1A7LA

Dominant b-cell epitope from the pres2 region of hepatitis b virus in the form of an inserted peptide segment in maltodextrin-binding protein
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
380
structure length
380
Chain Sequence
EGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDGSQDPRVRGLYFPAGGSECC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MALE-B363
publication title Crystal structure of a dominant B-cell epitope from the preS2 region of hepatitis B virus in the form of an inserted peptide segment in maltodextrin-binding protein.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Transport
total genus 115
structure length 380
sequence length 380
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1a7lA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1a7lA01
4F31B 2XX7A 3S2VA 1B9JA 3C35A 4GF8A 3VVDA 4F1YA 2REGA 4RPNA 1SW2A 1ZKBA 3FVOA 5JTYB 1MPCA 3I6VA 4NF5B 4F1VA 1LFHA 3K1NA 3FXRA 4YU0A 4YB7A 2CMOA 2QSXA 4H65A 4MBPA 4FEBA 3KEIA 1QKAA 4FIMA 1OVTA 1LLSA 3PMXA 4XIGQ 3SETA 3K6UA 3W9WA 1FQFA 3RPWA 2HZLA 1XC1A 4PETA 1MRPA 2X7PA 3QK6A 2B65A 1MQJA 1IZ1A 1FQDA 3SERA 5H8FB 3W15C 5DYHA 1M5DA 1ZLQA 2V3TA 3H4ZA 3S9MC 3A09A 3RGYA 2FNCA 2I4BA 4LZ5A 4TLLB 3RN8A 4ISUA 4I8CA 3L6GA 2DQVA 5IAIA 5CI5A 1P1NA 3BFTA 3GLBA 2KLFA 2GHAA 3E13X 3IOVA 4UACA 1LCTA 4IO2A 2X26A 1Q35A 5DEXA 3USDA 1US5A 2DWHA 1YPNA 5KZTA 4R9GA 5A5XB 1N7WA 3TTKA 1LBBA 1MQGA 3ZKLA 3CFLA 4LQ5A 2GRVA 1Z7NE 1UTBB 4I9DA 2F8DA 3HHFA 4XKPA 3DM0A 2XXRA 3JV9A 1LFGA 3MP1A 1DPEA 2ONSA 4F2OA 1O64A 1UTHB 1ZIUA 1FQCA 5I84A 5HBCA 4LUBA 1B3GA 3RT6B 3VFJA 5KCJA 2VHAA 1O63A 2R71A 3MQ9A 3SEYA 1D9VA 4KCDA 2F5XA 3TKDA 4NF8B 3IR1A 3Q29A 3N6UA 2V93A 3H6TA 2M8CA 1Y1MA 4FAJA 3B7DA 2OK2A 3PV0E 3TCFA 2D5WA 1B3FA 2QS1A 3PPQA 1FTJA 4JDFA 5AA4B 4KR5A 3G3IA 3EPEA 4U22A 3K4UA 4DCXA 4RYAA 4RNSA 4NF4A 5I57A 2QL3A 1N04A 2QRYA 4RJZA 3K02A 2OZZA 2DE2A 4ZZAA 4C1UA 4AB5A 3FASA 3EN3A 4FEDA 3IOTA 3V83A 2I3VA 1Y4TA 2DE4A 1NH7A 2G93A 3C9HA 3MW0A 3TZAA 4JB7A 1ELJA 3MP6A 1MH3A 4JWYA 2OWSA 4JBZA 3TTNA 4HTGA 1QUIA 4QFOA 2GFEA 4H5FA 3U92A 1MXUA 3EQ1A 3FJGA 4LONB 3C32A 3PUYE 3QYTA 4THIA 5M2VA 2ABHA 3R6UA 2QMXA 2NVUB 2X7QA 2OWTA 3GBAA 4P0GA 3VXCA 5I2NB 4HW8A 2HAUA 4DDDA 4NMYA 1XS5A 1MS7A 5DVJA 4X9TA 3K1MA 3G3JA 4ZDMA 3GXAA 1IXCA 4EF2A 3OENA 4ZZEA 4GQOA 2R6GE 5I58B 3OEKA 2DVCA 3PMVA 4R72A 4F2QA 1PB7A 3KN8A 1LBCA 3T22A 4YB5A 2F6PA 5ITOA 1DSNA 2ZYKA 3UGWA 2DOJA 2XD3A 4YMAA 1FTOA 1B4HA 2VD2A 3C34A 3LSWA 4R6YA 5H8SA 3VVEA 5KDTA 5JK4A 2I0CA 4WXJA 1URSA 2D3IA 2ZMBA 4H8JA 3VDFA 2RC9A 4ZEFA 2REJA 1B5IA 4QFLA 1MPDA 3IAZA 1MY2A 3FJMA 2IA4A 2F35A 3Q26A 4GIZA 2XXTA 3A3CA 4M4GA 2H98A 1SYIA 4ELOA 1M5BA 4TOZA 4BDOA 1VR5A 1LSTA 1JETA 4XKNA 3FV2A 4BDQA 1UIVA 2THIA 1A99A 2PMSA 5H8QB 3E9XA 4YMBA 3O28A 1A8FA 3PPOA 4GLIA 1Z7ME 3PGFA 3FVGA 2XXVA 4OXVA 4I62A 1B58A 2O6AA 4NF6A 3RTFB 5J1DA 3OMBA 4ZE9A 1DOTA 1R1NA 5CMMA 1YCJA 1RYXA 3CI8A 1TWYA 4DXBA 3LBSA 4DE8A 2Y7PA 3MVWA 4PFUA 1GV8A 4IO5A 3L6HA 4F18A 1B7HA 1B46A 2O84X 4OQOA 5H8NB 2NOOA 1YTVA 1M5FA 3LC8A 4IO7A 3OEMA 5H8HB 4F39A 5JEIA 2FYIA 1ZBMA 2H9BA 2ZYMA 2Q2CA 3G3HA 4KYEA 2NWJA 1MXXA 3IJXB 2QS2A 4NE4A 2W7YA 4R6KA 3SESA 1TT1A 3IB1A 1MY4A 4Z7EA 5I56A 3TYHA 2F7AA 3BKIB 3CG1A 1II5A 2IEEA 3IO6A 4OMBA 5L8DA 4R9FA 1LAXA 2E0SA 2F78A 1SI0A 3O6HA 1JNFA 4DZ1A 1H3DA 4PE5B 1UQWA 2PX1A 4BDMA 1GTKA 4G68C 3TELA 2HQ0A 3TDJA 1N84A 4YB6A 3U72A 3FUZA 3DP8A 1Y9UA 2ZYOA 3O9PA 4EQBA 1VSOA 4EXKA 3OD7A 2DWJA 4IO6A 3MJNA 4FORA 5CBRA 4KCCA 1B4ZA 3Q28A 2OJTA 1SBPA 3PUVE 1SI1A 3QUFA 2RINA 4F3BA 1I6AA 1BKAA 1Y3NA 1BIYA 4L17A 3MP8A 4X1BA 5B70A 3BFUA 3VVFA 2OBGA 4N13A 5DVIA 5FHNA 1MQDA 4RA1A 4U1ZA 4M1VA 1SDXA 1USYH 4QFPA 4EF1A 2I49A 5DTBA 3LSFB 1PB8A 1IXIA 4KPTA 4IGTA 1PBPA 3CG3A 3V8XB 4MFIA 1MXVA 1XOCA 1SD3A 1YAEA 2VP1A 5CMCA 3C33A 4G8NA 1HSJA 5AA3A 2Z23A 4DXCA 4JXIA 4R73A 1URDA 1JEUA 1FQBA 3OELA 2A5TB 2F97A 1I6QA 1LAHE 2ONKE 1S9TA 3PUXE 2YLNA 4ESXA 4E0WA 2Y7RA 4RK9A 3T66A 1ANFA 4JWOA 3DP4A 2XXXA 2H5YA 3RNNA 2I3WA 3G3GA 4G68B 2ZNTA 2Y7IA 1IXGA 3CIJA 3TUSA 1FQAA 1JEVA 2Q89A 4KFQA 1CB6A 3HSTA 3MZ1A 4QRZA 3KG2A 4QHQA 1NFTA 4MF3A 3ECRA 4DCYA 4LATA 4LQ2A 5FHOA 4ZS9A 1FCKA 1LB8A 3RLFE 3MPKA 4ZEBA 4X48A 4ECFA 4G2ZA 3GZGA 4AB6A 3F11A 4KI0E 4IB2A 1MQIA 2R9JA 3PU5A 2V3QA 3KJTA 2DE3A 5I2NA 3TCHA 2DVZA 5TP9B 1DMBA 1MDP1 2O69A 4JSDA 4ESWA 1MH4A 3SDFA 1SYHA 1B2HA 1RKMA 3PMWA 1AMFA 2GHBA 3K00A 3O2AA 4XXUA 5F7VA 1AIVA 5CRYA 4P11A 2DWAA 3CVGA 1B7ZA 5I2KB 3K01A 3HN0A 1FTLA 1LAGE 1ATGA 3IOWA 3C31A 2PVUA 1SQYA 3EHUA 3FVKA 5TPAA 3DLNA 4FECA 4O3BA 3DP6A 1B1HA 4H0WA 2UVJA 3PD8A 1NH8A 4U21A 3E4RA 3T9HB 3LR1A 5CBSA 3A3UA 4FE8A 4F3PA 3SEXA 3FJ7A 3N26A 1IUDA 2O1LA 1Y20A 1OLAA 1A54A 3EHTA 3CFZA 4G4PA 4RK2A 2QPQA 4OERA 2I6EA 4R2BA 3HCQA 3EHSA 5EHSA 4HCWA 4QSEA 1AL3A 3O6IA 4GFRA 3Q25A 1S50A 3D4GA 2QMWA 1D4NA 1Y3PA 1B6HA 3K0VA 5AA2A 3FXUA 2HXWA 4Q8RA 1B1XA 1MXYA 1FW0A 3QIMA 2UYFA 4NWDA 1QUJA 2I4CA 3C36A 1MPBA 4Z0IA 5I59A 2PYYA 3KJ7A 4N07A 3N5LA 2F6GA 1XVXA 1TFDA 2ANJA 4GL8A 3H6UA 4EDPA 3HHGA 4GL0A 5DEXB 3I5OA 4R2FA 5HPQA 4ELRA 1Y1ZA 5H8NA 3MWBA 1OIBA 1B3EA 3ODBA 3UN6A 3JZJA 5H8HA 1R6ZA 5CM6A 1S7YA 3SEWA 2HEUA 2RC7A 4POWA 3H3GA 1JVXA 2RCBA 1LB9A 4H5GA 2O7UA 3CFXA 3O66A 2HCAA 5HM4B 1BP5A 4MLQA 2ZNUA 5ISUA 1IEJA 3T9UA 5KCJB 1R9QA 1M5CA 3IOUA 1N3XA 1IIWA 4XKQA 1MXWA 2V25A 4DXUA 1VE4A 4FJPA 2DS9A 3PPRA 2ALUA 3VXBA 4G77A 3ILUB 4KD5A 1H45A 4KQPA 4GRKA 3OSRA 4O3AA 3IO4A 1P99A 4WEPA 3W9VA 1D3KA 3KSJA 1A55A 4OENA 2UYEA 3OO9A 5ELVA 4NF4B 1B32A 4NTLA 4BLAA 1Y3QA 5I57B 4K3FA 2PBWA 4U4SA 4YICA 3O97A 2OCUA 2Q2AA 1LCFA 4DLDA 3IORA 3MUQA 4IGRA 2XXPA 1NNKA 3ZSFA 1MM6A 4G8HA 4DIGA 2GH9A 3QSLA 3UK4A 1MG1A 3CR9A 5JTYA 2XXIA 4NF5A 4PQJA 3G7WA 5L9SA 3H6VA 3U8QA 3K1PA 1T0KA 4ZE8A 3O29A 3U94A 4BDLA 1B5JA 3UA8A 2D21A 1ZJLA 3KN7A 5F1QA 1ZMGA 3U1OA 2B3BA 1EZPA 3LSXA 4F22A 4KHZE 4GVOA 4QF9A 3ZKKA 4HCYA 2ZNSA 4RPOA 5H8FA 2Y7WA 2Y84A 4C0RA 1GVCA 4F1UA 3S4UA 4MH5A 3VV5A 4YZZA 2YPNA 2HZKA 4EUOA 3CSBA 1N7XA 4YKKA 3FZVA 4ZEIA 5KDTB 1POTA 2QJEA 2XXQA 2FA7A 5ITPA 5A5XA 4PFWA 3C4MA 2O51A 1UTBA 4EQ7A 2CZLA 1L5TA 4RXLA 1MDQA 4BDRA 3MVXA 3THIA 2O1MA 4N6PA 3PPNA 2RKMA 3K6XA 1UTHA 2XX9A 2E1SA 2UVGA 1P1UA 3WAEA 1N76A 2Z8EA 3MC2A 4OHNA 4C1TA 3OXNA 4ND9A 5BUUA 2RCAA 5AA1A 3FATA 3T9XB 1B51A 5FTHA 4H6DA 4NF8A 5TU0A 3PUWE 4NF6B 1B7UA 3QXMA 4PFTA 3MBPA 4HS7A 4O3CA 3R26A 4NEDA 1QW0A 5L9MA 4P0IA 2UXAA 3H03A 4TLMB 5EHMA 4X1DA 3IB2A 1MY1A 1F9BA 3IB0A 3JYRA 3OO6A 5AA4A 3PPPA 3TTLA 1ZU0A 2Z8FA 4XKRA 1XVYA 4LP2B 4Q0CA 3CSGA 3AXFA 3P7IA 4H67A 3S9LC 2A5SA 2Z8DA 4YKPA 2Q88A 1UIUA 1N0TA 3PD9A 4QSDA 4ELQA 5CC2A 4OETA 2XXWA 1KWHA 1EH3A 3TAJA 5I56B 1HSEA 4R74A 4YKJA 1FTKA 5EYFA 2QS3A 1SW5A 3MAMA 4GWOA 4POXA 2B3FA 2AIXA 1QJMA 2LAOA 1GR2A 2UVIA 2XX8A 3MVZA 1NL5A 5FHMA 2DYXA 4OEVA 2ONRA 2PT2A 3MZBA 4Q30B 3LUYA 4ZEKA 3PUZE 3M8UA 2XXUA 5I58A 3K2DA 3IL1B 1MY0A 3S9EA 3IJOB 1H76A 2UVHA 4PP0A 1B3LA 2Q9TA 1OVBA 3N94A 3B6WA 1US4A 4OZ9A 3MPLA 3CRBA 1EZOA 2F36A 3V89B 3MVYA 3SEVA 3OOAA 1IITA 2HAVA 4F19A 3VLVA 4IY5A 4AQ4A 3H06B 3KZGA 5AE4A 1XT8A 1M5EA 3KFMA 5BWJA 1TXFA 4JSOA 3UORA 3N6TA 5ICQA 1JW5A 3V5AA 5AA2D 3TFLA 1URGA 2AL4A 1OLCA 2HFBA 3D4CA 4EQ9A 4OWDA 3FD3A 2H4IA 4QFKA 1GGGA 2WKYA 4GOTA 1MXZA 2P0SA 3G3KA 4IO3A 1NKXA 2I0BA 1H44A 1SW4A 1B3HA 2P2AA 1J1NA 1I6BA 5H8QA 3I3VA 1DTZA 1POY1 4E0XA 1WDNA 2RC8A 1DPPA 4OVJA 1A7LA 1D9YA 4GXSB 1Q1KA 1Y4CA 2H99A 3FXQA 2XD2A 4OTEA 4FATA 3MZ9A 3IK6B 4OFJA 5B7DA 1B0LA 3QAXA 2AL5A 1MY3A 5CMKA 3TQLA 1A8EA 4ZECA 3H6WA 2DWIA 1BLFA 3QUJA 1N3WA 3OO8A 3K6WA 4GXAA 1DTGA 3U93A 3TPAA 2F7BA 3E3KA 4KYSA 2VGQA 1PDAA 4Q5TA 3RY3A 3VLWA 2V84A 4I1DA 3T96B 3VLUA 3BBRA 3M3FA 4JWXA 4QFNA 1USYE 3WAFA 1PB9A 3KBRA 4LZ7A 2OLBA 3RQTA 5CMBA 1AOVA 4MLVA 4ZEDA 3TMGA 1JW1A 1JVYA 3G3FA 2NXOA 2XXYA 1B52A 2AYSA 5DT6A 3TQWA 1B05A 4XTCQ 3ONMA 4G8MA 3FIRA 1H43A 3OO7A 3VE1B 2Q8JA 2ZXTA 3O6GA 4EXLA 1SVXB 3RTWB 4H1XA 5TPAB 4ELPA 1EZ9A 4QSCA 5L9OA 4OFOA 4U1OA 2G29A 3KSXA 3KOTA 1QVSA 4U4XA 1PBQA 4RY1A 4BDNA 4R6HA 2H25A 5LOMA 4KYDA 4NWCA 2F7CA 3TCGA 4OEUA 3T93B 4F3GA 2ESNA 3B6QA 1MQHA 1FQEA 3M3LA 4U2RA 1JQFA 1B0HA 1LFIA 1IXHA 5AA2B 2DP8A 3TEPA 2DXRA 3HO7A 3KGCA 1OMPA 3H7MA 1LGBC 5ICTA 4ONYA 3FGSA 1XHYA 1P1OA 2XXHA 3K6VA 3TTRA 4U23A 4WEDA 1VFEA 1NNPA 5I59B 1SW1A 4TQUQ 4R75A 2VD3A 3FV1A 4WKMA 2F34A 3IX1A 2A5TA 3TTMA 4OFLA 1RYOA 2RF1A 1TFAA 1QKBA 5DVFA 3RUMA 1PEBA 2DXYA 4IO4A 5K2XA 5IKBA 3FVNA 1FTMA 2NUVA 1WVJA 3RT8A 3ZS6A 2VOZA 1NNFA 1OQHA 2YJPA 4YKIA 4G68A 3GBBA 2Z22A 2O68A 1JW4A 1PC3A 2DSFA 4LA9A 3ILTB 4LZ8A 1R9LA 4LVQA 1LAFE 3SEUA 4OESA 4PFYA 1IQ7A 3OSQA 3KN3A 5K2YA 3S9NC 3M3KA 1I69A 4UA8A 4OYVA 1B40A 2PT1A 1AH5A 1QULA 1CE2A 5FTIA 1MM7A 1P1QA 3DELB 3TODA 3B6TA 1NNTA 2I58A 3Q27A 4YAHX 3HPIA 4F3SA 2P1SA 3EF7A 1QUKA 1BTJA 3T9VA 1B5HA 5TP9A 1ZTYA 1WODA 1HSLA 2I48A 3KOSA 2O7IA 4GD5A 3UP9A 3SKPA 1OQGA 3R7XA 4F29A 4H8IA 2XHDA 1O7TA 1VFDA 3UIFA 3LSLA 3HV1A 1P1WA 2ZYNA 1NMUA 5I2KA 2QS4A 2Y7KA 1A40A 2V3UA 4IY6A 2BJJX 1EU8A
