1A7LA

Dominant b-cell epitope from the pres2 region of hepatitis b virus in the form of an inserted peptide segment in maltodextrin-binding protein
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
380
structure length
380
Chain Sequence
EGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDGSQDPRVRGLYFPAGGSECC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a dominant B-cell epitope from the preS2 region of hepatitis B virus in the form of an inserted peptide segment in maltodextrin-binding protein.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Transport
molecule keywords MALE-B363
total genus 115
structure length 380
sequence length 380
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1a7lA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1a7lA01
5L9MA 1JEVA 2OJTA 3PPRA 2F6GA 3I3VA 3W9WA 2R71A 4G8MA 4Z0IA 3O28A 3RT8A 3C32A 4P0GA 1A8FA 4U4XA 1NH8A 3I5OA 3RN8A 3LC8A 3ZS6A 1XT8A 3QXMA 3FATA 4ZE8A 1FQDA 1SW5A 2O69A 5K2YA 1EZPA 4KCCA 2X7QA 3Q29A 3M8UA 2NXOA 1GR2A 3U92A 4RK2A 5I56A 4EF1A 1R6ZA 1S9TA 3MVYA 4OFOA 2V93A 2QMXA 3AXFA 1N3XA 2PMSA 4ELQA 2DE2A 2GHAA 2YPNA 3LSWA 2HAVA 1MXVA 4KYEA 4GD5A 2O1LA 2QMWA 3C36A 2V84A 5CM6A 1JETA 2H4IA 2H25A 1MPCA 2HFBA 3FJMA 3TTMA 3MVZA 5I57A 1B51A 4NEDA 2D21A 1MDQA 1XHYA 2IEEA 3LR1A 2DQVA 1B7HA 2CZLA 4IO3A 1QKAA 3ECRA 4OQOA 3SEYA 3TODA 5LOMA 3IOWA 3W15C 1FQCA 4F22A 4I62A 1D9YA 4PQJA 1LCTA 2VP1A 3TDJA 4F3SA 3FVNA 3PMXA 4NF8A 4F29A 2F8DA 1H43A 1B0HA 1PDAA 1Y4CA 1MQIA 2DWHA 2I6EA 3SDFA 2XXPA 4U23A 4U2RA 2GHBA 2PYYA 1M5EA 4L17A 5ISUA 2I0CA 1JVYA 3OSQA 2Z8EA 2UVJA 2ZYMA 3HPIA 3IR1A 4RYAA 4JWYA 1JW1A 4OEVA 3Q28A 3KZGA 3KJTA 3K6VA 3R26A 4IO7A 1LSTA 4G68A 1FCKA 2H9BA 4ZE9A 4ISUA 1ZLQA 1ZKBA 2Y7RA 3IB2A 2P1SA 3R7XA 4YB6A 5CC2A 3OELA 1IXGA 1N7XA 3P7IA 1PBQA 4R74A 3QK6A 3EPEA 3FUZA 3ZKLA 5AA3A 3R6UA 1SW4A 2HZKA 3KSXA 4KCDA 4KQPA 4ESWA 4F1YA 1GVCA 4MBPA 3U8QA 1VFDA 2AL5A 2B3BA 2I58A 3K01A 3SEWA 2I3WA 5I59A 3ZSFA 1GTKA 2XXQA 1URSA 4GL0A 1UIVA 1H3DA 1Y1ZA 4HCWA 4QSCA 1OQGA 4JB7A 4OERA 4RNSA 3RQTA 4YU0A 2XX7A 3TCGA 1USYH 4MF3A 1PEBA 3KOTA 3K4UA 4NF6B 1B1HA 3H03A 1B6HA 3MBPA 3PPOA 4U1OA 4IGTA 3M3FA 4GF8A 1TXFA 2R9JA 4H65A 3CSBA 4JSDA 1EH3A 2PT2A 3FD3A 1M5BA 2O7IA 2QS2A 2OWTA 1FQFA 3C31A 3OSRA 5DT6A 4GXAA 5H8HB 5I2NB 1NNPA 4ZEFA 4WEDA 4AQ4A 2E0SA 2REGA 1QJMA 3B6TA 2A5SA 3FXUA 4HS7A 1MXZA 1SVXB 4FEDA 1L5TA 4ND9A 3UK4A 3VVEA 3K2DA 4ELRA 4JBZA 5B7DA 1SYIA 4R2BA 2DVCA 4KYDA 4EDPA 1LLSA 1PB7A 1I6BA 1CB6A 4X1DA 3IAZA 3TCFA 3THIA 1IUDA 3MVWA 5ITOA 3OEKA 5ITPA 3SESA 1XS5A 4ZEDA 4OETA 3JV9A 1GV8A 2IA4A 3DLNA 4ZEIA 3S2VA 1NH7A 4X48A 1R1NA 1B7UA 3UGWA 3PGFA 1IXCA 3PMWA 2OWSA 3FZVA 4NE4A 3FJGA 4H5GA 1B7ZA 1B52A 2UVHA 4PFWA 5FHMA 5TP9B 3ILUB 4KPTA 3T9HB 3KN7A 3N94A 2PX1A 3ODBA 4GXSB 1B3FA 3CG3A 4LATA 3MP6A 1FTKA 2A5TB 4GVOA 2UVIA 4BDQA 1BLFA 1IXHA 3H3GA 3LUYA 1MPBA 3MPKA 4PFTA 1MXUA 4NWDA 4BDNA 1NMUA 5J1DA 3TEPA 2HEUA 1ZJLA 4RPNA 5CMBA 3RT6B 3MQ9A 4IGRA 1WVJA 4TLMB 4X9TA 1IQ7A 1P1UA 2V25A 3OEMA 1YCJA 1B5IA 3MP8A 4NF5B 1ELJA 1PB8A 3E9XA 4GOTA 1JW5A 4OVJA 1I6QA 1XOCA 3A3UA 4FE8A 2DXRA 4R6YA 1F9BA 2AL4A 1H45A 3MWBA 4QFPA 4THIA 4YB5A 3TQWA 2G29A 3CI8A 2RCAA 1EU8A 5L9OA 3PUZE 5KDTB 5AA1A 5DEXB 4R73A 3H6TA 2NWJA 3V83A 3PPQA 1DPPA 1P1OA 3IOTA 1MQJA 2RC8A 3OD7A 3MZ9A 4F18A 4Z7EA 3IOUA 4OYVA 4RXLA 4ZECA 2PVUA 1MM7A 3H6VA 2UYFA 3IORA 3TTRA 4JDFA 4Q0CA 3MP1A 3SEXA 5DVFA 3UIFA 4PETA 5DEXA 1S7YA 3GZGA 1MXWA 4F2OA 2HZLA 3FASA 3UN6A 1JW4A 1Q1KA 3G3JA 2XX9A 5HPQA 2AIXA 3KFMA 1OIBA 4ECFA 1B05A 2DE4A 4IY6A 4PE5B 4RY1A 1RYXA 2A5TA 1ZIUA 3F11A 3KOSA 4EXLA 2OZZA 3H6WA 5FTIA 1NNFA 2P0SA 1B9JA 1SBPA 2XHDA 1DPEA 4Q5TA 2ONKE 3CR9A 3M3KA 1RYOA 4IB2A 2RINA 4LONB 2QS3A 4XKQA 4DCXA 5I84A 2UXAA 1MRPA 4GQOA 4PFUA 3OO9A 5CMMA 1A40A 3EQ1A 4FEBA 1MG1A 2Q89A 2H98A 4I8CA 4G8NA 1DMBA 1TWYA 2H99A 4H6DA 1PC3A 3JZJA 2UVGA 3PMVA 1GGGA 1USYE 3HSTA 5H8NA 2ANJA 1R9QA 2OCUA 2V3QA 4NF6A 3SKPA 2OBGA 5I2KB 4EUOA 2Y7IA 3O6HA 2DSFA 2ZYKA 4HTGA 5JTYA 1B3LA 2PT1A 4FAJA 2XXTA 1P99A 3C35A 1NNKA 3C4MA 1SW1A 3RGYA 1B1XA 1JNFA 3DELB 3G3IA 3T9UA 1O64A 5JTYB 1D9VA 1OLAA 4QSDA 3TTNA 5H8NB 2DP8A 1LB9A 1JEUA 4H1XA 4OFJA 1B3HA 1QKBA 1R9LA 2F5XA 3C9HA 1LB8A 5H8HA 3QUJA 5I2NA 3IL1B 1UTHB 4G2ZA 3KJ7A 4F3GA 3DP6A 2Q9TA 3MJNA 4DXUA 4POWA 5TPAB 4F3BA 3BFTA 2DWIA 3VVDA 3S9EA 1MXYA 1N0TA 1AMFA 3G3GA 3HO7A 4R72A 2F36A 3B7DA 3IJXB 3LBSA 3K1MA 4GRKA 1US5A 2QJEA 1POTA 1URDA 3O97A 1P1WA 3C33A 3TCHA 1O63A 3VXCA 4GIZA 1JVXA 3OMBA 3PV0E 4K3FA 3B6WA 1XVYA 4HW8A 3N5LA 1LFHA 2VOZA 3IK6B 3QIMA 3EHTA 3QAXA 5H8QB 5IKBA 2RF1A 1VR5A 3FXQA 3KEIA 3PD8A 3FV1A 4MH5A 1FQAA 4QFOA 3RUMA 1IIWA 1H44A 1MQHA 1OMPA 1B46A 4U4SA 1N7WA 2F7CA 1VSOA 4R75A 4KR5A 2RC7A 5DVIA 1FTLA 1S50A 1SI1A 4DXCA 3LSXA 1BP5A 4OTEA 3U1OA 2XD3A 3Q25A 2LAOA 1Y3QA 3B6QA 3Q26A 4QFNA 4ZEKA 4BDMA 2DWJA 1LAXA 4R6HA 3C34A 3CFLA 3GXAA 3FXRA 3PPPA 2UYEA 4ZZEA 3V8XB 3MUQA 1WDNA 1Y9UA 3O6GA 2DE3A 4DIGA 3A3CA 3BBRA 2GFEA 1KWHA 3E4RA 2VGQA 4M1VA 4NMYA 3HCQA 3TUSA 2G93A 1US4A 1UTHA 2R6GE 2ZYNA 3G3KA 5A5XB 4YKJA 3W9VA 3KGCA 2O84X 2BJJX 5IAIA 3A09A 2D3IA 4WEPA 1YTVA 4DCYA 2W7YA 3LSLA 1Q35A 5ELVA 2HCAA 4R2FA 3IOVA 5CMCA 3EF7A 1B3GA 5FTHA 1FQEA 3SETA 5BWJA 3IJOB 2X26A 5I2KA 3TTLA 4PP0A 4TOZA 1BIYA 4G8HA 3FVKA 4KD5A 3GBAA 1QUKA 2V3TA 4R6KA 3ZKKA 4IO2A 2ZNUA 2FYIA 2QPQA 4OEUA 3OO6A 2FA7A 3RTFB 2DYXA 5EHSA 1YAEA 3G3FA 5DTBA 1POY1 4YKKA 3VLVA 5I58A 4YICA 3FV2A 2ZNTA 4XKNA 1JQFA 1A8EA 2PBWA 3DP4A 5DYHA 3K00A 3O9PA 5AA4B 1QVSA 2QL3A 4IO4A 3MVXA 5KCJB 5TPAA 4ZZAA 3UORA 4F19A 2B3FA 4H8IA 1UIUA 1ZBMA 4OESA 3T93B 3VXBA 2QS1A 2ZNSA 1P1QA 3FGSA 4N13A 4NTLA 4O3AA 4OFLA 3T66A 1Y3PA 2RKMA 4OZ9A 3OOAA 3O66A 4DDDA 1QW0A 4QF9A 2O7UA 4ZDMA 3WAFA 2DWAA 4OXVA 3K1NA 1IITA 1SW2A 3V89B 2DXYA 4BDLA 4BDOA 5JEIA 3IX1A 5H8SA 3TMGA 1UTBB 4XTCQ 1TT1A 3K0VA 4R9FA 1DSNA 1RKMA 2QRYA 3OO8A 4GL8A 4LUBA 1O7TA 5JK4A 3QUFA 2XXIA 3PUVE 1WODA 4M4GA 2P2AA 4G77A 1EZ9A 2Y7KA 4IO6A 1B2HA 3T22A 3WAEA 4BLAA 4F3PA 1MY0A 3L6GA 4F1VA 2I4CA 3ILTB 3TTKA 5FHOA 3H6UA 2O68A 4RJZA 4HCYA 4NF4A 4XKRA 3VLWA 2HXWA 4LP2B 4KYSA 2ESNA 3IB1A 4IO5A 1FTOA 3PD9A 2Z8FA 4FIMA 4ELOA 3S4UA 3D4GA 4EQ7A 4YZZA 1Z7NE 4NWCA 3TELA 4GWOA 2Z23A 1BTJA 1DOTA 1SDXA 1Y20A 2XXRA 3FVOA 4G68B 3SEUA 1B5JA 3SERA 4F39A 1B4ZA 2ABHA 5L9SA 2I3VA 2HAUA 3N6UA 4GFRA 5EHMA 1PB9A 2VD2A 1QULA 3MAMA 4JWXA 2OLBA 2NUVA 2XXUA 2B65A 1TFAA 2Y7PA 3G7WA 1YPNA 3O29A 4NF5A 3FJ7A 3PU5A 4U21A 4YAHX 4RPOA 1QUJA 3SEVA 2VHAA 5AA2B 5KZTA 3VDFA 4JWOA 4YKIA 3K6WA 4AB5A 4DE8A 2OK2A 2YJPA 4O3BA 2RC9A 1QUIA 4NF4B 3KN3A 1LBCA 1MY3A 3QYTA 4LZ7A 4WKMA 2F7BA 2I4BA 3K6UA 2D5WA 4LA9A 3K6XA 4Q30B 2ONRA 1LCFA 4LZ8A 4EQBA 1FW0A 1VFEA 5TU0A 4LQ2A 3TYHA 2DOJA 3PUWE 1LGBC 3KG2A 3VV5A 3IO4A 4KFQA 1MDP1 1MM6A 2I48A 1BKAA 3N26A 3T9VA 2AYSA 5EYFA 3BFUA 5H8FB 2Q8JA 3UA8A 5AE4A 4ONYA 1TFDA 1Z7ME 4G68C 3UP9A 4JXIA 1MS7A 4OHNA 3V5AA 3PPNA 2NVUB 4UA8A 3GLBA 5TP9A 1CE2A 1FQBA 4R9GA 2ZXTA 3Q27A 2O1MA 4WXJA 1B0LA 4RA1A 1LBBA 2HQ0A 4H5FA 4P11A 1DTGA 1NL5A 3O2AA 3U72A 5I56B 5HBCA 1IXIA 4U22A 1D4NA 2YLNA 3KSJA 2CMOA 2F7AA 4JSOA 2F78A 3E13X 1IEJA 1MQGA 2XX8A 5CBSA 2F97A 1I69A 2XD2A 4KI0E 5CMKA 3L6HA 3CFXA 1H76A 4FJPA 2Q2CA 1LFGA 3GBBA 1MXXA 3G3HA 4OWDA 5CI5A 3MPLA 5F7VA 3CFZA 1MY2A 4RK9A 3IB0A 4G4PA 2WKYA 3CVGA 4EF2A 4YMBA 3N6TA 3PUYE 1MH4A 4LQ5A 2ONSA 3TPAA 5AA4A 4C0RA 4EXKA 3JYRA 3EN3A 4I1DA 4UACA 3DM0A 1IZ1A 4FATA 2XXXA 3MZBA 2F6PA 4FORA 1II5A 5I58B 3FIRA 1Y1MA 2F34A 3VLUA 5B70A 4F1UA 3MZ1A 3DP8A 1D3KA 3H4ZA 1A99A 1B40A 2Z22A 2RCBA 3D4CA 1M5FA 3BKIB 4POXA 3HHGA 4X1BA 3EHSA 2ALUA 3T9XB 3EHUA 3RPWA 1ATGA 2Q88A 5AA2A 1LAHE 3K02A 3KBRA 1LAFE 3FVGA 4DLDA 4P0IA 1NKXA 1MY1A 4N07A 1N76A 4XXUA 4OMBA 3U93A 4O3CA 3S9LC 2Y84A 1FTMA 4PFYA 3VE1B 5I59B 1B58A 3CIJA 3HV1A 3TZAA 1HSJA 5KDTA 3OENA 1NFTA 3RTWB 4DZ1A 1NNTA 2VD3A 4IY5A 4U1ZA 3RNNA 3USDA 5H8FA 5ICQA 4TLLB 1LAGE 1OQHA 2I0BA 5CBRA 5A5XA 1SD3A 1B4HA 5M2VA 3QSLA 3TFLA 5K2XA 1J1NA 1OLCA 4ESXA 1SQYA 2XXYA 3H7MA 3CSGA 2E1SA 2X7PA 1AH5A 2ZYOA 3K1PA 4QRZA 5DVJA 1URGA 2V3UA 3KN8A 4FECA 3U94A 4NF8B 5F1QA 4KHZE 1MH3A 1M5CA 5ICTA 3RLFE 4YKPA 1FTJA 1HSLA 1B32A 2Q2AA 1N04A 1ANFA 1OVBA 4MFIA 1MQDA 3IO6A 1P1NA 4AB6A 4DXBA 4YMAA 2REJA 1AL3A 4TQUQ 3ONMA 2I49A 2FNCA 4ELPA 3I6VA 4H0WA 1A7LA 1B5HA 4E0WA 1UQWA 3M3LA 1M5DA 1AOVA 5L8DA 1N3WA 2Y7WA 5HM4B 1A54A 1SYHA 4H67A 1OVTA 3OO7A 4MLQA 4ZS9A 5H8QA 1LFIA 2XXWA 3CRBA 3TQLA 2THIA 3E3KA 2F35A 1MY4A 3MW0A 4QSEA 3TKDA 4C1UA 1ZU0A 4ZEBA 3S9MC 2XXVA 4GLIA 3MC2A 5AA2D 4LZ5A 4YB7A 1N84A 2O6AA 3HN0A 4QFKA 5CRYA 1ZTYA 1XVXA 2ZMBA 3CG1A 4N6PA 5I57B 1AIVA 3H06B 2Z8DA 2QSXA 2GRVA 3OXNA 4I9DA 1UTBA 4MLVA 2GH9A 4BDRA 1A55A 4LVQA 4OENA 1VE4A 3O6IA 3RY3A 2M8CA 2O51A 4XIGQ 4E0XA 3PUXE 4C1TA 3S9NC 5BUUA 3HHFA 1DTZA 2DVZA 1PBPA 2KLFA 3T96B 1SI0A 4H8JA 4F31B 5KCJA 1I6AA 3VFJA 1MPDA 1HSEA 1EZOA 1Y3NA 4XKPA 1Y4TA 1XC1A 2NOOA 2XXHA 5FHNA 3VVFA 1ZMGA 4QFLA 3TAJA 1T0KA 4Q8RA 4F2QA 2H5YA 3LSFB 2DS9A 4EQ9A 1B3EA 4QHQA 2QS4A
