1A7OH

Fv fragment of mouse monoclonal antibody d1.3 (balb/c, igg1, k) r96l deletion mutant on variant for chain l glu81->asp and chain h leu312->val
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
QVQLQESGPGLVAPSQSLSITCTVSGFSLTGYGVNWVRQPPGKGLEWLGMIWGDGNTDYNSALKSRLSISKDNSKSQVFLKMNSLHTDDTARYYCARERDYRLDYWGQGTTVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structures of D1.3 Fv Mutants
rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG1-KAPPA D1.3 FV (LIGHT CHAIN)
total genus 30
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 1998-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a7oH00
1IC7H 2YBRA 2DDQH 4Z7QE 1YECH 4I0KA 1N2RA 1GGCL 3BPNC 3ZSTA 4NZUH 4R96B 1RZJC 4YEEA 2Q8BH 2X4PA 4IRZH 3DX8B 3U36B 4NO5B 4ORGB 5TPWH 4MX7B 1FAIH 1H3WM 4KJYA 5FIEA 4I9WD 1BBDH 2FGWH 2UWEF 4NC1E 1QSFB 2AK1H 3GIZL 1RZGA 5D70H 5KAQF 1VPOL 3K0WA 1I3RB 1U92A 3VDBA 2CK0H 3BVNB 4U6XB 2QQKL 3SHSA 2FEEL 2G5BA 4XNUH 1RVFH 4PJ8D 2LU3A 3V5HB 4K94H 2XQBL 4HK3N 4RZCB 4Y4KA 1AO7B 4HKBA 5DWUH 4HV8A 4OM1L 1IL1A 1HIML 1NFIB 1TQBB 4JFDA 4NC0B 1A3RL 4F7TA 1HH9A 3WFBH 4GKZB 4Y5YA 1DVFC 3B8YA 4NJ9L 5DSCA 5HYJA 3QXAA 5IKCB 3TFKC 2VQTA 3I2CL 5BVJA 4XP9H 5IVXE 4Z7OF 2EE2A 1QFPA 2PW1B 3HE7B 3ARQA 1HSBB 4LPWA 4U1IA 3RNKA 3KLAA 1LO0H 5E4EC 3U30B 2QQQA 4Q2ZB 1WV7T 4D0BA 1BF8A 3PE9A 4N9OB 3AXLB 35C8L 4AL8L 5SWZE 3VXMA 2FNBA 1Y6KR 1UADC 2D7MA 3OAYK 4PY8J 4M6MH 3RZCC 2VLRE 1GZQA 3MOAH 3FO1B 4M7ZB 4F2MB 5CJQL 3BDYL 1C08A 1N0XH 3C9NA 2VITA 4ONFH 5IWLC 1YN7B 2V17L 4GG6F 4EUPA 3G5VA 5DJCB 2GHWB 1NCNA 5CLTA 3PWVA 2I9TB 3U0WH 1N5AA 15C8L 4XTRD 2BDNH 3QUMH 1B6DA 2IQ9H 4YWGH 4HX1B 4WTZA 1U8JA 5KVFH 2UYLB 3FN3A 1FNEA 2OR8A 4G7YH 3RWEA 1VGKA 2YA0A 4MNGE 3MA7A 3H9SE 4H1LB 4YXKL 5JLZB 1G7JB 3GSNB 2R1WA 1QFWL 2D4FA 4R7NB 4JREB 2OI9B 1WF5A 1C5DB 4LBEA 3RIFF 2ATPB 4JGMA 3TO2A 7FABL 1BGXL 4PJBB 5F1IA 3DXAD 5IJVA 1QZ1A 3QO1A 3C8KA 2VZSA 3X11A 5IQ7L 3RWCA 3MRBA 1I8LC 1PKQA 1NGWA 3HUJA 5D5ME 1PZ5A 4G8FA 1Y18B 4KTYA 4WV1B 4X6CB 1Q9KA 3QBTB 4P3CL 4I5BB 2YEZA 4HH9A 5GS1A 1UJ3B 5T3XL 3WDIA 2P8MB 3ULVH 1X5IA 4HXBH 4PRPA 4JPKH 4C55A 3RU8L 3TO2B 3AC0A 3U0TB 2E7LA 4BA8A 1H5BC 4G8GB 2F58L 1S9WB 1AY1L 2F53E 3NACL 5KG9A 3EYSH 2GIYA 3JTTB 3LQMA 4PBWD 3VXMD 1YEDA 2O26U 2FIKB 2F53A 4OQTL 3IAGC 2RGSA 3RTQD 2Q7YB 3ULUL 1VFUA 5C6PB 5LGHL 3O6FD 5DJZB 1C16A 4EUPH 1I7RA 4PJDB 4MCYB 2VUOA 3HZMB 1L0XA 5D7KD 4PJ7A 1JGLH 1JNHB 5T5NG 3ZE2E 1YJDH 4OZGE 3KJ4B 3NACH 1ZHNB 4U0RC 2OJEA 1IAII 1JNNH 1KLGB 5C0AA 4DW2H 5TE6L 1JWUB 3HS0B 4FG6D 4Z78B 3QFJB 3QDJD 3MOQA 1LO2L 4JFDD 3REVA 4PUBL 5F1SA 3BAEL 1TQCB 1EXUA 3NAAH 4Y4KD 2CLZA 3MLZL 4A2MA 3TJEH 1I7RB 4PJ8A 4PJDA 5F7NC 2DB8A 5D2LF 1XGQB 3O45B 2R2EA 4PY8I 4J3UA 5ISZE 4HG4K 1X6NA 2EDFA 3PV6A 4X4MA 