chains in the Genus database with same CATH superfamily
1NV4A 4F31B 2XX7A 3MYUA 3S2VA 1B9JA 3C35A 4HE2A 4GF8A 3VVDA 4F1YA 2REGA 4RPNA 1SW2A 1ZKBA 3FVOA 5JTYB 1MPCA 3I6VA 4GWSA 4PDHA 4NF5B 1IMFA 4F1VA 1LFHA 4P9KA 3K1NA 3FXRA 4YU0A 4YB7A 2CMOA 2QSXA 4H65A 4MBPA 4QBAA 4FEBA 3KEIA 4PAKA 1QKAA 4FIMA 2BJIA 1OVTA 1LLSA 4MCOA 3PMXA 4XIGQ 3SETA 3K6UA 3W9WA 1FPGA 1FQFA 3RPWA 2HZLA 4PBQA 1XC1A 4PETA 1MRPA 2OX3A 2X7PA 3QK6A 2B65A 1MQJA 1IZ1A 4PCDA 1FQDA 3SERA 5H8FB 3W15C 5DYHA 1M5DA 1ZLQA 3CHGA 2V3TA 3H4ZA 3S9MC 3A09A 5IZ3B 3RGYA 2FNCA 2I4BA 4LZ5A 4TLLB 3RN8A 4ISUA 4I8CA 3L6GA 2DQVA 5IAIA 5CI5A 1P1NA 3BFTA 3GLBA 2KLFA 2GHAA 3E13X 2ZZVA 3IOVA 4UACA 1LCTA 4IO2A 2X26A 1Q35A 5DEXA 3USDA 1US5A 2DWHA 1YPNA 5KZTA 4R9GA 5A5XB 1N7WA 3TTKA 4JVIA 1LBBA 1MQGA 1NUWA 3ZKLA 5ET6A 3CFLA 2L5VA 4LQ5A 4N15A 2GRVA 1Z7NE 1UTBB 4I9DA 4PDDA 5EYHA 2F8DA 3HHFA 5EQ7A 4XKPA 3DM0A 2XXRA 3JV9A 1LFGA 2VPOA 4JVCA 3MP1A 1DPEA 2ONSA 4F2OA 1O64A 1UTHB 1ZIUA 1FQCA 5EQAA 1FPEA 5I84A 5HBCA 4LUBA 1B3GA 3RT6B 3VFJA 5KCJA 2VHAA 1O63A 2R71A 3MQ9A 3SEYA 1D9VA 4KCDA 2F5XA 3TKDA 4NF8B 3IR1A 3Q29A 3N6UA 2V93A 3H6TA 2M8CA 1Y1MA 4FAJA 3B7DA 3EKIA 2OK2A 3PV0E 3TCFA 2D5WA 1B3FA 2QS1A 5EQ8A 3PPQA 1FTJA 4JDFA 3QMFA 4GWXA 1VDWA 5AA4B 4KR5A 3G3IA 3EPEA 4U22A 3K4UA 4DCXA 4RYAA 4RNSA 4NF4A 5I57A 2QL3A 1N04A 2QRYA 4RJZA 3K02A 1LBWA 2OZZA 2DE2A 3A29A 1FTAA 4ZZAA 2Y5LA 3PTYA 4LN5A 4PGNA 4OVQA 4C1UA 4AB5A 3FASA 3EN3A 4FEDA 3IOTA 3V83A 2I3VA 1Y4TA 2DE4A 1NH7A 2G93A 3C9HA 3MW0A 3TZAA 4JB7A 1ELJA 3MP6A 1MH3A 4JWYA 2OWSA 4JBZA 3TTNA 4HTGA 5ET7A 1QUIA 4QFOA 2FIEA 2GFEA 4H5FA 3U92A 1MXUA 3EQ1A 3FJGA 4LONB 3C32A 4OANA 3PUYE 3QYTA 4THIA 5M2VA 2ABHA 3R6UA 2QMXA 2NVUB 2X7QA 2OWTA 3GBAA 4P0GA 3VXCA 5I2NB 4HW8A 2HAUA 1FPIA 4DDDA 4NMYA 1IMDA 1XS5A 1MS7A 5DVJA 4X9TA 3K1MA 3G3JA 4OVRA 4GWWA 4ZDMA 3GXAA 1IXCA 4EF2A 3OENA 4ZZEA 4GQOA 4OVSA 2R6GE 5I58B 3OEKA 2DVCA 3PMVA 4R72A 4F2QA 1PB7A 2HHMA 3KN8A 1LBCA 3T22A 4YB5A 1FPJA 2F6PA 5ITOA 4O7IA 1DSNA 2ZYKA 3UGWA 4XEQA 2DOJA 2XD3A 4YMAA 1FTOA 1B4HA 2VD2A 3E79A 3C34A 3LSWA 4R6YA 5H8SA 2CZHA 3VVEA 1K9ZA 5KDTA 5JK4A 2I0CA 1KA0A 4NX1A 4WXJA 1URSA 2D3IA 2ZMBA 4H8JA 3VDFA 2RC9A 4ZEFA 2REJA 1B5IA 4QFLA 1MPDA 3IAZA 1MY2A 4GWYA 3FJMA 2IA4A 2F35A 3Q26A 4GIZA 2XXTA 3A3CA 4M4GA 2H98A 1SYIA 4ELOA 1M5BA 4X04A 4TOZA 1NUYA 4BDOA 1VR5A 1LSTA 1JETA 4XKNA 3FV2A 4DI4B 4BDQA 4P8BA 1UIVA 2THIA 1A99A 4HE0A 2PMSA 5H8QB 3E9XA 4YMBA 3O28A 1A8FA 2F3DA 3PPOA 4GLIA 4GWUA 1Z7ME 3PGFA 3FVGA 2XXVA 4OXVA 4I62A 1D9QA 1B58A 2O6AA 4NF6A 3RTFB 5J1DA 3OMBA 4ZE9A 3KC1A 1DOTA 1FJ6A 1R1NA 5CMMA 1YCJA 1RYXA 3CI8A 1TWYA 4DXBA 3LBSA 4DE8A 2Y7PA 3MVWA 1G0HA 4PFUA 1GV8A 4GWZA 4IO5A 3L6HA 2P3VA 4F18A 1B7HA 1B46A 2O84X 4OQOA 5H8NB 2NOOA 1YTVA 1M5FA 1G0IA 1NV2A 3LC8A 4IO7A 3OEMA 5H8HB 4F39A 5JEIA 2FYIA 1ZBMA 2H9BA 2ZYMA 2Q2CA 3G3HA 4KYEA 2NWJA 1IMBA 1MXXA 3IJXB 2QS2A 4NE4A 2W7YA 4R6KA 3SESA 1TT1A 3IB1A 1MY4A 4Z7EA 5I56A 3TYHA 2F7AA 3BKIB 3B8BA 3CG1A 1II5A 2IEEA 3IO6A 4OMBA 5L8DA 4R9FA 1LAXA 2E0SA 2F78A 1SI0A 3O6HA 1JNFA 4DZ1A 1H3DA 4PE5B 1UQWA 2PX1A 4XF5A 4BDMA 1GTKA 4G68C 3TELA 2HQ0A 3TDJA 1N84A 4YB6A 3U72A 3FUZA 3DP8A 1Y9UA 2ZYOA 3O9PA 4EQBA 1VSOA 4EXKA 3OD7A 3BIGA 2DWJA 4IO6A 3MJNA 4FORA 5CBRA 4KCCA 1B4ZA 3Q28A 4MHFA 2OJTA 1SBPA 3PUVE 1FBDA 1SI1A 3QUFA 2RINA 1CNQA 4F3BA 1I6AA 1BKAA 1Y3NA 1BIYA 4L17A 3MP8A 4X1BA 5B70A 3BFUA 3VVFA 2OBGA 4N13A 5DVIA 5FHNA 1MQDA 4RA1A 4U1ZA 4M1VA 1SDXA 1USYH 4QFPA 4EF1A 4PTKA 2I49A 3B50A 5DTBA 3LSFB 1PB8A 1IXIA 4KPTA 4N91A 3KBZA 4IGTA 1PBPA 3CG3A 3V8XB 2XA5A 4MFIA 1MXVA 5F24A 1FBEA 1XOCA 4N8GA 1SD3A 1YAEA 2VP1A 5CMCA 3C33A 4G8NA 1HSJA 5AA3A 4I40A 2Z23A 4DXCA 4JXIA 4R73A 1URDA 1JEUA 1FQBA 3OELA 2A5TB 2F97A 1I6QA 1LAHE 2ONKE 1S9TA 3PUXE 2YLNA 4ESXA 4E0WA 2Y7RA 4RK9A 4PFRA 5EQ9A 3T66A 1ANFA 4PGPA 2Q74A 3DP4A 4JWOA 2XXXA 2H5YA 3RNNA 2I3WA 4OVPA 2B4MA 2VT5A 3G3GA 4G68B 2ZNTA 2Y7IA 1IXGA 3CIJA 3TUSA 1FQAA 1JEVA 2Q89A 4KFQA 1CB6A 2QVVA 3HSTA 3MZ1A 4QRZA 3KG2A 4QHQA 1NFTA 4MF3A 3ECRA 4PFIA 4DCYA 4LATA 3MSTA 4LQ2A 5FHOA 4ZS9A 1FCKA 1LB8A 3RLFE 3MPKA 4ZEBA 4X48A 1KA1A 4ECFA 4G2ZA 5IM2A 3GZGA 4AB6A 3F11A 4KI0E 1IMCA 4IB2A 1MQIA 2R9JA 3PU5A 2B4LA 2V3QA 3KJTA 2CEXA 2DE3A 5I2NA 3TCHA 2DVZA 5TP9B 1DMBA 1MDP1 2O69A 2WYPA 4JSDA 4ESWA 1MH4A 1EYIA 3SDFA 1SYHA 1B2HA 1RKMA 3PMWA 1AMFA 2GHBA 3K00A 3O2AA 4UABA 4XXUA 5F7VA 1AIVA 3NOHA 4P11A 5CRYA 2DWAA 3CVGA 1B7ZA 5I2KB 3K01A 3HN0A 1FTLA 1LAGE 1ATGA 3IOWA 2CZKA 3C31A 2PVUA 4N6KA 1SQYA 3EHUA 3FVKA 5TPAA 3DLNA 2WYKA 4FECA 4O3BA 3DP6A 1B1HA 4H0WA 2UVJA 3PD8A 4G61A 3GYYA 1NH8A 4U21A 3E4RA 3T9HB 3LR1A 4I3EA 4N6DA 5CBSA 3A3UA 4FE8A 4F3PA 3SEXA 3E78A 3FJ7A 3N26A 1IUDA 2O1LA 1Y20A 1OLAA 1A54A 3EHTA 3CFZA 3LV0A 2MKZA 4G4PA 4RK2A 2QPQA 4OERA 2I6EA 4R2BA 2JJKA 3HCQA 3EHSA 5EHSA 4NQ8A 4HCWA 4QSEA 1AL3A 3O6IA 4GFRA 3Q25A 1S50A 3D4GA 2QMWA 1D4NA 2KQZA 1Y3PA 1B6HA 3K0VA 5AA2A 3FXUA 2HXWA 4Q8RA 1B1XA 4O7MA 1MXYA 1FPDA 1FW0A 3QIMA 2UYFA 1EYKA 4NWDA 1QUJA 2I4CA 4MMPA 3C36A 1MPBA 4Z0IA 5I59A 2PYYA 3KJ7A 4N07A 3N5LA 2WBDA 1LBYA 2F6GA 1XVXA 1TFDA 2ANJA 4GL8A 3H6UA 4EDPA 3HHGA 4GL0A 5ET5A 5EYGA 5DEXB 3I5OA 4R2FA 5HPQA 4ELRA 1Y1ZA 5H8NA 3MWBA 1OIBA 5FBPA 1B3EA 4GX6A 3ODBA 3UN6A 3JZJA 5H8HA 1R6ZA 5CM6A 3FXBA 1S7YA 3SEWA 2HEUA 1DK4A 2RC7A 4POWA 3H3GA 1JVXA 2RCBA 4H46A 1LB9A 2CZIA 1AWBA 4H5GA 2O7UA 1NV7A 1IMAA 3CFXA 3O66A 2HCAA 5HM4B 1BP5A 4MLQA 2ZNUA 5ISUA 1YXIA 4MEVA 1IEJA 5I5PA 3T9UA 5KCJB 1R9QA 1M5CA 3IOUA 1N3XA 1IIWA 1NV6A 4XKQA 4P56A 1MXWA 4MNCA 2V25A 3SZPA 4DXUA 1VE4A 4FJPA 2DS9A 3PPRA 2ALUA 1LEVA 3VXBA 4MNIA 4G77A 3ILUB 4KD5A 1H45A 4KQPA 1LBVA 4GRKA 3OSRA 4O3AA 3IO4A 1P99A 4WEPA 4HXVA 3W9VA 1D3KA 3KSJA 1A55A 4OENA 2UYEA 3OO9A 3BIHA 5ELVA 4NF4B 1B32A 4NTLA 4BLAA 1Y3QA 5I57B 4K3FA 2PBWA 4U4SA 4YICA 3O97A 2OCUA 2Q2AA 1K9YA 4P1EA 4PC9A 4PE3A 1LCFA 4DLDA 1NI9A 1RDYA 3IORA 4MX6A 3MUQA 4IGRA 2XXPA 1Q9DA 1NNKA 3ZSFA 1MM6A 1LBXA 4G8HA 4DIGA 2GH9A 3QSLA 3UK4A 1MG1A 3CR9A 1FBPA 4NHBA 5JTYA 2XXIA 4O8MA 2WEFA 4NF5A 4PQJA 3G7WA 5L9SA 3H6VA 3U8QA 4NF0A 3K1PA 1T0KA 4ZE8A 3O29A 3T0JA 3U94A 4BDLA 1B5JA 3UA8A 2D21A 4H45A 1ZJLA 3KN7A 1FJ9A 5F1QA 1ZMGA 3U1OA 2B3BA 2PCRA 1EZPA 3LSXA 4F22A 4KHZE 4GVOA 4QF9A 3ZKKA 4HCYA 2ZNSA 2V4CA 4XFEA 4RPOA 5H8FA 2Y7WA 2Y84A 4C0RA 1GVCA 5IZ3A 4F1UA 1LBZA 4PBHA 3S4UA 4MH5A 3VV5A 1FPBA 4P1LA 1FPLA 4YZZA 2YPNA 2HZKA 4EUOA 3CSBA 1N7XA 2R8TA 4YKKA 3FZVA 4ZEIA 5KDTB 1POTA 2QJEA 2XXQA 2FA7A 2P3NA 5ITPA 5A5XA 4OVTA 2XWOA 4PFWA 3C4MA 1FPFA 2O51A 4P47A 1UTBA 4GBWA 4EQ7A 2CZLA 1FBGA 1L5TA 4RXLA 1MDQA 4BDRA 3MVXA 3THIA 2O1MA 2XWVA 4N6PA 3PPNA 1NV5A 2RKMA 4PAIA 3K6XA 1UTHA 2XX9A 2E1SA 2UVGA 1P1UA 4PAFA 3WAEA 1N76A 2Z8EA 3MC2A 2QVUA 4OHNA 4C1TA 3OXNA 4ND9A 5BUUA 2RCAA 5AA1A 1RDXA 3FATA 3T9XB 1B51A 5FTHA 4H6DA 4NF8A 5TU0A 3PUWE 4NF6B 1B7UA 3QXMA 4PFTA 2FIXA 5A5LA 3MBPA 4HS7A 4O3CA 3R26A 4NEDA 1QW0A 5L9MA 4P0IA 2UXAA 3H03A 4TLMB 5EHMA 4X1DA 1YYZA 4DI3D 3IB2A 1QGXA 1MY1A 1FPKA 1F9BA 3IB0A 3JYRA 3OO6A 5AA4A 3PPPA 3TTLA 3IFAA 1ZU0A 2Z8FA 5I7IA 4XKRA 1XVYA 4LP2B 4Q0CA 3CSGA 3AXFA 3P7IA 4H67A 3S9LC 2A5SA 2Z8DA 4YKPA 2Q88A 1UIUA 1YZ0A 1N0TA 3PD9A 4QSDA 4ELQA 5CC2A 4OETA 2XXWA 4I3YA 1KWHA 1EH3A 3TAJA 5I56B 1HSEA 4R74A 4YKJA 1JP4A 1FTKA 5EYFA 2QS3A 1KZ8A 4N4UA 1SW5A 3MAMA 4GWOA 4POXA 2B3FA 2AIXA 1QJMA 2LAOA 1GR2A 2UVIA 3RPLB 2XX8A 3MVZA 1NL5A 5FHMA 2HXRA 5LDZA 2DYXA 4OEVA 2ONRA 5IGAA 2PT2A 3MZBA 4Q30B 4AS4A 3LUYA 4ZEKA 3PUZE 3M8UA 2ZZXA 5LTCA 2XXUA 5I58A 3K2DA 1XI6A 3IL1B 4OA4A 1MY0A 3S9EA 3IJOB 1H76A 1FRPA 2UVHA 4PP0A 1B3LA 1FBCA 2Q9TA 1OVBA 3N94A 4QXDA 2ZZWA 3B6WA 1US4A 4OZ9A 3MPLA 3KC0A 3CRBA 1EZOA 1IMEA 2F36A 3V89B 3MVYA 3SEVA 3OOAA 1IITA 2HAVA 4F19A 3VLVA 4IY5A 4AQ4A 3H06B 3KZGA 5AE4A 1XT8A 2OWZA 1M5EA 3KFMA 3ISPA 2GQ1A 5BWJA 1TXFA 4JSOA 3UORA 3N6TA 5ICQA 1JW5A 