chains in the Genus database with same CATH superfamily
1K9ZA 4Z0IA 3O28A 1NH8A 4MAGA 3ZS6A 3FATA 1SW5A 5K2YA 2NXOA 5I56A 4EF1A 2V93A 4NG7A 4KYEA 4GWZA 2HFBA 1MDQA 3LR1A 3TODA 1FQCA 4PBQA 2QVUA 4F29A 1B0HA 1Y4CA 3SDFA 1LBWA 4NX1A 2XXPA 5ISUA 2GHBA 2UVJA 4OEVA 4N17A 3K6VA 2H9BA 4ZE9A 2Y7RA 5EQ7A 3R7XA 1N7XA 4R74A 3QK6A 3FUZA 1LBZA 3U8QA 2B3BA 2I58A 2WBDA 1URSA 4QSCA 1OQGA 4YU0A 2XX7A 1USYH 1PEBA 3KOTA 4NF6B 1B6HA 3MBPA 3PPOA 5IM2A 4IGTA 3M3FA 4GF8A 1EH3A 2QS2A 3C31A 4PTKA 4N6DA 2REGA 3FXUA 5KCJA 1LLSA 3IAZA 3TCFA 3MVWA 5ITPA 1GV8A 2IA4A 1NUXA 3DLNA 4NE4A 3FJGA 4YMAA 3T9HB 3KN7A 4GXSB 3ODBA 4LATA 2B4MA 1FTKA 2A5TB 2UVIA 1D9QA 4PFTA 3MPKA 1NMUA 3OEMA 1ELJA 3RT8A 1XOCA 1H45A 3TQWA 4YB5A 5L9OA 3H6TA 4GBWA 4NF0A 3IOTA 1MQJA 2RC8A 4F18A 3TTRA 2PCRA 2UYFA 2WYKA 3MP1A 4F2OA 2HZLA 1JW4A 2OX3A 3KFMA 4RY1A 4PE5B 1RYXA 5A5LA 4EXLA 2OZZA 3T0JA 1NNFA 2P0SA 1B9JA 1DPEA 4Q5TA 1RYOA 4PGPA 5I84A 4QXDA 4G8NA 1DMBA 1TWYA 1PC3A 3PMVA 2UVGA 5ICQA 2ANJA 1R9QA 2OCUA 3SKPA 2OBGA 2XXTA 3C35A 3C4MA 3DELB 1O64A 1D9VA 1OLAA 5H8NB 1JEUA 1B3HA 4N91A 5H8HA 1KA0A 1UTHB 4G2ZA 3KJ7A 4F3BA 3BFTA 2DWIA 3S9EA 1MXYA 2F36A 3B7DA 1POTA 3TCHA 3VXCA 2XWIA 1LFHA 3EHTA 3QAXA 2RF1A 1NUZA 3FV1A 4P1EA 1B46A 2PFZA 1S50A 2XD3A 3Q25A 4ZEKA 1Y3QA 3Q26A 2VPNA 3C34A 4H46A 3A29A 4AS5A 3O6GA 2DE3A 4DIGA 1KWHA 5I7IA 4NMYA 1UTHA 5A5XB 5IAIA 3A09A 4WEPA 1IMCA 4X04A 4R2FA 5FTHA 5BWJA 2QVVA 1BIYA 4OVQA 3FVKA 1QUKA 3ZKKA 2ZNUA 2CZKA 1POY1 3FV2A 1NV3A 5DYHA 2PBWA 3MVXA 1UIUA 3T66A 4NTLA 4PDHA 4OZ9A 3OOAA 3IFAA 1SW2A 3V89B 2DXYA 4BDOA 3E78A 4XTCQ 3K0VA 1DSNA 3OO8A 1WODA 4IO6A 1NV4A 1BK4A 4F3PA 5FHOA 2O68A 4KYSA 1FTOA 4FIMA 4NHBA 2XWKA 2Z23A 2XXRA 4PAKA 1FJ6A 2ABHA 2HAUA 1IMAA 3N6UA 4HE1A 2VD2A 1QULA 2Q8MA 4JWXA 3G7WA 4NF5A 3FJ7A 2VHAA 5AA2B 3K6WA 4AB5A 4O3BA 4WKMA 1DBZA 2D5WA 3K6XA 2ONRA 4LZ8A 4EQBA 4GX4A 2P3VA 5TU0A 3KG2A 2AYSA 4MHFA 5H8FB 5AE4A 4OHNA 3Q27A 1B0LA 1LBBA 4JSOA 3KSJA 2XD2A 2QFLA 4KI0E 5CMKA 4N6KA 1MY2A 4G4PA 4EF2A 4YMBA 4EXKA 4PCDA 4I1DA 4JVDA 3DM0A 4GWSA 1FPJA 2F6PA 4FORA 5B70A 2F34A 3PTYA 1A99A 2Z22A 4JVIA 4POXA 3T9XB 3HHGA 3K02A 3KBRA 1NV0A 4XXUA 1N76A 3U93A 4PFYA 5I59B 3HV1A 5KDTA 3OENA 3RTWB 4DZ1A 1NNTA 5H8FA 4TLLB 1B4HA 3ROJA 3CSGA 3K1PA 1URGA 3KN8A 3U94A 3B8BA 1M5CA 4YKPA 3T1BA 1HSLA 2Q2AA 5ET6A 1N04A 1ANFA 3IO6A 4TQUQ 4NN3A 3ONMA 3I6VA 3M3LA 5H8QA 3TQLA 3MW0A 4C1UA 4ZEBA 3MC2A 4LZ5A 1AIVA 2QSXA 1YXIA 2GRVA 1UTBA 1CNQA 2O51A 4E0XA 5JK4A 1PBPA 1SI0A 4H8JA 1I6AA 1MPDA 4PBHA 2NOOA 5FHNA 1T0KA 3LSFB 5EQAA 1JEVA 3W9WA 4G8MA 1IMDA 3C32A 4U4XA 3RN8A 3LC8A 3QXMA 4ZE8A 1FQDA 4KCCA 3Q29A 1GR2A 1R6ZA 1S9TA 2DE2A 1MXVA 3C36A 2V84A 1JETA 3LV0A 3FJMA 3MVZA 4NEDA 4MNPA 2IEEA 3SEYA 3ECRA 4I40A 3W15C 4I62A 5LDZA 4MJOA 4PAIA 4U2RA 4L17A 1YYZA 3HPIA 4RYAA 3Q28A 2XA5A 4G68A 4N4UA 1ZLQA 2P1SA 3OELA 5AA3A 3KSXA 2I3WA 1GTKA 2XXQA 1H3DA 5IGAA 4OERA 3RQTA 4MF3A 4U1OA 1LBXA 2R9JA 4H65A 4JSDA 4OVRA 2O7IA 1FQFA 3OSRA 5I2NB 4ZEFA 2E0SA 3B6TA 4PFRA 1SVXB 4I3YA 4ND9A 1NV2A 1I6BA 1CB6A 1IUDA 4KXPA 4ZEDA 4OETA 3JV9A 1NH7A 1B7UA 3PMWA 2OWSA 4H5GA 2UVHA 5FHMA 3ILUB 1K9YA 1IMBA 1RDYA 4GVOA 1BLFA 5J1DA 1ZJLA 4TLMB 1WVJA 1P1UA 3QMFA 3MP8A 3E9XA 4OVJA 5DTBA 2DXRA 4R6YA 3MWBA 2G29A 2RCAA 1EU8A 5AA1A 4R73A 3H6VA 1MM7A 4MX6A 1S7YA 1MXWA 3UN6A 2XX9A 1OIBA 1B05A 1DK4A 4IY6A 1ZIUA 3F11A 3KOSA 2XHDA 2ZZXA 2ONKE 4IB2A 2RINA 4N15A 1MRPA 4PFUA 3OO9A 1A40A 4FEBA 2Q89A 1G0HA 1FSAA 1USYE 4NF6A 1FJ9A 3O6HA 2DSFA 2ZYKA 1B3LA 1P99A 1B1XA 3G3IA 3T9UA 3TTNA 2DP8A 3BIHA 1R9LA 3C9HA 1LB8A 3IL1B 4F3GA 3DP6A 3ISPA 2Q9TA 3MJNA 2CZHA 4P1LA 2CZIA 3G3GA 3IJXB 4GRKA 3U65A 1NV6A 1JVXA 4K3FA 2Q74A 3N5LA 5H8QB 5IKBA 3FXQA 3PD8A 4MH5A 1H44A 1OMPA 4U4SA 1N7WA 4KR5A 2RC7A 1BP5A 2LAOA 3B6QA 4R6HA 3V8XB 3MUQA 2GFEA 2G93A 3FBPA 3KGCA 2D3IA 4O7IA 4FBPA 3IJOB 2X26A 4PP0A 4TOZA 2QVRA 4G8HA 4R6KA 4OEUA 2QPQA 3OO6A 1YAEA 3G3FA 5I58A 4YICA 4H45A 4XKNA 3O9PA 5AA4B 5ET8A 2QL3A 3D1RA 5KCJB 1ZBMA 4OESA 4GBVA 4OFLA 3O66A 3K1NA 1IITA 3GYYA 3IX1A 4PGNA 2QRYA 4GL8A 4LUBA 1O7TA 4O8MA 3PUVE 2FBPA 2P2AA 1EZ9A 4LN5A 2HHMA 4HCYA 4NF4A 2HXWA 3PD9A 2Z8FA 4NWCA 3SERA 3SEUA 3CHGA 1B4ZA 5L9SA 2I3VA 3RPLA 4GFRA 5EHMA 3MAMA 2NUVA 5DVIA 2B65A 4U21A 3PU5A 5KZTA 4DE8A 2CEXA 2YJPA 2RC9A 1MY3A 3QYTA 4LZ7A 2B4LA 1NI9A 2GQ1A 1LCFA 4Q30B 1FW0A 2HPGA 3IO4A 2FVZA 3T9VA 1NV1A 1FBDA 3UP9A 1CE2A 1FQBA 2O1MA 4WXJA 4P11A 1NL5A 3O2AA 3U72A 4U22A 2YLNA 1FPEA 2F7AA 1IEJA 2WKYA 3CVGA 4LQ5A 4MNCA 4GWYA 4FATA 2XXXA 1II5A 5I58B 3FIRA 3VLUA 4F1UA 3MZ1A 3H4ZA 3D4CA 4X1BA 2ALUA 2Q88A 1LAFE 1NKXA 4OA4A 4OMBA 4O3CA 2Y84A 5K2XA 1J1NA 1OLCA 4ESXA 3H7MA 2XXYA 4PF8A 2X7PA 2OWZA 5DVJA 2V3UA 5F1QA 4KHZE 1FTJA 1OVBA 4AB6A 4DXBA 3RYDA 1UQWA 1N3WA 2DDKA 1OVTA 4ZS9A 1LFIA 2VT5A 2XXWA 3CRBA 2BJIA 3E3KA 3TKDA 3S9MC 4GLIA 1FBEA 1N84A 2O6AA 5I57B 1XVXA 4PFIA 4P3LA 4BDRA 1A55A 4LVQA 1VE4A 3RY3A 3HHFA 1DTZA 4N81A 2XWVA 1INPA 4XKPA 4QFLA 2H5YA 2DS9A 5L9MA 2OJTA 3I5OA 1FBFA 2F3BA 3U92A 1N3XA 2PMSA 4ELQA 4GD5A 2H25A 1MPCA 3TTMA 5I57A 1B51A 4JVCA 1XHYA 4DI3D 2CZLA 1QKAA 4F22A 1D9YA 4F3SA 1LCTA 1LEVA 3PMXA 4NF8A 2F8DA 2JJKA 3VXBA 1MQIA 2DWHA 1M5EA 2I0CA 1JVYA 3KBZA 2ZYMA 3IR1A 4JWYA 3KZGA 3R26A 1LSTA 1FCKA 1ZKBA 5CC2A 1IXGA 1SW4A 2HZKA 4KCDA 4F1YA 2L5VA 4MBPA 5T3JA 1VFDA 2AL5A 1NUYA 1FPFA 3SEWA 5I59A 3ZSFA 4GL0A 1UIVA 4MMPA 4HCWA 4JB7A 4RNSA 3TCGA 1NV5A 3CSBA 2PT2A 3FD3A 5DT6A 2OWTA 5H8HB 1NNPA 1QJMA 3EKIA 3VVEA 1L5TA 3UK4A 4ELRA 3K2DA 4R2BA 2DVCA 4KYDA 3OEKA 1XS5A 4X48A 1LBVA 5EQ8A 1IXCA 5TP9B 1B7ZA 1B52A 3N94A 2PX1A 1B3FA 3CG3A 4BDQA 1IXHA 3TEPA 4BDNA 1MXUA 4I3EA 4NWDA 4RPNA 4IGRA 4X9TA 1IQ7A 2V25A 4IR8A 1YCJA 1B5IA 4NF5B 3THIA 4QFPA 3PUZE 5KDTB 5DEXB 3PPQA 1DPPA 3OD7A 4Z7EA 4RXLA 4ZECA 2PVUA 4JDFA 4Q0CA 4PETA 3GZGA 1VDWA 5ET7A 1Q1KA 3G3JA 2AIXA 4ECFA 3H6WA 5FTIA 3CR9A 3M3KA 4LONB 4XKQA 2QS3A 3MYUA 5CMMA 5ESYA 1MG1A 2H98A 2Y5KA 4MNIA 2H99A 4H6DA 5EYHA 3HSTA 5I2KB 4HTGA 5JTYA 2PT1A 3RGYA 1JNFA 5F24A 4OFJA 1LB9A 4H1XA 1QKBA 2F5XA 4DXUA 5TPAB 3VVDA 1FPBA 4R72A 3LBSA 3K1MA 2QJEA 3O97A 1URDA 1P1WA 3C33A 2FIEA 4GIZA 3OMBA 1XVYA 3QIMA 4GX6A 1FBCA 3RUMA 4QFOA 1VSOA 1FTLA 4DXCA 3LSXA 4OTEA 3U1OA 1RDZA 3SZPA 4BDMA 2DWJA 1LAXA 3CFLA 3GXAA 2WX9A 3A3CA 2VGQA 4M1VA 3HCQA 3TUSA 1US4A 2R6GE 3NOHA 2O84X 2BJJX 1YTVA 5ELVA 1NUWA 3SETA 4KD5A 3GBAA 2V3TA 4IO2A 2FA7A 3RTFB 2DYXA 5EHSA 4YKKA 3VLVA 5IZ1A 4X8RA 1A8EA 3DP4A 4IO4A 2KQZA 2ZZWA 5TPAA 4ZZAA 4H8IA 3T93B 2QS1A 4O3AA 1P1QA 2RKMA 3WAFA 2DWAA 1UTBB 1TT1A 1RKMA 3QUFA 5FBPA 2XXIA 4M4GA 4G77A 3WAEA 1B2HA 4GWWA 3L6GA 2I4CA 3TTKA 2ESNA 3IB1A 4IO5A 4ELOA 4EQ7A 3D4GA 4YZZA 3TELA 1BTJA 1DOTA 1SDXA 1Y20A 1B5JA 3E79A 2OLBA 4O7MA 2XXUA 1TFAA 2Y7PA 4UABA 4GWUA 4JWOA 4YKIA 4NF4B 1QUIA 1SPIA 4LQ2A 3TYHA 2DOJA 1LGBC 2CEYA 3VV5A 1MM6A 2I48A 1BKAA 2Q8JA 1TFDA 4G68C 4JXIA 1MS7A 3V5AA 2NVUB 4UA8A 2KR0A 5TP9A 5I3SA 4R9GA 2ZXTA 4PC9A 1DTGA 1IXIA 2V4CA 2CMOA 3E13X 2XX8A 1I69A 3L6HA 3CFXA 4FJPA 1MXXA 3MPLA 4OVPA 3CFZA 3IB0A 4PDDA 1EYIA 2ONSA 5AA4A 4C0RA 4UACA 3MZBA 4GWXA 1Y1MA 1D3KA 1B40A 1M5FA 3BKIB 3EHUA 2F3DA 4PF6A 5AA2A 3FVGA 4DLDA 1MY1A 3S9LC 2PFYA 4OANA 1HSJA 1NFTA 4U1ZA 2I0BA 2Y5LA 5M2VA 1RDXA 4QRZA 1SQYA 2E1SA 2ZYOA 1EYJA 1MH3A 3RLFE 1B32A 1MQDA 1P1NA 2REJA 1AL3A 4ELPA 2FNCA 1AOVA 5HM4B 1JP4A 1SYHA 4H67A 4MLQA 5DW8A 1ZU0A 3MSTA 4PE3A 5CRYA 2ZMBA 3H06B 5IZ3B 3OXNA 1LBYA 4XIGQ 4C1TA 3S9NC 5BUUA 2WEFA 1Y3NA 1Y4TA 1XC1A 2XXHA 1QGXA 1ZMGA 1FBGA 4EQ9A 4QHQA 4QBAA 3PPRA 2F6GA 3I3VA 2R71A 2WYPA 4P0GA 1A8FA 1XT8A 2O69A 2X7QA 3M8UA 4RK2A 3MVYA 3AXFA 2QMXA 2GHAA 2YPNA 3LSWA 2HAVA 2O1LA 2QMWA 5CM6A 2H4IA 2D21A 2DQVA 1B7HA 4IO3A 4OQOA 5LOMA 1EZPA 3IOWA 5LTCA 3TDJA 4PQJA 2VP1A 3FVNA 1H43A 1PDAA 2I6EA 4U23A 2PYYA 3OSQA 2Z8EA 1FPKA 1JW1A 3KJTA 4N8YA 4IO7A 4ISUA 3IB2A 4YB6A 3P7IA 1PBQA 3KC1A 3EPEA 3B50A 