3O0RH 3IJSB 2VE6A 3Q3GB 5FDWA 2E9IA 5D8JL 2HJFB 3VFOB 4IDJH 1RPQA 3NCJL 1IAKA 4Y2DC 3MRJB 1DQJA 1H15B 4FFVD 1HEZB 3CDGB 3KNBB 4ZODA 4OFVA 5D96B 2NXZC 1T4KA 1UA6H 2AXJA 5F96H 3VXQB 1SQ2N 4P3DA 4X7TA 5AZ2H 5FAAA 2ENSA 3IDIB 4Q58C 3BP6B 3MREA 2A77H 4WDIB 2X1WL 3WIFB 4PG9B 4YHOL 2J88H 1Z5LA 1FYTB 1P7QA 5D7IE 3T65A 1TJGH 1A4JA 3UX9B 3MV7D 1BREA 3CZJA 4WUKL 5IV2B 4WHCA 4GAGH 1CF8L 3RVXD 4AL8H 4KVCL 4M1CD 4JFEA 1I8KB 4X9BA 4JO3H 2ZOKB 5KANG 1FH5L 4MD5A 3WXWH 4PREA 1NFDB 3BH8B 5GRVK 2W0PA 2E6QA 3FQRA 5KSAC 1B0GB 1KN2L 3K8LA 3SBWC 2BHZA 2WINB 2FSEB 2EXYD 1U9KA 1LGVA 4KHXL 1AJ7H 5I1KL 2GI7A 4UDTB 3T0EB 1CLYH 1KCUL 2CDGA 1BD2B 3PV7A 4U6VH 4U3HA 5F1OB 2Z8SA 3QXUA 4I9WE 4L4TB 2J2ZA 5DJCA 4NZRL 5JOFA 4UNTA 1FL5A 3EJYD 3GKWH 2GJ6A 2VSCA 4MVBD 4U3XA 4P4RA 3T4AA 1JMZA 1MCLA 4L3EB 1QEWA 3MRKA 4MXWL 2KH2B 2VLJB 4XNUL 5F6HJ 4QCIB 3MZTA 2RAMA 2OK0H 2DMKA 3BIKA 5FOBB 5FFLA 2COQA 4NP4L 4BKLA 3EOBB 3CZFA 1HNFA 1TNMA 4NHUB 3OGCB 4JG1L 4NN5C 1S7SB 3VFVB 4KJQD 5HHPB 2PW1A 1ACZA 5HVHB 3DECA 4IDLA 4F33A 2CK2A 1UEMA 3QWRA 2FX9L 1AIFA 2VDRL 2MQCA 4F9PA 1YYLL 3SDXE 1KIRA 4G5ZL 3DIFB 4MJIE 3PDOB 2VKWA 3P4MA 4JKPH 3BZEA 2Y36L 5EFIB 1ACYH 3RIAK 1T5XA 4BSVB 5LGKA 1AP2A 3M1BB 5KN5B 4IHOB 4GO6B 4XWOD 5HHOB 4Z0BL 5B38A 5IHUL 5ID0B 2FX9H 4U6HB 1VHPA 4HFUH 4Y89A 5F9JA 5HDBE 1HXMB 2WBJC 4RAUA 5I1JL 1JWSA 1C1EL 32C2B 5GRYA 1NL0H 1CR9H 5E6ZA 5HHMB 1MWAB 3SE8L 4DZ8B 2WSKA 1UZ6F 3T8XA 3WNKA 3BZFB 4JPWL 4HUVB 4FABH 1JPSL 2E7HA 3QNZA 1JYWA 2CUHA 1LD9B 1MAJA 3LY6A 4PLKC 1ZOXA 2R69H 4RMTA 1NUFA 3ZYIA 1TVBA 1U91B 4U49A 1QTYT 4XI5D 5JTWA 3OX8B 5IJKC 1ZANH 3DURA 2J8UA 4X6DE 3VGAB 3X3FL 1YY9C 1NBVL 1KPRA 4JJ5A 1LE9A 5E70A 1BAFH 3PL6B 5C6WH 1LEGB 1BBJB 4P3CH 4LP4A 1OAZH 4KKCC 2V2TB 2EDEA 4I18C 3F5WA 3QDGA 3OXRA 3RBGA 1V3JA 3DRQB 5EPMB 4WU7B 3NFSH 3UBXI 6FABH 4H0GA 3CK0H 1I9IL 3MRRB 4LLUB 3T2OA 3O3DB 3D25A 1CICC 4KKLD 5I8EA 1Z9SA 5FYKH 2R0KL 4KDVA 2JJSA 5I15H 3Q3GA 3IJSA 3FO9B 2B7DT 3JWOC 4BZ2H 5IFAL 4ZPVA 4KROC 3ZKQD 3EYUL 4LSSH 1DBKL 4JY5H 1TJGL 3OR6B 1CVSC 1TETH 5DMIH 3VD9A 4P4KA 4WU5B 4O9HH 3WHXA 4JHZA 1ZHLB 1YNLL 4EDXA 1S7WB 4NHCL 1ZVYA 1A6WL 5DD6B 4LPYA 3HZMA 3NIFE 3OL2A 3LRSB 4BFEA 2DS4A 4GRWB 4RISH 1FFNA 4P2QB 2AI0H 3QIUB 3WIFA 3HNVL 3REWA 1C7TA 4WHTA 5C0AB 1PYWA 3CFDA 5F71A 3UTZB 2YK1H 1MHEB 1NGYB 4U4BA 4N8CL 1U3YA 4XC3H 3TWCH 5I1KH 4YK4B 4NQCE 3S4SA 1K2DB 2HJLA 1J18A 1A9EA 4WU5A 4HW6A 3GHBL 3C5SB 2BOBA 2C4XA 5KSVB 1M4KA 3KS0J 1V3LA 3HC4L 1C16B 1K85A 4NQCA 3DBXA 1AI1L 1T83C 3IDMA 3UO1H 3ARBB 1TZIA 1PDKA 3WNLA 2H9GA 3QNXA 3S7GA 1JV5A 3LRGA 4RFOH 3ZKSD 1TVDA 3G5XA 1KJ2H 5BVPL 3BWAA 3C08L 1E4XL 5JR1L 4OAWA 4OV5A 1MCOL 2CJUH 2BXZA 2CLRA 3Q6GL 1N8ZA 3INUH 1I3GH 2WWMC 3MCLH 4HPOL 4RFNB 3GO1L 3TIDA 4OFKA 5C0EA 3OKKB 1ZE3C 2J6EA 