5EC2A 3LKPB 2YUXA 4FG6D 1P4IL 3T0ED 2MKLC 4C58B 2CXGA 3I75B 4GMTH 1IZJA 1HH6B 5LGKA 4RNRB 1R3HB 1HHIA 5ID0A 2NPLX 3BQUC 3WS6A 4BZYA 1ZGLP 3VGAC 5C2UB 4OQTH 5IESL 4GG8B 4RFOH 4YHKH 3O2WL 4PD4K 4WRLA 5FA3B 3RY6C 1INQB 5HDBE 1QFUL 1CDHA 3DYOA 1I85C 4B7IA 1I1YA 3QXAB 1DANU 4R0LC 5J89A 2IQAB 5DK2B 2X4RA 3Q1SL 1FFOA 3WXVL 2P45B 4YIQA 4PUBH 5L88H 3O9WC 5HYJD 3V2AR 4OLYH 4PTTA 1LK2B 3S37L 1U58B 4UV4H 1MPAH 5J9PB 4KI5F 3GUTB 2E5EA 3N1PC 4QHNB 2YN3A 4X80H 5T33L 4NKMB 4HT1H 1SVCP 4L8SA 4Y89A 4QRPB 3MRMB 1FC1A 5K9QG 1U8KB 1TPXC 1CIUA 1IGCH 1U91A 3DIFA 3NA9H 4R90H 1TCRA 3FQRB 1TVDA 5HHMB 2RHEA 7CGTA 5D93C 1Q38A 3C6SA 3MR9B 4OFPA 2H2SC 1U8JA 4F7EB 1TJIH 2C4FT 2A9MH 4LLWB 1W2KT 1FL6B 2VZSA 1IM9D 5TH2B 4XCCL 1I3GL 1ZSDB 1UEMA 1QLEL 1EERB 1H3VA 5K9JL 1NAMB 1IM9A 2XXCB 1RK0A 5L7XL 1FHGA 4Y4HB 5IT2L 1R3IH 2GW5A 3D3VD 4YK4C 1TQBC 2P7TA 3K46A 3VRJB 5IG7B 3ZYOA 2IH1B 4J2XA 4KROB 1OSPL 3LEYL 4QRPA 3IDGA 3CUPB 4LSRH 2BNRA 1K8IB 4MGXA 1AIFA 2ICCA 1V5JA 3WJJC 4X7SL 3CK0L 2O5YH 3UYRL 2KL6A 4QOKE 3HMXA 4H5SA 2VLJE 1TTFA 1A7NH 3L5WB 3MOBH 3QCUL 4MQSB 1SYVB 4N5UA 1AD0A 1FLRH 1JPST 3VI3F 5E99L 3QXDB 1KN2H 3EOTH 4OCXH 1XF1A 1CZ8H 1J7VR 4Q9RL 5D1ZA 5LKNA 4NQTA 1IGIL 4PGDA 4UI2A 2Q86A 3QDGE 2JJSC 2VN7A 3QHZL 1OW0C 1LP9E 4N90E 4JFOB 4P2OA 3RGVC 4PJ7F 5DRNB 3EZJB 1QSFD 1WIPA 3M45A 2QSVA 4FQIL 1A9EA 3DX8B 4MA7L 5GJTH 5CGYD 3V4VL 3NPSB 2ZNXA 5HY9B 4EN3A 5INCA 3MRCB 5LQBH 4GKZB 4XNMA 4GKSA 4NJ9L 3RJDA 5J7CC 4PJEF 1JNNH 4WWID 5I73B 1TQBB 4XAKE 2DIBA 4DZ8B 3ESUF 2FATH 4PJFA 2R29L 4GLRI 5HYFA 5DMGD 5GGTL 3BPLC 2CD0A 4GOSA 2DTSA 2VLKA 3VA2C 4XBEL 2XG4A 5IEHA 1MWAH 2GTZB 2WUCH 5DK0A 4OV5A 4KH2A 1IT9H 5C0CE 1A6TA 3TT1H 5IBTH 3EAKA 3LPFA 2Q8BH 2BNQE 3N1QC 3MUGB 1QA9A 2I27N 4U7SA 5DQ9A 2HH0L 4OGZA 3NPSC 3KJ6H 5KSBB 3VFUA 2IAMB 5C0JB 5DHXB 5JZ7C 4OZIE 4ENEC 2YBRB 4K55A 3GNML 3ZTNH 4NNXA 5DTFB 1S7TA 4QRQA 4EUPA 4OD2B 5HHME 2CIIA 4PRIE 4PJAB 5IW3A 2D7QA 3UTTB 5LJYH 3BKML 1BAFL 4QHLA 4HZLB 1MCLA 4QRPE 5H2BA 4NGHH 2FD6L 4GUPA 3S35X 1UYWH 1II4E 5F93C 2X1OA 2AEQH 4PJHF 4ENED 4N9OB 2JCCB 3G6JB 1DBMH 1Q72H 1GOHA 2KH2B 3V52L 4N90D 1KFAL 1I9JH 3P40A 4K3DL 3L3DB 5KVGL 3A67L 5SX5K 1WISA 3X12A 1DVFA 1MHEA 2A6JA 3M1BA 4LMQE 5I75B 1GGCH 1FL5B 1EO8H 4ZUWB 4KV5E 2KKQA 2ZZUT 3WCYA 1IKNC 2F19H 3B83A 5KG9A 5DGQA 4AK1A 1I3VA 4E5XB 5HHOB 1RU9H 1IC5L 2G5BA 3MRPB 3VFPB 4R9HA 2P24A 5TJWK 3DJ9A 5JXED 2HFFA 2BVUA 2Y07H 1CVSC 1I1YB 3QXAA 4RDQG 4HCRA 1JHLL 4BFGA 5K9KA 5SWSB 2J8HA 3G6DL 2R0WH 5FO9A 5J4MA 1B2WL 4LSPL 4Y19A 1FP5A 2YA2A 3GMOA 4N0CD 1ORSA 3BX7C 3KYNB 4X4ME 3RGVD 4O9HL 3KPSD 5I66B 2YC1B 4KHXL 3CXDH 3OAUL 3DGCR 3S35L 5KZCD 1D5IL 5J6GA 4WW2F 2DM2A 3A6BL 3VXME 3AGVA 4B5EA 1FL5A 2UYLA 1MI5E 4CMHC 4K23H 5ICYB 3QG6B 5AUMB 5AAWA 4K8RL 4LKCA 3V0WL 1A8JH 4OCYH 1MJ7H 3IJYB 5ISZD 2Z92A 1CT8A 5JHDA 2EYTB 4J1UB 5DJ2B 2VZVA 3PDGA 2ATKB 3TV3L 1IKFL 3DWTA 5FGRA 2BY1A 3QAZC 1J18A 5FYKH 1O7SA 15C8L 4NOFA 1I8KB 3TVMA 1OL0A 3KDMA 1ZHBA 3RNQB 3HR5B 4S10A 3D3VA 4RZCA 3K80A 4KJQC 4HD9A 4QRTB 3MJGX 1EUTA 5EIIB 1H3WM 1ROWA 3U0WL 1TJGL 3P30L 3FAXA 3UJIL 3KWWB 3TYGL 3D1MC 1JPFB 1RJZA 4HFUL 5HXMA 5JIIA 4FFWD 4JFOA 2HJKB 4D0BA 4YUEH 4RIRB 4H88L 3ARVA 2EE9A 5LGJB 2VLJA 5CJQL 2F9BT 1W72H 3QRGH 3FOLA 4HDIB 1BIIB 4YHOL 2YK1H 2EIEA 2GQHA 1W8OA 1XGPA 1GVIA 1I7TB 1FZMA 5FO8A 4KKLD 3UBXB 5IJKC 4U1MB 1AGCA 3NPZB 3ULUH 4AT6A 1FZKB 1HEZB 2NX5D 2A6KB 4L8CB 3MPCA 4X5XA 4LPUA 3L3JB 4HUNB 5J11C 1NCAL 1RZFL 3IETB 3F6IA 1INEH 4NZUL 2NLJA 4X8JB 1ZV5A 1CL7I 3GMRB 4ZO9A 1E4KC 4M1CD 1NFDA 1IRAY 3H9HB 1RIHL 1OAUL 3VXOA 3LSOA 3RY4A 2UZIL 1NMAL 3GB7B 1MRDH 2AW2A 2MHAB 2AABL 3T3MF 4GAJH 2VR5A 1E4XH 1GRWA 4E0RB 3QEQE 3L3JA 1HZHH 3S4SB 4Z5RB 5GRWA 3T0VA 6CGTA 3P73A 3KXFD 5GHWH 5C1MB 4LNRB 4LAQL 1HHIB 5ID0B 1KLGA 3GB7A 5E8DH 3CX2A 3QIWD 2KZWA 5I17A 1JZ6A 2J4WL 1CYGA 5DZLA 3AM8A 4WWKD 3IF1B 1U8NB 3BZ4B 1H8SA 4HSQA 2V5TA 3KPPB 3MRKA 4JR9L 