3ZKLA 3R6UA 4ESWA 4KQPA 1GVCA 3K01A 1Y1ZA 3KC0A 3K4UA 1B1HA 3H03A 1TXFA 1M5BA 4GXAA 4PFBA 4WEDA 4AQ4A 2A5SA 4HS7A 1MXZA 4FEDA 5B7DA 4JBZA 1SYIA 1KA1A 4EDPA 1PB7A 4X1DA 5ITOA 4P8BA 3SESA 4ZEIA 3S2VA 3UGWA 1R1NA 1IMFA 3PGFA 3FZVA 4PFWA 4KPTA 3MP6A 1FBPA 3H3GA 3LUYA 1MPBA 4HE2A 2HEUA 5CMBA 3RT6B 3MQ9A 4OVSA 1NV7A 2P3NA 1PB8A 4GOTA 4ZDMA 1JW5A 1I6QA 3A3UA 4FE8A 1F9BA 2AL4A 4THIA 3CI8A 4G61A 2NWJA 1P1OA 4OVTA 3MZ9A 3IOUA 4OYVA 3IORA 3SEXA 5DVFA 3UIFA 5DEXA 3FASA 4P56A 5HPQA 2DE4A 2WBBA 2A5TA 1SBPA 4DCXA 2UXAA 4GQOA 2XWOA 3EQ1A 4I8CA 5IZZA 3JZJA 3IFCA 1GGGA 5H8NA 4EUOA 2V3QA 2Y7IA 4FAJA 3HFUA 1NNKA 1SW1A 5I2KA 5JTYB 4QSDA 5I2NA 3QUJA 4XF5A 4POWA 1N0TA 1AMFA 3HO7A 5IZ3A 5I5PA 1US5A 4XFEA 1O63A 3PV0E 3B6WA 4HW8A 2VOZA 3IK6B 1VR5A 3KEIA 1FQAA 1IIWA 1MQHA 2F7CA 4R75A 1SI1A 4QFNA 4NAPA 3FXRA 3PPPA 2UYEA 4MCOA 4ZZEA 1WDNA 1Y9UA 3BBRA 3E4RA 2ZYNA 3G3KA 4YKJA 3W9VA 1FPIA 4DCYA 2W7YA 2ZZVA 3LSLA 1Q35A 2MKZA 2FHYA 2HCAA 3IOVA 5CMCA 3EF7A 1B3GA 4AS4A 1FQEA 3TTLA 1FPGA 4NGUA 5ET5A 1FTAA 2FYIA 1KZ8A 2ZNTA 1JQFA 3FXBA 3K00A 1QVSA 1YZ0A 3UORA 4F19A 2B3FA 2ZNSA 3FGSA 4N13A 1Y3PA 4DDDA 1QW0A 4QF9A 2O7UA 4OXVA 4BDLA 5JEIA 5H8SA 3TMGA 4R9FA 1DCUA 2VPOA 3LUZA 2Y7KA 3T22A 4BLAA 1MY0A 4F1VA 3ILTB 3H6UA 4RJZA 4XKRA 3VLWA 2FIXA 4LP2B 3S4UA 1Z7NE 4MEVA 5J16A 4GWOA 1G0IA 4G68B 3FVOA 4N8GA 4F39A 4HE0A 1PB9A 4OFOA 3V83A 1YPNA 3O29A 4YAHX 3SEVA 4RPOA 1QUJA 4P9KA 3VDFA 2OK2A 3KN3A 1LBCA 2F7BA 2I4BA 3K6UA 4LA9A 1VFEA 4MIJA 3PUWE 4KFQA 1MDP1 3N26A 5EYFA 3BFUA 1XI6A 4PAFA 3UA8A 4ONYA 1Z7ME 1FPDA 1Q9DA 1FPLA 3PPNA 3GLBA 4XEQA 4DI4B 3BIGA 4RA1A 5I56B 2HQ0A 4H5FA 5HBCA 1D4NA 2F78A 1MQGA 5CBSA 2F97A 4O94A 4P47A 1H76A 2Q2CA 1LFGA 5F7VA 3GBBA 3G3HA 4OWDA 5CI5A 4RK9A 3N6TA 3PUYE 1MH4A 3TPAA 3JYRA 3EN3A 1IZ1A 1FRPA 3DP8A 2RCBA 2XXKA 3EHSA 1EYKA 1ATGA 3RPWA 1AWBA 1LAHE 4NQ8A 4P0IA 4N07A 5EYGA 1FTMA 3VE1B 1B58A 3CIJA 3TZAA 4GX3A 3RNNA 2VD3A 4IY5A 4HXVA 1LAGE 1OQHA 5CBRA 5A5XA 1SD3A 3QSLA 3TFLA 3USDA 1AH5A 4FECA 4NF8B 5EQ9A 5ICTA 1FBHA 2R8TA 4MFIA 3RPLB 2I49A 4H0WA 1A7LA 1B5HA 4E0WA 1M5DA 5L8DA 2Y7WA 1A54A 3OO7A 2THIA 4QSEA 2F35A 1MY4A 2XXVA 5AA2D 4YB7A 3HN0A 4QFKA 1ZTYA 3CG1A 4N6PA 2Z8DA 4I9DA 4MLVA 2GH9A 2HXRA 4OENA 3O6IA 2M8CA 3PUXE 2DVZA 2KLFA 3T96B 4F31B 3VFJA 1HSEA 1EZOA 3VVFA 3TAJA 1IMEA 4Q8RA 4F2QA 1B3EA 2QS4A
chains in the Genus database with same CATH topology
5L9MA 1JEVA 2OJTA 3PPRA 2F6GA 3I3VA 3W9WA 2R71A 4G8MA 4Z0IA 3O28A 3RT8A 3C32A 4P0GA 1A8FA 4U4XA 1NH8A 3I5OA 3RN8A 3LC8A 3ZS6A 1XT8A 3QXMA 3FATA 4ZE8A 1FQDA 1SW5A 2O69A 5K2YA 1EZPA 4KCCA 2X7QA 3Q29A 3M8UA 2NXOA 1GR2A 3U92A 4RK2A 5I56A 4EF1A 1R6ZA 1S9TA 3MVYA 4OFOA 2V93A 2QMXA 3AXFA 1N3XA 2PMSA 4ELQA 2DE2A 2GHAA 2YPNA 3LSWA 2HAVA 1MXVA 4KYEA 4GD5A 2O1LA 2QMWA 3C36A 2V84A 5CM6A 1JETA 2H4IA 2H25A 1MPCA 2HFBA 3FJMA 3TTMA 3MVZA 5I57A 1B51A 4NEDA 2D21A 1MDQA 1XHYA 2IEEA 3LR1A 2DQVA 1B7HA 2CZLA 4IO3A 1QKAA 3ECRA 4OQOA 3SEYA 3TODA 5LOMA 3IOWA 3W15C 1FQCA 4F22A 4I62A 1D9YA 4PQJA 1LCTA 2VP1A 3TDJA 4F3SA 3FVNA 3PMXA 4NF8A 4F29A 2F8DA 1H43A 1B0HA 1PDAA 1Y4CA 1MQIA 2DWHA 2I6EA 3SDFA 2XXPA 4U23A 4U2RA 2GHBA 2PYYA 1M5EA 4L17A 5ISUA 2I0CA 1JVYA 3OSQA 2Z8EA 2UVJA 2ZYMA 3HPIA 3IR1A 4RYAA 4JWYA 1JW1A 4OEVA 3Q28A 3KZGA 3KJTA 3K6VA 3R26A 4IO7A 1LSTA 4G68A 1FCKA 2H9BA 4ZE9A 4ISUA 1ZLQA 1ZKBA 2Y7RA 3IB2A 2P1SA 3R7XA 4YB6A 5CC2A 3OELA 1IXGA 1N7XA 3P7IA 1PBQA 4R74A 3QK6A 3EPEA 3FUZA 3ZKLA 5AA3A 3R6UA 1SW4A 2HZKA 3KSXA 4KCDA 4KQPA 4ESWA 4F1YA 1GVCA 4MBPA 3U8QA 1VFDA 2AL5A 2B3BA 2I58A 3K01A 3SEWA 2I3WA 5I59A 3ZSFA 1GTKA 2XXQA 1URSA 4GL0A 1UIVA 1H3DA 1Y1ZA 4HCWA 4QSCA 1OQGA 4JB7A 4OERA 4RNSA 3RQTA 4YU0A 2XX7A 3TCGA 1USYH 4MF3A 1PEBA 3KOTA 3K4UA 4NF6B 1B1HA 3H03A 1B6HA 3MBPA 3PPOA 4U1OA 4IGTA 3M3FA 4GF8A 1TXFA 2R9JA 4H65A 3CSBA 4JSDA 1EH3A 2PT2A 3FD3A 1M5BA 2O7IA 2QS2A 2OWTA 1FQFA 3C31A 3OSRA 5DT6A 4GXAA 5H8HB 5I2NB 1NNPA 4ZEFA 4WEDA 4AQ4A 2E0SA 2REGA 1QJMA 3B6TA 2A5SA 3FXUA 4HS7A 1MXZA 1SVXB 4FEDA 1L5TA 4ND9A 3UK4A 3VVEA 3K2DA 4ELRA 4JBZA 5B7DA 1SYIA 4R2BA 2DVCA 4KYDA 4EDPA 1LLSA 1PB7A 1I6BA 1CB6A 4X1DA 3IAZA 3TCFA 3THIA 1IUDA 3MVWA 5ITOA 3OEKA 5ITPA 3SESA 1XS5A 4ZEDA 4OETA 3JV9A 1GV8A 2IA4A 3DLNA 4ZEIA 3S2VA 1NH7A 4X48A 1R1NA 1B7UA 3UGWA 3PGFA 1IXCA 3PMWA 2OWSA 3FZVA 4NE4A 3FJGA 4H5GA 1B7ZA 1B52A 2UVHA 4PFWA 5FHMA 5TP9B 3ILUB 4KPTA 3T9HB 3KN7A 3N94A 2PX1A 3ODBA 4GXSB 1B3FA 3CG3A 4LATA 3MP6A 1FTKA 2A5TB 4GVOA 2UVIA 4BDQA 1BLFA 1IXHA 3H3GA 3LUYA 1MPBA 3MPKA 4PFTA 1MXUA 4NWDA 4BDNA 1NMUA 5J1DA 3TEPA 2HEUA 1ZJLA 4RPNA 5CMBA 3RT6B 3MQ9A 4IGRA 1WVJA 4TLMB 4X9TA 1IQ7A 1P1UA 2V25A 3OEMA 1YCJA 1B5IA 3MP8A 4NF5B 1ELJA 1PB8A 3E9XA 4GOTA 1JW5A 4OVJA 1I6QA 1XOCA 3A3UA 4FE8A 2DXRA 4R6YA 1F9BA 2AL4A 1H45A 3MWBA 4QFPA 4THIA 4YB5A 3TQWA 2G29A 3CI8A 2RCAA 1EU8A 5L9OA 3PUZE 5KDTB 5AA1A 5DEXB 4R73A 3H6TA 2NWJA 3V83A 3PPQA 1DPPA 1P1OA 3IOTA 1MQJA 2RC8A 3OD7A 3MZ9A 4F18A 4Z7EA 3IOUA 4OYVA 4RXLA 4ZECA 2PVUA 1MM7A 3H6VA 2UYFA 3IORA 3TTRA 4JDFA 4Q0CA 3MP1A 3SEXA 5DVFA 3UIFA 4PETA 5DEXA 1S7YA 3GZGA 1MXWA 4F2OA 2HZLA 3FASA 3UN6A 1JW4A 1Q1KA 3G3JA 2XX9A 5HPQA 2AIXA 3KFMA 1OIBA 4ECFA 1B05A 2DE4A 4IY6A 4PE5B 4RY1A 1RYXA 2A5TA 1ZIUA 3F11A 3KOSA 4EXLA 2OZZA 3H6WA 5FTIA 1NNFA 2P0SA 1B9JA 1SBPA 2XHDA 1DPEA 4Q5TA 2ONKE 3CR9A 3M3KA 1RYOA 4IB2A 2RINA 4LONB 2QS3A 4XKQA 4DCXA 5I84A 2UXAA 1MRPA 4GQOA 4PFUA 3OO9A 5CMMA 1A40A 3EQ1A 4FEBA 1MG1A 2Q89A 2H98A 4I8CA 4G8NA 1DMBA 1TWYA 2H99A 4H6DA 1PC3A 3JZJA 2UVGA 3PMVA 1GGGA 1USYE 3HSTA 5H8NA 2ANJA 1R9QA 2OCUA 2V3QA 4NF6A 3SKPA 2OBGA 5I2KB 4EUOA 2Y7IA 3O6HA 2DSFA 2ZYKA 4HTGA 5JTYA 1B3LA 2PT1A 4FAJA 2XXTA 1P99A 3C35A 1NNKA 3C4MA 1SW1A 3RGYA 1B1XA 1JNFA 3DELB 3G3IA 3T9UA 1O64A 5JTYB 1D9VA 1OLAA 4QSDA 3TTNA 5H8NB 2DP8A 1LB9A 1JEUA 4H1XA 4OFJA 1B3HA 1QKBA 1R9LA 2F5XA 3C9HA 1LB8A 5H8HA 3QUJA 5I2NA 3IL1B 1UTHB 4G2ZA 3KJ7A 4F3GA 3DP6A 2Q9TA 3MJNA 4DXUA 4POWA 5TPAB 4F3BA 3BFTA 2DWIA 3VVDA 3S9EA 1MXYA 1N0TA 1AMFA 3G3GA 3HO7A 4R72A 2F36A 3B7DA 3IJXB 3LBSA 3K1MA 4GRKA 1US5A 2QJEA 1POTA 1URDA 3O97A 1P1WA 3C33A 3TCHA 1O63A 3VXCA 4GIZA 1JVXA 3OMBA 3PV0E 4K3FA 3B6WA 1XVYA 4HW8A 3N5LA 1LFHA 2VOZA 3IK6B 3QIMA 3EHTA 3QAXA 5H8QB 5IKBA 2RF1A 1VR5A 3FXQA 3KEIA 3PD8A 3FV1A 4MH5A 1FQAA 4QFOA 3RUMA 1IIWA 1H44A 1MQHA 1OMPA 1B46A 4U4SA 1N7WA 2F7CA 1VSOA 4R75A 4KR5A 2RC7A 5DVIA 1FTLA 1S50A 1SI1A 4DXCA 3LSXA 1BP5A 4OTEA 3U1OA 2XD3A 3Q25A 2LAOA 1Y3QA 3B6QA 3Q26A 4QFNA 4ZEKA 4BDMA 2DWJA 1LAXA 4R6HA 3C34A 3CFLA 3GXAA 3FXRA 3PPPA 2UYEA 4ZZEA 3V8XB 3MUQA 1WDNA 1Y9UA 3O6GA 2DE3A 4DIGA 3A3CA 3BBRA 2GFEA 1KWHA 3E4RA 2VGQA 4M1VA 4NMYA 3HCQA 3TUSA 2G93A 1US4A 1UTHA 2R6GE 2ZYNA 3G3KA 5A5XB 4YKJA 3W9VA 3KGCA 2O84X 2BJJX 5IAIA 3A09A 2D3IA 4WEPA 1YTVA 4DCYA 2W7YA 3LSLA 1Q35A 5ELVA 2HCAA 4R2FA 3IOVA 5CMCA 3EF7A 1B3GA 5FTHA 1FQEA 3SETA 5BWJA 3IJOB 2X26A 5I2KA 3TTLA 4PP0A 4TOZA 1BIYA 4G8HA 3FVKA 4KD5A 3GBAA 1QUKA 2V3TA 4R6KA 3ZKKA 4IO2A 2ZNUA 2FYIA 2QPQA 4OEUA 3OO6A 2FA7A 3RTFB 2DYXA 5EHSA 1YAEA 3G3FA 5DTBA 1POY1 4YKKA 3VLVA 5I58A 4YICA 3FV2A 2ZNTA 4XKNA 1JQFA 1A8EA 2PBWA 3DP4A 5DYHA 3K00A 3O9PA 5AA4B 1QVSA 2QL3A 4IO4A 3MVXA 5KCJB 5TPAA 4ZZAA 3UORA 4F19A 2B3FA 4H8IA 1UIUA 1ZBMA 4OESA 3T93B 3VXBA 2QS1A 2ZNSA 1P1QA 3FGSA 4N13A 4NTLA 4O3AA 4OFLA 3T66A 1Y3PA 2RKMA 4OZ9A 3OOAA 3O66A 4DDDA 1QW0A 4QF9A 2O7UA 4ZDMA 3WAFA 2DWAA 4OXVA 3K1NA 1IITA 1SW2A 3V89B 2DXYA 4BDLA 4BDOA 5JEIA 3IX1A 5H8SA 3TMGA 1UTBB 4XTCQ 1TT1A 3K0VA 4R9FA 1DSNA 1RKMA 2QRYA 3OO8A 4GL8A 4LUBA 1O7TA 5JK4A 3QUFA 2XXIA 3PUVE 1WODA 4M4GA 2P2AA 4G77A 1EZ9A 2Y7KA 4IO6A 1B2HA 3T22A 3WAEA 4BLAA 4F3PA 1MY0A 3L6GA 4F1VA 2I4CA 3ILTB 3TTKA 5FHOA 3H6UA 2O68A 4RJZA 4HCYA 4NF4A 4XKRA 3VLWA 2HXWA 4LP2B 4KYSA 2ESNA 3IB1A 4IO5A 1FTOA 3PD9A 2Z8FA 4FIMA 4ELOA 3S4UA 3D4GA 4EQ7A 4YZZA 1Z7NE 4NWCA 3TELA 4GWOA 2Z23A 1BTJA 1DOTA 1SDXA 1Y20A 2XXRA 3FVOA 4G68B 3SEUA 1B5JA 3SERA 4F39A 1B4ZA 2ABHA 5L9SA 2I3VA 2HAUA 3N6UA 4GFRA 5EHMA 1PB9A 2VD2A 1QULA 3MAMA 4JWXA 2OLBA 2NUVA 2XXUA 2B65A 1TFAA 2Y7PA 3G7WA 1YPNA 3O29A 4NF5A 3FJ7A 3PU5A 4U21A 4YAHX 4RPOA 1QUJA 3SEVA 2VHAA 5AA2B 5KZTA 3VDFA 4JWOA 4YKIA 3K6WA 4AB5A 4DE8A 2OK2A 2YJPA 4O3BA 2RC9A 1QUIA 4NF4B 3KN3A 1LBCA 1MY3A 3QYTA 4LZ7A 4WKMA 2F7BA 2I4BA 3K6UA 2D5WA 4LA9A 3K6XA 4Q30B 2ONRA 1LCFA 4LZ8A 4EQBA 1FW0A 1VFEA 5TU0A 4LQ2A 3TYHA 2DOJA 3PUWE 1LGBC 3KG2A 3VV5A 3IO4A 4KFQA 1MDP1 1MM6A 2I48A 1BKAA 3N26A 3T9VA 2AYSA 5EYFA 3BFUA 5H8FB 2Q8JA 