3V5AA 5AA2D 3T1BA 3TFLA 4GX3A 4PFBA 1URGA 4PF6A 4MNPA 2AL4A 1OLCA 2HFBA 3D4CA 4EQ9A 4OWDA 3FD3A 2H4IA 4QFKA 1GGGA 2WKYA 4GOTA 1MXZA 2P0SA 3G3KA 4IO3A 1NKXA 4NG7A 3RYDA 2I0BA 1H44A 1SW4A 1B3HA 2P2AA 1J1NA 2PFZA 1I6BA 5H8QA 3I3VA 1DTZA 2DDKA 1POY1 4E0XA 2QVRA 1WDNA 2RC8A 1DPPA 4OVJA 1A7LA 1D9YA 4GXSB 1Q1KA 1Y4CA 2H99A 3FXQA 4MAGA 2XD2A 4GBVA 4MJOA 3HFUA 4OTEA 4FATA 2FVZA 3MZ9A 3IK6B 4OFJA 5B7DA 4FBPA 1B0LA 3QAXA 4N17A 2AL5A 1INPA 1MY3A 3D1RA 5CMKA 3TQLA 1A8EA 4ZECA 3H6WA 2DWIA 1BLFA 3QUJA 1N3WA 3OO8A 3K6WA 4GXAA 1DTGA 3U93A 3TPAA 2F7BA 3E3KA 4KYSA 2VGQA 1PDAA 4Q5TA 2WBBA 2HPGA 3RY3A 3VLWA 2V84A 2CEYA 4I1DA 3T96B 3VLUA 3BBRA 3M3FA 4JWXA 4QFNA 1USYE 3WAFA 1PB9A 3KBRA 4LZ7A 1NV3A 2OLBA 3RQTA 5CMBA 2Q8MA 1AOVA 2KR0A 4MLVA 4ZEDA 3TMGA 1BK4A 1JW1A 1JVYA 5I3SA 1EYJA 3G3FA 4O94A 2NXOA 2XXYA 1B52A 2AYSA 5DT6A 3TQWA 1B05A 4XTCQ 3ONMA 4G8MA 3FIRA 1H43A 3OO7A 3VE1B 2Q8JA 2ZXTA 3O6GA 4EXLA 3LUZA 1SVXB 3U65A 3RTWB 4H1XA 5TPAB 4ELPA 5ESYA 1EZ9A 4QSCA 5L9OA 4OFOA 4U1OA 2G29A 3KSXA 2XXKA 3KOTA 1QVSA 4U4XA 1PBQA 4RY1A 4BDNA 4R6HA 1DCUA 4MIJA 2H25A 5LOMA 4IR8A 4KYDA 4GX4A 4NWCA 2F7CA 5DW8A 3TCGA 4OEUA 2PFYA 3T93B 4F3GA 2ESNA 2FHYA 3B6QA 1MQHA 1FQEA 1NV1A 3M3LA 4U2RA 1JQFA 1B0HA 1LFIA 1IXHA 3IFCA 5AA2B 2DP8A 3TEPA 2DXRA 3HO7A 3KGCA 1OMPA 3H7MA 1LGBC 5ICTA 4ONYA 3FGSA 1SPIA 1XHYA 1P1OA 2XXHA 2XWIA 3K6VA 3TTRA 4U23A 4WEDA 1FSAA 1VFEA 1NNPA 5I59B 1SW1A 4TQUQ 1FBFA 4R75A 2VD3A 3FV1A 4WKMA 2F34A 3IX1A 2A5TA 3TTMA 4HE1A 4OFLA 1RYOA 2RF1A 4N8YA 4AS5A 2FBPA 1TFAA 1QKBA 5IZ1A 5DVFA 3RUMA 1PEBA 2DXYA 4IO4A 5K2XA 5IKBA 3FVNA 1FTMA 2NUVA 1DBZA 1WVJA 5ET8A 3RT8A 3ZS6A 2VOZA 1NNFA 1OQHA 2YJPA 4YKIA 4G68A 3GBBA 2Z22A 2O68A 1JW4A 1PC3A 2DSFA 4NGUA 4LA9A 3ILTB 4LZ8A 1R9LA 4LVQA 2XWKA 1LAFE 3SEUA 4OESA 4PFYA 1IQ7A 3OSQA 3KN3A 5K2YA 4NAPA 1FBHA 3S9NC 3M3KA 1I69A 4UA8A 4X8RA 4P3LA 4OYVA 5T3JA 1B40A 2PT1A 1AH5A 1QULA 3FBPA 1CE2A 4N81A 2F3BA 1NV0A 5FTIA 5IZZA 1MM7A 1P1QA 3DELB 3TODA 3RPLA 3B6TA 1NNTA 1RDZA 2I58A 3Q27A 4YAHX 3ROJA 3HPIA 4F3SA 1NUXA 2P1SA 3EF7A 1QUKA 1BTJA 3T9VA 1B5HA 2Y5KA 1NUZA 5TP9A 1ZTYA 1WODA 2QFLA 1HSLA 2I48A 3KOSA 2O7IA 4GD5A 4PF8A 2VPNA 3UP9A 3SKPA 4NN3A 1OQGA 4KXPA 3R7XA 4F29A 4H8IA 2XHDA 1O7TA 1VFDA 3UIFA 2WX9A 3LSLA 3HV1A 1P1WA 2ZYNA 1NMUA 5I2KA 2QS4A 2Y7KA 1A40A 5J16A 2V3UA 4IY6A 2BJJX 4JVDA 1EU8A
chains in the Genus database with same CATH topology
4F31B 2XX7A 3S2VA 1B9JA 3C35A 4GF8A 3VVDA 4F1YA 2REGA 4RPNA 1SW2A 1ZKBA 3FVOA 5JTYB 1MPCA 3I6VA 4NF5B 4F1VA 1LFHA 3K1NA 3FXRA 4YU0A 4YB7A 2CMOA 2QSXA 4H65A 4MBPA 4FEBA 3KEIA 1QKAA 4FIMA 1OVTA 1LLSA 3PMXA 4XIGQ 3SETA 3K6UA 3W9WA 1FQFA 3RPWA 2HZLA 1XC1A 4PETA 1MRPA 2X7PA 3QK6A 2B65A 1MQJA 1IZ1A 1FQDA 3SERA 5H8FB 3W15C 5DYHA 1M5DA 1ZLQA 2V3TA 3H4ZA 3S9MC 3A09A 3RGYA 2FNCA 2I4BA 4LZ5A 4TLLB 3RN8A 4ISUA 4I8CA 3L6GA 2DQVA 5IAIA 5CI5A 1P1NA 3BFTA 3GLBA 2KLFA 2GHAA 3E13X 3IOVA 4UACA 1LCTA 4IO2A 2X26A 1Q35A 5DEXA 3USDA 1US5A 2DWHA 1YPNA 5KZTA 4R9GA 5A5XB 1N7WA 3TTKA 1LBBA 1MQGA 3ZKLA 3CFLA 4LQ5A 2GRVA 1Z7NE 1UTBB 4I9DA 2F8DA 3HHFA 4XKPA 3DM0A 2XXRA 3JV9A 1LFGA 3MP1A 1DPEA 2ONSA 4F2OA 1O64A 1UTHB 1ZIUA 1FQCA 5I84A 5HBCA 4LUBA 1B3GA 3RT6B 3VFJA 5KCJA 2VHAA 1O63A 2R71A 3MQ9A 3SEYA 1D9VA 4KCDA 2F5XA 3TKDA 4NF8B 3IR1A 3Q29A 3N6UA 2V93A 3H6TA 2M8CA 1Y1MA 4FAJA 3B7DA 2OK2A 3PV0E 3TCFA 2D5WA 1B3FA 2QS1A 3PPQA 1FTJA 4JDFA 5AA4B 4KR5A 3G3IA 3EPEA 4U22A 3K4UA 4DCXA 4RYAA 4RNSA 4NF4A 5I57A 2QL3A 1N04A 2QRYA 4RJZA 3K02A 2OZZA 2DE2A 4ZZAA 4C1UA 4AB5A 3FASA 3EN3A 4FEDA 3IOTA 3V83A 2I3VA 1Y4TA 2DE4A 1NH7A 2G93A 3C9HA 3MW0A 3TZAA 4JB7A 1ELJA 3MP6A 1MH3A 4JWYA 2OWSA 4JBZA 3TTNA 4HTGA 1QUIA 4QFOA 2GFEA 4H5FA 3U92A 1MXUA 3EQ1A 3FJGA 4LONB 3C32A 3PUYE 3QYTA 4THIA 5M2VA 2ABHA 3R6UA 2QMXA 2NVUB 2X7QA 2OWTA 3GBAA 4P0GA 3VXCA 5I2NB 4HW8A 2HAUA 4DDDA 4NMYA 1XS5A 1MS7A 5DVJA 4X9TA 3K1MA 3G3JA 4ZDMA 3GXAA 1IXCA 4EF2A 3OENA 4ZZEA 4GQOA 2R6GE 5I58B 3OEKA 2DVCA 3PMVA 4R72A 4F2QA 1PB7A 3KN8A 1LBCA 3T22A 4YB5A 2F6PA 5ITOA 1DSNA 2ZYKA 3UGWA 2DOJA 2XD3A 4YMAA 1FTOA 1B4HA 2VD2A 3C34A 3LSWA 4R6YA 5H8SA 3VVEA 5KDTA 5JK4A 2I0CA 4WXJA 1URSA 2D3IA 2ZMBA 4H8JA 3VDFA 2RC9A 4ZEFA 2REJA 1B5IA 4QFLA 1MPDA 3IAZA 1MY2A 3FJMA 2IA4A 2F35A 3Q26A 4GIZA 2XXTA 3A3CA 4M4GA 2H98A 1SYIA 4ELOA 1M5BA 4TOZA 4BDOA 1VR5A 1LSTA 1JETA 4XKNA 3FV2A 4BDQA 1UIVA 2THIA 1A99A 2PMSA 5H8QB 3E9XA 4YMBA 3O28A 1A8FA 3PPOA 4GLIA 1Z7ME 3PGFA 3FVGA 2XXVA 4OXVA 4I62A 1B58A 2O6AA 4NF6A 3RTFB 5J1DA 3OMBA 4ZE9A 1DOTA 1R1NA 5CMMA 1YCJA 1RYXA 3CI8A 1TWYA 4DXBA 3LBSA 4DE8A 2Y7PA 3MVWA 4PFUA 1GV8A 4IO5A 3L6HA 4F18A 1B7HA 1B46A 2O84X 4OQOA 5H8NB 2NOOA 1YTVA 1M5FA 3LC8A 4IO7A 3OEMA 5H8HB 4F39A 5JEIA 2FYIA 1ZBMA 2H9BA 2ZYMA 2Q2CA 3G3HA 4KYEA 2NWJA 1MXXA 3IJXB 2QS2A 4NE4A 2W7YA 4R6KA 3SESA 1TT1A 3IB1A 1MY4A 4Z7EA 5I56A 3TYHA 2F7AA 3BKIB 3CG1A 1II5A 2IEEA 3IO6A 4OMBA 5L8DA 4R9FA 1LAXA 2E0SA 2F78A 1SI0A 3O6HA 1JNFA 4DZ1A 1H3DA 4PE5B 1UQWA 2PX1A 4BDMA 1GTKA 4G68C 3TELA 2HQ0A 3TDJA 1N84A 4YB6A 3U72A 3FUZA 3DP8A 1Y9UA 2ZYOA 3O9PA 4EQBA 1VSOA 4EXKA 3OD7A 2DWJA 4IO6A 3MJNA 4FORA 5CBRA 4KCCA 1B4ZA 3Q28A 2OJTA 1SBPA 3PUVE 1SI1A 3QUFA 2RINA 4F3BA 1I6AA 1BKAA 1Y3NA 1BIYA 4L17A 3MP8A 4X1BA 5B70A 3BFUA 3VVFA 2OBGA 4N13A 5DVIA 5FHNA 1MQDA 4RA1A 4U1ZA 4M1VA 1SDXA 1USYH 4QFPA 4EF1A 2I49A 5DTBA 3LSFB 1PB8A 1IXIA 4KPTA 4IGTA 1PBPA 3CG3A 3V8XB 4MFIA 1MXVA 1XOCA 1SD3A 1YAEA 2VP1A 5CMCA 3C33A 4G8NA 1HSJA 5AA3A 2Z23A 4DXCA 4JXIA 4R73A 1URDA 1JEUA 1FQBA 3OELA 2A5TB 2F97A 1I6QA 1LAHE 2ONKE 1S9TA 3PUXE 2YLNA 4ESXA 4E0WA 2Y7RA 4RK9A 3T66A 1ANFA 4JWOA 3DP4A 2XXXA 2H5YA 3RNNA 2I3WA 3G3GA 4G68B 2ZNTA 2Y7IA 1IXGA 3CIJA 3TUSA 1FQAA 1JEVA 2Q89A 4KFQA 1CB6A 3HSTA 3MZ1A 4QRZA 3KG2A 4QHQA 1NFTA 4MF3A 3ECRA 4DCYA 4LATA 4LQ2A 5FHOA 4ZS9A 1FCKA 1LB8A 3RLFE 3MPKA 4ZEBA 4X48A 4ECFA 4G2ZA 3GZGA 4AB6A 3F11A 4KI0E 4IB2A 1MQIA 2R9JA 3PU5A 2V3QA 3KJTA 2DE3A 5I2NA 3TCHA 2DVZA 5TP9B 1DMBA 1MDP1 2O69A 4JSDA 4ESWA 1MH4A 3SDFA 1SYHA 1B2HA 1RKMA 3PMWA 1AMFA 2GHBA 3K00A 3O2AA 4XXUA 5F7VA 1AIVA 5CRYA 4P11A 2DWAA 3CVGA 1B7ZA 5I2KB 3K01A 3HN0A 1FTLA 1LAGE 1ATGA 3IOWA 3C31A 2PVUA 1SQYA 3EHUA 3FVKA 5TPAA 3DLNA 4FECA 4O3BA 3DP6A 1B1HA 4H0WA 2UVJA 3PD8A 1NH8A 4U21A 3E4RA 3T9HB 3LR1A 5CBSA 3A3UA 4FE8A 4F3PA 3SEXA 3FJ7A 3N26A 1IUDA 2O1LA 1Y20A 1OLAA 1A54A 3EHTA 3CFZA 4G4PA 4RK2A 2QPQA 4OERA 2I6EA 4R2BA 3HCQA 3EHSA 5EHSA 4HCWA 4QSEA 1AL3A 3O6IA 4GFRA 3Q25A 1S50A 3D4GA 2QMWA 1D4NA 1Y3PA 1B6HA 3K0VA 5AA2A 3FXUA 2HXWA 4Q8RA 1B1XA 1MXYA 1FW0A 3QIMA 2UYFA 4NWDA 1QUJA 2I4CA 3C36A 1MPBA 4Z0IA 5I59A 2PYYA 3KJ7A 4N07A 3N5LA 2F6GA 1XVXA 1TFDA 2ANJA 4GL8A 3H6UA 4EDPA 3HHGA 4GL0A 5DEXB 3I5OA 4R2FA 5HPQA 4ELRA 1Y1ZA 5H8NA 3MWBA 1OIBA 1B3EA 3ODBA 3UN6A 3JZJA 5H8HA 1R6ZA 5CM6A 1S7YA 3SEWA 2HEUA 2RC7A 4POWA 3H3GA 1JVXA 2RCBA 1LB9A 4H5GA 2O7UA 3CFXA 3O66A 2HCAA 5HM4B 1BP5A 4MLQA 2ZNUA 5ISUA 1IEJA 3T9UA 5KCJB 1R9QA 1M5CA 3IOUA 1N3XA 1IIWA 4XKQA 1MXWA 2V25A 4DXUA 1VE4A 4FJPA 2DS9A 3PPRA 2ALUA 3VXBA 4G77A 3ILUB 4KD5A 1H45A 4KQPA 4GRKA 3OSRA 4O3AA 3IO4A 1P99A 4WEPA 3W9VA 1D3KA 3KSJA 1A55A 4OENA 2UYEA 3OO9A 5ELVA 4NF4B 1B32A 4NTLA 4BLAA 1Y3QA 5I57B 4K3FA 2PBWA 4U4SA 4YICA 3O97A 2OCUA 2Q2AA 1LCFA 4DLDA 3IORA 3MUQA 4IGRA 2XXPA 1NNKA 3ZSFA 1MM6A 4G8HA 4DIGA 2GH9A 3QSLA 3UK4A 1MG1A 3CR9A 5JTYA 2XXIA 4NF5A 4PQJA 3G7WA 5L9SA 3H6VA 3U8QA 3K1PA 1T0KA 4ZE8A 3O29A 3U94A 4BDLA 1B5JA 3UA8A 2D21A 1ZJLA 3KN7A 5F1QA 1ZMGA 3U1OA 2B3BA 1EZPA 3LSXA 4F22A 4KHZE 4GVOA 4QF9A 3ZKKA 4HCYA 2ZNSA 4RPOA 5H8FA 2Y7WA 2Y84A 4C0RA 1GVCA 4F1UA 3S4UA 4MH5A 3VV5A 4YZZA 2YPNA 2HZKA 4EUOA 3CSBA 1N7XA 4YKKA 3FZVA 4ZEIA 5KDTB 1POTA 2QJEA 2XXQA 2FA7A 5ITPA 5A5XA 4PFWA 3C4MA 2O51A 1UTBA 4EQ7A 2CZLA 1L5TA 4RXLA 1MDQA 4BDRA 3MVXA 3THIA 2O1MA 4N6PA 3PPNA 2RKMA 3K6XA 1UTHA 2XX9A 2E1SA 2UVGA 1P1UA 3WAEA 1N76A 2Z8EA 3MC2A 4OHNA 4C1TA 3OXNA 4ND9A 5BUUA 2RCAA 5AA1A 3FATA 3T9XB 1B51A 5FTHA 4H6DA 4NF8A 5TU0A 3PUWE 4NF6B 1B7UA 3QXMA 4PFTA 3MBPA 4HS7A 4O3CA 3R26A 4NEDA 1QW0A 5L9MA 4P0IA 2UXAA 3H03A 4TLMB 5EHMA 4X1DA 3IB2A 1MY1A 1F9BA 3IB0A 3JYRA 3OO6A 5AA4A 3PPPA 3TTLA 1ZU0A 2Z8FA 4XKRA 1XVYA 4LP2B 4Q0CA 3CSGA 3AXFA 3P7IA 4H67A 3S9LC 2A5SA 2Z8DA 4YKPA 2Q88A 1UIUA 1N0TA 3PD9A 4QSDA 4ELQA 5CC2A 4OETA 2XXWA 1KWHA 1EH3A 3TAJA 5I56B 1HSEA 4R74A 4YKJA 1FTKA 5EYFA 2QS3A 1SW5A 3MAMA 4GWOA 4POXA 2B3FA 2AIXA 1QJMA 2LAOA 1GR2A 2UVIA 2XX8A 3MVZA 1NL5A 5FHMA 2DYXA 4OEVA 2ONRA 2PT2A 