3NZ8A 1XCTA 4J23A 4UV7H 5F96L 4E0RB 2D03L 5EC1B 3O6LH 4MQSB 4OLXL 1QVOA 1CFVL 1JMXA 1E27B 3C6LA 3C2SA 2VZVA 5LBSH 3PWJA 4JKKA 4ENED 1IC4H 1J0ZA 5BXFA 4WI9A 5K9KB 3NFNA 3O11B 4ZQKA 5B4MC 3IAPA 3U9UA 3CH1B 4ZDHB 3O8XB 3V6ZB 1H3XA 2NZ9C 2RQ8A 2P8LA 1P69B 2Y36H 4GAFB 2E27H 1ULVA 4HWEL 1KIRB 3P0YL 5LXGL 4CMMB 2NXYB 4Z0BH 3LQAH 4F9LA 1QSFE 3BT2L 2X9XA 3C09C 4RNRB 3MLWL 2YKLL 5F9WB 3PWJB 3S3SA 1OP5H 3CVHB 2R29L 3WBDA 3CFEA 1G7PB 2VABA 4BFBD 4JM4L 3SDAA 4RAUB 5FA3A 4UU9B 1S7VB 3MGOA 4LSQH 5ECJE 1VEMA 3IU3B 3BDBA 1QEWB 1KPVB 4JCLA 4FP8L 3OG6B 4MXWH 4F7TB 4U2YA 1WBYA 3P3YA 3BGFC 2R0LH 4N8VB 1RAMA 3K7UA 1JI1A 3W0WA 5L2JA 3TA3B 1RZIB 4X7SL 5I8KL 3LKQA 5C0FA 3SJVE 1I1YA 3RPKA 4NNPH 1CBVH 5TFSL 1UJ3C 3FTGA 8FABB 2YRPA 3BGFB 3LQZB 4Z95H 3QIBB 4HJ0C 5FYJH 5EU6D 4JZNB 5F1KC 4K8RC 3GUTA 1D5IH 4ORGA 2H26B 2VXVL 4HS8H 1HINH 3PJSA 5GXBB 4UV4H 4NOFA 4K7FA 2AJXH 2ZUYA 4LRNH 5TDOA 4Z7WF 2DYPB 1OAKH 4S1QH 3MLVL 4R8WL 4R2GC 5BJTB 4MD0B 3UCRA 5GGUA 3CVIH 4GMSH 5IGXH 2UZYB 4EKXA 5E8NA 1MJ7L 1JZ7A 5LGJA 1UM5L 4KRPB 3I2CH 1ZVSB 3BH9A 2ZPKH 3P11L 2F8XC 1OW0C 1LO2H 2YC1A 1UYWH 3VXRD 1P1ZB 1MWAL 2BSED 4NM4H 5EDXA 1E4WL 5I6XB 2R15A 3HUJE 3O41A 4HIHA 5FYLL 5ISZD 2XQYK 2Q1EA 4LLDA 3VFWA 1JRHI 3S37X 3TT1L 1YEHH 2AERT 3DROA 1DBML 3MR9B 4CVXA 3O8XC 2EXYC 2HWZL 1GZPB 4PRPE 2YRLA 2UZXB 3VRIB 5AAWA 4Y5XB 2ZCHH 1HHIA 3UJIL 5CJQH 3RZWA 4GG6E 1VFOA 2AK1L 4Y0GA 2X70B 1OP3H 2CRYA 2C1PA 3HZYA 3SBWA 1GJIA 5DFTA 3LB6C 5D5MB 4UDUA 1V5JA 2B1AL 3EYSL 1WIUA 1YEHL 5GSRB 3V4UL 4UQ3B 2HLFC 3AREA 3BMVA 5FO8A 2VDNH 2NCMA 4RFNC 1YMHB 4WFFD 1M71A 2DQGL 4POYA 3QPXL 3BN9C 3FO9A 4PGZA 3QG6B 2IBGA 3ESUF 2J88L 2NXZB 3MV8A 4Y4FD 4JFFE 1T89A 4P4KB 3R8QA 4CDGC 1QACA 3RWFB 3WHXB 3TO4A 5ITBH 1EO5A 4N5ED 1MLBB 4YHIB 3F5WB 3QDGB 2IG2L 3EW3B 3FQNA 1MFCH 3D39E 1RJZA 1NEZB 5DZOA 2CDFA 2M2DA 4POZD 1D5BB 1XF4B 4ODTL 4O2FB 1SYSB 5GGTA 2GTWB 4XPTH 5E8DH 3ZKXB 1EJOL 4JDTH 3MRFA 3D5OF 1OTSD 3UPCA 3WN5B 1XR8B 1OAYH 4YEFA 2CO6B 3BSZH 3ZLQC 4Q0XH 3P4LA 1VGEL 1IAOB 3SE8H 4KTEH 5FGCE 5DUML 1GHFH 1QRNA 3DVIA 3IFPB 3L95B 3QEHA 5JZ7D 5GIRB 4LPCA 4D0DA 3GMNB 1YEGL 2HT2D 4BJLA 5I1GL 2IFFL 3O4OB 1D5BA 1XF4A 3FONA 4IIQA 4MS8C 4FN0A 1NMBL 2M8XA 4KVNH 1S9WA 3NCFB 4GKNB 5GS2H 1K6QH 1T1YB 2IAMD 4M62H 3LRHA 1I9RH 4P2YA 4B50A 1BJ1J 4X4ME 4R90H 3VFOA 4U31A 5F3HA 4YBLB 1MCJA 3IAQA 5H8DA 5ICYA 3EDFA 4KFZC 3BGAA 1KPUA 5C0CD 3TJHC 5D7LE 3TYGH 3UTSE 4HIXH 3MUGA 3MLTA 1IM3B 3SDYH 2J3SA 1KC5L 4ZG1A 1YYMH 1KB5A 2CDEB 2ZNXA 1ZHNA 1NUDA 4Y2OA 4W81A 1IGTB 4M3JA 2W1NA 3ULVL 5HD8C 4L5FL 3RI5K 1D6EB 1MFEH 3TPKA 5JHLL 1HWGB 1XF5B 3QWOA 4MA7L 4EN3A 1KJMB 2IPKB 1TTGA 5DSCB 2MCPL 5DQDH 2DI7A 4IDJL 1PLGL 1ZAGA 3TH4T 5GISH 4HCRL 4OFPA 3H3KA 4K23H 5EBMB 5B39B 5F3BA 1IQWH 2B4CL 3IKCB 4PGCB 5F6IB 2Z31B 5C0GB 3DX6B 4Y19E 1BFSA 1RSFA 4P2OA 3K4DA 3MBXL 4QRSA 3KPLA 5DC0A 5J7CC 3QEGL 5FHAL 4QHLA 5C7XL 2FGZA 3GSWB 1YA5A 5D1ZA 5FA3B 2NLJA 2JJWA 2VLKB 3C60A 2BY3A 3C9NB 5J1SC 4XMKL 5J57B 4HWZB 3BUYB 1OF2B 3W0WB 3KYAA 2E7LC 3TNNA 2VDRH 4CW1B 4H1LH 4LLQB 4U3CA 3H0TA 3I85A 5D96C 5CP3A 4GW4A 3Q1SH 5KSUA 3CLFL 1N0LA 1RFDH 4K9EH 4OLWH 2YHGA 4NRXB 2R1WB 4PRIA 3F7RA 5KBNC 3VG9C 3ZKMC 1MCWM 3FO0L 4GG6B 1NFKA 5EH1A 4MNGB 3LQZA 4DTGL 2NY5H 3DETC 3UYRH 5D7LB 3MRDB 4JRWA 3TNMB 1EEQA 1NGZB 3G9VA 4R9HA 4YJZL 1DL7H 3VXOB 1A3QA 3BP7B 2WK2A 5D1QC 4B7IA 1XIWD 4R7DB 5ILTH 2H8PB 3E3QC 4HBQA 1NGPL 4OKDA 4DKEL 3RUGA 4LRIA 1DQDL 5I0ZA 4ZXBA 1QFWM 1B0RA 4ZFOA 1X5ZA 1QA9B 2LAGB 3SOBL 4U6HA 3OV6A 1BP3B 2WBJB 3T0ED 4I0PB 4GKOA 1KJ2B 4DZBA 2APVA 4X6EB 5D93B 4ZFZB 3GNML 5I17B 1P5VA 4G6ML 3TO4B 1UH2A 3HPJA 2VNCA 3HR5B 3OAUL 4XC1L 2EKSB 5FOJA 1DLHB 1MI5A 4JO3L 3LKSB 5SX4H 3HNTH 4Y4HD 1EHLL 4LVEA 4UAOB 1YNKL 3MR9A 4WUKH 4LPVA 3EOTL 4YGVB 4JFYB 1NMBH 5TF1H 3L5XH 1BBDL 1F8TH 5GZNC 5TE4H 5ESAB 3QEUA 5DMKB 5AUMB 1NPUA 4MQ7A 5DFWH 2YN5A 1YZZA 1K8IA 4MAYD 3TO4C 2D7TH 1E4KA 1YEIH 1KEGL 4X8XA 3AREB 5FO8B 3GJFK 1F42A 2E5EA 4TVSa 5HDOA 1MOEA 4E41A 5DRZA 4NBYB 1D3CA 4PJ8B 4LQ1A 1EFXB 1S9XA 1E6OH 3PHQA 4KZEH 1AGDB 3T0EC 3HMXH 4YHMH 3FAXA 3WNNA 3MUGB 1AD9A 1BFVL 1K8IB 5BRZB 3KJ6H 2OI9C 4JRYE 4U6YA 1HHHB 2F19H 3BD5A 2X40A 2ICWJ 4HIIB 3QP3A 3RY6C 5EU5A 5KJRL 2WW8A 3KPOB 4PYHA 2DLTA 4WTWA 4YO0A 1MY7A 5JMOC 5J6HB 4HH8A 4NO3A 3MJGX 5D6DA 5L7XL 4TPRH 3D3VE 2VYRE 2O5YL 2A2QT 1FORH 3IYLW 3LZFH 3WHE0 4CVZB 7CGTA 4I2XA 5GIRA 2FX7H 4Q6IB 3ZYOA 1KF9B 4TSCH 4NQCB 1OSZB 5TGBB 4TRPH 4X8JB 3RDTD 1C8PA 5BOZG 3FT2B 3WKMH 4NQDA 2Y06L 2I24N 1X5JA 1YEKL 1FZJA 1CQYA 2VAJA 2DQTL 4WW2F 2UVFA 5DURB 1CR9L 3EBAA 4OTXH 4H25B 2H41A 3AAZA 1LNUA 2R1YA 5F89B 4P23A 4MDIB 1VADA 3X3GH 5J4MA 4XAKE 3ZDXF 1BEYH 4FFVC 3MC0A 4HKXA 3QZWG 3P77B 4XP6H 2WNGA 4XXDA 2HLAB 4Y16C 3HMWL 1DP0A 3K81A 5KSBA 2AK4E 2PYED 4NQDB 4GRLA 3CIQA 2MSPA 1AI1H 2EEBA 1FZJB 3VD4A 3SDCC 2R9HD 3QCVL 3RGVC 2CRZA 1B0WA 1NGYA 2CMRL 4HJJH 2EEDA 4XCEB 2VC2H 4GG6A 1HH9B 4WFFE 1P4IL 3QUKB 1Q9WB 4X9IA 2F54A 4YNYA 4DN4L 3DPBA 5B22A 3WNPA 3SKJH 2A6DA 2ADFH 2DL2A 1WAAE 4DVRH 4L8SA 1EEYA 3HE7A 5JXED 3WV0A 4HQQH 3EYQD 1MEXH 3GMQB 4OLUL 4OCWL 3GNMH 1QR4A 1VFBB 4HC1L 2VLJD 4WUUD 4G6KL 1AQDB 4LCWE 2D7PA 3U46B 2Z8RA 5A2JH 2HFEA 1SMAA 4E42A 5IQ9B 1GYAA 1A6ZA 3HFML 3QQ4A 5IBLC 3KYKL 3WFDL 5FO9A 3QEGH 5KVMC 3UYOD 2JCCB 3PGDB 5DQ9B 1CE1H 5TQ0L 3ESVF 2XNAA 1ZMYA 2MKWA 3MOBL 4E5XB 5JORA 3RVUD 3GMQA 1CG9B 1MCCA 1KIPA 2XICA 1J0IA 4HZLB 4JFDB 4XP9L 5K9KA 1FV1A 4IBLT 4HF5L 5D71L 5GGSA 1RK0B 2NXZD 3K1KC 4BH7A 5B38G 2DJSA 4FQXB 1N3NB 3N9GL 5DD3H 1X9QA 4UINH 3QNYB 1VERA 5IVZB 3QH3A 5DEFA 1GIGH 1A7RH 1CDYA 3H7BA 1FJ1A 1DL7L 4YXLH 2OZ4H 2CSPA 1BIIA 2BVEA 2DKSA 4JRXA 3U6RA 2WLYA 1GC1H 3P0VH 4GXUN 3IKKA 5CSGA 5EOCJ 5GGRA 2BSTA 2CK0L 3MV9B 4JG0L 5IT2L 4OGXH 2OS7A 4N5EC 5FCUL 1HYSD 4I4WB 1BVLA 1TITA 2OP4L 3DRQA 5GJTL 3EOBA 3WKNA 1RZ7L 1GZQB 12E8H 4UV7L 3U4BL 4IS6A 3SCMA 4R3SB 1PKQE 4AM0A 3KPTA 5DJ8B 3JV6B 5DDHA 4G80A 4NBZB 2BY1A 1DVFA 3Q6FB 5FGRA 5BCAA 1HKLH 2PCPB 3HA0A 4LAQL 4C56B 4I77L 1MVUB 5ACMA 2DQUH 4ZXBB 3TN0A 3QHZH 4S0TD 4CVXB 1BJ8A 2BRQA 3D85A 3G6DL 5L8JB 3ZYJA 5C7XH 4KU1A 3FQWA 1LO4H 2EDBA 1H0DB 4FFZH 1SYVB 4NRYB 4Z7WB 4M8QB 2NR6C 5ID1B 2VDNL 4LFHG 2V5YA 5FEBA 1F3DH 1AXTH 2J12B 5FM5O 3FB8B 1KCSH 3DRTA 1JGLL 4W4NA 5C0BD 1Y18A 4WV1A 4ZUUB 1DLFL 3RTQB 2VZUA 3O3AA 4OZ4B 1DQQB 1Q9LA 5KSVA 3B9KA 1ZEAH 1F4WH 3SQOH 4OI7A 5C0ND 3IU4H 5MP6L 3X13A 2B4CC 4NNPL 3V4PH 5I6XC 5EUOF 1FG9C 3NAAL 5DFVC 4FQHA 2NY1D 4LASL 1OWWA 5C0RL 1DANT 4U1GC 4Z95L 2OM5A 2GSIA 1YN6B 3B6SB 3RWGB 2D7OA 3QCUH 4IMKC 3FQUA 4PJGB 4QRPA 5KSBB 2IBZX 4OZ4A 2YBRB 5IP4A 3MLXL 3ULUC 3ARDD 4V2BA 3F8UB 2IADB 3WLWD 5DJ6A 2WUBH 4PLOB 1QBLL 4PRNB 1CGTA 5KS9E 3QWQB 1XF3B 4PJDF 1KLGA 1G9MH 4JN1L 2XZQL 5JXAH 2PYFB 4C54A 1X4ZA 4X4YA 5K9QG 3FT2A 1EGJL 2DYPD 3MFFB 4TSBL 1FO0A 5TE7H 4NBXB 5D7SL 2EYSA 3MRNA 4YHLH 3DMMC 4ZFFA 4ZO9A 4OT1H 5ICYB 4Y5YB 3EFDH 1QSFD 4JHAL 1FYTD 2UWEB 5TQ2L 3ROOB 1I75A 3D3VD 4UZGA 5T1KD 5DI8A 4QT5A 1IVLA 5D6CB 1HHJB 1DQTA 3SGEH 4LLVA 5DVMA 4UIKL 2ICCA 3MRQB 1FZMA 3PABA 1IGJB 4ZOCA 1MIEL 4EJ1C 4KPHL 4YBHA 1S7VA 3MGOB 1IGTA 3RWHA 3MLZH 3BEWB 1CE6A 4ZAKA 1D9KB 4ONOA 1QQDA 4H20H 4WI7A 3E2HB 5KSAA 2NTSP 3UTQA 2IPUK 2LAAA 2BNUA 3RKDC 3UTSA 2VDQH 4OF8A 2HYMA 2DQGH 2C3VA 1QHPA 4P46C 5L2JB 4V1DE 4NT6A 4R26L 4U7MA 3FT3B 2EECA 4NKOA 2UVEA 3BVNA 5D1QD 4OLVH 4HUUB 5JQ6L 3D2UD 1DUZB 3BD4A 2HFGL 3QCTH 5E2WL 5AG9A 4HGKC 4ZTOH 4QTHA 3MOAL 3NZ8B 4ZUVA 5CZKA 3RWEB 2ARJB 4KKCD 4DVBA 4IOSD 4Y4FB 4FTVB 2X89D 3OZ9L 2QSCL 1OD7A 2YK1L 3CD4A 3C6LB 3WS6C 4Q6IC 5C09D 4IOIB 3ARFD 5CBEB 3AUVA 1FGVL 4J3VA 2E3VA 5I30H 4NO0A 5L2KE 1NLDL 5F7KC 4ZUTA 3P4OB 3STZA 1MPAH 2R1XA 1FNSL 5EOCL 1AO7A 4HKBB 1E28B 2ARJQ 2A73A 4P5TD 4RMSA 4HIJB 4GXVL 1WK0A 2H2PC 2C26A 1S9VA 4X7DC 5IR1B 1A64A 3V5KB 5I15L 5EBWA 4OM1H 4LL9A 1AC6A 1HSAB 3KYMB 3E6HA 4R97B 4J3WA 4TUJB 4QHKI 2HT4C 2HJKA 4HWBH 2P5WB 5DMYA 2AEWA 4XNYH 5ANMA 2AJ3A 2HAZA 5C0GA 1U3HA 1DBBL 1U8JB 4MMZC 2BNRD 3KR3L 4LIQH 4P2OB 4WFGE 1IT9L 2OK0L 5E9DA 2A0LD 5GRVL 2QHRL 3DMMB 4J8RA 3GBLA 1S5HA 4P5MA 3O3UN 3V5KA 4YPGB 1E4KC 2LU7A 3H3PL 2Y23A 2XY2A 4NRZA 1EJ6A 4HS6B 2AXHA 3O4LA 1XGUA 5T1DL 3FOMA 1WQVT 4WJ5B 2ICEB 1IC7L 5HDLA 1KJ3H 2J1KA 1J5OH 2RIKA 5KSBE 1IEBB 4BQCA 3GSVB 2MMXA 3MODH 3D18B 2XZQH 3TCLB 4PJGA 1DEDA 4LARH 5IHZA 4QHUA 4X4XB 3GUTB 4UAOC 2B5IC 4BZ2L 2FEDC 2DQHH 3ARDC 3SY0A 4K3EL 1CGWA 4PB9L 