3UA8A 5AE4A 4ONYA 1TFDA 1Z7ME 4G68C 3UP9A 4JXIA 1MS7A 4OHNA 3V5AA 3PPNA 2NVUB 4UA8A 3GLBA 5TP9A 1CE2A 1FQBA 4R9GA 2ZXTA 3Q27A 2O1MA 4WXJA 1B0LA 4RA1A 1LBBA 2HQ0A 4H5FA 4P11A 1DTGA 1NL5A 3O2AA 3U72A 5I56B 5HBCA 1IXIA 4U22A 1D4NA 2YLNA 3KSJA 2CMOA 2F7AA 4JSOA 2F78A 3E13X 1IEJA 1MQGA 2XX8A 5CBSA 2F97A 1I69A 2XD2A 4KI0E 5CMKA 3L6HA 3CFXA 1H76A 4FJPA 2Q2CA 1LFGA 3GBBA 1MXXA 3G3HA 4OWDA 5CI5A 3MPLA 5F7VA 3CFZA 1MY2A 4RK9A 3IB0A 4G4PA 2WKYA 3CVGA 4EF2A 4YMBA 3N6TA 3PUYE 1MH4A 4LQ5A 2ONSA 3TPAA 5AA4A 4C0RA 4EXKA 3JYRA 3EN3A 4I1DA 4UACA 3DM0A 1IZ1A 4FATA 2XXXA 3MZBA 2F6PA 4FORA 1II5A 5I58B 3FIRA 1Y1MA 2F34A 3VLUA 5B70A 4F1UA 3MZ1A 3DP8A 1D3KA 3H4ZA 1A99A 1B40A 2Z22A 2RCBA 3D4CA 1M5FA 3BKIB 4POXA 3HHGA 4X1BA 3EHSA 2ALUA 3T9XB 3EHUA 3RPWA 1ATGA 2Q88A 5AA2A 1LAHE 3K02A 3KBRA 1LAFE 3FVGA 4DLDA 4P0IA 1NKXA 1MY1A 4N07A 1N76A 4XXUA 4OMBA 3U93A 4O3CA 3S9LC 2Y84A 1FTMA 4PFYA 3VE1B 5I59B 1B58A 3CIJA 3HV1A 3TZAA 1HSJA 5KDTA 3OENA 1NFTA 3RTWB 4DZ1A 1NNTA 2VD3A 4IY5A 4U1ZA 3RNNA 3USDA 5H8FA 5ICQA 4TLLB 1LAGE 1OQHA 2I0BA 5CBRA 5A5XA 1SD3A 1B4HA 5M2VA 3QSLA 3TFLA 5K2XA 1J1NA 1OLCA 4ESXA 1SQYA 2XXYA 3H7MA 3CSGA 2E1SA 2X7PA 1AH5A 2ZYOA 3K1PA 4QRZA 5DVJA 1URGA 2V3UA 3KN8A 4FECA 3U94A 4NF8B 5F1QA 4KHZE 1MH3A 1M5CA 5ICTA 3RLFE 4YKPA 1FTJA 1HSLA 1B32A 2Q2AA 1N04A 1ANFA 1OVBA 4MFIA 1MQDA 3IO6A 1P1NA 4AB6A 4DXBA 4YMAA 2REJA 1AL3A 4TQUQ 3ONMA 2I49A 2FNCA 4ELPA 3I6VA 4H0WA 1A7LA 1B5HA 4E0WA 1UQWA 3M3LA 1M5DA 1AOVA 5L8DA 1N3WA 2Y7WA 5HM4B 1A54A 1SYHA 4H67A 1OVTA 3OO7A 4MLQA 4ZS9A 5H8QA 1LFIA 2XXWA 3CRBA 3TQLA 2THIA 3E3KA 2F35A 1MY4A 3MW0A 4QSEA 3TKDA 4C1UA 1ZU0A 4ZEBA 3S9MC 2XXVA 4GLIA 3MC2A 5AA2D 4LZ5A 4YB7A 1N84A 2O6AA 3HN0A 4QFKA 5CRYA 1ZTYA 1XVXA 2ZMBA 3CG1A 4N6PA 5I57B 1AIVA 3H06B 2Z8DA 2QSXA 2GRVA 3OXNA 4I9DA 1UTBA 4MLVA 2GH9A 4BDRA 1A55A 4LVQA 4OENA 1VE4A 3O6IA 3RY3A 2M8CA 2O51A 4XIGQ 4E0XA 3PUXE 4C1TA 3S9NC 5BUUA 3HHFA 1DTZA 2DVZA 1PBPA 2KLFA 3T96B 1SI0A 4H8JA 4F31B 5KCJA 1I6AA 3VFJA 1MPDA 1HSEA 1EZOA 1Y3NA 4XKPA 1Y4TA 1XC1A 2NOOA 2XXHA 5FHNA 3VVFA 1ZMGA 4QFLA 3TAJA 1T0KA 4Q8RA 4F2QA 2H5YA 3LSFB 2DS9A 4EQ9A 1B3EA 4QHQA 2QS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L9M A;  1JEV A;  2OJT A;  3PPR A;  2F6G A;  3I3V A;  3W9W A;  2R71 A;  4G8M A;  4Z0I A;  3O28 A;  3RT8 A;  3C32 A;  4P0G A;  1A8F A;  4U4X A;  1NH8 A;  3I5O A;  3RN8 A;  3LC8 A;  3ZS6 A;  1XT8 A;  3QXM A;  3FAT A;  4ZE8 A;  1FQD A;  1SW5 A;  2O69 A;  5K2Y A;  1EZP A;  4KCC A;  2X7Q A;  3Q29 A;  3M8U A;  2NXO A;  1GR2 A;  3U92 A;  4RK2 A;  5I56 A;  4EF1 A;  1R6Z A;  1S9T A;  3MVY A;  4OFO A;  2V93 A;  2QMX A;  3AXF A;  1N3X A;  2PMS A;  4ELQ A;  2DE2 A;  2GHA A;  2YPN A;  3LSW A;  2HAV A;  1MXV A;  4KYE A;  4GD5 A;  2O1L A;  2QMW A;  3C36 A;  2V84 A;  5CM6 A;  1JET A;  2H4I A;  2H25 A;  1MPC A;  2HFB A;  3FJM A;  3TTM A;  3MVZ A;  5I57 A;  1B51 A;  4NED A;  2D21 A;  1MDQ A;  1XHY A;  2IEE A;  3LR1 A;  2DQV A;  1B7H A;  2CZL A;  4IO3 A;  1QKA A;  3ECR A;  4OQO A;  3SEY A;  3TOD A;  5LOM A;  3IOW A;  3W15 C;  1FQC A;  4F22 A;  4I62 A;  1D9Y A;  4PQJ A;  1LCT A;  2VP1 A;  3TDJ A;  4F3S A;  3FVN A;  3PMX A;  4NF8 A;  4F29 A;  2F8D A;  1H43 A;  1B0H A;  1PDA A;  1Y4C A;  1MQI A;  2DWH A;  2I6E A;  3SDF A;  2XXP A;  4U23 A;  4U2R A;  2GHB A;  2PYY A;  1M5E A;  4L17 A;  5ISU A;  2I0C A;  1JVY A;  3OSQ A;  2Z8E A;  2UVJ A;  2ZYM A;  3HPI A;  3IR1 A;  4RYA A;  4JWY A;  1JW1 A;  4OEV A;  3Q28 A;  3KZG A;  3KJT A;  3K6V A;  3R26 A;  4IO7 A;  1LST A;  4G68 A;  1FCK A;  2H9B A;  4ZE9 A;  4ISU A;  1ZLQ A;  1ZKB A;  2Y7R A;  3IB2 A;  2P1S A;  3R7X A;  4YB6 A;  5CC2 A;  3OEL A;  1IXG A;  1N7X A;  3P7I A;  1PBQ A;  4R74 A;  3QK6 A;  3EPE A;  3FUZ A;  3ZKL A;  5AA3 A;  3R6U A;  1SW4 A;  2HZK A;  3KSX A;  4KCD A;  4KQP A;  4ESW A;  4F1Y A;  1GVC A;  4MBP A;  3U8Q A;  1VFD A;  2AL5 A;  2B3B A;  2I58 A;  3K01 A;  3SEW A;  2I3W A;  5I59 A;  3ZSF A;  1GTK A;  2XXQ A;  1URS A;  4GL0 A;  1UIV A;  1H3D A;  1Y1Z A;  4HCW A;  4QSC A;  1OQG A;  4JB7 A;  4OER A;  4RNS A;  3RQT A;  4YU0 A;  2XX7 A;  3TCG A;  1USY H;  4MF3 A;  1PEB A;  3KOT A;  3K4U A;  4NF6 B;  1B1H A;  3H03 A;  1B6H A;  3MBP A;  3PPO A;  4U1O A;  4IGT A;  3M3F A;  4GF8 A;  1TXF A;  2R9J A;  4H65 A;  3CSB A;  4JSD A;  1EH3 A;  2PT2 A;  3FD3 A;  1M5B A;  2O7I A;  2QS2 A;  2OWT A;  1FQF A;  3C31 A;  3OSR A;  5DT6 A;  4GXA A;  5H8H B;  5I2N B;  1NNP A;  4ZEF A;  4WED A;  4AQ4 A;  2E0S A;  2REG A;  1QJM A;  3B6T A;  2A5S A;  3FXU A;  4HS7 A;  1MXZ A;  1SVX B;  4FED A;  1L5T A;  4ND9 A;  3UK4 A;  3VVE A;  3K2D A;  4ELR A;  4JBZ A;  5B7D A;  1SYI A;  4R2B A;  2DVC A;  4KYD A;  4EDP A;  1LLS A;  1PB7 A;  1I6B A;  1CB6 A;  4X1D A;  3IAZ A;  3TCF A;  3THI A;  1IUD A;  3MVW A;  5ITO A;  3OEK A;  5ITP A;  3SES A;  1XS5 A;  4ZED A;  4OET A;  3JV9 A;  1GV8 A;  2IA4 A;  3DLN A;  4ZEI A;  3S2V A;  1NH7 A;  4X48 A;  1R1N A;  1B7U A;  3UGW A;  3PGF A;  1IXC A;  3PMW A;  2OWS A;  3FZV A;  4NE4 A;  3FJG A;  4H5G A;  1B7Z A;  1B52 A;  2UVH A;  4PFW A;  5FHM A;  5TP9 B;  3ILU B;  4KPT A;  3T9H B;  3KN7 A;  3N94 A;  2PX1 A;  3ODB A;  4GXS B;  1B3F A;  3CG3 A;  4LAT A;  3MP6 A;  1FTK A;  2A5T B;  4GVO A;  2UVI A;  4BDQ A;  1BLF A;  1IXH A;  3H3G A;  3LUY A;  1MPB A;  3MPK A;  4PFT A;  1MXU A;  4NWD A;  4BDN A;  1NMU A;  5J1D A;  3TEP A;  2HEU A;  1ZJL A;  4RPN A;  5CMB A;  3RT6 B;  3MQ9 A;  4IGR A;  1WVJ A;  4TLM B;  4X9T A;  1IQ7 A;  1P1U A;  2V25 A;  3OEM A;  1YCJ A;  1B5I A;  3MP8 A;  4NF5 B;  1ELJ A;  1PB8 A;  3E9X A;  4GOT A;  1JW5 A;  4OVJ A;  1I6Q A;  1XOC A;  3A3U A;  4FE8 A;  2DXR A;  4R6Y A;  1F9B A;  2AL4 A;  1H45 A;  3MWB A;  4QFP A;  4THI A;  4YB5 A;  3TQW A;  2G29 A;  3CI8 A;  2RCA A;  1EU8 A;  5L9O A;  3PUZ E;  5KDT B;  5AA1 A;  5DEX B;  4R73 A;  3H6T A;  2NWJ A;  3V83 A;  3PPQ A;  1DPP A;  1P1O A;  3IOT A;  1MQJ A;  2RC8 A;  3OD7 A;  3MZ9 A;  4F18 A;  4Z7E A;  3IOU A;  4OYV A;  4RXL A;  4ZEC A;  2PVU A;  1MM7 A;  3H6V A;  2UYF A;  3IOR A;  3TTR A;  4JDF A;  4Q0C A;  3MP1 A;  3SEX A;  5DVF A;  3UIF A;  4PET A;  5DEX A;  1S7Y A;  3GZG A;  1MXW A;  4F2O A;  2HZL A;  3FAS A;  3UN6 A;  1JW4 A;  1Q1K A;  3G3J A;  2XX9 A;  5HPQ A;  2AIX A;  3KFM A;  1OIB A;  4ECF A;  1B05 A;  2DE4 A;  4IY6 A;  4PE5 B;  4RY1 A;  1RYX A;  2A5T A;  1ZIU A;  3F11 A;  3KOS A;  4EXL A;  2OZZ A;  3H6W A;  5FTI A;  1NNF A;  2P0S A;  1B9J A;  1SBP A;  2XHD A;  1DPE A;  4Q5T A;  2ONK E;  3CR9 A;  3M3K A;  1RYO A;  4IB2 A;  2RIN A;  4LON B;  2QS3 A;  4XKQ A;  4DCX A;  5I84 A;  2UXA A;  1MRP A;  4GQO A;  4PFU A;  3OO9 A;  5CMM A;  1A40 A;  3EQ1 A;  4FEB A;  1MG1 A;  2Q89 A;  2H98 A;  4I8C A;  4G8N A;  1DMB A;  1TWY A;  2H99 A;  4H6D A;  1PC3 A;  3JZJ A;  2UVG A;  3PMV A;  1GGG A;  1USY E;  3HST A;  5H8N A;  2ANJ A;  1R9Q A;  2OCU A;  2V3Q A;  4NF6 A;  3SKP A;  2OBG A;  5I2K B;  4EUO A;  2Y7I A;  3O6H A;  2DSF A;  2ZYK A;  4HTG A;  5JTY A;  1B3L A;  2PT1 A;  4FAJ A;  2XXT A;  1P99 A;  3C35 A;  1NNK A;  3C4M A;  1SW1 A;  3RGY A;  1B1X A;  1JNF A;  3DEL B;  3G3I A;  3T9U A;  1O64 A;  5JTY B;  1D9V A;  1OLA A;  4QSD A;  3TTN A;  5H8N B;  2DP8 A;  1LB9 A;  1JEU A;  4H1X A;  4OFJ A;  1B3H A;  1QKB A;  1R9L A;  2F5X A;  3C9H A;  1LB8 A;  5H8H A;  3QUJ A;  5I2N A;  3IL1 B;  1UTH B;  4G2Z A;  3KJ7 A;  4F3G A;  3DP6 A;  2Q9T A;  3MJN A;  4DXU A;  4POW A;  5TPA B;  4F3B A;  3BFT A;  2DWI A;  3VVD A;  3S9E A;  1MXY A;  1N0T A;  1AMF A;  3G3G A;  3HO7 A;  4R72 A;  2F36 A;  3B7D A;  3IJX B;  3LBS A;  3K1M A;  4GRK A;  1US5 A;  2QJE A;  1POT A;  1URD A;  3O97 A;  1P1W A;  3C33 A;  3TCH A;  1O63 A;  3VXC A;  4GIZ A;  1JVX A;  3OMB A;  3PV0 E;  4K3F A;  3B6W A;  1XVY A;  4HW8 A;  3N5L A;  1LFH A;  2VOZ A;  3IK6 B;  3QIM A;  3EHT A;  3QAX A;  5H8Q B;  5IKB A;  2RF1 A;  1VR5 A;  3FXQ A;  3KEI A;  3PD8 A;  3FV1 A;  4MH5 A;  1FQA A;  4QFO A;  3RUM A;  1IIW A;  1H44 A;  1MQH A;  1OMP A;  1B46 A;  4U4S A;  1N7W A;  2F7C A;  1VSO A;  4R75 A;  4KR5 A;  2RC7 A;  5DVI A;  1FTL A;  1S50 A;  1SI1 A;  4DXC A;  3LSX A;  1BP5 A;  4OTE A;  3U1O A;  2XD3 A;  3Q25 A;  2LAO A;  1Y3Q A;  3B6Q A;  3Q26 A;  4QFN A;  4ZEK A;  4BDM A;  2DWJ A;  1LAX A;  4R6H A;  3C34 A;  3CFL A;  3GXA A;  3FXR A;  3PPP A;  2UYE A;  4ZZE A;  3V8X B;  3MUQ A;  1WDN A;  1Y9U A;  3O6G A;  