3MZBA 4Q30B 3LUYA 4ZEKA 3PUZE 3M8UA 2XXUA 5I58A 3K2DA 3IL1B 1MY0A 3S9EA 3IJOB 1H76A 2UVHA 4PP0A 1B3LA 2Q9TA 1OVBA 3N94A 3B6WA 1US4A 4OZ9A 3MPLA 3CRBA 1EZOA 2F36A 3V89B 3MVYA 3SEVA 3OOAA 1IITA 2HAVA 4F19A 3VLVA 4IY5A 4AQ4A 3H06B 3KZGA 5AE4A 1XT8A 1M5EA 3KFMA 5BWJA 1TXFA 4JSOA 3UORA 3N6TA 5ICQA 1JW5A 3V5AA 5AA2D 3TFLA 1URGA 2AL4A 1OLCA 2HFBA 3D4CA 4EQ9A 4OWDA 3FD3A 2H4IA 4QFKA 1GGGA 2WKYA 4GOTA 1MXZA 2P0SA 3G3KA 4IO3A 1NKXA 2I0BA 1H44A 1SW4A 1B3HA 2P2AA 1J1NA 1I6BA 5H8QA 3I3VA 1DTZA 1POY1 4E0XA 1WDNA 2RC8A 1DPPA 4OVJA 1A7LA 1D9YA 4GXSB 1Q1KA 1Y4CA 2H99A 3FXQA 2XD2A 4OTEA 4FATA 3MZ9A 3IK6B 4OFJA 5B7DA 1B0LA 3QAXA 2AL5A 1MY3A 5CMKA 3TQLA 1A8EA 4ZECA 3H6WA 2DWIA 1BLFA 3QUJA 1N3WA 3OO8A 3K6WA 4GXAA 1DTGA 3U93A 3TPAA 2F7BA 3E3KA 4KYSA 2VGQA 1PDAA 4Q5TA 3RY3A 3VLWA 2V84A 4I1DA 3T96B 3VLUA 3BBRA 3M3FA 4JWXA 4QFNA 1USYE 3WAFA 1PB9A 3KBRA 4LZ7A 2OLBA 3RQTA 5CMBA 1AOVA 4MLVA 4ZEDA 3TMGA 1JW1A 1JVYA 3G3FA 2NXOA 2XXYA 1B52A 2AYSA 5DT6A 3TQWA 1B05A 4XTCQ 3ONMA 4G8MA 3FIRA 1H43A 3OO7A 3VE1B 2Q8JA 2ZXTA 3O6GA 4EXLA 1SVXB 3RTWB 4H1XA 5TPAB 4ELPA 1EZ9A 4QSCA 5L9OA 4OFOA 4U1OA 2G29A 3KSXA 3KOTA 1QVSA 4U4XA 1PBQA 4RY1A 4BDNA 4R6HA 2H25A 5LOMA 4KYDA 4NWCA 2F7CA 3TCGA 4OEUA 3T93B 4F3GA 2ESNA 3B6QA 1MQHA 1FQEA 3M3LA 4U2RA 1JQFA 1B0HA 1LFIA 1IXHA 5AA2B 2DP8A 3TEPA 2DXRA 3HO7A 3KGCA 1OMPA 3H7MA 1LGBC 5ICTA 4ONYA 3FGSA 1XHYA 1P1OA 2XXHA 3K6VA 3TTRA 4U23A 4WEDA 1VFEA 1NNPA 5I59B 1SW1A 4TQUQ 4R75A 2VD3A 3FV1A 4WKMA 2F34A 3IX1A 2A5TA 3TTMA 4OFLA 1RYOA 2RF1A 1TFAA 1QKBA 5DVFA 3RUMA 1PEBA 2DXYA 4IO4A 5K2XA 5IKBA 3FVNA 1FTMA 2NUVA 1WVJA 3RT8A 3ZS6A 2VOZA 1NNFA 1OQHA 2YJPA 4YKIA 4G68A 3GBBA 2Z22A 2O68A 1JW4A 1PC3A 2DSFA 4LA9A 3ILTB 4LZ8A 1R9LA 4LVQA 1LAFE 3SEUA 4OESA 4PFYA 1IQ7A 3OSQA 3KN3A 5K2YA 3S9NC 3M3KA 1I69A 4UA8A 4OYVA 1B40A 2PT1A 1AH5A 1QULA 1CE2A 5FTIA 1MM7A 1P1QA 3DELB 3TODA 3B6TA 1NNTA 2I58A 3Q27A 4YAHX 3HPIA 4F3SA 2P1SA 3EF7A 1QUKA 1BTJA 3T9VA 1B5HA 5TP9A 1ZTYA 1WODA 1HSLA 2I48A 3KOSA 2O7IA 4GD5A 3UP9A 3SKPA 1OQGA 3R7XA 4F29A 4H8IA 2XHDA 1O7TA 1VFDA 3UIFA 3LSLA 3HV1A 1P1WA 2ZYNA 1NMUA 5I2KA 2QS4A 2Y7KA 1A40A 2V3UA 4IY6A 2BJJX 1EU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F31 B;  2XX7 A;  3S2V A;  1B9J A;  3C35 A;  4GF8 A;  3VVD A;  4F1Y A;  2REG A;  4RPN A;  1SW2 A;  1ZKB A;  3FVO A;  5JTY B;  1MPC A;  3I6V A;  4NF5 B;  4F1V A;  1LFH A;  3K1N A;  3FXR A;  4YU0 A;  4YB7 A;  2CMO A;  2QSX A;  4H65 A;  4MBP A;  4FEB A;  3KEI A;  1QKA A;  4FIM A;  1OVT A;  1LLS A;  3PMX A;  4XIG Q;  3SET A;  3K6U A;  3W9W A;  1FQF A;  3RPW A;  2HZL A;  1XC1 A;  4PET A;  1MRP A;  2X7P A;  3QK6 A;  2B65 A;  1MQJ A;  1IZ1 A;  1FQD A;  3SER A;  5H8F B;  3W15 C;  5DYH A;  1M5D A;  1ZLQ A;  2V3T A;  3H4Z A;  3S9M C;  3A09 A;  3RGY A;  2FNC A;  2I4B A;  4LZ5 A;  4TLL B;  3RN8 A;  4ISU A;  4I8C A;  3L6G A;  2DQV A;  5IAI A;  5CI5 A;  1P1N A;  3BFT A;  3GLB A;  2KLF A;  2GHA A;  3E13 X;  3IOV A;  4UAC A;  1LCT A;  4IO2 A;  2X26 A;  1Q35 A;  5DEX A;  3USD A;  1US5 A;  2DWH A;  1YPN A;  5KZT A;  4R9G A;  5A5X B;  1N7W A;  3TTK A;  1LBB A;  1MQG A;  3ZKL A;  3CFL A;  4LQ5 A;  2GRV A;  1Z7N E;  1UTB B;  4I9D A;  2F8D A;  3HHF A;  4XKP A;  3DM0 A;  2XXR A;  3JV9 A;  1LFG A;  3MP1 A;  1DPE A;  2ONS A;  4F2O A;  1O64 A;  1UTH B;  1ZIU A;  1FQC A;  5I84 A;  5HBC A;  4LUB A;  1B3G A;  3RT6 B;  3VFJ A;  5KCJ A;  2VHA A;  1O63 A;  2R71 A;  3MQ9 A;  3SEY A;  1D9V A;  4KCD A;  2F5X A;  3TKD A;  4NF8 B;  3IR1 A;  3Q29 A;  3N6U A;  2V93 A;  3H6T A;  2M8C A;  1Y1M A;  4FAJ A;  3B7D A;  2OK2 A;  3PV0 E;  3TCF A;  2D5W A;  1B3F A;  2QS1 A;  3PPQ A;  1FTJ A;  4JDF A;  5AA4 B;  4KR5 A;  3G3I A;  3EPE A;  4U22 A;  3K4U A;  4DCX A;  4RYA A;  4RNS A;  4NF4 A;  5I57 A;  2QL3 A;  1N04 A;  2QRY A;  4RJZ A;  3K02 A;  2OZZ A;  2DE2 A;  4ZZA A;  4C1U A;  4AB5 A;  3FAS A;  3EN3 A;  4FED A;  3IOT A;  3V83 A;  2I3V A;  1Y4T A;  2DE4 A;  1NH7 A;  2G93 A;  3C9H A;  3MW0 A;  3TZA A;  4JB7 A;  1ELJ A;  3MP6 A;  1MH3 A;  4JWY A;  2OWS A;  4JBZ A;  3TTN A;  4HTG A;  1QUI A;  4QFO A;  2GFE A;  4H5F A;  3U92 A;  1MXU A;  3EQ1 A;  3FJG A;  4LON B;  3C32 A;  3PUY E;  3QYT A;  4THI A;  5M2V A;  2ABH A;  3R6U A;  2QMX A;  2NVU B;  2X7Q A;  2OWT A;  3GBA A;  4P0G A;  3VXC A;  5I2N B;  4HW8 A;  2HAU A;  4DDD A;  4NMY A;  1XS5 A;  1MS7 A;  5DVJ A;  4X9T A;  3K1M A;  3G3J A;  4ZDM A;  3GXA A;  1IXC A;  4EF2 A;  3OEN A;  4ZZE A;  4GQO A;  2R6G E;  5I58 B;  3OEK A;  2DVC A;  3PMV A;  4R72 A;  4F2Q A;  1PB7 A;  3KN8 A;  1LBC A;  3T22 A;  4YB5 A;  2F6P A;  5ITO A;  1DSN A;  2ZYK A;  3UGW A;  2DOJ A;  2XD3 A;  4YMA A;  1FTO A;  1B4H A;  2VD2 A;  3C34 A;  3LSW A;  4R6Y A;  5H8S A;  3VVE A;  5KDT A;  5JK4 A;  2I0C A;  4WXJ A;  1URS A;  2D3I A;  2ZMB A;  4H8J A;  3VDF A;  2RC9 A;  4ZEF A;  2REJ A;  1B5I A;  4QFL A;  1MPD A;  3IAZ A;  1MY2 A;  3FJM A;  2IA4 A;  2F35 A;  3Q26 A;  4GIZ A;  2XXT A;  3A3C A;  4M4G A;  2H98 A;  1SYI A;  4ELO A;  1M5B A;  4TOZ A;  4BDO A;  1VR5 A;  1LST A;  1JET A;  4XKN A;  3FV2 A;  4BDQ A;  1UIV A;  2THI A;  1A99 A;  2PMS A;  5H8Q B;  3E9X A;  4YMB A;  3O28 A;  1A8F A;  3PPO A;  4GLI A;  1Z7M E;  3PGF A;  3FVG A;  2XXV A;  4OXV A;  4I62 A;  1B58 A;  2O6A A;  4NF6 A;  3RTF B;  5J1D A;  3OMB A;  4ZE9 A;  1DOT A;  1R1N A;  5CMM A;  1YCJ A;  1RYX A;  3CI8 A;  1TWY A;  4DXB A;  3LBS A;  4DE8 A;  2Y7P A;  3MVW A;  4PFU A;  1GV8 A;  4IO5 A;  3L6H A;  4F18 A;  1B7H A;  1B46 A;  2O84 X;  4OQO A;  5H8N B;  2NOO A;  1YTV A;  1M5F A;  3LC8 A;  4IO7 A;  3OEM A;  5H8H B;  4F39 A;  5JEI A;  2FYI A;  1ZBM A;  2H9B A;  2ZYM A;  2Q2C A;  3G3H A;  4KYE A;  2NWJ A;  1MXX A;  3IJX B;  2QS2 A;  4NE4 A;  2W7Y A;  4R6K A;  3SES A;  1TT1 A;  3IB1 A;  1MY4 A;  4Z7E A;  5I56 A;  3TYH A;  2F7A A;  3BKI B;  3CG1 A;  1II5 A;  2IEE A;  3IO6 A;  4OMB A;  5L8D A;  4R9F A;  1LAX A;  2E0S A;  2F78 A;  1SI0 A;  3O6H A;  1JNF A;  4DZ1 A;  1H3D A;  4PE5 B;  1UQW A;  2PX1 A;  4BDM A;  1GTK A;  4G68 C;  3TEL A;  2HQ0 A;  3TDJ A;  1N84 A;  4YB6 A;  3U72 A;  3FUZ A;  3DP8 A;  1Y9U A;  2ZYO A;  3O9P A;  4EQB A;  1VSO A;  4EXK A;  3OD7 A;  2DWJ A;  4IO6 A;  3MJN A;  4FOR A;  5CBR A;  4KCC A;  1B4Z A;  3Q28 A;  2OJT A;  1SBP A;  3PUV E;  1SI1 A;  3QUF A;  2RIN A;  4F3B A;  1I6A A;  1BKA A;  1Y3N A;  1BIY A;  4L17 A;  3MP8 A;  4X1B A;  5B70 A;  3BFU A;  3VVF A;  2OBG A;  4N13 A;  5DVI A;  5FHN A;  1MQD A;  4RA1 A;  4U1Z A;  4M1V A;  1SDX A;  1USY H;  4QFP A;  4EF1 A;  2I49 A;  5DTB A;  3LSF B;  1PB8 A;  1IXI A;  4KPT A;  4IGT A;  1PBP A;  3CG3 A;  3V8X B;  4MFI A;  1MXV A;  1XOC A;  1SD3 A;  1YAE A;  2VP1 A;  5CMC A;  3C33 A;  4G8N A;  1HSJ A;  5AA3 A;  2Z23 A;  4DXC A;  4JXI A;  4R73 A;  1URD A;  1JEU A;  1FQB A;  3OEL A;  2A5T B;  2F97 A;  1I6Q A;  1LAH E;  2ONK E;  1S9T A;  3PUX E;  2YLN A;  4ESX A;  4E0W A;  2Y7R A;  4RK9 A;  3T66 A;  1ANF A;  4JWO A;  3DP4 A;  2XXX A;  2H5Y A;  3RNN A;  2I3W A;  3G3G A;  4G68 B;  2ZNT A;  2Y7I A;  1IXG A;  3CIJ A;  3TUS A;  1FQA A;  1JEV A;  2Q89 A;  4KFQ A;  1CB6 A;  3HST A;  3MZ1 A;  4QRZ A;  3KG2 A;  4QHQ A;  1NFT A;  4MF3 A;  3ECR A;  4DCY A;  4LAT A;  4LQ2 A;  5FHO A;  4ZS9 A;  1FCK A;  1LB8 A;  3RLF E;  3MPK A;  4ZEB A;  4X48 A;  4ECF A;  4G2Z A;  3GZG A;  4AB6 A;  3F11 A;  4KI0 E;  4IB2 A;  1MQI A;  2R9J A;  3PU5 A;  2V3Q A;  3KJT A;  2DE3 A;  5I2N A;  3TCH A;  2DVZ A;  5TP9 B;  1DMB A;  1MDP 1;  2O69 A;  4JSD A;  4ESW A;  1MH4 A;  3SDF A;  1SYH A;  1B2H A;  1RKM A;  3PMW A;  1AMF A;  2GHB A;  3K00 A;  3O2A A;  4XXU A;  5F7V A;  1AIV A;  5CRY A;  4P11 A;  2DWA A;  3CVG A;  1B7Z A;  5I2K B;  3K01 A;  3HN0 A;  1FTL A;  1LAG E;  1ATG A;  3IOW A;  3C31 A;  2PVU A;  1SQY A;  3EHU A;  3FVK A;  5TPA A;  3DLN A;  4FEC A;  4O3B A;  3DP6 A;  1B1H A;  4H0W A;  2UVJ A;  3PD8 A;  1NH8 A;  4U21 A;  3E4R A;  3T9H B;  3LR1 A;  5CBS A;  3A3U A;  4FE8 A;  4F3P A;  3SEX A;  3FJ7 A;  3N26 A;  1IUD A;  2O1L A;  1Y20 A;  1OLA A;  1A54 A;  3EHT A;  3CFZ A;  4G4P A;  4RK2 A;  2QPQ A;  4OER A;  2I6E A;  4R2B A;  3HCQ A;  3EHS A;  5EHS A;  4HCW A;  4QSE A;  1AL3 A;  3O6I A;  4GFR A;  3Q25 A;  1S50 A;  3D4G A;  2QMW A;  1D4N A;  1Y3P A;  1B6H A;  3K0V A;  5AA2 A;  3FXU A;  2HXW A;  4Q8R A;  1B1X A;  1MXY A;  1FW0 A;  3QIM A;  2UYF A;  4NWD A;  1QUJ A;  2I4C A;  