2XWBA 5DJ8A 4JRYA 4P2QA 3U2SB 2P42B 2IBZY 3GMPA 5I1JH 2YWYA 3IJHB 3U9PL 3HUJB 4IIQC 4GJTB 2JIXA 4MJ5B 3EIFA 3V8OA 3VXSD 5CGYC 2YC1B 4RFEB 5AG8A 3SDCB 4MLSA 4HT1L 5H94A 3WIIL 1OL0A 2A38A 3IFOB 4XCCH 1YEFL 4HWBA 4I0PA 2L0DA 5ERWA 1EIBA 3MACH 2EDLA 5D1QB 3QG7L 2H9GB 1WZMA 3TVMA 4IIQB 1OT1A 1ZANL 4UT6H 4BQ8A 3W39A 2X1XR 4K3JH 4YUEH 1JHKL 3NA9H 4MJ6A 3D69A 4K07A 4NP4H 3SGKA 1RZ8B 3ARXA 3KLHD 1CZ8L 1DUYA 5FYJD 3FO0H 5IVOA 1G9EA 4J4PD 5E00B 2MCG1 2DI8A 3ZHDA 1IM3A 1YECL 3VFNA 3SE4C 2GUOB 43C9A 5EIIA 3SE3C 1MFEL 5MHSD 5C8JB 1OAZL 4ZOAA 5FO7B 4I3RL 3BN9D 1B2WH 4DFHA 3SJVA 3OKDB 1QR1B 4MA7H 5LJYH 3PWPA 2RCSH 1ZLVH 3VFPB 3O6FB 2X09A 3F58L 3TBWA 2J8UE 1HCVA 2XT1B 4DKAA 3B6SA 3TP4A 2P45B 4X0KB 3IVKA 2PN5A 2AEIT 2JB6B 2IPTH 4TN9A 3BKML 5GHWH 3MLYL 4AEIH 3MRKB 1A14H 3BO8A 2DOCA 3L5JA 5B39A 2VO5A 4MMXC 5IM7B 1MVFA 2PNDA 5BW7A 3FZUC 4JVUA 3S88H 4M6NL 4KAQH 2FJGB 4XP1L 4NQDE 4XHJD 3IF1A 1CL7I 1NC2D 3C5JA 1EHXA 4CRPA 1CBVL 2XA8H 1WJ3A 2Z92B 4G3YH 4M62L 2W59A 3O81A 3P4OA 3SDAB 2JB6A 1SY6A 1UXWB 3C5ZA 3MLUH 2EDJA 3RJQB 4EI5A 1CLOH 2YWZA 2AABL 3IDYB 5GRWA 4XAWL 3GSOB 4PGEB 1IRAY 3Q5OA 4NQUA 1UCBH 1ZA3A 1MLCB 3O3EB 4RMVA 2WQRA 4JFFD 2MNUA 3MLSH 1ZGLB 1J0HA 2P5EA 5HYJB 5IKCA 1RZIA 4UDTA 2R4RL 5D6CA 4Y1AD 1OSZA 5TGBA 3NH7H 3ZKND 3MLVH 4R8WH 4P5KA 2JTDA 5ITBL 1CXHA 5F9JB 4HUUA 4JLRA 1A7PL 2I25N 1DFBL 4YDJB 2H3NB 4ETYA 4YDKH 2X44D 1KSRA 2I60L 3CX5J 2DWEB 2ADIB 3SGJA 1F4XL 4W6WB 1JIBA 3QDAA 4HJ0D 5GZND 2ZUSA 1P4BL 4F7MA 3AM8A 5T5NF 3MO1B 3R06A 3BP7A 2EDHA 3RX8A 4DN3L 3DV6B 1FFRA 5MEQB 3HPLB 1MIML 3ES6B 1UKSA 3LEYL 1P84J 2Q3ZA 3MBEC 4Y4HC 5FK9B 3E1F1 3RGVA 4HKJB 4P2RB 3DYOA 3OKEA 5E7BA 3RA7L 3UTTB 3NFPA 2VZ1A 4X6CF 5IF0B 4OIIL 2PYEB 1U95B 3B5HA 3ME0A 4M43L 1DLFH 2X4OB 1J8HE 2A9NH 3WIHL 3QQNA 3O9WD 1YEJH 5DUPL 5IR1A 5I71C 5CLWA 1TZHB 4I48B 4PJBA 4OJFL 1PZUB 4R90L 2ARWA 4P46A 1C5CH 2XWBB 5E5RB 2BNQB 4JG0H 3V4VL 3RDTB 1XIWC 1A1NA 1S5IH 4QLRA 1FJ1B 4QHLB 5IVXF 4Z7OE 2Y07L 3OJDA 5ESVB 2VLMD 1CS6A 3LEVH 3R4DA 1DBMH 3TYFB 1FCGA 3HE6A 4PRBA 4ONGH 4U33A 2AV1B 4KKNA 1MREL 4RFEA 5ICXB 3MNVB 3KAAA 1RURL 3QNZB 2NY0B 4I4WA 3RTQC 5CKGA 3WFHB 4U1JB 4MNQA 2Y7QB 3QXAB 4G9FA 3WEXB 5FDYA 1H3GA 1XF1A 3KHQA 4GW4B 1CZ8H 3OMZA 1BZ9A 4G80B 5B3JE 5KG9B 2ZCKL 5HTSA 5C07D 2ZJSH 1NGWB 2ICES 3IDGA 1MFDH 1MRCL 3MRLA 2A6JB 1ITCA 2W0LA 1S78C 1U8OB 2HJLB 1LEGA 2A0LC 4QHUB 1P1ZA 5C0DA 3LV3B 1O7SA 4KVCH 4U1NB 2W0FA 3LZFL 2PO6D 2WWMD 5BRZA 5C6TH 2NW2B 2BC4B 2OBGA 3U4AA 4QXTB 1CLYL 3FFCD 3LKPA 5D7KE 4NDMA 1P6AB 5DUBA 3QH3B 4XX1E 1MHPH 1I3UA 4RWYL 1IEAA 4HULB 1MEXL 2GW5A 4P57A 2VDOL 3DX9B 3MRLB 4PB9H 4EIZC 2NTFA 3NA4A 4G8GD 3TCXA 3ZKXC 1RJLB 1LO3L 2PO6C 2ED7A 4GMSL 3CSPA 4WEBL 1D9KC 1YNTB 5GGSY 4PJXB 1PGRB 4DGYH 2XZCL 1J88A 3LKPB 5K9OA 