2DE3 A;  4DIG A;  3A3C A;  3BBR A;  2GFE A;  1KWH A;  3E4R A;  2VGQ A;  4M1V A;  4NMY A;  3HCQ A;  3TUS A;  2G93 A;  1US4 A;  1UTH A;  2R6G E;  2ZYN A;  3G3K A;  5A5X B;  4YKJ A;  3W9V A;  3KGC A;  2O84 X;  2BJJ X;  5IAI A;  3A09 A;  2D3I A;  4WEP A;  1YTV A;  4DCY A;  2W7Y A;  3LSL A;  1Q35 A;  5ELV A;  2HCA A;  4R2F A;  3IOV A;  5CMC A;  3EF7 A;  1B3G A;  5FTH A;  1FQE A;  3SET A;  5BWJ A;  3IJO B;  2X26 A;  5I2K A;  3TTL A;  4PP0 A;  4TOZ A;  1BIY A;  4G8H A;  3FVK A;  4KD5 A;  3GBA A;  1QUK A;  2V3T A;  4R6K A;  3ZKK A;  4IO2 A;  2ZNU A;  2FYI A;  2QPQ A;  4OEU A;  3OO6 A;  2FA7 A;  3RTF B;  2DYX A;  5EHS A;  1YAE A;  3G3F A;  5DTB A;  1POY 1;  4YKK A;  3VLV A;  5I58 A;  4YIC A;  3FV2 A;  2ZNT A;  4XKN A;  1JQF A;  1A8E A;  2PBW A;  3DP4 A;  5DYH A;  3K00 A;  3O9P A;  5AA4 B;  1QVS A;  2QL3 A;  4IO4 A;  3MVX A;  5KCJ B;  5TPA A;  4ZZA A;  3UOR A;  4F19 A;  2B3F A;  4H8I A;  1UIU A;  1ZBM A;  4OES A;  3T93 B;  3VXB A;  2QS1 A;  2ZNS A;  1P1Q A;  3FGS A;  4N13 A;  4NTL A;  4O3A A;  4OFL A;  3T66 A;  1Y3P A;  2RKM A;  4OZ9 A;  3OOA A;  3O66 A;  4DDD A;  1QW0 A;  4QF9 A;  2O7U A;  4ZDM A;  3WAF A;  2DWA A;  4OXV A;  3K1N A;  1IIT A;  1SW2 A;  3V89 B;  2DXY A;  4BDL A;  4BDO A;  5JEI A;  3IX1 A;  5H8S A;  3TMG A;  1UTB B;  4XTC Q;  1TT1 A;  3K0V A;  4R9F A;  1DSN A;  1RKM A;  2QRY A;  3OO8 A;  4GL8 A;  4LUB A;  1O7T A;  5JK4 A;  3QUF A;  2XXI A;  3PUV E;  1WOD A;  4M4G A;  2P2A A;  4G77 A;  1EZ9 A;  2Y7K A;  4IO6 A;  1B2H A;  3T22 A;  3WAE A;  4BLA A;  4F3P A;  1MY0 A;  3L6G A;  4F1V A;  2I4C A;  3ILT B;  3TTK A;  5FHO A;  3H6U A;  2O68 A;  4RJZ A;  4HCY A;  4NF4 A;  4XKR A;  3VLW A;  2HXW A;  4LP2 B;  4KYS A;  2ESN A;  3IB1 A;  4IO5 A;  1FTO A;  3PD9 A;  2Z8F A;  4FIM A;  4ELO A;  3S4U A;  3D4G A;  4EQ7 A;  4YZZ A;  1Z7N E;  4NWC A;  3TEL A;  4GWO A;  2Z23 A;  1BTJ A;  1DOT A;  1SDX A;  1Y20 A;  2XXR A;  3FVO A;  4G68 B;  3SEU A;  1B5J A;  3SER A;  4F39 A;  1B4Z A;  2ABH A;  5L9S A;  2I3V A;  2HAU A;  3N6U A;  4GFR A;  5EHM A;  1PB9 A;  2VD2 A;  1QUL A;  3MAM A;  4JWX A;  2OLB A;  2NUV A;  2XXU A;  2B65 A;  1TFA A;  2Y7P A;  3G7W A;  1YPN A;  3O29 A;  4NF5 A;  3FJ7 A;  3PU5 A;  4U21 A;  4YAH X;  4RPO A;  1QUJ A;  3SEV A;  2VHA A;  5AA2 B;  5KZT A;  3VDF A;  4JWO A;  4YKI A;  3K6W A;  4AB5 A;  4DE8 A;  2OK2 A;  2YJP A;  4O3B A;  2RC9 A;  1QUI A;  4NF4 B;  3KN3 A;  1LBC A;  1MY3 A;  3QYT A;  4LZ7 A;  4WKM A;  2F7B A;  2I4B A;  3K6U A;  2D5W A;  4LA9 A;  3K6X A;  4Q30 B;  2ONR A;  1LCF A;  4LZ8 A;  4EQB A;  1FW0 A;  1VFE A;  5TU0 A;  4LQ2 A;  3TYH A;  2DOJ A;  3PUW E;  1LGB C;  3KG2 A;  3VV5 A;  3IO4 A;  4KFQ A;  1MDP 1;  1MM6 A;  2I48 A;  1BKA A;  3N26 A;  3T9V A;  2AYS A;  5EYF A;  3BFU A;  5H8F B;  2Q8J A;  3UA8 A;  5AE4 A;  4ONY A;  1TFD A;  1Z7M E;  4G68 C;  3UP9 A;  4JXI A;  1MS7 A;  4OHN A;  3V5A A;  3PPN A;  2NVU B;  4UA8 A;  3GLB A;  5TP9 A;  1CE2 A;  1FQB A;  4R9G A;  2ZXT A;  3Q27 A;  2O1M A;  4WXJ A;  1B0L A;  4RA1 A;  1LBB A;  2HQ0 A;  4H5F A;  4P11 A;  1DTG A;  1NL5 A;  3O2A A;  3U72 A;  5I56 B;  5HBC A;  1IXI A;  4U22 A;  1D4N A;  2YLN A;  3KSJ A;  2CMO A;  2F7A A;  4JSO A;  2F78 A;  3E13 X;  1IEJ A;  1MQG A;  2XX8 A;  5CBS A;  2F97 A;  1I69 A;  2XD2 A;  4KI0 E;  5CMK A;  3L6H A;  3CFX A;  1H76 A;  4FJP A;  2Q2C A;  1LFG A;  3GBB A;  1MXX A;  3G3H A;  4OWD A;  5CI5 A;  3MPL A;  5F7V A;  3CFZ A;  1MY2 A;  4RK9 A;  3IB0 A;  4G4P A;  2WKY A;  3CVG A;  4EF2 A;  4YMB A;  3N6T A;  3PUY E;  1MH4 A;  4LQ5 A;  2ONS A;  3TPA A;  5AA4 A;  4C0R A;  4EXK A;  3JYR A;  3EN3 A;  4I1D A;  4UAC A;  3DM0 A;  1IZ1 A;  4FAT A;  2XXX A;  3MZB A;  2F6P A;  4FOR A;  1II5 A;  5I58 B;  3FIR A;  1Y1M A;  2F34 A;  3VLU A;  5B70 A;  4F1U A;  3MZ1 A;  3DP8 A;  1D3K A;  3H4Z A;  1A99 A;  1B40 A;  2Z22 A;  2RCB A;  3D4C A;  1M5F A;  3BKI B;  4POX A;  3HHG A;  4X1B A;  3EHS A;  2ALU A;  3T9X B;  3EHU A;  3RPW A;  1ATG A;  2Q88 A;  5AA2 A;  1LAH E;  3K02 A;  3KBR A;  1LAF E;  3FVG A;  4DLD A;  4P0I A;  1NKX A;  1MY1 A;  4N07 A;  1N76 A;  4XXU A;  4OMB A;  3U93 A;  4O3C A;  3S9L C;  2Y84 A;  1FTM A;  4PFY A;  3VE1 B;  5I59 B;  1B58 A;  3CIJ A;  3HV1 A;  3TZA A;  1HSJ A;  5KDT A;  3OEN A;  1NFT A;  3RTW B;  4DZ1 A;  1NNT A;  2VD3 A;  4IY5 A;  4U1Z A;  3RNN A;  3USD A;  5H8F A;  5ICQ A;  4TLL B;  1LAG E;  1OQH A;  2I0B A;  5CBR A;  5A5X A;  1SD3 A;  1B4H A;  5M2V A;  3QSL A;  3TFL A;  5K2X A;  1J1N A;  1OLC A;  4ESX A;  1SQY A;  2XXY A;  3H7M A;  3CSG A;  2E1S A;  2X7P A;  1AH5 A;  2ZYO A;  3K1P A;  4QRZ A;  5DVJ A;  1URG A;  2V3U A;  3KN8 A;  4FEC A;  3U94 A;  4NF8 B;  5F1Q A;  4KHZ E;  1MH3 A;  1M5C A;  5ICT A;  3RLF E;  4YKP A;  1FTJ A;  1HSL A;  1B32 A;  2Q2A A;  1N04 A;  1ANF A;  1OVB A;  4MFI A;  1MQD A;  3IO6 A;  1P1N A;  4AB6 A;  4DXB A;  4YMA A;  2REJ A;  1AL3 A;  4TQU Q;  3ONM A;  2I49 A;  2FNC A;  4ELP A;  3I6V A;  4H0W A;  1A7L A;  1B5H A;  4E0W A;  1UQW A;  3M3L A;  1M5D A;  1AOV A;  5L8D A;  1N3W A;  2Y7W A;  5HM4 B;  1A54 A;  1SYH A;  4H67 A;  1OVT A;  3OO7 A;  4MLQ A;  4ZS9 A;  5H8Q A;  1LFI A;  2XXW A;  3CRB A;  3TQL A;  2THI A;  3E3K A;  2F35 A;  1MY4 A;  3MW0 A;  4QSE A;  3TKD A;  4C1U A;  1ZU0 A;  4ZEB A;  3S9M C;  2XXV A;  4GLI A;  3MC2 A;  5AA2 D;  4LZ5 A;  4YB7 A;  1N84 A;  2O6A A;  3HN0 A;  4QFK A;  5CRY A;  1ZTY A;  1XVX A;  2ZMB A;  3CG1 A;  4N6P A;  5I57 B;  1AIV A;  3H06 B;  2Z8D A;  2QSX A;  2GRV A;  3OXN A;  4I9D A;  1UTB A;  4MLV A;  2GH9 A;  4BDR A;  1A55 A;  4LVQ A;  4OEN A;  1VE4 A;  3O6I A;  3RY3 A;  2M8C A;  2O51 A;  4XIG Q;  4E0X A;  3PUX E;  4C1T A;  3S9N C;  5BUU A;  3HHF A;  1DTZ A;  2DVZ A;  1PBP A;  2KLF A;  3T96 B;  1SI0 A;  4H8J A;  4F31 B;  5KCJ A;  1I6A A;  3VFJ A;  1MPD A;  1HSE A;  1EZO A;  1Y3N A;  4XKP A;  1Y4T A;  1XC1 A;  2NOO A;  2XXH A;  5FHN A;  3VVF A;  1ZMG A;  4QFL A;  3TAJ A;  1T0K A;  4Q8R A;  4F2Q A;  2H5Y A;  3LSF B;  2DS9 A;  4EQ9 A;  1B3E A;  4QHQ A;  2QS4 A; 
#chains in the Genus database with same CATH topology
 1K9Z A;  4Z0I A;  3O28 A;  1NH8 A;  4MAG A;  3ZS6 A;  3FAT A;  1SW5 A;  5K2Y A;  2NXO A;  5I56 A;  4EF1 A;  2V93 A;  4NG7 A;  4KYE A;  4GWZ A;  2HFB A;  1MDQ A;  3LR1 A;  3TOD A;  1FQC A;  4PBQ A;  2QVU A;  4F29 A;  1B0H A;  1Y4C A;  3SDF A;  1LBW A;  4NX1 A;  2XXP A;  5ISU A;  2GHB A;  2UVJ A;  4OEV A;  4N17 A;  3K6V A;  2H9B A;  4ZE9 A;  2Y7R A;  5EQ7 A;  3R7X A;  1N7X A;  4R74 A;  3QK6 A;  3FUZ A;  1LBZ A;  3U8Q A;  2B3B A;  2I58 A;  2WBD A;  1URS A;  4QSC A;  1OQG A;  4YU0 A;  2XX7 A;  1USY H;  1PEB A;  3KOT A;  4NF6 B;  1B6H A;  3MBP A;  3PPO A;  5IM2 A;  4IGT A;  3M3F A;  4GF8 A;  1EH3 A;  2QS2 A;  3C31 A;  4PTK A;  4N6D A;  2REG A;  3FXU A;  5KCJ A;  1LLS A;  3IAZ A;  3TCF A;  3MVW A;  5ITP A;  1GV8 A;  2IA4 A;  1NUX A;  3DLN A;  4NE4 A;  3FJG A;  4YMA A;  3T9H B;  3KN7 A;  4GXS B;  3ODB A;  4LAT A;  2B4M A;  1FTK A;  2A5T B;  2UVI A;  1D9Q A;  4PFT A;  3MPK A;  1NMU A;  3OEM A;  1ELJ A;  3RT8 A;  1XOC A;  1H45 A;  3TQW A;  4YB5 A;  5L9O A;  3H6T A;  4GBW A;  4NF0 A;  3IOT A;  1MQJ A;  2RC8 A;  4F18 A;  3TTR A;  2PCR A;  2UYF A;  2WYK A;  3MP1 A;  4F2O A;  2HZL A;  1JW4 A;  2OX3 A;  3KFM A;  4RY1 A;  4PE5 B;  1RYX A;  5A5L A;  4EXL A;  2OZZ A;  3T0J A;  1NNF A;  2P0S A;  1B9J A;  1DPE A;  4Q5T A;  1RYO A;  4PGP A;  5I84 A;  4QXD A;  4G8N A;  1DMB A;  1TWY A;  1PC3 A;  3PMV A;  2UVG A;  5ICQ A;  2ANJ A;  1R9Q A;  2OCU A;  3SKP A;  2OBG A;  2XXT A;  3C35 A;  3C4M A;  3DEL B;  1O64 A;  1D9V A;  1OLA A;  5H8N B;  1JEU A;  1B3H A;  4N91 A;  5H8H A;  1KA0 A;  1UTH B;  4G2Z A;  3KJ7 A;  4F3B A;  3BFT A;  2DWI A;  3S9E A;  1MXY A;  2F36 A;  3B7D A;  1POT A;  3TCH A;  3VXC A;  2XWI A;  1LFH A;  3EHT A;  3QAX A;  2RF1 A;  1NUZ A;  3FV1 A;  4P1E A;  1B46 A;  2PFZ A;  1S50 A;  2XD3 A;  3Q25 A;  4ZEK A;  1Y3Q A;  3Q26 A;  2VPN A;  3C34 A;  4H46 A;  3A29 A;  4AS5 A;  3O6G A;  2DE3 A;  4DIG A;  1KWH A;  5I7I A;  4NMY A;  1UTH A;  5A5X B;  5IAI A;  3A09 A;  4WEP A;  1IMC A;  4X04 A;  4R2F A;  5FTH A;  5BWJ A;  2QVV A;  1BIY A;  4OVQ A;  3FVK A;  1QUK A;  3ZKK A;  2ZNU A;  2CZK A;  1POY 1;  3FV2 A;  1NV3 A;  5DYH A;  2PBW A;  3MVX A;  1UIU A;  3T66 A;  4NTL A;  4PDH A;  4OZ9 A;  3OOA A;  3IFA A;  1SW2 A;  3V89 B;  2DXY A;  4BDO