3C36 A;  1MPB A;  4Z0I A;  5I59 A;  2PYY A;  3KJ7 A;  4N07 A;  3N5L A;  2F6G A;  1XVX A;  1TFD A;  2ANJ A;  4GL8 A;  3H6U A;  4EDP A;  3HHG A;  4GL0 A;  5DEX B;  3I5O A;  4R2F A;  5HPQ A;  4ELR A;  1Y1Z A;  5H8N A;  3MWB A;  1OIB A;  1B3E A;  3ODB A;  3UN6 A;  3JZJ A;  5H8H A;  1R6Z A;  5CM6 A;  1S7Y A;  3SEW A;  2HEU A;  2RC7 A;  4POW A;  3H3G A;  1JVX A;  2RCB A;  1LB9 A;  4H5G A;  2O7U A;  3CFX A;  3O66 A;  2HCA A;  5HM4 B;  1BP5 A;  4MLQ A;  2ZNU A;  5ISU A;  1IEJ A;  3T9U A;  5KCJ B;  1R9Q A;  1M5C A;  3IOU A;  1N3X A;  1IIW A;  4XKQ A;  1MXW A;  2V25 A;  4DXU A;  1VE4 A;  4FJP A;  2DS9 A;  3PPR A;  2ALU A;  3VXB A;  4G77 A;  3ILU B;  4KD5 A;  1H45 A;  4KQP A;  4GRK A;  3OSR A;  4O3A A;  3IO4 A;  1P99 A;  4WEP A;  3W9V A;  1D3K A;  3KSJ A;  1A55 A;  4OEN A;  2UYE A;  3OO9 A;  5ELV A;  4NF4 B;  1B32 A;  4NTL A;  4BLA A;  1Y3Q A;  5I57 B;  4K3F A;  2PBW A;  4U4S A;  4YIC A;  3O97 A;  2OCU A;  2Q2A A;  1LCF A;  4DLD A;  3IOR A;  3MUQ A;  4IGR A;  2XXP A;  1NNK A;  3ZSF A;  1MM6 A;  4G8H A;  4DIG A;  2GH9 A;  3QSL A;  3UK4 A;  1MG1 A;  3CR9 A;  5JTY A;  2XXI A;  4NF5 A;  4PQJ A;  3G7W A;  5L9S A;  3H6V A;  3U8Q A;  3K1P A;  1T0K A;  4ZE8 A;  3O29 A;  3U94 A;  4BDL A;  1B5J A;  3UA8 A;  2D21 A;  1ZJL A;  3KN7 A;  5F1Q A;  1ZMG A;  3U1O A;  2B3B A;  1EZP A;  3LSX A;  4F22 A;  4KHZ E;  4GVO A;  4QF9 A;  3ZKK A;  4HCY A;  2ZNS A;  4RPO A;  5H8F A;  2Y7W A;  2Y84 A;  4C0R A;  1GVC A;  4F1U A;  3S4U A;  4MH5 A;  3VV5 A;  4YZZ A;  2YPN A;  2HZK A;  4EUO A;  3CSB A;  1N7X A;  4YKK A;  3FZV A;  4ZEI A;  5KDT B;  1POT A;  2QJE A;  2XXQ A;  2FA7 A;  5ITP A;  5A5X A;  4PFW A;  3C4M A;  2O51 A;  1UTB A;  4EQ7 A;  2CZL A;  1L5T A;  4RXL A;  1MDQ A;  4BDR A;  3MVX A;  3THI A;  2O1M A;  4N6P A;  3PPN A;  2RKM A;  3K6X A;  1UTH A;  2XX9 A;  2E1S A;  2UVG A;  1P1U A;  3WAE A;  1N76 A;  2Z8E A;  3MC2 A;  4OHN A;  4C1T A;  3OXN A;  4ND9 A;  5BUU A;  2RCA A;  5AA1 A;  3FAT A;  3T9X B;  1B51 A;  5FTH A;  4H6D A;  4NF8 A;  5TU0 A;  3PUW E;  4NF6 B;  1B7U A;  3QXM A;  4PFT A;  3MBP A;  4HS7 A;  4O3C A;  3R26 A;  4NED A;  1QW0 A;  5L9M A;  4P0I A;  2UXA A;  3H03 A;  4TLM B;  5EHM A;  4X1D A;  3IB2 A;  1MY1 A;  1F9B A;  3IB0 A;  3JYR A;  3OO6 A;  5AA4 A;  3PPP A;  3TTL A;  1ZU0 A;  2Z8F A;  4XKR A;  1XVY A;  4LP2 B;  4Q0C A;  3CSG A;  3AXF A;  3P7I A;  4H67 A;  3S9L C;  2A5S A;  2Z8D A;  4YKP A;  2Q88 A;  1UIU A;  1N0T A;  3PD9 A;  4QSD A;  4ELQ A;  5CC2 A;  4OET A;  2XXW A;  1KWH A;  1EH3 A;  3TAJ A;  5I56 B;  1HSE A;  4R74 A;  4YKJ A;  1FTK A;  5EYF A;  2QS3 A;  1SW5 A;  3MAM A;  4GWO A;  4POX A;  2B3F A;  2AIX A;  1QJM A;  2LAO A;  1GR2 A;  2UVI A;  2XX8 A;  3MVZ A;  1NL5 A;  5FHM A;  2DYX A;  4OEV A;  2ONR A;  2PT2 A;  3MZB A;  4Q30 B;  3LUY A;  4ZEK A;  3PUZ E;  3M8U A;  2XXU A;  5I58 A;  3K2D A;  3IL1 B;  1MY0 A;  3S9E A;  3IJO B;  1H76 A;  2UVH A;  4PP0 A;  1B3L A;  2Q9T A;  1OVB A;  3N94 A;  3B6W A;  1US4 A;  4OZ9 A;  3MPL A;  3CRB A;  1EZO A;  2F36 A;  3V89 B;  3MVY A;  3SEV A;  3OOA A;  1IIT A;  2HAV A;  4F19 A;  3VLV A;  4IY5 A;  4AQ4 A;  3H06 B;  3KZG A;  5AE4 A;  1XT8 A;  1M5E A;  3KFM A;  5BWJ A;  1TXF A;  4JSO A;  3UOR A;  3N6T A;  5ICQ A;  1JW5 A;  3V5A A;  5AA2 D;  3TFL A;  1URG A;  2AL4 A;  1OLC A;  2HFB A;  3D4C A;  4EQ9 A;  4OWD A;  3FD3 A;  2H4I A;  4QFK A;  1GGG A;  2WKY A;  4GOT A;  1MXZ A;  2P0S A;  3G3K A;  4IO3 A;  1NKX A;  2I0B A;  1H44 A;  1SW4 A;  1B3H A;  2P2A A;  1J1N A;  1I6B A;  5H8Q A;  3I3V A;  1DTZ A;  1POY 1;  4E0X A;  1WDN A;  2RC8 A;  1DPP A;  4OVJ A;  1A7L A;  1D9Y A;  4GXS B;  1Q1K A;  1Y4C A;  2H99 A;  3FXQ A;  2XD2 A;  4OTE A;  4FAT A;  3MZ9 A;  3IK6 B;  4OFJ A;  5B7D A;  1B0L A;  3QAX A;  2AL5 A;  1MY3 A;  5CMK A;  3TQL A;  1A8E A;  4ZEC A;  3H6W A;  2DWI A;  1BLF A;  3QUJ A;  1N3W A;  3OO8 A;  3K6W A;  4GXA A;  1DTG A;  3U93 A;  3TPA A;  2F7B A;  3E3K A;  4KYS A;  2VGQ A;  1PDA A;  4Q5T A;  3RY3 A;  3VLW A;  2V84 A;  4I1D A;  3T96 B;  3VLU A;  3BBR A;  3M3F A;  4JWX A;  4QFN A;  1USY E;  3WAF A;  1PB9 A;  3KBR A;  4LZ7 A;  2OLB A;  3RQT A;  5CMB A;  1AOV A;  4MLV A;  4ZED A;  3TMG A;  1JW1 A;  1JVY A;  3G3F A;  2NXO A;  2XXY A;  1B52 A;  2AYS A;  5DT6 A;  3TQW A;  1B05 A;  4XTC Q;  3ONM A;  4G8M A;  3FIR A;  1H43 A;  3OO7 A;  3VE1 B;  2Q8J A;  2ZXT A;  3O6G A;  4EXL A;  1SVX B;  3RTW B;  4H1X A;  5TPA B;  4ELP A;  1EZ9 A;  4QSC A;  5L9O A;  4OFO A;  4U1O A;  2G29 A;  3KSX A;  3KOT A;  1QVS A;  4U4X A;  1PBQ A;  4RY1 A;  4BDN A;  4R6H A;  2H25 A;  5LOM A;  4KYD A;  4NWC A;  2F7C A;  3TCG A;  4OEU A;  3T93 B;  4F3G A;  2ESN A;  3B6Q A;  1MQH A;  1FQE A;  3M3L A;  4U2R A;  1JQF A;  1B0H A;  1LFI A;  1IXH A;  5AA2 B;  2DP8 A;  3TEP A;  2DXR A;  3HO7 A;  3KGC A;  1OMP A;  3H7M A;  1LGB C;  5ICT A;  4ONY A;  3FGS A;  1XHY A;  1P1O A;  2XXH A;  3K6V A;  3TTR A;  4U23 A;  4WED A;  1VFE A;  1NNP A;  5I59 B;  1SW1 A;  4TQU Q;  4R75 A;  2VD3 A;  3FV1 A;  4WKM A;  2F34 A;  3IX1 A;  2A5T A;  3TTM A;  4OFL A;  1RYO A;  2RF1 A;  1TFA A;  1QKB A;  5DVF A;  3RUM A;  1PEB A;  2DXY A;  4IO4 A;  5K2X A;  5IKB A;  3FVN A;  1FTM A;  2NUV A;  1WVJ A;  3RT8 A;  3ZS6 A;  2VOZ A;  1NNF A;  1OQH A;  2YJP A;  4YKI A;  4G68 A;  3GBB A;  2Z22 A;  2O68 A;  1JW4 A;  1PC3 A;  2DSF A;  4LA9 A;  3ILT B;  4LZ8 A;  1R9L A;  4LVQ A;  1LAF E;  3SEU A;  4OES A;  4PFY A;  1IQ7 A;  3OSQ A;  3KN3 A;  5K2Y A;  3S9N C;  3M3K A;  1I69 A;  4UA8 A;  4OYV A;  1B40 A;  2PT1 A;  1AH5 A;  1QUL A;  1CE2 A;  5FTI A;  1MM7 A;  1P1Q A;  3DEL B;  3TOD A;  3B6T A;  1NNT A;  2I58 A;  3Q27 A;  4YAH X;  3HPI A;  4F3S A;  2P1S A;  3EF7 A;  1QUK A;  1BTJ A;  3T9V A;  1B5H A;  5TP9 A;  1ZTY A;  1WOD A;  1HSL A;  2I48 A;  3KOS A;  2O7I A;  4GD5 A;  3UP9 A;  3SKP A;  1OQG A;  3R7X A;  4F29 A;  4H8I A;  2XHD A;  1O7T A;  1VFD A;  3UIF A;  3LSL A;  3HV1 A;  1P1W A;  2ZYN A;  1NMU A;  5I2K A;  2QS4 A;  2Y7K A;  1A40 A;  2V3U A;  4IY6 A;  2BJJ X;  1EU8 A; 
#chains in the Genus database with same CATH topology
 1NV4 A;  4F31 B;  2XX7 A;  3MYU A;  3S2V A;  1B9J A;  3C35 A;  4HE2 A;  4GF8 A;  3VVD A;  4F1Y A;  2REG A;  4RPN A;  1SW2 A;  1ZKB A;  3FVO A;  5JTY B;  1MPC A;  3I6V A;  4GWS A;  4PDH A;  4NF5 B;  1IMF A;  4F1V A;  1LFH A;  4P9K A;  3K1N A;  3FXR A;  4YU0 A;  4YB7 A;  2CMO A;  2QSX A;  4H65 A;  4MBP A;  4QBA A;  4FEB A;  3KEI A;  4PAK A;  1QKA A;  4FIM A;  2BJI A;  1OVT A;  1LLS A;  4MCO A;  3PMX A;  4XIG Q;  3SET A;  3K6U A;  3W9W A;  1FPG A;  1FQF A;  3RPW A;  2HZL A;  4PBQ A;  1XC1 A;  4PET A;  1MRP A;  2OX3 A;  2X7P A;  3QK6 A;  2B65 A;  1MQJ A;  1IZ1 A;  4PCD A;  1FQD A;  3SER A;  5H8F B;  3W15 C;  5DYH A;  1M5D A;  1ZLQ A;  3CHG A;  2V3T A;  3H4Z A;  3S9M C;  3A09 A;  5IZ3 B;  3RGY A;  2FNC A;  2I4B A;  4LZ5 A;  4TLL B;  3RN8 A;  4ISU A;  4I8C A;  3L6G A;  2DQV A;  5IAI A;  5CI5 A;  1P1N A;  3BFT A;  3GLB A;  2KLF A;  2GHA A;  3E13 X;  2ZZV A;  3IOV A;  4UAC A;  1LCT A;  4IO2 A;  2X26 A;  1Q35 A;  5DEX A;  3USD A;  1US5 A;  2DWH A;  1YPN A;  5KZT A;  4R9G A;  5A5X B;  1N7W A;  3TTK A;  4JVI A;  1LBB A;  1MQG A;  1NUW A;  3ZKL A;  5ET6 A;  3CFL A;  2L5V A;  4LQ5 A;  4N15 A;  2GRV A;  1Z7N E;  1UTB B;  4I9D A;  4PDD A;  5EYH A;  2F8D A;  3HHF A;  5EQ7 A;  4XKP A;  3DM0 A;  2XXR A;  3JV9 A;  1LFG A;  2VPO A;  4JVC A;  3MP1 A;  1DPE A;  2ONS A;  4F2O A;  1O64 A;  1UTH B;  1ZIU A;  1FQC A;  5EQA A;  1FPE A;  5I84 A;  5HBC A;  4LUB A;  1B3G A;  3RT6 B;  3VFJ A;  5KCJ A;  2VHA A;  1O63 A;  2R71 A;  3MQ9 A;  3SEY A;  1D9V A;  4KCD A;  2F5X A;  3TKD A;  4NF8 B;  3IR1 A;  3Q29 A;  3N6U A;  2V93 A;  3H6T A;  2M8C A;  1Y1M A;  4FAJ A;  3B7D A;  3EKI A;  2OK2 A;  3PV0 E;  3TCF A;  2D5W A;  1B3F A;  2QS1 A;  5EQ8 A;  3PPQ A;  1FTJ A;  4JDF A;  3QMF A;  4GWX A;  1VDW A;  5AA4 B;  4KR5 A;  3G3I A;  3EPE A;  4U22 A;  3K4U A;  4DCX A;  4RYA A;  4RNS A;  4NF4 A;  5I57 A;  2QL3 A;  1N04 A;  2QRY A;  4RJZ A;  3K02 A;  1LBW A;  2OZZ A;  2DE2 A;  3A29 A;  1FTA A;  4ZZA A;  2Y5L A;  3PTY A;  4LN5 A;  4PGN A;  4OVQ A;  4C1U A;  4AB5 A;  3FAS A;  3EN3 A;  4FED A;  3IOT A;  3V83 A;  2I3V A;  1Y4T A;  2DE4 A;  1NH7 A;  2G93 A;  3C9H A;  3MW0 A;  3TZA A;  4JB7 A;  1ELJ A;  3MP6 A;  1MH3 A;  4JWY A;  2OWS A;  4JBZ A;  3TTN A;  4HTG A;  