4JO2H 1F4AA 5C1MB 1H8SA 4AEHL 2IGFH 4Y2DA 1AR1D 4ODUB 3ILPB 2BNQE 4OZGA 3RWIB 3EYOA 5T3XE 3T0DA 2NY2B 1QSZA 3RWDA 1CLOL 1J0YA 1MVUA 1NCCL 1LO3H 1JHTA 1Q9KB 3MRJA 1MCBA 2VDPL 3VMOA 3IDXH 3JWDL 4NSKB 5FYKE 5HYIA 1I8IA 4PRHD 2FD6L 1ES0A 4YHKL 3PNWA 2DLEA 2P8PA 4GRLB 4WVRA 2LV4A 5IB5A 3C8HA 3WL9B 2C3HA 3ZE1E 1P9MA 3H9SD 4M1DL 1XIWB 2WP3T 1ZKAA 1OB1B 12E8L 4LRNL 3EHBC 5EO0A 3U4BH 3VH8B 4WO4A 3EYFA 4D94A 2HVKA 5JDSB 5C0BB 4N8VG 2WP3O 4NYLB 4YIQA 4BQ6A 4JHAH 5TQ2H 5F6HI 4PJCF 3V7AE 2OXHA 4HUWA 3WXVL 3MLWH 1G7QB 1JPTL 2OYPA 1FE8L 2Q8BL 5D2LE 4HLJA 3TPUB 1IFHL 4OQ1A 3WL9A 1WFNA 3ZDYF 2XV6B 1NKOA 4Q9CA 1IGYA 5DGQA 2GSIB 4XVTL 5KVDH 3CX5K 2C7UA 4GRWE 3O8XA 3C08H 4OUUA 3GSWA 4OZHF 2P8LB 4Q0XL 3WFCL 1C5BH 5DYOA 5L0QB 4KGLA 1KTDB 4GMTL 4LCIH 3MV7B 5IWLA 4OSUH 2LU4A 3TIEB 1R24A 3ALPA 5IQ7H 4MLIA 2WINA 1ZHKB 4QRRD 1ZHBA 3NTCL 5ETUB 5KVDL 5HYSB 3H3PH 1TJIL 3WE6A 2XWTA 1RUKL 2XTJC 3QXDA 4G8EA 1YUHB 2R1YB 5F89A 4O9HL 4JLRB 3LPFA 2FO4B 3WS3A 4WWKB 1GGBL 3WD5L 4ZMAT 3QUMA 4IMLA 1OAQH 1T1XB 4QCIA 3QUZC 4UILH 4YXHL 4U1JA 4DN3H 3L5XL 1TMCB 3ZE0E 4W68A 5DVKA 2FHFA 3CFEB 4F33B 1XGTA 5LGHH 1X7QB 1OAUL 3QUXB 3U4EA 2ZCLL 3T0VA 4E9LA 2ZOKA 3MRPB 3RZCA 2A6JA 3V6FA 2BDNL 3QUML 4MVBC 3OKLA 5ICZA 4XNXL 2VLKE 2GT9B 3EOYG 2DLGA 2DQJL 3PG2A 3QUMB 4G6AC 4MZ2A 2Q7NA 3G6JB 4F7MB 4LHQB 2NY2D 4MHHG 1GHFL 2FR4A 3ARZA 4ODSH 3OB0H 1KT2A 4O2EB 4JKMA 5FGBA 4JB9H 3QI9D 5CP7A 1WWAX 3QUXC 5JA8B 2BSRB 5ID0A 4M5ZL 1J9CT 5GGUB 1E4XH 3V4VH 3ORJA 4FA8A 5GZOD 1FL5B 1FGVH 4I2XE 1TNNA 4DOHE 3TEUA 3JTSB 1ORSB 4Y4FC 1NGZA 2FIRT 4KROB 4DVBB 1RVFL 1CICA 1T20A 3SDXF 1OCWH 5F88A 1F8TL 1EH9A 1AGCA 3LIZL 4AIZA 3O6ML 2XZAL 3SQBA 2WMPA 3MX0A 1YY8B 4QHNA 4WIQA 3BKYL 3L6FB 4K9EL 5EIVA 3DOSA 3F6LA 3LSOB 4H88L 2R23A 3MV7E 3HNSH 4EI6A 1AR2A 1L6XA 1BAFL 2J6EH 1IJ9A 4JE4B 2F53B 3PL6C 3BH9B 4R4FH 5H35B 1QNZL 2EH7L 3L5HA 5HGGS 2P43B 2AKRB 2VIRB 1RJCA 4KXZI 4WWKD 4QXTA 4E41E 2R4SL 1Q0YL 4KMTL 2D9QB 4POZC 5IGXL 5FYLD 1JRHL 4LPXA 4FXKA 4Q9BA 3QCTL 1OW0A 5GISL 5KSBF 1XH3A 1G6RA 4IRSB 1V05A 5FUCC 2VDOH 2DLHA 1JHKH 3S5LG 2ITCA 3DTXA 1T2JA 4YFLF 5DLML 4NRZB 1A7NH 1TVHB 5EU4B 1LO5B 4JHWL 3ARFB 3G9AB 4I8DA 4ODUA 3GM0A 2VDMH 3P9LB 1MAMH 1UWGL 4IM8A 3EYOB 4ODWA 3TYGL 4D9LL 2AQ1A 2L4OA 1HHGB 3PGCB 2YPLD 1G6RL 4PIRF 3SDDB 5TF1L 4MDIA 1IC1A 1G6RB 1VENA 2P48B 3IFPA 3QEHB 2EDKA 2PXYB 1WCBB 3I02B 3RPIA 4N0RA 4WU7A 1OGTB 4DGVL 4PRIE 3WHE1 5DJAB 1JNHA 5DA0B 1ZS8B 3O3AB 2RFXA 2FBOJ 1T1YA 1UJTA 4D9LH 1ZSDA 4IRJD 1DSFH 5IMKA 4UUJB 5SWZA 3VXME 2XWTB 5DXWA 1XGRB 4NZUL 5FV2A 4G8EB 5INDA 2YD1A 3SDDA 3IVKB 4XPHL 1MAKA 4CVZA 4NKIL 1NFDE 5H37H 3MJ7A 3WLBB 5F1NB 1J5OL 2ZPKL 2EH8L 4P2RE 1G7QA 3SDCD 3CFJA 1JK8A 4LKCA 5FGSA 4KTDH 1E27A 4GKNA 4JDZA 2OTWA 4JR9L 2BVYA 4QTHB 2HJFA 