A;  3E78 A;  4XTC Q;  3K0V A;  1DSN A;  3OO8 A;  1WOD A;  4IO6 A;  1NV4 A;  1BK4 A;  4F3P A;  5FHO A;  2O68 A;  4KYS A;  1FTO A;  4FIM A;  4NHB A;  2XWK A;  2Z23 A;  2XXR A;  4PAK A;  1FJ6 A;  2ABH A;  2HAU A;  1IMA A;  3N6U A;  4HE1 A;  2VD2 A;  1QUL A;  2Q8M A;  4JWX A;  3G7W A;  4NF5 A;  3FJ7 A;  2VHA A;  5AA2 B;  3K6W A;  4AB5 A;  4O3B A;  4WKM A;  1DBZ A;  2D5W A;  3K6X A;  2ONR A;  4LZ8 A;  4EQB A;  4GX4 A;  2P3V A;  5TU0 A;  3KG2 A;  2AYS A;  4MHF A;  5H8F B;  5AE4 A;  4OHN A;  3Q27 A;  1B0L A;  1LBB A;  4JSO A;  3KSJ A;  2XD2 A;  2QFL A;  4KI0 E;  5CMK A;  4N6K A;  1MY2 A;  4G4P A;  4EF2 A;  4YMB A;  4EXK A;  4PCD A;  4I1D A;  4JVD A;  3DM0 A;  4GWS A;  1FPJ A;  2F6P A;  4FOR A;  5B70 A;  2F34 A;  3PTY A;  1A99 A;  2Z22 A;  4JVI A;  4POX A;  3T9X B;  3HHG A;  3K02 A;  3KBR A;  1NV0 A;  4XXU A;  1N76 A;  3U93 A;  4PFY A;  5I59 B;  3HV1 A;  5KDT A;  3OEN A;  3RTW B;  4DZ1 A;  1NNT A;  5H8F A;  4TLL B;  1B4H A;  3ROJ A;  3CSG A;  3K1P A;  1URG A;  3KN8 A;  3U94 A;  3B8B A;  1M5C A;  4YKP A;  3T1B A;  1HSL A;  2Q2A A;  5ET6 A;  1N04 A;  1ANF A;  3IO6 A;  4TQU Q;  4NN3 A;  3ONM A;  3I6V A;  3M3L A;  5H8Q A;  3TQL A;  3MW0 A;  4C1U A;  4ZEB A;  3MC2 A;  4LZ5 A;  1AIV A;  2QSX A;  1YXI A;  2GRV A;  1UTB A;  1CNQ A;  2O51 A;  4E0X A;  5JK4 A;  1PBP A;  1SI0 A;  4H8J A;  1I6A A;  1MPD A;  4PBH A;  2NOO A;  5FHN A;  1T0K A;  3LSF B;  5EQA A;  1JEV A;  3W9W A;  4G8M A;  1IMD A;  3C32 A;  4U4X A;  3RN8 A;  3LC8 A;  3QXM A;  4ZE8 A;  1FQD A;  4KCC A;  3Q29 A;  1GR2 A;  1R6Z A;  1S9T A;  2DE2 A;  1MXV A;  3C36 A;  2V84 A;  1JET A;  3LV0 A;  3FJM A;  3MVZ A;  4NED A;  4MNP A;  2IEE A;  3SEY A;  3ECR A;  4I40 A;  3W15 C;  4I62 A;  5LDZ A;  4MJO A;  4PAI A;  4U2R A;  4L17 A;  1YYZ A;  3HPI A;  4RYA A;  3Q28 A;  2XA5 A;  4G68 A;  4N4U A;  1ZLQ A;  2P1S A;  3OEL A;  5AA3 A;  3KSX A;  2I3W A;  1GTK A;  2XXQ A;  1H3D A;  5IGA A;  4OER A;  3RQT A;  4MF3 A;  4U1O A;  1LBX A;  2R9J A;  4H65 A;  4JSD A;  4OVR A;  2O7I A;  1FQF A;  3OSR A;  5I2N B;  4ZEF A;  2E0S A;  3B6T A;  4PFR A;  1SVX B;  4I3Y A;  4ND9 A;  1NV2 A;  1I6B A;  1CB6 A;  1IUD A;  4KXP A;  4ZED A;  4OET A;  3JV9 A;  1NH7 A;  1B7U A;  3PMW A;  2OWS A;  4H5G A;  2UVH A;  5FHM A;  3ILU B;  1K9Y A;  1IMB A;  1RDY A;  4GVO A;  1BLF A;  5J1D A;  1ZJL A;  4TLM B;  1WVJ A;  1P1U A;  3QMF A;  3MP8 A;  3E9X A;  4OVJ A;  5DTB A;  2DXR A;  4R6Y A;  3MWB A;  2G29 A;  2RCA A;  1EU8 A;  5AA1 A;  4R73 A;  3H6V A;  1MM7 A;  4MX6 A;  1S7Y A;  1MXW A;  3UN6 A;  2XX9 A;  1OIB A;  1B05 A;  1DK4 A;  4IY6 A;  1ZIU A;  3F11 A;  3KOS A;  2XHD A;  2ZZX A;  2ONK E;  4IB2 A;  2RIN A;  4N15 A;  1MRP A;  4PFU A;  3OO9 A;  1A40 A;  4FEB A;  2Q89 A;  1G0H A;  1FSA A;  1USY E;  4NF6 A;  1FJ9 A;  3O6H A;  2DSF A;  2ZYK A;  1B3L A;  1P99 A;  1B1X A;  3G3I A;  3T9U A;  3TTN A;  2DP8 A;  3BIH A;  1R9L A;  3C9H A;  1LB8 A;  3IL1 B;  4F3G A;  3DP6 A;  3ISP A;  2Q9T A;  3MJN A;  2CZH A;  4P1L A;  2CZI A;  3G3G A;  3IJX B;  4GRK A;  3U65 A;  1NV6 A;  1JVX A;  4K3F A;  2Q74 A;  3N5L A;  5H8Q B;  5IKB A;  3FXQ A;  3PD8 A;  4MH5 A;  1H44 A;  1OMP A;  4U4S A;  1N7W A;  4KR5 A;  2RC7 A;  1BP5 A;  2LAO A;  3B6Q A;  4R6H A;  3V8X B;  3MUQ A;  2GFE A;  2G93 A;  3FBP A;  3KGC A;  2D3I A;  4O7I A;  4FBP A;  3IJO B;  2X26 A;  4PP0 A;  4TOZ A;  2QVR A;  4G8H A;  4R6K A;  4OEU A;  2QPQ A;  3OO6 A;  1YAE A;  3G3F A;  5I58 A;  4YIC A;  4H45 A;  4XKN A;  3O9P A;  5AA4 B;  5ET8 A;  2QL3 A;  3D1R A;  5KCJ B;  1ZBM A;  4OES A;  4GBV A;  4OFL A;  3O66 A;  3K1N A;  1IIT A;  3GYY A;  3IX1 A;  4PGN A;  2QRY A;  4GL8 A;  4LUB A;  1O7T A;  4O8M A;  3PUV E;  2FBP A;  2P2A A;  1EZ9 A;  4LN5 A;  2HHM A;  4HCY A;  4NF4 A;  2HXW A;  3PD9 A;  2Z8F A;  4NWC A;  3SER A;  3SEU A;  3CHG A;  1B4Z A;  5L9S A;  2I3V A;  3RPL A;  4GFR A;  5EHM A;  3MAM A;  2NUV A;  5DVI A;  2B65 A;  4U21 A;  3PU5 A;  5KZT A;  4DE8 A;  2CEX A;  2YJP A;  2RC9 A;  1MY3 A;  3QYT A;  4LZ7 A;  2B4L A;  1NI9 A;  2GQ1 A;  1LCF A;  4Q30 B;  1FW0 A;  2HPG A;  3IO4 A;  2FVZ A;  3T9V A;  1NV1 A;  1FBD A;  3UP9 A;  1CE2 A;  1FQB A;  2O1M A;  4WXJ A;  4P11 A;  1NL5 A;  3O2A A;  3U72 A;  4U22 A;  2YLN A;  1FPE A;  2F7A A;  1IEJ A;  2WKY A;  3CVG A;  4LQ5 A;  4MNC A;  4GWY A;  4FAT A;  2XXX A;  1II5 A;  5I58 B;  3FIR A;  3VLU A;  4F1U A;  3MZ1 A;  3H4Z A;  3D4C A;  4X1B A;  2ALU A;  2Q88 A;  1LAF E;  1NKX A;  4OA4 A;  4OMB A;  4O3C A;  2Y84 A;  5K2X A;  1J1N A;  1OLC A;  4ESX A;  3H7M A;  2XXY A;  4PF8 A;  2X7P A;  2OWZ A;  5DVJ A;  2V3U A;  5F1Q A;  4KHZ E;  1FTJ A;  1OVB A;  4AB6 A;  4DXB A;  3RYD A;  1UQW A;  1N3W A;  2DDK A;  1OVT A;  4ZS9 A;  1LFI A;  2VT5 A;  2XXW A;  3CRB A;  2BJI A;  3E3K A;  3TKD A;  3S9M C;  4GLI A;  1FBE A;  1N84 A;  2O6A A;  5I57 B;  1XVX A;  4PFI A;  4P3L A;  4BDR A;  1A55 A;  4LVQ A;  1VE4 A;  3RY3 A;  3HHF A;  1DTZ A;  4N81 A;  2XWV A;  1INP A;  4XKP A;  4QFL A;  2H5Y A;  2DS9 A;  5L9M A;  2OJT A;  3I5O A;  1FBF A;  2F3B A;  3U92 A;  1N3X A;  2PMS A;  4ELQ A;  4GD5 A;  2H25 A;  1MPC A;  3TTM A;  5I57 A;  1B51 A;  4JVC A;  1XHY A;  4DI3 D;  2CZL A;  1QKA A;  4F22 A;  1D9Y A;  4F3S A;  1LCT A;  1LEV A;  3PMX A;  4NF8 A;  2F8D A;  2JJK A;  3VXB A;  1MQI A;  2DWH A;  1M5E A;  2I0C A;  1JVY A;  3KBZ A;  2ZYM A;  3IR1 A;  4JWY A;  3KZG A;  3R26 A;  1LST A;  1FCK A;  1ZKB A;  5CC2 A;  1IXG A;  1SW4 A;  2HZK A;  4KCD A;  4F1Y A;  2L5V A;  4MBP A;  5T3J A;  1VFD A;  2AL5 A;  1NUY A;  1FPF A;  3SEW A;  5I59 A;  3ZSF A;  4GL0 A;  1UIV A;  4MMP A;  4HCW A;  4JB7 A;  4RNS A;  3TCG A;  1NV5 A;  3CSB A;  2PT2 A;  3FD3 A;  5DT6 A;  2OWT A;  5H8H B;  1NNP A;  1QJM A;  3EKI A;  3VVE A;  1L5T A;  3UK4 A;  4ELR A;  3K2D A;  4R2B A;  2DVC A;  4KYD A;  3OEK A;  1XS5 A;  4X48 A;  1LBV A;  5EQ8 A;  1IXC A;  5TP9 B;  1B7Z A;  1B52 A;  3N94 A;  2PX1 A;  1B3F A;  3CG3 A;  4BDQ A;  1IXH A;  3TEP A;  4BDN A;  1MXU A;  4I3E A;  4NWD A;  4RPN A;  4IGR A;  4X9T A;  1IQ7 A;  2V25 A;  4IR8 A;  1YCJ A;  1B5I A;  4NF5 B;  3THI A;  4QFP A;  3PUZ E;  5KDT B;  5DEX B;  3PPQ A;  1DPP A;  3OD7 A;  4Z7E A;  4RXL A;  4ZEC A;  2PVU A;  4JDF A;  4Q0C A;  4PET A;  3GZG A;  1VDW A;  5ET7 A;  1Q1K A;  3G3J A;  2AIX A;  4ECF A;  3H6W A;  5FTI A;  3CR9 A;  3M3K A;  4LON B;  4XKQ A;  2QS3 A;  3MYU A;  5CMM A;  5ESY A;  1MG1 A;  2H98 A;  2Y5K A;  4MNI A;  2H99 A;  4H6D A;  5EYH A;  3HST A;  5I2K B;  4HTG A;  5JTY A;  2PT1 A;  3RGY A;  1JNF A;  5F24 A;  4OFJ A;  1LB9 A;  4H1X A;  1QKB A;  2F5X A;  4DXU A;  5TPA B;  3VVD A;  1FPB A;  4R72 A;  3LBS A;  3K1M A;  2QJE A;  3O97 A;  1URD A;  1P1W A;  3C33 A;  2FIE A;  4GIZ A;  3OMB A;  1XVY A;  3QIM A;  4GX6 A;  1FBC A;  3RUM A;  4QFO A;  1VSO A;  1FTL A;  4DXC A;  3LSX A;  4OTE A;  3U1O A;  1RDZ A;  3SZP A;  4BDM A;  2DWJ A;  1LAX A;  3CFL A;  3GXA A;  2WX9 A;  3A3C A;  2VGQ A;  4M1V A;  3HCQ A;  3TUS A;  1US4 A;  2R6G E;  3NOH A;  2O84 X;  2BJJ X;  1YTV A;  5ELV A;  1NUW A;  3SET A;  4KD5 A;  3GBA A;  2V3T A;  4IO2 A;  2FA7 A;  3RTF B;  2DYX A;  5EHS A;  4YKK A;  3VLV A;  5IZ1 A;  4X8R A;  1A8E A;  3DP4 A;  4IO4 A;  2KQZ A;  2ZZW A;  5TPA A;  4ZZA A;  4H8I A;  3T93 B;  2QS1 A;  4O3A A;  1P1Q A;  2RKM A;  3WAF A;  2DWA A;  1UTB B;  1TT1 A;  1RKM A;  3QUF A;  5FBP A;  2XXI A;  4M4G A;  4G77 A;  3WAE A;  1B2H A;  4GWW A;  3L6G A;  2I4C A;  3TTK A;  2ESN A;  3IB1 A;  4IO5 A;  4ELO A;  4EQ7 A;  3D4G A;  4YZZ A;  3TEL A;  1BTJ A;  1DOT A;  1SDX A;  1Y20 A;  1B5J A;  3E79 A;  2OLB A;  4O7M A;  2XXU A;  1TFA A;  2Y7P A;  4UAB A;  4GWU A;  4JWO A;  4YKI A;  4NF4 B;  1QUI A;  1SPI A;  4LQ2 A;  3TYH A;  2DOJ A;  1LGB C;  2CEY A;  3VV5 A;  1MM6 A;  2I48 A;  1BKA A;  2Q8J A;  1TFD A;  4G68 C;  4JXI A;  1MS7 A;  3V5A A;  2NVU B;  4UA8 A;  2KR0 A;  5TP9 A;  5I3S A;  4R9G A;  2ZXT A;  4PC9 A;  1DTG A;  1IXI A;  2V4C A;  2CMO A;  3E13 X;  2XX8 A;  1I69 A;  3L6H A;  3CFX A;  4FJP A;  1MXX A;  3MPL A;  4OVP A;  3CFZ A;  3IB0 A;  4PDD A;  1EYI A;  2ONS A;  5AA4 A;  4C0R A;  4UAC A;  3MZB A;  4GWX A;  1Y1M A;  1D3K A;  1B40 A;  1M5F A;  3BKI B;  3EHU A;  2F3D A;  4PF6 A;  5AA2 A;  3FVG A;  4DLD A;  1MY1 A;  3S9L C;  2PFY A;  4OAN A;  1HSJ A;  1NFT A;  4U1Z A;  2I0B A;  2Y5L A;  5M2V A;  1RDX A;  4QRZ A;  1SQY A;  2E1S A;  2ZYO