1NBZA 2YKLL 4XX1G 1ETZB 1ACZA 1FN4A 1DLFH 2PW2B 5DI8B 5DJZA 5E5RB 5SX4H 3ZHLA 4EQ2A 1QSZA 3RHWF 5JORA 4W70A 4GW5B 2XWTB 4JZJA 1AR2A 1AY1L 5L2JA 2X09A 5EPMA 3VGBA 1S9WB 1R5IB 1EHLH 1S7SB 3VWKB 1YN7B 3RWJB 1I7UA 4DUVA 1WGOA 1FPTL 5D8JL 3MRDB 4JPVL 1YEFL 3UTQA 2E7LC 5AZ2L 1B4RA 5IB3A 1LQSR 4BQ6A 4DGVH 4NBYB 4JM4L 3CFDA 3G9AB 5T3XE 3FO2B 3VE0A 1FH5L 3IAGC 4WHTB 5EBLA 3OR7A 4KWUA 4PJHA 1B0WA 3D9AL 1YN7A 3RWJA 4N8VB 1R3HA 4XTRC 3MCLH 2MPAH 1BJ1J 4YNYA 2P48B 4NOBA 1FNEB 4Q74A 4Q9QL 4AQ1B 1LEKA 4U6VH 5C09A 4DZBA 4GW5A 4E41A 3GMQB 2GTWB 4FQJL 3WFDL 3MUHL 4XBPB 3MGOB 2Z31B 1AGEB 4GRMB 3OKMB 3HMWL 1T1WB 1CR9H 1KCLA 2WQRA 1DQJB 2Y36H 1PZUB 2B8OT 3OXRB 2H8PA 5GRVK 4ONGH 3QJFA 1QVOA 4OLUH 1LDPH 1MJJB 1KJ3L 4V3EB 2FBJL 3O8XC 3BZFA 3L3HA 4U6HA 2IANA 3MGTB 4A6YH 1JGEA 3PJSB 2ENYA 1RIVH 2VKXA 3HE7A 5CP7A 5KVEH 5DFVC 5DLML 1Q8MA 5FOBB 1PY9A 2HT4C 4ZS7L 4X7CC 2QSTA 4WO4D 3GJEB 4WV1C 4BZ2L 3BPCA 2P42B 3GO1L 4NKDB 5C3TA 4JRXE 4X4XB 1NBVH 5EZLA 3VWJD 4R26H 1HHHA 4UBDC 1X5AA 3P0VH 4TUKL 4J3XA 3PJSA 2DOCA 2AXFB 3QDJB 3OV6A 5E6IC 3LB6D 3MCKB 4JHWL 5HHXL 1T66D 5J57B 3GKZA 1BFOB 1WLHA 2YXFA 5EOTA 1KENH 3TO2B 2PUQT 2IH1A 3OKLA 1LP9B 4JFYA 3WLWD 3AY4C 3EJZC 5TF1L 3GRWL 2ZJSH 5IK3A 5IWLC 5HI5C 4I18C 2AEWA 1UADC 2FEDC 3LEXB 1NBZB 4XPHH 5C0DA 3ULVF 2PF6A 4UTBH 2BY0A 3CFEA 4YHNB 1OAYL 3NFPA 1XIWC 3V6OE 3QDMA 1DL7H 5BJTB 1EVTC 1MIEL 2K7PA 3T0EE 4Z6AT 5HYSB 4WTXA 4UU9B 3NIFF 1MAMH 2W0LA 1F4XL 3SJVD 4L3EB 5GRJL 5D93B 4NQSB 4RIRA 2Z91A 2C9AA 4Y4KC 4ZUUB 1J8HE 3IDIA 3VXOB 1ZS8A 2AQ3A 1N64H 3STLA 3RU8H 5E0QA 1CGXA 4R7DA 1WAAF 3MJ6A 5CGMA 4PJDB 4UOJA 3QPQC 1QNZL 3O41B 4WU5B 4WNQB 5DRWB 3DUHA 1QSEB 3ZE0E 4OZHF 5DHYB 5F7UA 4QT5A 3NGBC 4KQ3L 1BOYA 1HEZA 3MV11 1AO7B 3B2UC 3AFLA 3X3FH 4E42B 3FONA 5CIPH 3HZVA 2A9NH 4MDJB 1ZA3A 1F58H 4YHZH 3T09A 3CZJA 4RMVA 1E0OB 4XC3L 1CICA 4OFYD 4UZGA 4FMFA 3K81A 4QEGA 5GS0D 4OFIA 2C7UB 2SEBB 4HWEL 5DK0B 5IQ7H 4OV5B 4ONHA 4JFFA 1ULVA 3HZVB 1S7QA 5CD3A 3BD4A 2V2TB 3TH4T 3A6CL 1JK8B 1DQDL 1HYSC 2P5EB 1LK3L 4X5WB 1BQUA 5EBMB 3OTTA 1GL4B 3V79C 3FN9A 4RFNC 3VFMB 4EDWL 3LEVH 1I7UB 4K2UL 1R3KA 5E4EB 3L5JA 5CD3B 1OW0A 2E3VA 4NO0A 2F15A 2QQNL 5C08A 4GKNB 3G5VA 5JA9A 1FNFA 3EOAB 4QXGL 1DSFL 2NZIA 2X9YA 1S8DA 5TE4L 3HC4L 4EQ3A 2VITA 1MCQA 1ITBB 1XR9B 5F1KC 3CZFA 2R2CA 4XWGH 2WIIA 2P4AB 3LQZB 3BKCH 3GMNA 3EYFB 1E6OH 4LBEA 1LNUB 4X6DB 3ROLA 1XAUA 2AJZA 3Q48A 4JFFB 1CF8H 4PRIB 3L7EB 3FRPA 1DBAL 2BFVL 4D94A 3KYMA 5A2IH 1FIGL 3HNVL 5I17B 4L8DB 4LKCB 1Q9KA 2OTUA 4OSUH 2J6EA 3VD5A 4AG4H 1UXWB 3DVGA 4H20L 2E7CA 2A0LC 1C5CL 3KPRE 5JHLH 3RNKA 3QFDB 2M1KA 1Z0NA 1VFAB 1QR4A 2J5LC 1ORSB 3KYNA 5F71A 2FX7H 2HFEB 1UENA 3O6LL 4RA3A 3BEWA 4Y16B 5HYSG 4KTDH 3MQIA 1YMHB 3REWB 5C0FB 3QFDA 2VUYA 2FSEB 1DE4B 2NY3D 2DICA 3D0LB 2LVCA 2DI9A 3WSQH 4R4FH 5M94B 1BJMA 3RUGF 1PG7H 3V6OC 3GSUB 3TN0C 3DMMB 3OZ9H 4BM7A 5FYJU 4JB9H 1ZHNA 3HE6A 3MRNA 4TQEL 1PQZB 2JJTC 5L9DL 2DLHA 1UXWA 3DVGB 3T4AA 2RGSA 4YX2H 1WBZA 3L3HB 4LSTL 5ID1A 3WO4B 5TE6L 2IQAA 5E08H 1YEDA 3G6AB 5I1GH 3GSXA 3TH3T 1Y6NR 1BZ7B 3O0RH 1IGYB 3HI1A 3OAYK 4HIXL 1I8MB 4AIXA 5JQ6H 4HF5H 3TO4A 1EIBA 3T8XB 1IAIL 1U58A 4XP5H 3HPJA 2X70B 3JZ7A 4NCC1 1VADB 5ESAA 3KPQA 4X6CA 2EH7L 3I3EA 3BO8B 4FQQA 5J3HC 2FIKB 4G7VL 2NY7L 4IBLT 4R97B 5KVFL 4M48H 5KSVA 4PJXB 4TUJA 3K2UH 4EN3B 1NEZG 2QQKL 4MSWB 1JWSA 1J0HA 3MUZ1 3F7VA 1P53A 1MQ8A 4ZO6A 1TNMA 3QCVH 1CQYA 5T3XH 5GRUH 4KVCH 1M7DA 2ESVB 4OTXL 3WS3A 1T2QH 1MEXH 1HH6A 1RZJL 2WWMD 3DYPA 1CICD 4OFYA 1L7IH 1BJ8A 3MZTA 2EDNA 4PJ5B 3LS5L 1V05A 4KKAD 3WIIH 1Z5LB 5DJAB 1H15B 4OJFL 2FYYA 1SYSB 3KXFE 3MODL 3T2QA 3GK8H 3TEUA 4Y2OA 5F7KC 2Z8WC 3ARSA 2D7NA 3BP5A 3VG9C 2ESVA 4HC1A 1YNTB 4YDKH 4KK8C 4XP9L 1JPTL 4DW2L 7FABH 2CIKA 4MDJA 1FN4B 1IGTB 3D85D 3LS4H 4NZJA 2Z9TA 4GRLC 1JGUL 3SDAD 1NMCB 3RVWC 3WEXA 1M1SA 1OTTD 5HHVH 1W0VA 4I2XA 4DOHB 4FXGB 5F7YC 1WWCA 4K9EH 4Y1AE 3CXHK 1G9EA 