5ET7 A;  1QUI A;  4QFO A;  2FIE A;  2GFE A;  4H5F A;  3U92 A;  1MXU A;  3EQ1 A;  3FJG A;  4LON B;  3C32 A;  4OAN A;  3PUY E;  3QYT A;  4THI A;  5M2V A;  2ABH A;  3R6U A;  2QMX A;  2NVU B;  2X7Q A;  2OWT A;  3GBA A;  4P0G A;  3VXC A;  5I2N B;  4HW8 A;  2HAU A;  1FPI A;  4DDD A;  4NMY A;  1IMD A;  1XS5 A;  1MS7 A;  5DVJ A;  4X9T A;  3K1M A;  3G3J A;  4OVR A;  4GWW A;  4ZDM A;  3GXA A;  1IXC A;  4EF2 A;  3OEN A;  4ZZE A;  4GQO A;  4OVS A;  2R6G E;  5I58 B;  3OEK A;  2DVC A;  3PMV A;  4R72 A;  4F2Q A;  1PB7 A;  2HHM A;  3KN8 A;  1LBC A;  3T22 A;  4YB5 A;  1FPJ A;  2F6P A;  5ITO A;  4O7I A;  1DSN A;  2ZYK A;  3UGW A;  4XEQ A;  2DOJ A;  2XD3 A;  4YMA A;  1FTO A;  1B4H A;  2VD2 A;  3E79 A;  3C34 A;  3LSW A;  4R6Y A;  5H8S A;  2CZH A;  3VVE A;  1K9Z A;  5KDT A;  5JK4 A;  2I0C A;  1KA0 A;  4NX1 A;  4WXJ A;  1URS A;  2D3I A;  2ZMB A;  4H8J A;  3VDF A;  2RC9 A;  4ZEF A;  2REJ A;  1B5I A;  4QFL A;  1MPD A;  3IAZ A;  1MY2 A;  4GWY A;  3FJM A;  2IA4 A;  2F35 A;  3Q26 A;  4GIZ A;  2XXT A;  3A3C A;  4M4G A;  2H98 A;  1SYI A;  4ELO A;  1M5B A;  4X04 A;  4TOZ A;  1NUY A;  4BDO A;  1VR5 A;  1LST A;  1JET A;  4XKN A;  3FV2 A;  4DI4 B;  4BDQ A;  4P8B A;  1UIV A;  2THI A;  1A99 A;  4HE0 A;  2PMS A;  5H8Q B;  3E9X A;  4YMB A;  3O28 A;  1A8F A;  2F3D A;  3PPO A;  4GLI A;  4GWU A;  1Z7M E;  3PGF A;  3FVG A;  2XXV A;  4OXV A;  4I62 A;  1D9Q A;  1B58 A;  2O6A A;  4NF6 A;  3RTF B;  5J1D A;  3OMB A;  4ZE9 A;  3KC1 A;  1DOT A;  1FJ6 A;  1R1N A;  5CMM A;  1YCJ A;  1RYX A;  3CI8 A;  1TWY A;  4DXB A;  3LBS A;  4DE8 A;  2Y7P A;  3MVW A;  1G0H A;  4PFU A;  1GV8 A;  4GWZ A;  4IO5 A;  3L6H A;  2P3V A;  4F18 A;  1B7H A;  1B46 A;  2O84 X;  4OQO A;  5H8N B;  2NOO A;  1YTV A;  1M5F A;  1G0I A;  1NV2 A;  3LC8 A;  4IO7 A;  3OEM A;  5H8H B;  4F39 A;  5JEI A;  2FYI A;  1ZBM A;  2H9B A;  2ZYM A;  2Q2C A;  3G3H A;  4KYE A;  2NWJ A;  1IMB A;  1MXX A;  3IJX B;  2QS2 A;  4NE4 A;  2W7Y A;  4R6K A;  3SES A;  1TT1 A;  3IB1 A;  1MY4 A;  4Z7E A;  5I56 A;  3TYH A;  2F7A A;  3BKI B;  3B8B A;  3CG1 A;  1II5 A;  2IEE A;  3IO6 A;  4OMB A;  5L8D A;  4R9F A;  1LAX A;  2E0S A;  2F78 A;  1SI0 A;  3O6H A;  1JNF A;  4DZ1 A;  1H3D A;  4PE5 B;  1UQW A;  2PX1 A;  4XF5 A;  4BDM A;  1GTK A;  4G68 C;  3TEL A;  2HQ0 A;  3TDJ A;  1N84 A;  4YB6 A;  3U72 A;  3FUZ A;  3DP8 A;  1Y9U A;  2ZYO A;  3O9P A;  4EQB A;  1VSO A;  4EXK A;  3OD7 A;  3BIG A;  2DWJ A;  4IO6 A;  3MJN A;  4FOR A;  5CBR A;  4KCC A;  1B4Z A;  3Q28 A;  4MHF A;  2OJT A;  1SBP A;  3PUV E;  1FBD A;  1SI1 A;  3QUF A;  2RIN A;  1CNQ A;  4F3B A;  1I6A A;  1BKA A;  1Y3N A;  1BIY A;  4L17 A;  3MP8 A;  4X1B A;  5B70 A;  3BFU A;  3VVF A;  2OBG A;  4N13 A;  5DVI A;  5FHN A;  1MQD A;  4RA1 A;  4U1Z A;  4M1V A;  1SDX A;  1USY H;  4QFP A;  4EF1 A;  4PTK A;  2I49 A;  3B50 A;  5DTB A;  3LSF B;  1PB8 A;  1IXI A;  4KPT A;  4N91 A;  3KBZ A;  4IGT A;  1PBP A;  3CG3 A;  3V8X B;  2XA5 A;  4MFI A;  1MXV A;  5F24 A;  1FBE A;  1XOC A;  4N8G A;  1SD3 A;  1YAE A;  2VP1 A;  5CMC A;  3C33 A;  4G8N A;  1HSJ A;  5AA3 A;  4I40 A;  2Z23 A;  4DXC A;  4JXI A;  4R73 A;  1URD A;  1JEU A;  1FQB A;  3OEL A;  2A5T B;  2F97 A;  1I6Q A;  1LAH E;  2ONK E;  1S9T A;  3PUX E;  2YLN A;  4ESX A;  4E0W A;  2Y7R A;  4RK9 A;  4PFR A;  5EQ9 A;  3T66 A;  1ANF A;  4PGP A;  2Q74 A;  3DP4 A;  4JWO A;  2XXX A;  2H5Y A;  3RNN A;  2I3W A;  4OVP A;  2B4M A;  2VT5 A;  3G3G A;  4G68 B;  2ZNT A;  2Y7I A;  1IXG A;  3CIJ A;  3TUS A;  1FQA A;  1JEV A;  2Q89 A;  4KFQ A;  1CB6 A;  2QVV A;  3HST A;  3MZ1 A;  4QRZ A;  3KG2 A;  4QHQ A;  1NFT A;  4MF3 A;  3ECR A;  4PFI A;  4DCY A;  4LAT A;  3MST A;  4LQ2 A;  5FHO A;  4ZS9 A;  1FCK A;  1LB8 A;  3RLF E;  3MPK A;  4ZEB A;  4X48 A;  1KA1 A;  4ECF A;  4G2Z A;  5IM2 A;  3GZG A;  4AB6 A;  3F11 A;  4KI0 E;  1IMC A;  4IB2 A;  1MQI A;  2R9J A;  3PU5 A;  2B4L A;  2V3Q A;  3KJT A;  2CEX A;  2DE3 A;  5I2N A;  3TCH A;  2DVZ A;  5TP9 B;  1DMB A;  1MDP 1;  2O69 A;  2WYP A;  4JSD A;  4ESW A;  1MH4 A;  1EYI A;  3SDF A;  1SYH A;  1B2H A;  1RKM A;  3PMW A;  1AMF A;  2GHB A;  3K00 A;  3O2A A;  4UAB A;  4XXU A;  5F7V A;  1AIV A;  3NOH A;  4P11 A;  5CRY A;  2DWA A;  3CVG A;  1B7Z A;  5I2K B;  3K01 A;  3HN0 A;  1FTL A;  1LAG E;  1ATG A;  3IOW A;  2CZK A;  3C31 A;  2PVU A;  4N6K A;  1SQY A;  3EHU A;  3FVK A;  5TPA A;  3DLN A;  2WYK A;  4FEC A;  4O3B A;  3DP6 A;  1B1H A;  4H0W A;  2UVJ A;  3PD8 A;  4G61 A;  3GYY A;  1NH8 A;  4U21 A;  3E4R A;  3T9H B;  3LR1 A;  4I3E A;  4N6D A;  5CBS A;  3A3U A;  4FE8 A;  4F3P A;  3SEX A;  3E78 A;  3FJ7 A;  3N26 A;  1IUD A;  2O1L A;  1Y20 A;  1OLA A;  1A54 A;  3EHT A;  3CFZ A;  3LV0 A;  2MKZ A;  4G4P A;  4RK2 A;  2QPQ A;  4OER A;  2I6E A;  4R2B A;  2JJK A;  3HCQ A;  3EHS A;  5EHS A;  4NQ8 A;  4HCW A;  4QSE A;  1AL3 A;  3O6I A;  4GFR A;  3Q25 A;  1S50 A;  3D4G A;  2QMW A;  1D4N A;  2KQZ A;  1Y3P A;  1B6H A;  3K0V A;  5AA2 A;  3FXU A;  2HXW A;  4Q8R A;  1B1X A;  4O7M A;  1MXY A;  1FPD A;  1FW0 A;  3QIM A;  2UYF A;  1EYK A;  4NWD A;  1QUJ A;  2I4C A;  4MMP A;  3C36 A;  1MPB A;  4Z0I A;  5I59 A;  2PYY A;  3KJ7 A;  4N07 A;  3N5L A;  2WBD A;  1LBY A;  2F6G A;  1XVX A;  1TFD A;  2ANJ A;  4GL8 A;  3H6U A;  4EDP A;  3HHG A;  4GL0 A;  5ET5 A;  5EYG A;  5DEX B;  3I5O A;  4R2F A;  5HPQ A;  4ELR A;  1Y1Z A;  5H8N A;  3MWB A;  1OIB A;  5FBP A;  1B3E A;  4GX6 A;  3ODB A;  3UN6 A;  3JZJ A;  5H8H A;  1R6Z A;  5CM6 A;  3FXB A;  1S7Y A;  3SEW A;  2HEU A;  1DK4 A;  2RC7 A;  4POW A;  3H3G A;  1JVX A;  2RCB A;  4H46 A;  1LB9 A;  2CZI A;  1AWB A;  4H5G A;  2O7U A;  1NV7 A;  1IMA A;  3CFX A;  3O66 A;  2HCA A;  5HM4 B;  1BP5 A;  4MLQ A;  2ZNU A;  5ISU A;  1YXI A;  4MEV A;  1IEJ A;  5I5P A;  3T9U A;  5KCJ B;  1R9Q A;  1M5C A;  3IOU A;  1N3X A;  1IIW A;  1NV6 A;  4XKQ A;  4P56 A;  1MXW A;  4MNC A;  2V25 A;  3SZP A;  4DXU A;  1VE4 A;  4FJP A;  2DS9 A;  3PPR A;  2ALU A;  1LEV A;  3VXB A;  4MNI A;  4G77 A;  3ILU B;  4KD5 A;  1H45 A;  4KQP A;  1LBV A;  4GRK A;  3OSR A;  4O3A A;  3IO4 A;  1P99 A;  4WEP A;  4HXV A;  3W9V A;  1D3K A;  3KSJ A;  1A55 A;  4OEN A;  2UYE A;  3OO9 A;  3BIH A;  5ELV A;  4NF4 B;  1B32 A;  4NTL A;  4BLA A;  1Y3Q A;  5I57 B;  4K3F A;  2PBW A;  4U4S A;  4YIC A;  3O97 A;  2OCU A;  2Q2A A;  1K9Y A;  4P1E A;  4PC9 A;  4PE3 A;  1LCF A;  4DLD A;  1NI9 A;  1RDY A;  3IOR A;  4MX6 A;  3MUQ A;  4IGR A;  2XXP A;  1Q9D A;  1NNK A;  3ZSF A;  1MM6 A;  1LBX A;  4G8H A;  4DIG A;  2GH9 A;  3QSL A;  3UK4 A;  1MG1 A;  3CR9 A;  1FBP A;  4NHB A;  5JTY A;  2XXI A;  4O8M A;  2WEF A;  4NF5 A;  4PQJ A;  3G7W A;  5L9S A;  3H6V A;  3U8Q A;  4NF0 A;  3K1P A;  1T0K A;  4ZE8 A;  3O29 A;  3T0J A;  3U94 A;  4BDL A;  1B5J A;  3UA8 A;  2D21 A;  4H45 A;  1ZJL A;  3KN7 A;  1FJ9 A;  5F1Q A;  1ZMG A;  3U1O A;  2B3B A;  2PCR A;  1EZP A;  3LSX A;  4F22 A;  4KHZ E;  4GVO A;  4QF9 A;  3ZKK A;  4HCY A;  2ZNS A;  2V4C A;  4XFE A;  4RPO A;  5H8F A;  2Y7W A;  2Y84 A;  4C0R A;  1GVC A;  5IZ3 A;  4F1U A;  1LBZ A;  4PBH A;  3S4U A;  4MH5 A;  3VV5 A;  1FPB A;  4P1L A;  1FPL A;  4YZZ A;  2YPN A;  2HZK A;  4EUO A;  3CSB A;  1N7X A;  2R8T A;  4YKK A;  3FZV A;  4ZEI A;  5KDT B;  1POT A;  2QJE A;  2XXQ A;  2FA7 A;  2P3N A;  5ITP A;  5A5X A;  4OVT A;  2XWO A;  4PFW A;  3C4M A;  1FPF A;  2O51 A;  4P47 A;  1UTB A;  4GBW A;  4EQ7 A;  2CZL A;  1FBG A;  1L5T A;  4RXL A;  1MDQ A;  4BDR A;  3MVX A;  3THI A;  2O1M A;  2XWV A;  4N6P A;  3PPN A;  1NV5 A;  2RKM A;  4PAI A;  3K6X A;  1UTH A;  2XX9 A;  2E1S A;  2UVG A;  1P1U A;  4PAF A;  3WAE A;  1N76 A;  2Z8E A;  3MC2 A;  2QVU A;  4OHN A;  4C1T A;  3OXN A;  4ND9 A;  5BUU A;  2RCA A;  5AA1 A;  1RDX A;  3FAT A;  3T9X B;  1B51 A;  5FTH A;  4H6D A;  4NF8 A;  5TU0 A;  3PUW E;  4NF6 B;  1B7U A;  3QXM A;  4PFT A;  2FIX A;  5A5L A;  3MBP A;  4HS7 A;  4O3C A;  3R26 A;  4NED A;  1QW0 A;  5L9M A;  4P0I A;  2UXA A;  3H03 A;  4TLM B;  5EHM A;  4X1D A;  1YYZ A;  4DI3 D;  3IB2 A;  1QGX A;  1MY1 A;  1FPK A;  1F9B A;  3IB0 A;  3JYR A;  3OO6 A;  5AA4 A;  3PPP A;  3TTL A;  3IFA A;  1ZU0 A;  2Z8F A;  5I7I A;  4XKR A;  1XVY A;  4LP2 B;  4Q0C A;  3CSG A;  3AXF A;  3P7I A;  4H67 A;  3S9L C;  2A5S A;  2Z8D A;  4YKP A;  2Q88 A;  1UIU A;  1YZ0 A;  1N0T A;  3PD9 A;  4QSD A;  4ELQ A;  5CC2 A;  4OET A;  2XXW A;  4I3Y A;  1KWH A;  1EH3 A;  3TAJ A;  5I56 B;  1HSE A;  4R74 A;  4YKJ A;  1JP4 A;  1FTK A;  5EYF A;  2QS3 A;  1KZ8 A;  4N4U A;  1SW5 A;  3MAM A;  4GWO A;  4POX A;  2B3F A;  2AIX A;  1QJM A;  2LAO A;  1GR2 A;  2UVI A;  3RPL B;  2XX8 A;  3MVZ A;  1NL5 A;  5FHM A;  2HXR A;  5LDZ A;  2DYX A;  4OEV A;  2ONR A;  5IGA A;  2PT2 A;  3MZB A;  4Q30 B;  4AS4 A;  3LUY A;  4ZEK A;  3PUZ E;  3M8U A;  2ZZX A;  5LTC A;  2XXU A;  5I58 A;  3K2D A;  1XI6 A;  3IL1 B;  4OA4 A;  1MY0 A;  3S9E A;  3IJO B;  1H76 A;  1FRP A;  2UVH A;  4PP0 A;  1B3L A;  1FBC A;  2Q9T A;  1OVB A;  3N94 A;  4QXD A;  2ZZW A;  3B6W A;  1US4 A;  4OZ9 A;  3MPL A;  3KC0 A;  3CRB A;  1EZO A;  1IME A;  2F36 A;  3V89 B;  3MVY A;  3SEV A;  3OOA A;  1IIT A;  2HAV A;  4F19 A;  3VLV A;  4IY5 A;  4AQ4 A;  3H06 B;  3KZG A;  5AE4 A;  1XT8 A;  2OWZ A;  1M5E A;  3KFM A;  3ISP A;  2GQ1 A;  5BWJ A;  1TXF A;  4JSO A;  3UOR A;  3N6T A;  5ICQ A;  1JW5 A;  3V5A A;  5AA2 D;  3T1B A;  3TFL A;  4GX3 A;  4PFB A;  1URG A;  4PF6 A;  4MNP A;  2AL4 A;  1OLC A;  2HFB A;  3D4C A;  4EQ9 A;  4OWD A;  3FD3 A;  2H4I A;  4QFK A;  1GGG A;  2WKY A;  4GOT A;  1MXZ A;  2P0S A;  3G3K A;  4IO3 A;  1NKX A;  4NG7 A;  3RYD A;  2I0B A;  1H44 A;  1SW4 A;  1B3H A;  2P2A A;  1J1N A;  2PFZ A;  1I6B A;  5H8Q A;  3I3V A;  1DTZ A;  2DDK A;  1POY 1;  4E0X A;  2QVR A;  1WDN A;  2RC8 A;  1DPP A;  4OVJ A;  1A7L A;  1D9Y A;  4GXS B;  1Q1K A;  1Y4C A;  2H99 A;  3FXQ A;  4MAG A;  2XD2 A;  4GBV A;  4MJO A;  3HFU A;  4OTE A;  4FAT A;  2FVZ A;  3MZ9 A;  3IK6 B;  4OFJ A;  5B7D A;  4FBP A;  1B0L A;  3QAX A;  4N17 A;  2AL5 A;  1INP A;  1MY3 A;  3D1R A;  5CMK A;  3TQL A;  1A8E A;  4ZEC A;  3H6W A;  2DWI A;  1BLF A;  3QUJ A;  1N3W A;  3OO8 A;  3K6W A;  4GXA A;  1DTG A;  3U93 A;  3TPA A;  2F7B A;  3E3K A;  4KYS A;  2VGQ A;  1PDA A;  4Q5T A;  2WBB A;  2HPG A;  3RY3 A;  3VLW A;  2V84 A;  2CEY A;  4I1D A;  3T96 B;  3VLU A;  3BBR A;  3M3F A;  4JWX A;  4QFN A;  1USY E;  3WAF A;  1PB9 A;  3KBR A;  4LZ7 A;  1NV3 A;  2OLB A;  3RQT A;  5CMB A;  2Q8M A;  1AOV A;  2KR0 A;  4MLV A;  4ZED A;  3TMG A;  1BK4 A;  1JW1 A;  1JVY A;  5I3S A;  1EYJ A;  3G3F A;  4O94 A;  2NXO A;  2XXY A;  1B52 A;  2AYS A;  5DT6 A;  3TQW A;  1B05 A;  4XTC Q;  3ONM A;  4G8M A;  3FIR A;  1H43 A;  3OO7 A;  3VE1 B;  2Q8J A;  2ZXT A;  3O6G A;  4EXL A;  3LUZ A;  1SVX B;  3U65 A;  3RTW B;  4H1X A;  5TPA B;  4ELP A;  5ESY A;  1EZ9 A;  4QSC A;  5L9O A;  4OFO A;  4U1O A;  2G29 A;  3KSX A;  2XXK A;  3KOT A;  1QVS A;  4U4X A;  1PBQ A;  4RY1 A;  4BDN A;  4R6H A;  1DCU A;  4MIJ A;  2H25 A;  5LOM A;  4IR8 A;  4KYD A;  4GX4 A;  4NWC A;  2F7C A;  5DW8 A;  3TCG A;  4OEU A;  2PFY A;  3T93 B;  4F3G A;  2ESN A;  2FHY A;  3B6Q A;  1MQH A;  1FQE A;  1NV1 A;  3M3L A;  4U2R A;  1JQF A;  1B0H A;  1LFI A;  1IXH A;  3IFC A;  5AA2 B;  2DP8 A;  3TEP A;  2DXR A;  3HO7 A;  3KGC A;  1OMP A;  3H7M A;  1LGB C;  5ICT A;  4ONY A;  3FGS A;  1SPI A;  1XHY A;  1P1O A;  2XXH A;  2XWI A;  3K6V A;  3TTR A;  4U23 A;  4WED A;  1FSA A;  1VFE A;  1NNP A;  5I59 B;  1SW1 A;  4TQU Q;  1FBF A;  4R75 A;  2VD3 A;  3FV1 A;  4WKM A;  2F34 A;  3IX1 A;  2A5T A;  3TTM A;  4HE1 A;  4OFL A;  1RYO A;  2RF1 A;  4N8Y A;  4AS5 A;  2FBP A;  1TFA A;  1QKB A;  5IZ1 A;  5DVF A;  3RUM A;  1PEB A;  2DXY A;  4IO4 A;  5K2X A;  5IKB A;  3FVN A;  1FTM A;  2NUV A;  1DBZ A;  1WVJ A;  5ET8 A;  3RT8 A;  3ZS6 A;  2VOZ A;  1NNF A;  1OQH A;  2YJP A;  4YKI A;  4G68 A;  3GBB A;  2Z22 A;  2O68 A;  1JW4 A;  1PC3 A;  2DSF A;  4NGU A;  4LA9 A;  3ILT B;  4LZ8 A;  1R9L A;  4LVQ A;  2XWK A;  1LAF E;  3SEU A;  4OES A;  4PFY A;  1IQ7 A;  3OSQ A;  3KN3 A;  5K2Y A;  4NAP A;  1FBH A;  3S9N C;  3M3K A;  1I69 A;  4UA8 A;  4X8R A;  4P3L A;  4OYV A;  5T3J A;  1B40 A;  2PT1 A;  1AH5 A;  1QUL A;  3FBP A;  1CE2 A;  4N81 A;  2F3B A;  1NV0 A;  5FTI A;  5IZZ A;  1MM7 A;  1P1Q A;  3DEL B;  3TOD A;  3RPL A;  3B6T A;  1NNT A;  1RDZ A;  2I58 A;  3Q27 A;  4YAH X;  3ROJ A;  3HPI A;  4F3S A;  1NUX A;  2P1S A;  3EF7 A;  1QUK A;  1BTJ A;  3T9V A;  1B5H A;  2Y5K A;  1NUZ A;  5TP9 A;  1ZTY A;  1WOD A;  2QFL A;  1HSL A;  2I48 A;  3KOS A;  2O7I A;  4GD5 A;  4PF8 A;  2VPN A;  3UP9 A;  3SKP A;  4NN3 A;  1OQG A;  4KXP A;  3R7X A;  4F29 A;  4H8I A;  2XHD A;  1O7T A;  1VFD A;  3UIF A;  2WX9 A;  3LSL A;  3HV1 A;  1P1W A;  2ZYN A;  1NMU A;  5I2K A;  2QS4 A;  2Y7K A;  1A40 A;  5J16 A;  2V3U A;  4IY6 A;  2BJJ X;  4JVD A;  1EU8 A; 
#chains in the Genus database with same CATH homology
 4F31 B;  2XX7 A;  3S2V A;  1B9J A;  3C35 A;  4GF8 A;  3VVD A;  4F1Y A;  2REG A;  4RPN A;  1SW2 A;  1ZKB A;  3FVO A;  5JTY B;  1MPC A;  3I6V A;  4NF5 B;  4F1V A;  1LFH A;  3K1N A;  3FXR A;  4YU0 A;  4YB7 A;  2CMO A;  2QSX A;  4H65 A;  4MBP A;  4FEB A;  3KEI A;  1QKA A;  4FIM A;  1OVT A;  1LLS A;  3PMX A;  4XIG Q;  3SET A;  3K6U A;  3W9W A;  1FQF A;  3RPW A;  2HZL A;  1XC1 A;  4PET A;  1MRP A;  2X7P A;  3QK6 A;  2B65 A;  1MQJ A;  1IZ1 A;  1FQD A;  3SER A;  5H8F B;  3W15 C;  5DYH A;  1M5D A;  1ZLQ A;  2V3T A;  3H4Z A;  3S9M C;  3A09 A;  3RGY A;  2FNC A;  2I4B A;  4LZ5 A;  4TLL B;  3RN8 A;  4ISU A;  4I8C A;  3L6G A;  2DQV A;  5IAI A;  5CI5 A;  1P1N A;  3BFT A;  3GLB A;  2KLF A;  2GHA A;  3E13 X;  3IOV A;  4UAC A;  1LCT A;  4IO2 A;  2X26 A;  1Q35 A;  5DEX A;  3USD A;  1US5 A;  2DWH A;  1YPN A;  5KZT A;  4R9G A;  5A5X B;  1N7W A;  3TTK A;  1LBB A;  1MQG A;  3ZKL A;  3CFL A;  4LQ5 A;  2GRV A;  1Z7N E;  1UTB B;  4I9D A;  2F8D A;  3HHF A;  4XKP A;  3DM0 A;  2XXR A;  3JV9 A;  1LFG A;  3MP1 A;  1DPE A;  2ONS A;  4F2O A;  1O64 A;  1UTH B;  1ZIU A;  1FQC A;  5I84 A;  5HBC A;  4LUB A;  1B3G A;  3RT6 B;  3VFJ A;  5KCJ A;  2VHA A;  1O63 A;  2R71 A;  3MQ9 A;  3SEY A;  1D9V A;  4KCD A;  2F5X A;  3TKD A;  4NF8 B;  3IR1 A;  3Q29 A;  3N6U A;  2V93 A;  3H6T A;  2M8C A;  1Y1M A;  4FAJ A;  3B7D A;  2OK2 A;  3PV0 E;  3TCF A;  2D5W A;  1B3F A;  2QS1 A;  3PPQ A;  1FTJ A;  4JDF A;  5AA4 B;  4KR5 A;  3G3I A;  3EPE A;  4U22 A;  3K4U A;  4DCX A;  4RYA A;  4RNS A;  4NF4 A;  5I57 A;  2QL3 A;  1N04 A;  2QRY A;  4RJZ A;  3K02 A;  2OZZ A;  2DE2 A;  4ZZA A;  4C1U A;  4AB5 A;  3FAS A;  3EN3 A;  4FED A;  3IOT A;  3V83 A;  2I3V A;  1Y4T A;  2DE4 A;  1NH7 A;  2G93 A;  3C9H A;  3MW0 A;  3TZA A;  4JB7 A;  1ELJ A;  3MP6 A;  1MH3 A;  4JWY A;  2OWS A;  4JBZ A;  3TTN A;  4HTG A;  1QUI A;  4QFO A;  2GFE A;  4H5F A;  3U92 A;  1MXU A;  3EQ1 A;  3FJG A;  4LON B;  3C32 A;  3PUY E;  3QYT A;  4THI A;  5M2V A;  2ABH A;  3R6U A;  2QMX A;  2NVU B;  2X7Q A;  2OWT A;  3GBA A;  4P0G A;  3VXC A;  5I2N B;  4HW8 A;  2HAU A;  4DDD A;  4NMY A;  1XS5 A;  1MS7 A;  5DVJ A;  4X9T A;  3K1M A;  3G3J A;  4ZDM A;  3GXA A;  1IXC A;  4EF2 A;  3OEN A;  4ZZE A;  4GQO A;  2R6G E;  5I58 B;  3OEK A;  2DVC A;  3PMV A;  4R72 A;  4F2Q A;  1PB7 A;  3KN8 A;  1LBC A;  3T22 A;  4YB5 A;  2F6P A;  5ITO A;  1DSN A;  2ZYK A;  3UGW A;  2DOJ A;  2XD3 A;  4YMA A;  1FTO A;  1B4H A;  2VD2 A;  3C34 A;  3LSW A;  4R6Y A;  5H8S A;  3VVE A;  5KDT A;  5JK4 A;  2I0C A;  4WXJ A;  1URS A;  2D3I A;  2ZMB A;  4H8J A;  3VDF A;  2RC9 A;  4ZEF A;  2REJ A;  1B5I A;  4QFL A;  1MPD A;  3IAZ A;  1MY2 A;  3FJM A;  2IA4 A;  2F35 A;  3Q26 A;  4GIZ A;  2XXT A;  3A3C A;  4M4G A;  2H98 A;  1SYI A;  4ELO A;  1M5B A;  4TOZ A;  4BDO A;  1VR5 A;  1LST A;  1JET A;  4XKN A;  3FV2 A;  4BDQ A;  1UIV A;  2THI A;  1A99 A;  2PMS A;  5H8Q B;  3E9X A;  4YMB A;  3O28 A;  1A8F A;  3PPO A;  4GLI A;  1Z7M E;  3PGF A;  3FVG A;  2XXV A;  4OXV A;  4I62 A;  1B58 A;  2O6A A;  4NF6 A;  3RTF B;  5J1D A;  3OMB A;  4ZE9 A;  1DOT A;  1R1N A;  5CMM A;  1YCJ A;  1RYX A;  3CI8 A;  1TWY A;  4DXB A;  3LBS A;  4DE8 A;  2Y7P A;  3MVW A;  4PFU A;  1GV8 A;  4IO5 A;  3L6H A;  4F18 A;  1B7H A;  1B46 A;  2O84 X;  4OQO A;  5H8N B;  2NOO A;  1YTV A;  1M5F A;  3LC8 A;  4IO7 A;  3OEM A;  5H8H B;  4F39 A;  5JEI A;  2FYI A;  1ZBM A;  2H9B A;  2ZYM A;  2Q2C A;  3G3H A;  4KYE A;  2NWJ A;  1MXX A;  3IJX B;  2QS2 A;  4NE4 A;  2W7Y A;  4R6K A;  3SES A;  1TT1 A;  3IB1 A;  1MY4 A;  4Z7E A;  5I56 A;  3TYH A;  2F7A A;  3BKI B;  3CG1 A;  1II5 A;  2IEE A;  3IO6 A;  4OMB A;  5L8D A;  4R9F A;  1LAX A;  2E0S A;  2F78 A;  1SI0 A;  3O6H A;  1JNF A;  4DZ1 A;  1H3D A;  4PE5 B;  1UQW A;  2PX1 A;  4BDM A;  1GTK A;  4G68 C;  3TEL A;  2HQ0 A;  3TDJ A;  1N84 A;  4YB6 A;  3U72 A;  3FUZ A;  3DP8 A;  1Y9U A;  2ZYO A;  3O9P A;  4EQB A;  1VSO A;  4EXK A;  3OD7 A;  2DWJ A;  4IO6 A;  3MJN A;  4FOR A;  5CBR A;  4KCC A;  1B4Z A;  3Q28 A;  2OJT A;  1SBP A;  3PUV E;  1SI1 A;  3QUF A;  2RIN A;  4F3B A;  1I6A A;  1BKA A;  1Y3N A;  1BIY A;  4L17 A;  3MP8 A;  4X1B A;  5B70 A;  3BFU A;  3VVF A;  2OBG A;  4N13 A;  5DVI A;  5FHN A;  1MQD A;  4RA1 A;  4U1Z A;  4M1V A;  1SDX A;  1USY H;  4QFP A;  4EF1 A;  2I49 A;  5DTB A;  3LSF B;  1PB8 A;  1IXI A;  4KPT A;  4IGT A;  1PBP A;  3CG3 A;  3V8X B;  4MFI A;  1MXV A;  1XOC A;  1SD3 A;  1YAE A;  2VP1 A;  5CMC A;  3C33 A;  4G8N A;  1HSJ A;  5AA3 A;  2Z23 A;  4DXC A;  4JXI A;  4R73 A;  1URD A;  1JEU A;  1FQB A;  3OEL A;  2A5T B;  2F97 A;  1I6Q A;  1LAH E;  2ONK E;  1S9T A;  3PUX E;  2YLN A;  4ESX A;  4E0W A;  2Y7R A;  4RK9 A;  3T66 A;  1ANF A;  4JWO A;  3DP4 A;  2XXX A;  2H5Y A;  3RNN A;  2I3W A;  3G3G A;  4G68 B;  2ZNT A;  2Y7I A;  1IXG A;  3CIJ A;  3TUS A;  1FQA A;  1JEV A;  2Q89 A;  4KFQ A;  1CB6 A;  3HST A;  3MZ1 A;  4QRZ A;  3KG2 A;  4QHQ A;  1NFT A;  4MF3 A;  3ECR A;  4DCY A;  4LAT A;  4LQ2 A;  5FHO A;  4ZS9 A;  1FCK A;  1LB8 A;  3RLF E;  3MPK A;  4ZEB A;  4X48 A;  4ECF A;  4G2Z A;  3GZG A;  4AB6 A;  3F11 A;  4KI0 E;  4IB2 A;  1MQI A;  2R9J A;  3PU5 A;  2V3Q A;  3KJT A;  2DE3 A;  5I2N A;  3TCH A;  2DVZ A;  5TP9 B;  1DMB A;  1MDP 1;  2O69 A;  4JSD A;  4ESW A;  1MH4 A;  3SDF A;  1SYH A;  1B2H A;  1RKM A;  3PMW A;  1AMF A;  2GHB A;  3K00 A;  3O2A A;  4XXU A;  5F7V A;  1AIV A;  5CRY A;  4P11 A;  2DWA A;  3CVG A;  1B7Z A;  5I2K B;  3K01 A;  3HN0 A;  1FTL A;  1LAG E;  1ATG A;  3IOW A;  3C31 A;  2PVU A;  1SQY A;  3EHU A;  3FVK A;  5TPA A;  3DLN A;  4FEC A;  4O3B A;  3DP6 A;  1B1H A;  4H0W A;  2UVJ A;  3PD8 A;  1NH8 A;  4U21 A;  3E4R A;  3T9H B;  3LR1 A;  5CBS A;  3A3U A;  4FE8 A;  4F3P A;  3SEX A;  3FJ7 A;  3N26 A;  1IUD A;  2O1L A;  1Y20 A;  1OLA A;  1A54 A;  3EHT A;  3CFZ A;  4G4P A;  4RK2 A;  2QPQ A;  4OER A;  2I6E A;  4R2B A;  3HCQ A;  3EHS A;  5EHS A;  4HCW A;  4QSE A;  1AL3 A;  3O6I A;  4GFR A;  3Q25 A;  1S50 A;  3D4G A;  2QMW A;  1D4N A;  1Y3P A;  1B6H A;  3K0V A;  5AA2 A;  3FXU A;  2HXW A;  4Q8R A;  1B1X A;  1MXY A;  1FW0 A;  3QIM A;  2UYF A;  4NWD A;  1QUJ A;  2I4C A;  3C36 A;  1MPB A;  4Z0I A;  5I59 A;  2PYY A;  3KJ7 A;  4N07 A;  3N5L A;  2F6G A;  1XVX A;  1TFD A;  2ANJ A;  4GL8 A;  3H6U A;  4EDP A;  3HHG A;  4GL0 A;  5DEX B;  3I5O A;  4R2F A;  5HPQ A;  4ELR A;  1Y1Z A;  5H8N A;  3MWB A;  1OIB A;  1B3E A;  3ODB A;  3UN6 A;  3JZJ A;  5H8H A;  1R6Z A;  5CM6 A;  1S7Y A;  3SEW A;  2HEU A;  2RC7 A;  4POW A;  3H3G A;  1JVX A;  2RCB A;  1LB9 A;  4H5G A;  2O7U A;  3CFX A;  3O66 A;  2HCA A;  5HM4 B;  1BP5 A;  4MLQ A;  2ZNU A;  5ISU A;  1IEJ A;  3T9U A;  5KCJ B;  1R9Q A;  1M5C A;  3IOU A;  1N3X A;  1IIW A;  4XKQ A;  1MXW A;  2V25 A;  4DXU A;  1VE4 A;  4FJP A;  2DS9 A;  3PPR A;  2ALU A;  3VXB A;  4G77 A;  3ILU B;  4KD5 A;  1H45 A;  4KQP A;  4GRK A;  3OSR A;  4O3A A;  3IO4 A;  1P99 A;  4WEP A;  3W9V A;  1D3K A;  3KSJ A;  1A55 A;  4OEN A;  2UYE A;  3OO9 A;  5ELV A;  4NF4 B;  1B32 A;  4NTL A;  4BLA A;  1Y3Q A;  5I57 B;  4K3F A;  2PBW A;  4U4S A;  4YIC A;  3O97 A;  2OCU A;  2Q2A A;  1LCF A;  4DLD A;  3IOR A;  3MUQ A;  4IGR A;  2XXP A;  1NNK A;  3ZSF A;  1MM6 A;  4G8H A;  4DIG A;  2GH9 A;  3QSL A;  3UK4 A;  1MG1 A;  3CR9 A;  5JTY A;  2XXI A;  4NF5 A;  4PQJ A;  3G7W A;  5L9S A;  3H6V A;  3U8Q A;  3K1P A;  1T0K A;  4ZE8 A;  3O29 A;  3U94 A;  4BDL A;  1B5J A;  3UA8 A;  2D21 A;  1ZJL A;  3KN7 A;  5F1Q A;  1ZMG A;  3U1O A;  2B3B A;  1EZP A;  3LSX A;  4F22 A;  4KHZ E;  4GVO A;  4QF9 A;  3ZKK A;  4HCY A;  2ZNS A;  4RPO A;  5H8F A;  2Y7W A;  2Y84 A;  4C0R A;  1GVC A;  4F1U A;  3S4U A;  4MH5 A;  3VV5 A;  4YZZ A;  2YPN A;  2HZK A;  4EUO A;  3CSB A;  1N7X A;  4YKK A;  3FZV A;  4ZEI A;  5KDT B;  1POT A;  2QJE A;  2XXQ A;  2FA7 A;  5ITP A;  5A5X A;  4PFW A;  3C4M A;  2O51 A;  1UTB A;  4EQ7 A;  2CZL A;  1L5T A;  4RXL A;  1MDQ A;  4BDR A;  3MVX A;  3THI A;  2O1M A;  4N6P A;  3PPN A;  2RKM A;  3K6X A;  1UTH A;  2XX9 A;  2E1S A;  2UVG A;  1P1U A;  3WAE A;  1N76 A;  2Z8E A;  3MC2 A;  4OHN A;  4C1T A;  3OXN A;  4ND9 A;  5BUU A;  2RCA A;  5AA1 A;  3FAT A;  3T9X B;  1B51 A;  5FTH A;  4H6D A;  4NF8 A;  5TU0 A;  3PUW E;  4NF6 B;  1B7U A;  3QXM A;  4PFT A;  3MBP A;  4HS7 A;  4O3C A;  3R26 A;  4NED A;  1QW0 A;  5L9M A;  4P0I A;  2UXA A;  3H03 A;  4TLM B;  5EHM A;  4X1D A;  3IB2 A;  1MY1 A;  1F9B A;  3IB0 A;  3JYR A;  3OO6 A;  5AA4 A;  3PPP A;  3TTL A;  1ZU0 A;  2Z8F A;  4XKR A;  1XVY A;  4LP2 B;  4Q0C A;  3CSG A;  3AXF A;  3P7I A;  4H67 A;  3S9L C;  2A5S A;  2Z8D A;  4YKP A;  2Q88 A;  1UIU A;  1N0T A;  3PD9 A;  4QSD A;  4ELQ A;  5CC2 A;  4OET A;  2XXW A;  1KWH A;  1EH3 A;  3TAJ A;  5I56 B;  1HSE A;  4R74 A;  4YKJ A;  1FTK A;  5EYF A;  2QS3 A;  1SW5 A;  3MAM A;  4GWO A;  4POX A;  2B3F A;  2AIX A;  1QJM A;  2LAO A;  1GR2 A;  2UVI A;  2XX8 A;  3MVZ A;  1NL5 A;  5FHM A;  2DYX A;  4OEV A;  2ONR A;  2PT2 A;  3MZB A;  4Q30 B;  3LUY A;  4ZEK A;  3PUZ E;  3M8U A;  2XXU A;  5I58 A;  3K2D A;  3IL1 B;  1MY0 A;  3S9E A;  3IJO B;  1H76 A;  2UVH A;  4PP0 A;  1B3L A;  2Q9T A;  1OVB A;  3N94 A;  3B6W A;  1US4 A;  4OZ9 A;  3MPL A;  3CRB A;  1EZO A;  2F36 A;  3V89 B;  3MVY A;  3SEV A;  3OOA A;  1IIT A;  2HAV A;  4F19 A;  3VLV A;  4IY5 A;  4AQ4 A;  3H06 B;  3KZG A;  5AE4 A;  1XT8 A;  1M5E A;  3KFM A;  5BWJ A;  1TXF A;  4JSO A;  3UOR A;  3N6T A;  5ICQ A;  1JW5 A;  3V5A A;  5AA2 D;  3TFL A;  1URG A;  2AL4 A;  1OLC A;  2HFB A;  3D4C A;  4EQ9 A;  4OWD A;  3FD3 A;  2H4I A;  4QFK A;  1GGG A;  2WKY A;  4GOT A;  1MXZ A;  2P0S A;  3G3K A;  4IO3 A;  1NKX A;  2I0B A;  1H44 A;  1SW4 A;  1B3H A;  2P2A A;  1J1N A;  1I6B A;  5H8Q A;  3I3V A;  1DTZ A;  1POY 1;  4E0X A;  1WDN A;  2RC8 A;  1DPP A;  4OVJ A;  1A7L A;  1D9Y A;  4GXS B;  1Q1K A;  1Y4C A;  2H99 A;  3FXQ A;  2XD2 A;  4OTE A;  4FAT A;  3MZ9 A;  3IK6 B;  4OFJ A;  5B7D A;  1B0L A;  3QAX A;  2AL5 A;  1MY3 A;  5CMK A;  3TQL A;  1A8E A;  4ZEC A;  3H6W A;  2DWI A;  1BLF A;  3QUJ A;  1N3W A;  3OO8 A;  3K6W A;  4GXA A;  1DTG A;  3U93 A;  3TPA A;  2F7B A;  3E3K A;  4KYS A;  2VGQ A;  1PDA A;  4Q5T A;  3RY3 A;  3VLW A;  2V84 A;  4I1D A;  3T96 B;  3VLU A;  3BBR A;  3M3F A;  4JWX A;  4QFN A;  1USY E;  3WAF A;  1PB9 A;  3KBR A;  4LZ7 A;  2OLB A;  3RQT A;  5CMB A;  1AOV A;  4MLV A;  4ZED A;  3TMG A;  1JW1 A;  1JVY A;  3G3F A;  2NXO A;  2XXY A;  1B52 A;  2AYS A;  5DT6 A;  3TQW A;  1B05 A;  4XTC Q;  3ONM A;  4G8M A;  3FIR A;  1H43 A;  3OO7 A;  3VE1 B;  2Q8J A;  2ZXT A;  3O6G A;  4EXL A;  1SVX B;  3RTW B;  4H1X A;  5TPA B;  4ELP A;  1EZ9 A;  4QSC A;  5L9O A;  4OFO A;  4U1O A;  2G29 A;  3KSX A;  3KOT A;  1QVS A;  4U4X A;  1PBQ A;  4RY1 A;  4BDN A;  4R6H A;  2H25 A;  5LOM A;  4KYD A;  4NWC A;  2F7C A;  3TCG A;  4OEU A;  3T93 B;  4F3G A;  2ESN A;  3B6Q A;  1MQH A;  1FQE A;  3M3L A;  4U2R A;  1JQF A;  1B0H A;  1LFI A;  1IXH A;  5AA2 B;  2DP8 A;  3TEP A;  2DXR A;  3HO7 A;  3KGC A;  1OMP A;  3H7M A;  1LGB C;  5ICT A;  4ONY A;  3FGS A;  1XHY A;  1P1O A;  2XXH A;  3K6V A;  3TTR A;  4U23 A;  4WED A;  1VFE A;  1NNP A;  5I59 B;  1SW1 A;  4TQU Q;  4R75 A;  2VD3 A;  3FV1 A;  4WKM A;  2F34 A;  3IX1 A;  2A5T A;  3TTM A;  4OFL A;  1RYO A;  2RF1 A;  1TFA A;  1QKB A;  5DVF A;  3RUM A;  1PEB A;  2DXY A;  4IO4 A;  5K2X A;  5IKB A;  3FVN A;  1FTM A;  2NUV A;  1WVJ A;  3RT8 A;  3ZS6 A;  2VOZ A;  1NNF A;  1OQH A;  2YJP A;  4YKI A;  4G68 A;  3GBB A;  2Z22 A;  2O68 A;  1JW4 A;  1PC3 A;  2DSF A;  4LA9 A;  3ILT B;  4LZ8 A;  1R9L A;  4LVQ A;  1LAF E;  3SEU A;  4OES A;  4PFY A;  1IQ7 A;  3OSQ A;  3KN3 A;  5K2Y A;  3S9N C;  3M3K A;  1I69 A;  4UA8 A;  4OYV A;  1B40 A;  2PT1 A;  1AH5 A;  1QUL A;  1CE2 A;  5FTI A;  1MM7 A;  1P1Q A;  3DEL B;  3TOD A;  3B6T A;  1NNT A;  2I58 A;  3Q27 A;  4YAH X;  3HPI A;  4F3S A;  2P1S A;  3EF7 A;  1QUK A;  1BTJ A;  3T9V A;  1B5H A;  5TP9 A;  1ZTY A;  1WOD A;  1HSL A;  2I48 A;  3KOS A;  2O7I A;  4GD5 A;  3UP9 A;  3SKP A;  1OQG A;  3R7X A;  4F29 A;  4H8I A;  2XHD A;  1O7T A;  1VFD A;  3UIF A;  3LSL A;  3HV1 A;  1P1W A;  2ZYN A;  1NMU A;  5I2K A;  2QS4 A;  2Y7K A;  1A40 A;  2V3U A;  4IY6 A;  2BJJ X;  1EU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...