A;  1EYJ A;  1MH3 A;  3RLF E;  1B32 A;  1MQD A;  1P1N A;  2REJ A;  1AL3 A;  4ELP A;  2FNC A;  1AOV A;  5HM4 B;  1JP4 A;  1SYH A;  4H67 A;  4MLQ A;  5DW8 A;  1ZU0 A;  3MST A;  4PE3 A;  5CRY A;  2ZMB A;  3H06 B;  5IZ3 B;  3OXN A;  1LBY A;  4XIG Q;  4C1T A;  3S9N C;  5BUU A;  2WEF A;  1Y3N A;  1Y4T A;  1XC1 A;  2XXH A;  1QGX A;  1ZMG A;  1FBG A;  4EQ9 A;  4QHQ A;  4QBA A;  3PPR A;  2F6G A;  3I3V A;  2R71 A;  2WYP A;  4P0G A;  1A8F A;  1XT8 A;  2O69 A;  2X7Q A;  3M8U A;  4RK2 A;  3MVY A;  3AXF A;  2QMX A;  2GHA A;  2YPN A;  3LSW A;  2HAV A;  2O1L A;  2QMW A;  5CM6 A;  2H4I A;  2D21 A;  2DQV A;  1B7H A;  4IO3 A;  4OQO A;  5LOM A;  1EZP A;  3IOW A;  5LTC A;  3TDJ A;  4PQJ A;  2VP1 A;  3FVN A;  1H43 A;  1PDA A;  2I6E A;  4U23 A;  2PYY A;  3OSQ A;  2Z8E A;  1FPK A;  1JW1 A;  3KJT A;  4N8Y A;  4IO7 A;  4ISU A;  3IB2 A;  4YB6 A;  3P7I A;  1PBQ A;  3KC1 A;  3EPE A;  3B50 A;  3ZKL A;  3R6U A;  4ESW A;  4KQP A;  1GVC A;  3K01 A;  1Y1Z A;  3KC0 A;  3K4U A;  1B1H A;  3H03 A;  1TXF A;  1M5B A;  4GXA A;  4PFB A;  4WED A;  4AQ4 A;  2A5S A;  4HS7 A;  1MXZ A;  4FED A;  5B7D A;  4JBZ A;  1SYI A;  1KA1 A;  4EDP A;  1PB7 A;  4X1D A;  5ITO A;  4P8B A;  3SES A;  4ZEI A;  3S2V A;  3UGW A;  1R1N A;  1IMF A;  3PGF A;  3FZV A;  4PFW A;  4KPT A;  3MP6 A;  1FBP A;  3H3G A;  3LUY A;  1MPB A;  4HE2 A;  2HEU A;  5CMB A;  3RT6 B;  3MQ9 A;  4OVS A;  1NV7 A;  2P3N A;  1PB8 A;  4GOT A;  4ZDM A;  1JW5 A;  1I6Q A;  3A3U A;  4FE8 A;  1F9B A;  2AL4 A;  4THI A;  3CI8 A;  4G61 A;  2NWJ A;  1P1O A;  4OVT A;  3MZ9 A;  3IOU A;  4OYV A;  3IOR A;  3SEX A;  5DVF A;  3UIF A;  5DEX A;  3FAS A;  4P56 A;  5HPQ A;  2DE4 A;  2WBB A;  2A5T A;  1SBP A;  4DCX A;  2UXA A;  4GQO A;  2XWO A;  3EQ1 A;  4I8C A;  5IZZ A;  3JZJ A;  3IFC A;  1GGG A;  5H8N A;  4EUO A;  2V3Q A;  2Y7I A;  4FAJ A;  3HFU A;  1NNK A;  1SW1 A;  5I2K A;  5JTY B;  4QSD A;  5I2N A;  3QUJ A;  4XF5 A;  4POW A;  1N0T A;  1AMF A;  3HO7 A;  5IZ3 A;  5I5P A;  1US5 A;  4XFE A;  1O63 A;  3PV0 E;  3B6W A;  4HW8 A;  2VOZ A;  3IK6 B;  1VR5 A;  3KEI A;  1FQA A;  1IIW A;  1MQH A;  2F7C A;  4R75 A;  1SI1 A;  4QFN A;  4NAP A;  3FXR A;  3PPP A;  2UYE A;  4MCO A;  4ZZE A;  1WDN A;  1Y9U A;  3BBR A;  3E4R A;  2ZYN A;  3G3K A;  4YKJ A;  3W9V A;  1FPI A;  4DCY A;  2W7Y A;  2ZZV A;  3LSL A;  1Q35 A;  2MKZ A;  2FHY A;  2HCA A;  3IOV A;  5CMC A;  3EF7 A;  1B3G A;  4AS4 A;  1FQE A;  3TTL A;  1FPG A;  4NGU A;  5ET5 A;  1FTA A;  2FYI A;  1KZ8 A;  2ZNT A;  1JQF A;  3FXB A;  3K00 A;  1QVS A;  1YZ0 A;  3UOR A;  4F19 A;  2B3F A;  2ZNS A;  3FGS A;  4N13 A;  1Y3P A;  4DDD A;  1QW0 A;  4QF9 A;  2O7U A;  4OXV A;  4BDL A;  5JEI A;  5H8S A;  3TMG A;  4R9F A;  1DCU A;  2VPO A;  3LUZ A;  2Y7K A;  3T22 A;  4BLA A;  1MY0 A;  4F1V A;  3ILT B;  3H6U A;  4RJZ A;  4XKR A;  3VLW A;  2FIX A;  4LP2 B;  3S4U A;  1Z7N E;  4MEV A;  5J16 A;  4GWO A;  1G0I A;  4G68 B;  3FVO A;  4N8G A;  4F39 A;  4HE0 A;  1PB9 A;  4OFO A;  3V83 A;  1YPN A;  3O29 A;  4YAH X;  3SEV A;  4RPO A;  1QUJ A;  4P9K A;  3VDF A;  2OK2 A;  3KN3 A;  1LBC A;  2F7B A;  2I4B A;  3K6U A;  4LA9 A;  1VFE A;  4MIJ A;  3PUW E;  4KFQ A;  1MDP 1;  3N26 A;  5EYF A;  3BFU A;  1XI6 A;  4PAF A;  3UA8 A;  4ONY A;  1Z7M E;  1FPD A;  1Q9D A;  1FPL A;  3PPN A;  3GLB A;  4XEQ A;  4DI4 B;  3BIG A;  4RA1 A;  5I56 B;  2HQ0 A;  4H5F A;  5HBC A;  1D4N A;  2F78 A;  1MQG A;  5CBS A;  2F97 A;  4O94 A;  4P47 A;  1H76 A;  2Q2C A;  1LFG A;  5F7V A;  3GBB A;  3G3H A;  4OWD A;  5CI5 A;  4RK9 A;  3N6T A;  3PUY E;  1MH4 A;  3TPA A;  3JYR A;  3EN3 A;  1IZ1 A;  1FRP A;  3DP8 A;  2RCB A;  2XXK A;  3EHS A;  1EYK A;  1ATG A;  3RPW A;  1AWB A;  1LAH E;  4NQ8 A;  4P0I A;  4N07 A;  5EYG A;  1FTM A;  3VE1 B;  1B58 A;  3CIJ A;  3TZA A;  4GX3 A;  3RNN A;  2VD3 A;  4IY5 A;  4HXV A;  1LAG E;  1OQH A;  5CBR A;  5A5X A;  1SD3 A;  3QSL A;  3TFL A;  3USD A;  1AH5 A;  4FEC A;  4NF8 B;  5EQ9 A;  5ICT A;  1FBH A;  2R8T A;  4MFI A;  3RPL B;  2I49 A;  4H0W A;  1A7L A;  1B5H A;  4E0W A;  1M5D A;  5L8D A;  2Y7W A;  1A54 A;  3OO7 A;  2THI A;  4QSE A;  2F35 A;  1MY4 A;  2XXV A;  5AA2 D;  4YB7 A;  3HN0 A;  4QFK A;  1ZTY A;  3CG1 A;  4N6P A;  2Z8D A;  4I9D A;  4MLV A;  2GH9 A;  2HXR A;  4OEN A;  3O6I A;  2M8C A;  3PUX E;  2DVZ A;  2KLF A;  3T96 B;  4F31 B;  3VFJ A;  1HSE A;  1EZO A;  3VVF A;  3TAJ A;  1IME A;  4Q8R A;  4F2Q A;  1B3E A;  2QS4 A; 
#chains in the Genus database with same CATH homology
 5L9M A;  1JEV A;  2OJT A;  3PPR A;  2F6G A;  3I3V A;  3W9W A;  2R71 A;  4G8M A;  4Z0I A;  3O28 A;  3RT8 A;  3C32 A;  4P0G A;  1A8F A;  4U4X A;  1NH8 A;  3I5O A;  3RN8 A;  3LC8 A;  3ZS6 A;  1XT8 A;  3QXM A;  3FAT A;  4ZE8 A;  1FQD A;  1SW5 A;  2O69 A;  5K2Y A;  1EZP A;  4KCC A;  2X7Q A;  3Q29 A;  3M8U A;  2NXO A;  1GR2 A;  3U92 A;  4RK2 A;  5I56 A;  4EF1 A;  1R6Z A;  1S9T A;  3MVY A;  4OFO A;  2V93 A;  2QMX A;  3AXF A;  1N3X A;  2PMS A;  4ELQ A;  2DE2 A;  2GHA A;  2YPN A;  3LSW A;  2HAV A;  1MXV A;  4KYE A;  4GD5 A;  2O1L A;  2QMW A;  3C36 A;  2V84 A;  5CM6 A;  1JET A;  2H4I A;  2H25 A;  1MPC A;  2HFB A;  3FJM A;  3TTM A;  3MVZ A;  5I57 A;  1B51 A;  4NED A;  2D21 A;  1MDQ A;  1XHY A;  2IEE A;  3LR1 A;  2DQV A;  1B7H A;  2CZL A;  4IO3 A;  1QKA A;  3ECR A;  4OQO A;  3SEY A;  3TOD A;  5LOM A;  3IOW A;  3W15 C;  1FQC A;  4F22 A;  4I62 A;  1D9Y A;  4PQJ A;  1LCT A;  2VP1 A;  3TDJ A;  4F3S A;  3FVN A;  3PMX A;  4NF8 A;  4F29 A;  2F8D A;  1H43 A;  1B0H A;  1PDA A;  1Y4C A;  1MQI A;  2DWH A;  2I6E A;  3SDF A;  2XXP A;  4U23 A;  4U2R A;  2GHB A;  2PYY A;  1M5E A;  4L17 A;  5ISU A;  2I0C A;  1JVY A;  3OSQ A;  2Z8E A;  2UVJ A;  2ZYM A;  3HPI A;  3IR1 A;  4RYA A;  4JWY A;  1JW1 A;  4OEV A;  3Q28 A;  3KZG A;  3KJT A;  3K6V A;  3R26 A;  4IO7 A;  1LST A;  4G68 A;  1FCK A;  2H9B A;  4ZE9 A;  4ISU A;  1ZLQ A;  1ZKB A;  2Y7R A;  3IB2 A;  2P1S A;  3R7X A;  4YB6 A;  5CC2 A;  3OEL A;  1IXG A;  1N7X A;  3P7I A;  1PBQ A;  4R74 A;  3QK6 A;  3EPE A;  3FUZ A;  3ZKL A;  5AA3 A;  3R6U A;  1SW4 A;  2HZK A;  3KSX A;  4KCD A;  4KQP A;  4ESW A;  4F1Y A;  1GVC A;  4MBP A;  3U8Q A;  1VFD A;  2AL5 A;  2B3B A;  2I58 A;  3K01 A;  3SEW A;  2I3W A;  5I59 A;  3ZSF A;  1GTK A;  2XXQ A;  1URS A;  4GL0 A;  1UIV A;  1H3D A;  1Y1Z A;  4HCW A;  4QSC A;  1OQG A;  4JB7 A;  4OER A;  4RNS A;  3RQT A;  4YU0 A;  2XX7 A;  3TCG A;  1USY H;  4MF3 A;  1PEB A;  3KOT A;  3K4U A;  4NF6 B;  1B1H A;  3H03 A;  1B6H A;  3MBP A;  3PPO A;  4U1O A;  4IGT A;  3M3F A;  4GF8 A;  1TXF A;  2R9J A;  4H65 A;  3CSB A;  4JSD A;  1EH3 A;  2PT2 A;  3FD3 A;  1M5B A;  2O7I A;  2QS2 A;  2OWT A;  1FQF A;  3C31 A;  3OSR A;  5DT6 A;  4GXA A;  5H8H B;  5I2N B;  1NNP A;  4ZEF A;  4WED A;  4AQ4 A;  2E0S A;  2REG A;  1QJM A;  3B6T A;  2A5S A;  3FXU A;  4HS7 A;  1MXZ A;  1SVX B;  4FED A;  1L5T A;  4ND9 A;  3UK4 A;  3VVE A;  3K2D A;  4ELR A;  4JBZ A;  5B7D A;  1SYI A;  4R2B A;  2DVC A;  4KYD A;  4EDP A;  1LLS A;  1PB7 A;  1I6B A;  1CB6 A;  4X1D A;  3IAZ A;  3TCF A;  3THI A;  1IUD A;  3MVW A;  5ITO A;  3OEK A;  5ITP A;  3SES A;  1XS5 A;  4ZED A;  4OET A;  3JV9 A;  1GV8 A;  2IA4 A;  3DLN A;  4ZEI A;  3S2V A;  1NH7 A;  4X48 A;  1R1N A;  1B7U A;  3UGW A;  3PGF A;  1IXC A;  3PMW A;  2OWS A;  3FZV A;  4NE4 A;  3FJG A;  4H5G A;  1B7Z A;  1B52 A;  2UVH A;  4PFW A;  5FHM A;  5TP9 B;  3ILU B;  4KPT A;  3T9H B;  3KN7 A;  3N94 A;  2PX1 A;  3ODB A;  4GXS B;  1B3F A;  3CG3 A;  4LAT A;  3MP6 A;  1FTK A;  2A5T B;  4GVO A;  2UVI A;  4BDQ A;  1BLF A;  1IXH A;  3H3G A;  3LUY A;  1MPB A;  3MPK A;  4PFT A;  1MXU A;  4NWD A;  4BDN A;  1NMU A;  5J1D A;  3TEP A;  2HEU A;  1ZJL A;  4RPN A;  5CMB A;  3RT6 B;  3MQ9 A;  4IGR A;  1WVJ A;  4TLM B;  4X9T A;  1IQ7 A;  1P1U A;  2V25 A;  3OEM A;  1YCJ A;  1B5I A;  3MP8 A;  4NF5 B;  1ELJ A;  1PB8 A;  3E9X A;  4GOT A;  1JW5 A;  4OVJ A;  1I6Q A;  1XOC A;  3A3U A;  4FE8 A;  2DXR A;  4R6Y A;  1F9B A;  2AL4 A;  1H45 A;  3MWB A;  4QFP A;  4THI A;  4YB5 A;  3TQW A;  2G29 A;  3CI8 A;  2RCA A;  1EU8 A;  5L9O A;  3PUZ E;  5KDT B;  5AA1 A;  5DEX B;  4R73 A;  3H6T A;  2NWJ A;  3V83 A;  3PPQ A;  1DPP A;  1P1O A;  3IOT A;  1MQJ A;  2RC8 A;  3OD7 A;  3MZ9 A;  4F18 A;  4Z7E A;  3IOU A;  4OYV A;  4RXL A;  4ZEC A;  2PVU A;  1MM7 A;  3H6V A;  2UYF A;  3IOR A;  3TTR A;  4JDF A;  4Q0C A;  3MP1 A;  