2XWBA 5IVXA 4O02L 5DFWH 1E27B 4Y5YA 4RISH 1MCFA 4YC2B 5GZNC 1TMCB 4X9IA 2L0DA 3GMMB 3BGFB 3RRQA 3T04D 1QRNE 2CRYA 3PL6A 2ZG2A 4FFVD 1Q1JH 2CUHA 4PRDA 4R8WL 4NQSA 2E8ZA 3LQAH 3VXMD 1P6FA 3L9RA 5T3XD 4TVSa 2VLRB 2D03L 2VDOL 4ODXA 1G6VK 3CVIL 4F58L 5JOFA 2VC2H 1A3LH 1NGYB 3G6JE 1DBBL 4L5FH 4ZPTB 1L0XA 1QBBA 1A7QH 1ERNA 2WIIB 1WITA 3HE6C 4G6ML 1J9CT 4OD3H 4NQEA 4ELKB 1L6ZA 5ADPH 3MV7D 4Z7OF 4UAOC 3DURB 3W39A 5L6YH 1D9KB 1FZOA 5KAQG 5EB9A 1CD1A 4MZ3A 5ECJE 1XH3B 1MFCL 2ZUSA 3MV7A 5I1HL 3U46B 4NZTH 3WIHA 1E6JH 5BO1H 4MA1B 4WO4A 1ZXQA 1BM3H 3OSKA 4HJGA 1NAKH 1J1OH 3TZVD 3DV4B 4D0CA 4I13B 2B1HH 4MB5A 3CFCH 3NVQA 1JHKL 4NNPL 5L2KA 3GJFB 1EVUA 3HMXL 3OKEA 4WIQA 4NQVB 5FDYA 4JO4H 2KUTA 1MCKA 3QEGH 1ONQB 1FYTE 1G7IA 4I3RH 2GUOB 3WL9B 4G9DA 4U33A 1G0YR 1TXKA 3QRFM 2ESVE 1H5BA 4HGWB 4BQBA 4FQ1L 5KJRH 4QLRA 3VDAA 3OKMA 4L4VE 1EHNA 1IGFH 5F1NB 5H37H 2D7OA 1YMMA 4JFPB 3C5ZC 3OG6B 4DEPB 1FG2A 1H5BC 1F4YH 2YD4A 3NN8B 1P5VA 1HXYB 4A6YA 2O26U 3EFFA 4M8VA 4IRSC 1N6QH 4WCYL 1RK0B 4XPAH 3LKNA 4M03A 4GAFB 5FYKU 2FLBT 5DK2A 3TT3H 2VDLH 4S1QL 1Q0YH 2ATPA 2HVKB 3SKOB 1QFWI 2R1WB 3F7YA 2P8LB 5F3BA 3MLSH 1JGLH 4XNQB 4AL8L 4BFBD 3CVHB 3SKNB 2QV2A 1KXTB 3NFSH 4ZXBC 4OGXH 4JGUA 4NT6B 3BD5A 2XPGB 4QXTB 2ZUVA 2NXZC 2R9HC 2HLFD 5I71C 1NCBL 5DFTA 4LHUD 1CL7H 3CUPA 4NWTH 3PV6A 4IRSB 4YPJA 3HA0A 4QY8A 3T2NH 3EIFA 1HIML 3T0AA 1WF5A 3PXHA 4JQIH 3GHBH 1BFOA 3CC5A 1NKRA 1R3LA 4HBCH 3C60A 1ZLWH 5T5FL 1N2RA 4JPKL 2XNAB 2QL1A 5KOVC 4QY8B 2YRPA 5AUMA 3D69A 5HGDB 2R0LH 3B5TA 2P44B 3ECBA 3ARFD 4H8WL 1WZKA 2ESVD 1G7HA 2X1WL 4MAYC 3IDIB 4WV1A 5E1AA 2Q86B 1T20B 3C60C 3SY0A 3BE1H 2V17H 3G08A 1BVLB 4D3CH 4MYWB 3FB7B 3LKQB 5AWNH 1URLA 2ARJA 4XCYA 5DEFB 4WV1B 3FTGA 2VISB 3UJTH 5H35B 1G7HB 4Z78A 4P9HL 3S5LA 3IU4L 3ULVL 5FGCE 3RWEB 5E2TH 1C1EH 4LASH 4XT1C 2Q76A 4TSBH 3RIFF 5EPMB 4YPGB 4KUZL 5I1CH 4KJWC 5LBSL 1KEGH 3CFBB 4GRWH 5BRZA 3PWLA 3G5ZB 5D2LA 5BVJA 3OMZA 5DJZB 1RMFL 3AU1A 3B4NA 4I4WB 5EIVA 1P4BL 5IBLD 4GG6A 4I3SL 1IGJB 4CBPA 2VDRL 4ZS6C 2YA0A 3FB6B 4QYOB 5E24E 3BN9D 3UZQA 3RPIA 4P2CG 4HAGA 4ODTL 35C8H 4LCIL 2X4QA 1MI5A 2IH3A 3RGHA 2YSSA 5JW4R 5B38B 3QIUA 1LO2H 1DBKH 2GJ6B 3WHE0 1HINL 3RVVD 4LARH 1YN6B 2AJSH 3ZDYE 1EEYA 2GAZA 2A0LD 1FNGA 1H8NA 3O81A 3DX6B 3HLAA 5TQ0L 2YUVA 3EJYD 1Z0MA 1ZKAA 1A6PA 5EOCL 4C59B 3DIFB 3FFCE 2FWOA 4MMZC 5ESQB 1JGVH 3KPRD 5C08B 2LV4A 1IBGH 1I8KA 1U3HA 3P4OB 1RULH 4M43H 4AMKH 4DVRL 1I9IH 4P46C 4F9PC 3O2DH 1TPXB 4CW1B 1T80A 2AVGA 5FEBA 1PX4A 1S3KH 3JWOC 5FOJA 4ELMA 3RY5A 1OF2B 2EXYC 5IB1B 2ICWA 1HHGB 3H3PL 4GQ9H 1MRCL 3DRTB 3WUWA 3HAEH 4M7JL 8FABB 2NY2D 4O51B 4Y19D 4QTIL 2CR3A 1FO0L 1PQZA 2G60L 4QO1A 1MY5A 1U8MA 2R56H 3DVNA 4DGYL 4NRYB 3WFEH 2BOCA 2C1PB 1BIIA 3MJ7B 1SBSL 2AJZB 4LSSH 4LAJH 1SM3H 1KG0A 1HHGA 4JM2A 1QO3B 5DHVB 3D85B 1S7RB 2CDEA 1LO0L 5D96C 4B41A 4RDQF 4NRXB 3O4OC 1BD2B 4V2BA 4Z7UA 2FRGP 5DVMA 1C5DA 2PO6A 5I16A 3MRLB 4JFDE 4ZFFB 4U1SB 1KB5L 3BSZH 43CAB 3QNXB 4MAYD 5D7IF 1V3JA 4FG6C 4Y19B 4Q2ZB 3QXDA 1XH3A 3THML 5C0BE 4U1SA 3QHFH 3MOAH 4XP1H 3VFTA 2NNAA 3CDYA 4FRWA 4UAOB 5J6HB 4TTGA 3O6KH 5FF6A 4N5ED 3ETBF 4D9RD 4TSCH 3MJ7A 1I4FA 4MD4A 4XC1L 5FHAH 4UOW0 1GOGA 4I0PC 4JM2C 5E8NA 2EYTA 1G7IB 4WFGE 2I60H 4NM4L 5D7JD 2RR3A 4X5LA 1SYSA 1IGJA 2PKDA 4OZIA 1DEDA 1T6VN 3E3QE 4LP4A 4GQPH 1N5YH 1ED3B 1RJLA 4RAUB 5EIQA 5EZOH 4NUGL 3MV8A 4MJ5A 5CIPB 1RZKL 2VDKH 4JFHD 4XHQA 5ENWB 3FZUD 3CH8A 2VUOA 3LCYA 3IFLL 1ZS8B 3N9GL 2FEDD 2NXYB 3SKJH 5FDWB 3OB0K 4DFIA 3V5HA 1F3JA 2L7UA 2W9DL 2X4UA 2I9LB 5CILH 4ISVB 1VGEL 1ZT1A 3SO5A 4HXAL 2IPUK 3VH8G 1TVHB 4RNRA 3B2VH 2EDJA 4O58L 3SJVE 5J9PA 2EZ0D 2FGWH 5FYJH 4OI8A 5D7SH 1R24B 3H9SB 1YPZB 1IVLA 4OZHA 1J05A 5IMOB 4JN1H 4OV6F 2EYRA 5DSCA 1ZGLM 3MSPA 1Z5LA 1RVFH 3OJDA 3UCRA 2X7LA 3IU3B 2GI7A 1CK0L 5FXCH 2GSIA 2FDBP 3LMJH 3AU1B 4F7MB 4XHJD 1JPFA 1RJZB 5I76A 1R24A 1WZ1L 4LSQH 1A0QH 1DUYA 2BMKB 3VRIA 2NY1B 3F12A 3S88L 4JFQB 4OCWH 4LLMB 1BBJB 2ZPKH 3LIZH 3GI8H 1JF5A 3O8XD 1YNKH 4HWBL 3HI5L 4KRPB 1ZT1B 1WCBB 1R3KB 4X83A 3WEXB 1KTLB 1QFWH 4Y5VC 2EXYD 3K4AA 1C5DB 2PO6B 1AC6A 3JV4B 1K4CA 3GSVA 1CTNA 3JV6A 3KR3H 4ODSH 4BH7B 1EZVY 4E5XA 1S7WB 1A14H 1CK0H 1T83A 5DRXA 4XCEB 3N50A 2IWGA 5BW7A 5FYLH 3QUXD 4IIQB 1CWVA 2YBRA 3O4LD 2E9JA 3QDJD 1EMTL 2QHRH 1IAKB 2NW2B 4W6XB 1UJ3C 2YZ1A 2EDWA 4EI5A 4MNGA 2ZSWA 3V8OA 3WNPA 2RIKA 4LFHD 5D1XD 2Z31D 1X44A 1NC4A 5FYJL 3L1OL 2CR6A 1NLBH 4GMSH 5BMFH 4G80B 2CQVA 2VXVL 4AH2A 1JTOA 4HCRH 2VQUA 3O6FB 5DHYA 4OLZL 3T3PE 2ICEB 3WUWB 3IXTB 4Z7OE 1H3GA 3CH1A 1CLOL 3ARBD 4F7TA 4M5YL 1VEMA 3N9GH 2R69L 4NRZB 4OKDA 3G5XB 5BZDA 4N68A 1MRFL 3ESVF 5HHNB 5D2NE 3SPVA 4LHQB 4L4VD 4PJCA 2WM0A 2OQJB 1RZKH 2AK4B 2NW3A 2ADGA 3OKNB 1ZSDA 1JVKA 1OTTC 1YUHA 1CDBA 1FORH 1G6RL 3WFCH 3MTRA 4L29A 3STBA 3K4DA 3O3AA 1LQVA 1BREA 4Z7VA 2QLVB 4KI5D 4R7NB 4DVBB 1NGPL 1B4JL 2JTDA 4WHTA 5EBLB 4ORZC 1K4DB 4OLXL 4R4ND 1LE9A 4OIIL 1SJXA 1ZTXH 4QF1B 1CIDA 3K4ZA 4WFHD 1CFVH 4LSDA 1TENA 1BLNB 3HLAB 4L3EA 3W9EA 1F6AB 4N0RA 4BQ8A 1G1CA 5FHAL 3SDAB 1IGML 4QCIA 3WIHL 4CVXB 2RAMA 4F57H 3SO3B 3UTSB 4M3JA 5FYLD 1JTPA 4A2LA 5ID1B 2C1PA 1P7QA 1AJ7H 4LLQA 1BFSA 1HCVA 5FECB 4HPOL 3H9SA 3E2HB 4MB3A 5MI0B 2ICWJ 2BVQB 2CLRB 3BUYA 3MV9D 3P0YH 3R1GL 4MJIE 2NY3B 3QIWB 3EDDA 5F7DB 2MQ3A 1M6OA 5IG7A 3DNKA 2KPNA 4FZ8H 1QEWA 2CRZA 3B5GA 4OD2A 4U6YA 3OKKB 1AP2A 1W72A 3UTSD 5DQDL 3RZWA 2WW8A 4LRNH 3GFUA 3BPCB 3KPLB 1E28A 3FQWA 3W9EB 5FGSA 1PVHA 4PV9B 2R1WA 3UYPA 3DUSA 3RNKB 4J3SA 4UINH 4Y2DC 1GHFH 5C3LD 1JBJA 5I8CB 3QG7L 3QB7C 3DGGB 3CSPA 1GAFH 1VACB 2GITB 3RX8A 2Q7NA 3SCMB 3LPGA 5DWUL 5IMKB 5DEZA 5C07B 4L4TE 1J1XH 3RDTB 3WBDA 1EJOL 3TO4D 5T1DH 3QIBB 2X6MA 5KS9A 1K5NA 1A7OH 1TLKA 5JNYB 3I2CL 3INUL 3NH7H 4YDVB 1UM6H 5FYJE 2MCPL 3OGCA 2HVJA 3WUWG 3IDMA 2MKWA 1U8HB 3GSWA 1FVDA 4AMKL 1EAPB 1RULL 3P9LB 4PYGA 5DD5H 3IDXH 3NCFB 5JIPA 3DVIA 2HTKD 5B38G 1FC2D 2HRPL 3ULVE 2ITCB 1DANT 3WFBH 5BS0D 1MCPL 4MJ6B 1YDPA 3ARBC 2JIXD 3CPLB 5T5NF 1UEYA 1NUNB 2BVOA 2VDPL 3BKYL 5C70A 4HKJA 4MA3A 2UWEA 3TBVB 1LO4L 1MJ8H 1NCNA 1HWHB 2E6PA 2BZDA 4ODTH 3LQMA 4Y4FB 4N0UB 5GRZA 3O3DA 1RUAL 4E41E 3OPZH 1CICB 1DUZA 3PABA 3KYAA 5ERWA 3BHBB 3Q3GB 1AQKL 1K2DA 4HK3N 3ZTJG 2JE8A 5KSAC 2EYSB 4L1HA 1KN4H 2J8UF 4PGCA 2KQNA 2M26A 3GKWH 4ZPTA 1T0MA 1MH5B 3LKOB 4HIJB 5KSUB 5LXGH 1N6UA 2BMKA 4TSBL 4LASL 2DL9A 1P7QB 5E2TL 1L6XA 2ZG1A 3QUXA 3S3SA 4EN3D 5M95B 1A2YB 2EDDA 2FHBA 4PJDF 4Q58C 2PTTA 5KSAA 3UJTL 2E6JA 2ZNWA 2GJ6E 4M93B 1WT5C 3RWIB 4KQ4H 2WZPD 2GTWA 4I18A 2BSTA 2FLRT 2QADB 1MFDL 5F1SA 3RWHA 5MEQB 3GKWL 1VESA 5F7EH 5F6IC 3JV0A 4RRPA 5F9WB 1YY8B 3DX6A 2AXGB 2IBZY 4Y4KB 3QI9B 1HYSD 4L3ED 4NO0D 1KEMH 4PGEA 4EUPG 3V6ZA 1YNLH 2C4XA 4PV9A 3MGTA 5T5FH 3ZE1E 3PHQA 2EEBA 4JAMB 1SVZA 5FGCB 5HGAB 1KACB 2AS5M 5I1KL 4ODVL 3UTTE 5CGTA 3QUXB 5IVXE 2DQIH 3S98A 2BVEA 5HI4C 3EOBB 5CZKA 5E7FA 1Y0LB 5KS9F 2WIMA 5GPRA 3LQAC 5B8CA 5D7JB 1YEKL 2AXFA 4IDJH 3HG1B 5KSBE 2LAGB 4ODWA 4H25A 5C0AE 4LL9A 3ZE2F 4PD4J 3QQ9C 4XCNB 2JK5A 4K7PY 2BNQB 5IROA 3QIUC 4YHMH 5HHOD 3G6JA 2FR4A 2C5DC 3W0WE 1SMAA 2GK2A 4ZSOA 3MRIB 1XIWA 3CLFL 3QJHA 4KK9C 3CFJA 1LILA 4KKAC 2P5ED 5I15L 5DWUH 4YO0B 1E4XI 3VMOA 1HKLL 1AR1D 4CVZB 4I0PD 2DI8A 2IMMA 3JXAA 3QEHA 3U4AA 4JGJA 4WI5A 4Q2ZA 5D1ZC 3OHXB 1RHHB 3TNMB 3OKNA 4JG0L 4DAGL 1IGFL 2IAMD 4UT9L 1ZHBB 3RNQA 1OHQA 1L9MA 4HMEA 2MQCA 3I3DA 3V6FA 3O2DA 2OL3B 2ZWLT 3VGEA 5C6TL 2LVEA 4YDJB 1UZ6E 4U1IB 3OF6D 4ZAKD 5A40E 2F53D 4AT6B 1P4LB 1H3XA 2VQ1A 4NHUB 5C07A 3GDBA 5CS7A 1SYVA 2VIRB 5B39A 4C57C 3O6ML 2QR0B 1KPRB 4ZG1A 2D31B 2HFTA 3HMXH 1D3CA 1H3PL 1OD9A 1X6LA 1JHKH 3FB8B 3VFWB 3JTTA 5ALBL 3QULA 4NWUH 5HGHA 4S1DC 2R23B 1ZT4B 3QUMB 1I9RH 3PHSA 4J12A 4MWFB 5ESVA 5I1AA 1RFDL 5F96H 5FM5M 5JUEL 2FJHA 4F57L 1Q94B 5K93A 4EI6A 5I1HH 5MEPB 1T2XA 4Q0XH 3QXTA 1S9WA 4MJ5B 5CIPA 1S7SA 2R8SL 1NGWB 1EZVX 4OIIH 2FJHB 