3SEX A;  5DVF A;  3UIF A;  4PET A;  5DEX A;  1S7Y A;  3GZG A;  1MXW A;  4F2O A;  2HZL A;  3FAS A;  3UN6 A;  1JW4 A;  1Q1K A;  3G3J A;  2XX9 A;  5HPQ A;  2AIX A;  3KFM A;  1OIB A;  4ECF A;  1B05 A;  2DE4 A;  4IY6 A;  4PE5 B;  4RY1 A;  1RYX A;  2A5T A;  1ZIU A;  3F11 A;  3KOS A;  4EXL A;  2OZZ A;  3H6W A;  5FTI A;  1NNF A;  2P0S A;  1B9J A;  1SBP A;  2XHD A;  1DPE A;  4Q5T A;  2ONK E;  3CR9 A;  3M3K A;  1RYO A;  4IB2 A;  2RIN A;  4LON B;  2QS3 A;  4XKQ A;  4DCX A;  5I84 A;  2UXA A;  1MRP A;  4GQO A;  4PFU A;  3OO9 A;  5CMM A;  1A40 A;  3EQ1 A;  4FEB A;  1MG1 A;  2Q89 A;  2H98 A;  4I8C A;  4G8N A;  1DMB A;  1TWY A;  2H99 A;  4H6D A;  1PC3 A;  3JZJ A;  2UVG A;  3PMV A;  1GGG A;  1USY E;  3HST A;  5H8N A;  2ANJ A;  1R9Q A;  2OCU A;  2V3Q A;  4NF6 A;  3SKP A;  2OBG A;  5I2K B;  4EUO A;  2Y7I A;  3O6H A;  2DSF A;  2ZYK A;  4HTG A;  5JTY A;  1B3L A;  2PT1 A;  4FAJ A;  2XXT A;  1P99 A;  3C35 A;  1NNK A;  3C4M A;  1SW1 A;  3RGY A;  1B1X A;  1JNF A;  3DEL B;  3G3I A;  3T9U A;  1O64 A;  5JTY B;  1D9V A;  1OLA A;  4QSD A;  3TTN A;  5H8N B;  2DP8 A;  1LB9 A;  1JEU A;  4H1X A;  4OFJ A;  1B3H A;  1QKB A;  1R9L A;  2F5X A;  3C9H A;  1LB8 A;  5H8H A;  3QUJ A;  5I2N A;  3IL1 B;  1UTH B;  4G2Z A;  3KJ7 A;  4F3G A;  3DP6 A;  2Q9T A;  3MJN A;  4DXU A;  4POW A;  5TPA B;  4F3B A;  3BFT A;  2DWI A;  3VVD A;  3S9E A;  1MXY A;  1N0T A;  1AMF A;  3G3G A;  3HO7 A;  4R72 A;  2F36 A;  3B7D A;  3IJX B;  3LBS A;  3K1M A;  4GRK A;  1US5 A;  2QJE A;  1POT A;  1URD A;  3O97 A;  1P1W A;  3C33 A;  3TCH A;  1O63 A;  3VXC A;  4GIZ A;  1JVX A;  3OMB A;  3PV0 E;  4K3F A;  3B6W A;  1XVY A;  4HW8 A;  3N5L A;  1LFH A;  2VOZ A;  3IK6 B;  3QIM A;  3EHT A;  3QAX A;  5H8Q B;  5IKB A;  2RF1 A;  1VR5 A;  3FXQ A;  3KEI A;  3PD8 A;  3FV1 A;  4MH5 A;  1FQA A;  4QFO A;  3RUM A;  1IIW A;  1H44 A;  1MQH A;  1OMP A;  1B46 A;  4U4S A;  1N7W A;  2F7C A;  1VSO A;  4R75 A;  4KR5 A;  2RC7 A;  5DVI A;  1FTL A;  1S50 A;  1SI1 A;  4DXC A;  3LSX A;  1BP5 A;  4OTE A;  3U1O A;  2XD3 A;  3Q25 A;  2LAO A;  1Y3Q A;  3B6Q A;  3Q26 A;  4QFN A;  4ZEK A;  4BDM A;  2DWJ A;  1LAX A;  4R6H A;  3C34 A;  3CFL A;  3GXA A;  3FXR A;  3PPP A;  2UYE A;  4ZZE A;  3V8X B;  3MUQ A;  1WDN A;  1Y9U A;  3O6G A;  2DE3 A;  4DIG A;  3A3C A;  3BBR A;  2GFE A;  1KWH A;  3E4R A;  2VGQ A;  4M1V A;  4NMY A;  3HCQ A;  3TUS A;  2G93 A;  1US4 A;  1UTH A;  2R6G E;  2ZYN A;  3G3K A;  5A5X B;  4YKJ A;  3W9V A;  3KGC A;  2O84 X;  2BJJ X;  5IAI A;  3A09 A;  2D3I A;  4WEP A;  1YTV A;  4DCY A;  2W7Y A;  3LSL A;  1Q35 A;  5ELV A;  2HCA A;  4R2F A;  3IOV A;  5CMC A;  3EF7 A;  1B3G A;  5FTH A;  1FQE A;  3SET A;  5BWJ A;  3IJO B;  2X26 A;  5I2K A;  3TTL A;  4PP0 A;  4TOZ A;  1BIY A;  4G8H A;  3FVK A;  4KD5 A;  3GBA A;  1QUK A;  2V3T A;  4R6K A;  3ZKK A;  4IO2 A;  2ZNU A;  2FYI A;  2QPQ A;  4OEU A;  3OO6 A;  2FA7 A;  3RTF B;  2DYX A;  5EHS A;  1YAE A;  3G3F A;  5DTB A;  1POY 1;  4YKK A;  3VLV A;  5I58 A;  4YIC A;  3FV2 A;  2ZNT A;  4XKN A;  1JQF A;  1A8E A;  2PBW A;  3DP4 A;  5DYH A;  3K00 A;  3O9P A;  5AA4 B;  1QVS A;  2QL3 A;  4IO4 A;  3MVX A;  5KCJ B;  5TPA A;  4ZZA A;  3UOR A;  4F19 A;  2B3F A;  4H8I A;  1UIU A;  1ZBM A;  4OES A;  3T93 B;  3VXB A;  2QS1 A;  2ZNS A;  1P1Q A;  3FGS A;  4N13 A;  4NTL A;  4O3A A;  4OFL A;  3T66 A;  1Y3P A;  2RKM A;  4OZ9 A;  3OOA A;  3O66 A;  4DDD A;  1QW0 A;  4QF9 A;  2O7U A;  4ZDM A;  3WAF A;  2DWA A;  4OXV A;  3K1N A;  1IIT A;  1SW2 A;  3V89 B;  2DXY A;  4BDL A;  4BDO A;  5JEI A;  3IX1 A;  5H8S A;  3TMG A;  1UTB B;  4XTC Q;  1TT1 A;  3K0V A;  4R9F A;  1DSN A;  1RKM A;  2QRY A;  3OO8 A;  4GL8 A;  4LUB A;  1O7T A;  5JK4 A;  3QUF A;  2XXI A;  3PUV E;  1WOD A;  4M4G A;  2P2A A;  4G77 A;  1EZ9 A;  2Y7K A;  4IO6 A;  1B2H A;  3T22 A;  3WAE A;  4BLA A;  4F3P A;  1MY0 A;  3L6G A;  4F1V A;  2I4C A;  3ILT B;  3TTK A;  5FHO A;  3H6U A;  2O68 A;  4RJZ A;  4HCY A;  4NF4 A;  4XKR A;  3VLW A;  2HXW A;  4LP2 B;  4KYS A;  2ESN A;  3IB1 A;  4IO5 A;  1FTO A;  3PD9 A;  2Z8F A;  4FIM A;  4ELO A;  3S4U A;  3D4G A;  4EQ7 A;  4YZZ A;  1Z7N E;  4NWC A;  3TEL A;  4GWO A;  2Z23 A;  1BTJ A;  1DOT A;  1SDX A;  1Y20 A;  2XXR A;  3FVO A;  4G68 B;  3SEU A;  1B5J A;  3SER A;  4F39 A;  1B4Z A;  2ABH A;  5L9S A;  2I3V A;  2HAU A;  3N6U A;  4GFR A;  5EHM A;  1PB9 A;  2VD2 A;  1QUL A;  3MAM A;  4JWX A;  2OLB A;  2NUV A;  2XXU A;  2B65 A;  1TFA A;  2Y7P A;  3G7W A;  1YPN A;  3O29 A;  4NF5 A;  3FJ7 A;  3PU5 A;  4U21 A;  4YAH X;  4RPO A;  1QUJ A;  3SEV A;  2VHA A;  5AA2 B;  5KZT A;  3VDF A;  4JWO A;  4YKI A;  3K6W A;  4AB5 A;  4DE8 A;  2OK2 A;  2YJP A;  4O3B A;  2RC9 A;  1QUI A;  4NF4 B;  3KN3 A;  1LBC A;  1MY3 A;  3QYT A;  4LZ7 A;  4WKM A;  2F7B A;  2I4B A;  3K6U A;  2D5W A;  4LA9 A;  3K6X A;  4Q30 B;  2ONR A;  1LCF A;  4LZ8 A;  4EQB A;  1FW0 A;  1VFE A;  5TU0 A;  4LQ2 A;  3TYH A;  2DOJ A;  3PUW E;  1LGB C;  3KG2 A;  3VV5 A;  3IO4 A;  4KFQ A;  1MDP 1;  1MM6 A;  2I48 A;  1BKA A;  3N26 A;  3T9V A;  2AYS A;  5EYF A;  3BFU A;  5H8F B;  2Q8J A;  3UA8 A;  5AE4 A;  4ONY A;  1TFD A;  1Z7M E;  4G68 C;  3UP9 A;  4JXI A;  1MS7 A;  4OHN A;  3V5A A;  3PPN A;  2NVU B;  4UA8 A;  3GLB A;  5TP9 A;  1CE2 A;  1FQB A;  4R9G A;  2ZXT A;  3Q27 A;  2O1M A;  4WXJ A;  1B0L A;  4RA1 A;  1LBB A;  2HQ0 A;  4H5F A;  4P11 A;  1DTG A;  1NL5 A;  3O2A A;  3U72 A;  5I56 B;  5HBC A;  1IXI A;  4U22 A;  1D4N A;  2YLN A;  3KSJ A;  2CMO A;  2F7A A;  4JSO A;  2F78 A;  3E13 X;  1IEJ A;  1MQG A;  2XX8 A;  5CBS A;  2F97 A;  1I69 A;  2XD2 A;  4KI0 E;  5CMK A;  3L6H A;  3CFX A;  1H76 A;  4FJP A;  2Q2C A;  1LFG A;  3GBB A;  1MXX A;  3G3H A;  4OWD A;  5CI5 A;  3MPL A;  5F7V A;  3CFZ A;  1MY2 A;  4RK9 A;  3IB0 A;  4G4P A;  2WKY A;  3CVG A;  4EF2 A;  4YMB A;  3N6T A;  3PUY E;  1MH4 A;  4LQ5 A;  2ONS A;  3TPA A;  5AA4 A;  4C0R A;  4EXK A;  3JYR A;  3EN3 A;  4I1D A;  4UAC A;  3DM0 A;  1IZ1 A;  4FAT A;  2XXX A;  3MZB A;  2F6P A;  4FOR A;  1II5 A;  5I58 B;  3FIR A;  1Y1M A;  2F34 A;  3VLU A;  5B70 A;  4F1U A;  3MZ1 A;  3DP8 A;  1D3K A;  3H4Z A;  1A99 A;  1B40 A;  2Z22 A;  2RCB A;  3D4C A;  1M5F A;  3BKI B;  4POX A;  3HHG A;  4X1B A;  3EHS A;  2ALU A;  3T9X B;  3EHU A;  3RPW A;  1ATG A;  2Q88 A;  5AA2 A;  1LAH E;  3K02 A;  3KBR A;  1LAF E;  3FVG A;  4DLD A;  4P0I A;  1NKX A;  1MY1 A;  4N07 A;  1N76 A;  4XXU A;  4OMB A;  3U93 A;  4O3C A;  3S9L C;  2Y84 A;  1FTM A;  4PFY A;  3VE1 B;  5I59 B;  1B58 A;  3CIJ A;  3HV1 A;  3TZA A;  1HSJ A;  5KDT A;  3OEN A;  1NFT A;  3RTW B;  4DZ1 A;  1NNT A;  2VD3 A;  4IY5 A;  4U1Z A;  3RNN A;  3USD A;  5H8F A;  5ICQ A;  4TLL B;  1LAG E;  1OQH A;  2I0B A;  5CBR A;  5A5X A;  1SD3 A;  1B4H A;  5M2V A;  3QSL A;  3TFL A;  5K2X A;  1J1N A;  1OLC A;  4ESX A;  1SQY A;  2XXY A;  3H7M A;  3CSG A;  2E1S A;  2X7P A;  1AH5 A;  2ZYO A;  3K1P A;  4QRZ A;  5DVJ A;  1URG A;  2V3U A;  3KN8 A;  4FEC A;  3U94 A;  4NF8 B;  5F1Q A;  4KHZ E;  1MH3 A;  1M5C A;  5ICT A;  3RLF E;  4YKP A;  1FTJ A;  1HSL A;  1B32 A;  2Q2A A;  1N04 A;  1ANF A;  1OVB A;  4MFI A;  1MQD A;  3IO6 A;  1P1N A;  4AB6 A;  4DXB A;  4YMA A;  2REJ A;  1AL3 A;  4TQU Q;  3ONM A;  2I49 A;  2FNC A;  4ELP A;  3I6V A;  4H0W A;  1A7L A;  1B5H A;  4E0W A;  1UQW A;  3M3L A;  1M5D A;  1AOV A;  5L8D A;  1N3W A;  2Y7W A;  5HM4 B;  1A54 A;  1SYH A;  4H67 A;  1OVT A;  3OO7 A;  4MLQ A;  4ZS9 A;  5H8Q A;  1LFI A;  2XXW A;  3CRB A;  3TQL A;  2THI A;  3E3K A;  2F35 A;  1MY4 A;  3MW0 A;  4QSE A;  3TKD A;  4C1U A;  1ZU0 A;  4ZEB A;  3S9M C;  2XXV A;  4GLI A;  3MC2 A;  5AA2 D;  4LZ5 A;  4YB7 A;  1N84 A;  2O6A A;  3HN0 A;  4QFK A;  5CRY A;  1ZTY A;  1XVX A;  2ZMB A;  3CG1 A;  4N6P A;  5I57 B;  1AIV A;  3H06 B;  2Z8D A;  2QSX A;  2GRV A;  3OXN A;  4I9D A;  1UTB A;  4MLV A;  2GH9 A;  4BDR A;  1A55 A;  4LVQ A;  4OEN A;  1VE4 A;  3O6I A;  3RY3 A;  2M8C A;  2O51 A;  4XIG Q;  4E0X A;  3PUX E;  4C1T A;  3S9N C;  5BUU A;  3HHF A;  1DTZ A;  2DVZ A;  1PBP A;  2KLF A;  3T96 B;  1SI0 A;  4H8J A;  4F31 B;  5KCJ A;  1I6A A;  3VFJ A;  1MPD A;  1HSE A;  1EZO A;  1Y3N A;  4XKP A;  1Y4T A;  1XC1 A;  2NOO A;  2XXH A;  5FHN A;  3VVF A;  1ZMG A;  4QFL A;  3TAJ A;  1T0K A;  4Q8R A;  4F2Q A;  2H5Y A;  3LSF B;  2DS9 A;  4EQ9 A;  1B3E A;  4QHQ A;  2QS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...