3IJSA 3MLZH 1N3NA 4MCYB 5I1AB 1IQDB 2J8UE 5DJ8B 5J11B 1A3LL 2K7QA 3WDIA 2VLLA 5EOQL 1GIGL 1A1MA 2X7LB 4GAYA 5JDJA 2D03H 5BVPH 4PRNB 2EO1A 2DQDL 2DKSA 4PRPD 3QZWB 2R69H 4K7PL 1ES0A 3ES6A 2IH3B 1CLOH 4GAYB 2ZUQB 4DJMA 4OF8A 4OT1H 3U36A 5D7JA 5EBGA 1YEGL 1N7ML 2UY7A 3VXPA 2IBZX 3KPNA 2H2SD 1F6FB 3FQTB 4TNWK 4QT5B 2B0SH 3RZCA 1NUDA 1CFQA 3NIDF 2YUWA 3FFCD 3RUGA 3ZHDA 1IMHC 4KI1A 4FFYL 4X0KA 5ISZA 3UTOA 2F5AL 3ZT6A 1IL1A 3C6LD 2P47B 1OTUC 3DX7B 5ESQA 4OB5H 3UTTA 1XF5B 5EU3B 5IBLC 5BZWB 4HMCA 1WFOA 3GIZL 4JE4B 1CFQB 4OCSH 5L2KD 1FJ1A 5F3HB 4FNLL 1A14L 1T21B 2Y4SA 3CDFA 3ARRA 2O61B 3S7GA 1MQKL 1UVQA 1QKZL 2OSLB 4Y16C 4L8CA 1BVLA 4M3KB 4MJID 3GBMH 1ZWIB 3RGVA 4ESKA 3S97C 1Y6KR 2BNUB 1HN1A 4WEBL 2FNBA 3O4OB 1JV5A 3PF2A 2O93L 2XRAL 1FFQA 1YNKL 5IP4A 8FABA 4ZAKB 1KCGC 1I8IB 4WWKC 5CSGA 3FN3A 1DVFB 1MHEB 3QJFB 1F11A 1RJCA 3RZCC 2ILLA 5JPNA 3WIFB 1A0QL 4G8GA 5T3XL 5J56B 1QKZH 4LF3A 4UDTA 3JTSA 4NNYA 5E2UH 4FNLH 2F54B 2VH5H 3OKLB 1RUKL 1X5JA 3BP6B 4OCSL 1DJSA 5IBUG 1XT5A 4OB5L 1P7KB 1AHWC 4YHPA 1MCNA 1SJEA 2EZ0C 4JN1L 4IRJC 4IOFC 3AB0B 2Y6SD 3Q5YA 5E6ZA 3JSSA 5T1LB 1KIRB 2B0SL 5D7KD 1HK6A 3C6LA 3ZT7A 1NCWH 1MJUL 3KPRB 4NJAL 3TVMB 1N7MH 1IAIH 3PIQA 3FQUB 1DFBH 4OT1L 3SGJC 5JQ6L 5ACZA 4HUVA 3UMTA 2RCSH 3U7WH 3V9FA 3DX9B 2HRLA 1EK3A 2PYEB 5I1GL 3D18B 3OR6A 1T4KA 4WW1A 2ADJA 4D8PB 3G5YB 2DQDH 3BEVB 5HD8C 2VDKL 4TQEH 1AHWB 2C3XA 5D7LD 3JUZA 1J0ZA 1UXSB 5F7WC 3SGKC 2BVTA 3QIUD 4RWYH 4GH7B 4PJIF 4JPIB 3JWNC 4OQTA 3X3GH 2HJLA 4RQQB 3O45B 4PJBB 3GGWB 3VD4A 4X6CF 4TSAL 2R8SH 1XIWD 2XA3A 2DKMA 3WLBA 1F3JB 5C0EA 3ARFB 4Z7UF 4RBPK 4Q0XL 2XG5A 3K1DA 4BSVA 4MA1C 2W07A 3PL6C 4ZUUA 3WLWC 2R2BA 1YYLL 3KPTA 3OHXA 3O6KL 2GJJA 3HNSL 3LRHA 3QDHA 3CMOH 5DMIH 4LNRA 2OXGA 3SKMB 1ITCA 4NBZB 5I0ZA 4OSUL 1Z6JT 1H3PH 3MRLA 1E28B 3FQWB 2E9BA 1NSNL 4YFEA 1XIWB 4UOW1 3BZFB 3CVHH 1QA9B 4P5MA 4V1DD 3C60B 1LP9F 2YD2A 1KB5H 3BSZL 3KYMB 1NBYB 5D2NB 2D0HA 3BKCL 3FT3A 1DEEA 2DBJA 4XWGL 1V7NL 1QSVA 1FCCA 1XGQA 3TIDB 4I77H 1DR9A 3HC4H 5C0EB 2A6KA 1P7QD 3IKCB 1MELA 2J3SA 3IDYB 1QSEE 3OAZH 3DYMA 4DAGH 4P4KB 4EKXA 4XVJL 3QT2A 4F15B 1AXIB 1O0VA 4ETQB 3QFJD 2G60H 4I2XE 1GGIH 3IDUA 4KDWA 4NPYA 1HKLH 1EO5A 4AY0A 1XGQB 1RZ7L 4KKNA 2R0KL 1GZPA 2EH8L 4UV7H 1FV1A 4YHML 4BA8A 4FQHB 4WY7L 5E8OA 4Z77A 3TA3D 1I9IL 4AQOA 2AK1L 2VQTA 4O2CB 5EWIL 3ARGA 1JNHA 5DHVA 1A3RH 3T0BA 3PDOB 1FV1B 1KIPB 1NC2B 2EDKA 4PREA 4JVWA 3U46A 2BVPB 1V7ML 5DD3L 2A9NL 1CD0A 1NAMH 5GS0H 5I1EL 3GSNA 4NIKB 1QYGL 2B5IB 4PRIA 4NHUE 5B38A 4NRZA 2W65A 4UIKL 5DI8A 3FB5B 4NQDB 4NKIH 3QI9C 3WNKA 4NO3A 1U0QA 3ISWA 2NNAB 5DD0L 35C8L 4G9DB 4LCIH 4JPIA 1AI1H 2F58L 1A64A 3WL9A 4G6KL 3X13B 4ZNEA 1AGEA 4GRMA 4C56D 4XNXH 5JPNB 5KVMC 4LFHG 5ICYA 3U4BH 4KJWD 5L0QC 1AGFB 3ZTJH 4BQ9A 3IRPX 1YEIL 4EVNB 1YQVH 4ZUTB 1EEZB 5MENB 2Y06H 4KUZH 5I1CL 5C2BH 5E94A 3VXUA 1HHJB 4JZNB 4KK8D 2AEIT 1B6UA 4MS8A 1TIUA 2DYPB 2HWZH 4KAQL 5JPMB 3O8XA 1U3ZA 4AZ8A 1FNHA 1UJTA 1OAYH 4P9HH 4Q6IA 2HKFH 1D6EA 1FZOB 4G43A 1KCSL 4CVZA 2A38A 1MI5B 3O3BA 3NGBB 1NGZA 4MS8C 4NKOB 2WWMC 4L4TD 4ZXBB 5EO9B 5C2BL 2V17L 2HAZA 2Y06L 1MFBL 4L3AA 4Y19E 5D7LB 4LCWD 1G0DA 5FGBA 5DMGC 5GSVA 3VG9B 1T1YA 2ITDA 1JFMA 4W4OC 5IM7A 3ARTA 3BPNB 4LDOB 5SX4I 1BD2E 4XNXL 5SWSE 4J4PC 4HDIA 5B3NA 1MCJA 4JPKH 4TUKH 5FA4B 4HBCL 1UB5A 3HAEB 4TVPH 3U9PL 3ZE0F 3CNKA 1CFNB 3Q5OA 1NAMA 1NBVL 1J05B 3I50L 1UWXK 1FNAA 1C08B 2A6DA 4H0HB 2IALB 4UIKH 4RGOL 4NKDA 3HC0A 4APQB 1HQRA 3MRIA 1QYGH 1RIVL 2EKSB 1RUMH 3VJ6A 2FR4B 1V7MH 5DD3H 2JK5B 4R6UA 5T1MA 2VLJD 5HYSA 3MREB 1KJ3H 3QNZA 1A9BB 1ACYL 4XNUH 2ADGB 4OGXL 2AV1B 1A5FL 4U05A 4PJEE 3HI6H 4QWWC 5IB4A 2X4PB 4YAQB 5HDQL 5LWYL 4KJYA 1K8DA 1P7HL 2ZUTA 4D9RE 4R4NC 1ZLSH 4P48A 2AK1H 4P4RA 1A4KB 1CXHA 4ZTOL 4WY7H 3PHOA 3MLSL 3NH7L 2OJEB 5FUCC 4PRHD 1AGCB 1QHPA 2V5SA 4S1QH 5IVZA 2Z4QB 2W1NA 2VDMH 3TT3L 1J1XL 5JOPE 2X05A 1SJHA 4HWBA 3SJVA 1RZ7H 1JTTA 3C5ZD 1TZHA 5CEZD 2DIJA 4P3WA 1LGVA 4X6BA 1NEZB 1GAFL 1L9NA 4D8PA 1FAIL 1XCTB 3RWEA 3D48R 4OGAC 4XVJH 4ODXB 1REIA 4KZDH 5DZOA 2XN9E 4C56E 4UINL 1GXEA 3C5SB 3AREA 2Z8SA 2Y5TA 4AIZA 2D2OA 3LN4A 5EC1B 3RFZC 1KNOB 1VHPA 3MJ8A 4FQ1H 5AZ2H 1VENA 4LRNL 1DLHB 4JDVA 1T1XA 4Y5YB 2V5MA 4L8BA 3OKEB 1AH1A 1EHLL 4ZUTA 4PYHA 4S2SA 2PO6D 4OI9A 3K8LA 3TA3C 1Q9LA 2IF7A 1AY1H 3QEGL 4NN7B 4KZDL 2YMXH 3GHEH 3QH3A 4PJCE 1N6VA 1UH4A 3RX5A 3T0DA 3EO1B 3MLRL 3HFML 4NNPH 3VFMA 1QTYT 2IPTL 1TNNA 4JZJB 2AJ3B 2I9TA 3T4YB 2GSIB 4NHCL 4HPOH 3HNSH 3S3JA 4F7MA 1YEHL 3MRHB 1MWAB 4HIJA 1PKQA 3L3IB 1YYLH 4JDTH 3CFKA 5I8EB 4CJ1A 3KJ4C 2EYRB 3WIHH 1R3JA 4L3CB 2W0PA 2SEBA 3KYOA 1OVZA 2P5WE 3KNBA 4HC1H 2NY0D 3NFNA 3HE7D 2VXTL 1ZLSL 4MNGE 4TSAH 1I1AD 4OLXH 5AEAA 4G8FB 4XNUL 3L3IA 3BKJH 4MXVE 1E4XL 1NGPH 4MS8D 1I1FB 1I1AA 3BQUD 4CMHB 1OF2A 1TVHA 1OGAB 1PFCA 3VE0B 5EUOA 4PJBE 1FORL 2XI9A 3WFCL 3CVIH 3CCHB 4NC2B 4HIHB 1I8LC 2CRMA 4QXWA 4PREB 3I50H 4GKNA 4X9GA 1IL1B 2N56A 4RFNB 1IEAB 2EKSA 3U48A 1M6OB 1PW3A 4HUUA 1C8PA 3DURA 3W39B 3VWKC 3C8KA 4OZFA 4Z7UB 4X7DC 4NJAH 5D5MA 1N4XH 4F15C 3BVNB 4CJ0A 2VXVH 2DL2A 4O02H 3RVWD 3QEQA 3WIFA 2ED9A 3VRIB 3KPMB 4OAWB 4HG4K 1FYTB 3JTSB 1I1CA 3L7EA 2GK0A 1I7ZA 4TTDC 3CAFA 4K7FA 5I75C 1AKJB 3QI9D 4LCCC 2EEAA 4OCLC 4TULL 3UO1H 1I8IA 7FABL 5E2UL 3ZE2E 4K3GA 2WLYA 3T08A 1NH6A 3MV8E 4X6FA 1LP9A 5EO0B 4HH9B 1K4DA 2HWZL 4HFWA 4AENB 5HGBA 1FO0A 3MODH 4WWKA 1QG3A 3TCLA 4XVUC 5GJSH 3VD3A 1JWSB 2VWEC 1UA6H 2FSEA 5CSZA 3S88H 5F88B 1YEIH 3REWA 5C0FA 4JRYE 4UQ2B 1XF4A 2FH6A 2KQMA 4P2QB 3NZ8B 4YFDB 1OGAE 3EJZD 1T5XA 2BSSA 2F58H 3GIVB 1ED3A 2XTLA 2NY6D 3ZKQD 1J0IA 5I8KH 2CDEB 2QQKH 4HLZG 4GG6E 3GIZH 3QA3B 3BH8A 4IRJD 4WUUD 1OP5H 3V0WH 2BVOB 4Z95L 4NFDA 5BJTA 4MXQA 4JJ5B 1P4LA 4BZ1L 4CRPA 2X4QB 1D5IH 2DQFB 3DXAB 5D1QA 3ARDC 3CXDL 5I8EA 4DK6A 1QVOB 1YEGH 2DJ4A 2VLJB 1H0DB 3VG0L 3OWEA 2W9DH 4ONOA 5CILL 1A7RH 5CCKL 4JFDA 1T89C 3QCTH 1JWMA 3O0RL 2QQQA 2P8MB 5E08L 4HX1A 3B9KB 5TDNA 1X5KA 2FWOB 1QSED 2JF1A 2RB8A 3P4MA 2V7NA 2X89A 3OZ9L 5J1AB 3MLXL 1AO7D 3SN6N 3CCHA 4D9LL 2B4CC 3B9VA 3D2UA 4OCMC 5BCAA 4HX1B 4CU6A 3QWOB 4WJ5B 1GGIL 2Y7QB 1TDQA 2D9CA 2ZCHH 4LKXA 4Y4FC 1PYWB 2A74B 1KBGH 4KTDL 1KUMA 3SCMD 1QOKA 2B5IC 1EDQA 5C0JA 4I77L 3R8QA 2FX7L 1DDHA 1T83C 2FYYB 1FYTD 3EJYC 2DBLH 4H1LB 5IMMA 4NO2B 4QYOA 1RSFA 2YPKA 3BDYL 1IARB 3HCVA 5L2JB 1S7XB 5B39G 1MIMH 4PGJA 5IKCB 1U95A 3CVHL 5DQJA 4IIQA 1N5AB 2H2PD 2AEPH 2YN5A 4N5EA 1DEEB 4KY1L 5CKAA 3SO3C 5DK3A 2ZUXA 5F89B 2P8PB 1A22B 3SE9L 2DAVA 4V1DB 3DXAE 2NYYC 4RMTA 3KPPA 4IJ3B 1MIML 3N85L 3SCMA 3VXRE 4U1NB 2I25N 3TNNA 3T1WA 4PJ8D 4U0RC 1A6AA 5E5MA 5ABDE 4HS3B 5EULV 1FGNL 3DROB 3HRPA 2F53B 4OM0H 5DTFA 2CLZB 3DTXA 1D7FA 1QRNB 1GGYA 2HH0H 2W60B 2XKNB 1UVQB 4JG0H 4DKFH 5I76B 3IJHA 4QXGH 2HLAA 2ZCHL 1JYNA 2Q8BL 4Z77B 2XQYG 4I0KA 1IT9L 3ECBB 2GAZB 3GSXB 1OARH 3OBAA 5E8NB 2HFGL 2XKUA 3BRFA 3MLXH 4GS7B 4D9LH 4GQ9L 3MLPA 3ILPB 5KSUA 5KN5A 1X4YA 1FVEA 4PJXE 4KXZI 3VDCA 3O2DL 4JKPH 1RJLB 4DGIL 3V0VB 2VLLB 1KJMA 3F7RA 4OZGA 1FFOB 2W91A 5IQ7L 4MCZB 3QCTL 1LO3L 1LWRA 1UFUA 4NN6B 2A83A 1JGVL 3MA7A 3NIFE 3QWRA 4WUKL 5GJTL 5E9DA 3QZWA 3CLEL 1NCWL 5CAYB 3PQYB 3VXSB 4Z7VF 5C07D 2PYEA 1KLUA 1C12A 4BZ1H 3MRBA 5SX5H 3CX5K 3G5YA 4Q9RH 2DQIL 3GJFA 2BCKB 4Z95H 1HHJA 4JZNA 5IIEB 3ULSA 4AEIL 3C87A 3W5MA 1EEZA 5MENA 1I1FA 4HUVB 1RUKH 5I8KL 2VH5L 2IANB 3KLAA 5EIIA 2WINA 3RU8L 3ZKXC 4ZD3H 4U3HA 3SQBA 2NX5B 3TBSA 1YNLL 3VDBA 4WW2B 2O5YL 1JF6A 2LU4A 3OXRA 4ZFFA 1UA6L 5MHSD 4HUKB 5DDHB 5F7EL 1RK1A 3LEYH 5GJSL 2XRAH 4YHNA 4DN3L 1YMMB 3FN0H 3WHXA 5C0RL 2VRAA 5EO9A 2HJLB 2J8UA 4FXKA 1AGBA 1ORQB 5I1JH 4XWOC 2OZ4L 2N4IA 2MWCA 4KKCD 1MQKH 3D3VE 1YZZA 4N0FA 5H8DA 4HJ0C 2KBGA 4TULH 4HAFA 1VFMA 4BQCA 4QCIB 1KB5B 1UKTA 3GRWH 5C6PB 1HQ4B 4XZUB 4JRXA 1KENL 5IB1A 4AEEA 2R2HB 1G1YA 3BH8B 3TVMD 1A4KA 2RFXB 2L7JA 3NA9L 4B50A 1NFDB 1EFQA 2EDYA 2X4SB 3QEHB 1OAZL 1A1NB 4I2XB 4S2SB 5T1MB 1YDPB 4LIQL 3QWRD 3WFHA 2A73B 1MPAL 4ETQA 4I5BA 5HGGS 3LEXA 3AS3A 4BZ2H 1HIMH 3WJLA 4NQEB 4ELKA 4ZS7H 1CL7L 5I1LB 5IVZB 3D25A 2R0ZL 3WHE1 4M8QB 3TPUB 3MLTA 4WHYG 1HXMA 2R2EA 1NFDE 1L0YA 4ZUWA 1S5IL 4YHKL 2GITA 2OXHA 3HS0A 1Z9LA 5HVHC 2NTFB 3WUZA 5KSAD 1T7WA 3WO3B 2CUIA 2DJUA 2IPKA 4HC1L 3D25B 3WD5L 3HMWH 3PWUA 2ZCLH 4U0RB 1MCDA 1Q0YL 1A7OL 1BP3B 4JDTL 5D6DA 3ZMRA 3DO3A 3TPKA 3UAJD 3VFVA 2BVYA 1YJDL 3TJHC 3I6LE 3PG2A 4CGTA 3H9HA 5T1LD 5C7XH 4NWUL 1YN6A 3MO1A 3UJJL 2IPTH 5HHNA 4FFVC 2Q7YA 5DVKA 4WFGD 3HFMH 3MLRH 4M7KL 1Q9OA 3MV7E 3QG7H 4PJAA 5TDNB 4D0DA 1JMZA 2YMXL 3GHEL 4Y2DA 1S7TB 1S9VB 1FH5H 1BBJA 4PJ8A 1J8KA 4GW1A 1KULA 3ULVC 4ZOBA 1YY8A 3JTTB 3X11A 3K8MA 3SDCA 2J2ZA 4J3VA 3RIFK 2H3NB 3ARED 1FGVL 3BWAB 3BXNB 2EICA 3C5JA 4K3HA 4IMKA 1YQ2A 3IJYA 3KPNB 2NX5E 3D0VB 1FGVH 3BP5B 4Y8AA 4QTHA 2NQCA 3SDDB 3T77A 3G04A 1B0RB 3D39D 4FZ8L 4DUXA 3LN5A 4L3CA 3ES6B 2DJSA 3X13A 1XF3B 1RZJC 3BXNA 4LCYA 5IEHB 4M7KH 3CDGA 1OP3K 4CKVX 1DLFL 4MNQB 5GGSA 5HYJA 1EUUA 3SKNA 1FFPA 1YJDH 2OSLA 2P46B 1JUFA 3FFDB 1KT2B 3IFPB 2HG5B 2BY2A 2VDML 4G42B 3CLFH 4ZXBA 2XT1B 5J12B 4NZTL 2BXZA 2VITB 4NQUA 3BW9A 3MOQA 5FOBA 2GT9B 3GMMA 4QHKJ 1DN0A 4PJIB 3HE7B 1TZIA 4CUCA 3ZKXB 1D6EB 2BRRL 1CDYA 1DQLL 2EDLA 2J5LB 4LAQH 3FFDA 2KZ1B 5HDQH 4BUHA 5LWYH 1S5IH 5GQBA 1ACYH 4FMKA 3HE7C 1VFAA 3BYYA 1B4JH 1IJ9A 4NN7C 1A7QL 1VB9A 1FVCA 3CC5B 5GGRA 4Y8DC 4NQXB 3RL1B 5IJVA 2VC2L 1RZ8A 3CIQA 2R0ZH 3B43A 3GMLA 1OAUH 1RIHH 2VDOH 3ZT5A 5DEGB 5FKPA 1TQCB 3OL2A 4BSWA 3ZSSA 1Q9KB 3GMQA 1MRFH 2APBA 4I9WE 4TYUA 3HR6A 4ODVH 2QHLA 2XZQL 3JVGC 2CK2A 4NRYA 4LIQH 2Q8AH 4HKBA 1CT8B 1JE6A 3P2TA 4XNZB 3O9WA 2W38A 3BPLB 4TVPL 5JIKA 4F3FA 4Z7WF 4XCEA 3DMMA 1OAZH 4HCRL 4X7TA 2RBLA 1DE4A 5F8QC 4P2OC 1KEML 1K8DB 3TIDA 4L8SC 4PJGE 5BV7C 4KROD 5HHVL 25C8L 3VI4F 5FDWA 1MFBH 1HSBB 5BOZG 1OY3B 1NFDF 1MVFA 3H3KA 3I6LD 5CJQH 3LPWA 2O5XL 5IB4B 5FYLL 4YUEL 5DURD 5SWZD 1IM9B 4U6XB 4DW2H 5IMLA 3E3QC 5DXWA 3KR3L 2VKWA 3I84A 2OZ4H 1WC7B 5I1JL 4RA0C 5FM5O 3MRGB 2JB6A 2GKIA 2VABA 2UVFA 4UU9A 5C0RH 2FO4A 3FN0L 3AREB 3WIIL 3O9WB 3MRKB 4DN3H 2PTTB 5E1AB 3TO4B 5F6IB 2GTZA 3GI8L 3GMPB 4FXLA 1YQVL 4YXLH 2LQRA 2VZ3A 1BVKA 2AXJA 2R1XB 5FV2A 3LD8B 3QISA 3EYVB 4OTXH 3VU2A 4H5SB 3WNLA 1WZ1H 4LSQL 4MQTB 5SV3A 2DQJL 3U4BL 2JB6B 1RUAH 4M02A 1EJ6A 4K8RC 5JW4N 4OCRH 4QWWD 3TO4C 2IBGA 4ZD3L 1IQDA 2PETA 3MRRA 4UB0H 4KZEL 1VKXB 3MBED 5BRZB 5DD0H 5E8EA 1CXEA 4Z76A 4K8RH 2VLKD 3TH2T 4XRCA 3UTSA 4WHCA 2EH7H 3V5HB 3TN0A 5C6WH 4PJ9C 3O3DB 2VERN 3CLEH 2DQCH 1EXUA 3X17A 4HXAH 4DCQB 2FECI 2HRPH 1CD8A 2F54D 5CFHA 4OCNC 1Z2KA 2GCYA 4HF5L 1HQRB 3ROOB 4W81A 1LO3H 1UJ3A 3GGWA 2AXGA 5EWIH 5D96B 2MCPH 2QADD 1JYVA 3BYTA 1D5BB 2Y07L 2GJ6A 5KSBA 2FZ3B 2MOVA 3HG1A 1ZVSA 3BGMA 1KC5L 1EJOH 4U2YA 3SGDH 2HMID 5KAQF 3JBG7 1VSCA 2P8PA 1A6ZA 4BSWB 1XR9A 1W0YT 2WY3A 1A6TB 5AAMA 2F19L 3ARDA 4X9FA 2AAVA 3C5JB 4P2QE 1H3TA 4PP1C 2P7TB 3E6HB 5IKCA 4UNUA 2H32H 1NPUA 4JN2B 4U1LA 5GIRB 4JKKA 5HHPA 4G9FD 5F44A 4NC1E 3C08H 4FP8L 3OJVC 4RBPH 1WWWX 1A7PL 4OM0L 4KRMB 1FIEA 1FGNH 4QOKD 4KUCF 3C9NA 1VCAA 4L9DA 1AQDB 4NFCA 2ED7A 3SE3A 1TQCC 2BVPA 1S5HA 5BXFA 3B9KC 5FB8A 5JHLL 3TF7A 2AEQL 3N85H 4KRPC 4KU1A 3DROA 1KT2A 3IFPA 3SE9H 3NMEA 5EU4A 2OTPA 3R0MA 3QHFL 5DRXB 3VRLF 4ZSOB 2APVA 4POUB 3TNNB 1JCKA 2DD8H 5ITFB 4KY1H 3QDGD 2AEPL 1FIGH 1CGUA 5BXFB 4R2GB 1M4KA 4OIBA 3TP4A 4MQ7B 3ULVD 5T1LA 4RGNB 2IADB 32C2A 5D2NC 2HYMA 1KG0B 3CMGA 3VGHA 1FSKC 3L5HA 1KTRL 4K71C 5ELIA 1JF1A 5B8CB 2DBLL 5EU7E 4WWKB 1CDJA 1IGMH 3HE6B 3MRNB 1D9KA 4L9LC 3KJ6L 4JKMA 4NO3B 2BOBA 2ZSVA 3ZE1F 4FP8H 3EOYG 3ZDZE 1T0PB 3IDJB 1KBGL 5D9SA 1DSFH 3WFEL 1ETZA 1ZTXL 4N9GB 2HTLD 4UUJB 1BZ7A 3MGOA 1CN4A 4N5EC 3DPBA 4BUGA 3X3GL 3SCMC 4WTWA 3V7AG 5BS0B 5EO1A 1X9QA 2W0FA 1S7UB 2AJVH 4EDWH 1MRCH 3H3PH 1ZHNB 1KC5H 4S0UC 1RZIA 3BO8A 3MMEA 2ZP0T 5DT1H 4NSKA 5F8RC 5ESAB 3RP1A 3FOMA 5FYKE 2XTJD 3U83A 4M43L 5LQBL 3VFUB 3Q6FB 3REVB 3VGDA 5I9QC 1A7RL 2CDFB 2BCKA 4XXCC 3RWIA 5JDSB 1DFBL 3D5OF 3MMEB 4FZEH 4XC3H 3BIAX 2DWDB 5HDLA 1TCRB 2CKBB 3FQRA 5IB2B 5T3ZD 2MCG1 1IGIH 2H41A 2P1YA 3GSWB 3G6JF 5CBEB 5DFVD 4YQXH 1BX2B 1QPXA 3VXPB 3BUYB 1HINH 2CLRA 4QHKI 5IK3B 4GRWB 3BZEA 5DDHA 3U0PB 1N8ZA 4P5TB 3QCUH 4ZOAA 1BVKB 2YWYA 2DQJH 4I3SH 1P4BH 4HIIB 3DHJA 5DO2C 2ARJB 1BQHA 1RMFH 3QUYC 3CVHA 2X4SA 1QFWL 4PJ5A 5GRJH 1KCKA 3NCYP 1OB1A 4W6WB 4CU8A 4WEBH 4K07A 3IJSB 1R3IL 4QHUA 4LVEA 3KWWA 3GBML 2UY6A 1E27A 2JCCE 3IU4H 3QXUA 2K3TA 5DQ9B 1BQHB 3K0WA 3UO1L 1AD0B 3QEUB 2O5XH 3L3KB 2G2RA 3BGAA 3MNVA 5LAXA 5K9QI 4GG6F 5HDBF 1TJIL 5HGDA 3OGCB 3QJHB 5DMYA 3AB0C 4K94L 1MCWM 2D9QB 4OKVB 2V2WB 1WQVT 1K2DB 3B2VL 4O58H 4WI3A 3WKNA 2V5YA 4OUUB 3L3KA 1NC2A 1B3JA 4HT1L 5EN2B 5T33H 2ZSWB 3W9DB 2ZOKA 3LN5B 1T6WA 4PFEA 3QNYB 4R26L 3U9UB 2PCPA 2Q8AL 4LPCA 2UYLB 2EXWC 4K7PH 4JQIL 1VGKB 1Y6MR 2QSCH 4A2MA 3U2SA 5J12C 4GRWE 4NWTL 4O4YL 3TZVA 3AMLA 5BVPL 5ACZB 2HT2D 2GY7B 3Q1SH 4UDUA 4X98A 5EZOL 4WO4B 1TJHL 4H1LG 3FO2A 3HUJF 2GY5A 4ISVA 3QSKB 3QH3B 3D0LA 5F70A 3MLZL 4O2FB 1Y18B 3MBEB 1OAKL 2FB4L 4NPYB 4OQTL 5IESH 2OQJA 4EOWH 4KUCD 3WJLC 1DQLH 2VXTH 2BRRH 4MVBA 4AL8H 3T0EC 3AAZB 4YHIB 5DC0A 2Q3AA 3PNWA 1FNLA 5C9JA 4X0KB 4WI9A 1KJ2A 1P84J 3P4NB 2X1PA 2BY3A 4RQQA 2EDQA 2MMXA 1RFDH 2AK4D 4P3DB 2QADC 1I9RL 1YEHH 1N6QL 2B39A 3UTSE 1DVFD 5J1TC 1LO5B 3DLQR 1CDIA 3IXAB 3VXMA 4ZUVB 4HGWA 5FGBC 3THMH 2NZ9C 1B0RA 3BGMB 2PYFB 3CU7A 4P46D 5J6GB 2ARWA 2HLFC 2NY1D 3QFJE 2ITDB 4WEMB 5ILTL 3AS2A 4UQ3A 4JPVH 4QOKB 1UCBL 5F1IB 4LHUB 5C71A 1EH9A 2IFGA 1K4CB 4RAVA 2FL5A 2ZOLA 5K9OB 4P23A 1YY9D 3AAZA 1Q0XH 4JAMA 5FO9B 4UT9H 3PXJA 3JV5A 3QXVA 4OD1H 4X6DF 1L4IA 1WZLA 4CMMA 2VL4A 4DGYH 1FLTX 1FAIH 2BVQA 2MTPA 4JFEA 3HUJB 4ONFL 1A02N 2BSRA 3UJJH 3NBNA 2B1HL 4ODHL 3QDGB 4G8FA 1U8OB 4PG9B 3O3EB 43CAA 5C7XL 4JR9H 3IDJA 3QP3A 2GEEA 5KG9B 5EUOB 2VAJA 3U1SL 3H0TB 3TO2A 1HQ4A 1BZQK 5B39B 4AH2B 3QG6A 3MRQB 2ZCLL 3EGSA 1VEPA 4I1NB 1IAIM 3WD5H 4P2RB 3MV8D 1ZE3C 5A1AA 3TBTA 4ZTOH 3DARA 4MZ2A 3RWGB 4PRAB 2L4OA 3HI6L 2LABA 4YC2C 3RWDA 3RGVB 1DCLA 2UVEA 2YEZA 4GAJL 4JFZL 3QR2A 2X10A 1C7SA 4YDVA 5I66A 1MRDL 2VOTA 1RUML 2G5RA 1OGAD 4RGOH 5GGUB 4YBLB 3ULUC 3HZMB 4UNTA 5TF0A 3BMVA 1QD0A 1MHPL 4F7CA 1NBQA 1NCAH 4P2RD 3ARDD 5EC2B 1JGDB 3FL7A 4LPVA 4PY8J 1KYOJ 3QDME 4ZO8A 5H94B 2G9HA 4X9HA 4G6FD 3RKPA 4M6AA 5IV2B 4N0CC 2VXQL 3BP4B 4FQHA 1N0LA 2GJ6D 4MD5A 1PAMA 4ZAKC 1RAMA 1FNSL 3UX9B 4DKAA 4FOMA 5JXEC 3AS0A 5DJ0A 4HK0A 4MJ6A 3NOIA 1HXMB 3OGOE 5DJYA 4HIEB 3EO0B 3HE6D 4U1JB 4C56A 4HIIA 5E2VL 4G6AC 5AD0A 2NY2B 2D31A 4KRNA 4YE4L 2A1WL 1MF2L 3VD9A 4OF0A 4KQ4L 4IDLA 3ULVH 1KCSH 4W4OA 1KLGB 1ZVYA 2HKFL 4YDKL 3GIVA 2R9HD 4MQXC 4QRPD 1UB6A 4KAQH 1PKQB 5KN5B 5AWNL 2Z4QA 3L3OB 2W59A 3O41A 3KPLA 3VXTA 3D87B 4HBQA 3F8UB 3KS0J 3BE1L 4Z7NE 4PJIE 3LSOB 4RGMC 1ZK9A 1BF8A 4EUPH 1KIPA 4TTDD 1O7VA 4C83A 2R0LL 3QCVL 3TV3H 4ZO7A 3P73B 3MUY1 1KIQB 3L3GA 4G9FB 4Y4KA 4KK5D 4WU7B 4AEIH 1T1XB 4OCYL 3OJDB 3KLSA 3RIAK 2EKJA 5EU6E 1S7QB 2VDPH 3BKYH 5JR1L 2NY7H 5GGSB 1K3ZA 1U8LA 4NKIL 3T2NL 3FT4A 5I2IA 5MERB 4I18B 3V0AC 2LTQB 2VZTA 1B0GB 4KHXH 2A77H 3BVNA 4WUKH 1C16B 2HJFB 2VLMD 4TNWF 4NKQB 1A21A 1CLYH 3IDXL 3MNVB 1F45A 2XV6B 2JCCA 4MHHG 2Q20A 2UWEF 3DBXA 3E6FB 4DGIH 1JGLL 1UM6L 4JKPL 2DRUA 4YX2L 3VXRB 5I1DA 4O2FA 2Z93A 3I2CH 1D5ZB 2EH8H 4UV7L 3T2OA 3O8XB 3PHQB 2HFEA 2VDLL 4D2NA 4NO5A 3VCLB 2DQGL 1KXQE 4XPAL 2HFGH 4WCYH 4XPBL 1HHKA 4MQ7A 1OARL 5DMJB 2UZXB 1QBLL 4N1EA 4R4FL 3WSQL 2V9RA 3FO9B 1JN6A 1UQSA 4Y5VA 4JRXD 5DUBB 5F7FA 1EO8L 5EU4B 4RAVB 4NSKB 1I1AB 1NDMB 3C09B 3S36X 5E03A 4F37F 1EBAA 4L8DA 4DKFL 5CD5D 5GS2D 3OX8A 1H9VA 3H7BB 1P9MC 3NCCB 5KJRL 1I9JL 4CDGC 5DQDH 1V7NH 2VAAA 4X6DA 3IKKA 3G5XA 5BZDB 1SQ2N 3PQYE 2Q87A 3VXSE 5FF6B 1D5XA 1XGTA 2ICWB 4HK0B 5J6HA 1KJVB 3ZL4H 3SEPA 4DZ8A 2JELH 4RX4A 4AG4L 2ZSVB 3R1GH