1U8MA 5C9KA 2QADB 1XT5A 3O11A 4ZQKB 3HAEB 3QWOB 1S7QA 3CX2A 5L88H 4L3CA 2ATKB 3DETD 1M7DB 4HKZA 4RGOL 1WZ1H 1IKNC 1L9NA 5FYJL 4HUNB 4KROD 2P24B 3WO4B 3RBSA 3AB0C 1YMMA 1KNOA 1N6QH 4GBXD 3K3QA 3MCKA 4PRHB 1NAMB 1QSED 2BP3A 4APQB 4RGNE 3I6GB 5IEHA 5C07E 3FTGB 5CCKH 1MCNA 4PGDA 4OZFG 4U7KA 5FECA 3H9SB 1I8KA 2CKBA 4KUCF 3GSQB 3WO4C 5AZ2L 5FM4A 2YUVA 1G0YR 1U92B 4Q7DA 2WBKA 2F9BT 5M95B 3ARWA 2JK5A 3Q0HA 1ZT1B 2IG2H 3I75B 1NAMA 1WVZA 4NOBA 1GAFL 3UTPE 1G1YA 2ICWB 4C83B 5D1ZC 4ONHA 3RGVB 4OD3L 5BZWB 2W38A 1PX3A 4MWFA 3WMSA 5JW4Q 3DMMA 4J8RB 4P5MB 4MNHB 3UAJD 2LQRA 1IE5A 3LN5B 3A6OA 1CGYA 2AP2A 1P6FA 3TESA 1RULL 4TVPH 5GGTH 2VDLH 1IFHH 4M7LH 4EXKA 1UM4L 4HF5H 4HUXB 4G43A 3DARA 3AU1B 4E5XA 2Y6SC 4GBXC 2HH0H 3OSKA 2B8OT 4DGYL 1SJHA 1HI6B 1KN2H 5ALCL 4Z8FL 1NDGB 3VU2A 1OGAA 3ARVA 4L8BA 3HTLX 4HGWA 2NNAB 4MNQE 5E94B 3HCVA 4ZXBC 4DZBB 1K4CA 2RJMA 5IW1A 3OJVC 3KYKH 5D7LA 1JHLL 3UPAA 2CXKA 5FUOH 4GQPH 3LKOB 1A6UL 2R0ZL 5DRNA 2EKSA 3UPRB 2YZ8A 2ZSVA 4HIHB 5I73B 1I1AD 2H8PA 2EICA 3RVWC 2CJUL 4BQBA 2WBWB 1NC4A 5HHOA 2XA8L 1LO5A 3U30C 3QT2A 1PSKL 5DVNA 2IMNA 5H94B 1K5NA 4LDOB 4CN6A 3P9LA 4TNVF 5DD0L 4M5YL 3W9EA 4YH6A 4GBXB 2Y5TA 3ARGD 3U83A 4FFYL 4UINL 1VGEH 2AEQL 2W65A 5E8OA 1MRDL 1VGKB 5D5MF 4RGNB 1JUFB 3CMGA 1EJOH 3BJ91 1CL7L 1A7OH 4KMQA 1BJ1H 3QUYD 2YD7A 3GBNH 3AS0A 5E2WH 3HC0A 2ATPA 1CDIA 1NC4B 3FHAA 2VQ1B 4HFUL 1Q9OA 5J56B 3BEVB 1R0AH 1A1NB 1EVUA 2JKXA 3HRZB 4KTDL 3VWJC 4AEEA 4KH2A 4GRLC 3B83A 2DQFB 2EH8H 3FFCE 4RA3A 1A6AA 3L3JB 1FP5A 5LQBL 4FQLL 4XMKH 2X4TA 4U6VL 3PL6D 4EI5C 3FOMB 2ZUUA 3MMEA 3WKML 5KOMC 3H9YA 1U8LB 4PV8A 2CIKA 3NN8B 4N68A 3U7WL 3BESR 3GBML 2ZOLA 3CUPA 4NNXA 4U0QB 1ZGLP 3WIHH 1PVHA 1UVQA 1JN6A 5FF6B 3V52H 3JTTA 4P2RD 4KTEL 4ZPVB 5JZ7C 1MJJA 3GIZH 4FQQA 3SY0B 3BZDA 3ULVC 1XF2A 1FN4B 3AB0B 3Q6GH 4FP8H 4YHKH 4M7ZC 5EULV 4BFIA 3OKOB 4LHUB 4FQJH 3TIDB 3KPNB 3MTRA 1KCSL 1CK0H 3QQ9C 2O61A 3OF6D 4KDTC 5TE7L 4XP5H 3PGFL 3VWKA 4LQFH 2BOCA 3LHPH 4KHTL 4EQ2A 5SX5H 3PNWB 3HI1B 5A3ID 4L9LA 2P5WD 3CSGA 4PJAB 5IMKB 5JW3H 1E6OL 1RIVH 2W91A 4HV8B 3QDMD 3S96A 3MA9H 4LPTA 5BXFB 5I8CA 4LOUC 4XVUD 1BD2D 5IHLB 3RAJL 3KXFA 2GJJA 1MLBA 3SGJC 2HMID 3RPIB 1MJ8L 2R4SH 4LSPL 4RA0C 3ZTJG 3CFJB 1U8PA 5EU6E 4DJMA 1I9JH 2E9BA 5IBUG 1A1OA 4PJ5B 3AREC 2FDBP 3FQXA 5L7XH 3QCUL 5DZNA 2GUOA 4OFYA 2EC9U 4BZYA 4P3DB 3FMGH 4KQ3L 2X4PB 1P7HL 5LWYH 2OMBA 3MO1A 4GSDH 4MNHA 5TPWL 1N3NA 3C2AH 5JHDB 2GAZA 3FRUB 4YNYB 4K9EC 3R8BB 5I1HL 4ZYKA 1QFWI 4H20L 4KK5D 4ZD3L 4GAYA 3VXTB 2VXQH 3PWNA 4JM2A 1CDUA 1HQRB 1FPTH 2QBWA 4PJCE 4MS8D 2PF6A 3MCKB 1I1AB 3H6JA 1ZLSH 3FQXB 4HZAA 5MERA 4PJ9D 5FB8A 1CFTA 4XX1G 1DDHA 3OAZK 3VH8A 2ZWLT 1FBIL 1D5MA 1OAQL 2CKBB 4PRDA 1M7DA 3O2VH 3EJYC 5D7SH 1ETZB 4DKFL 4P46B 2Z4QA 1LK3H 2FB4L 2DKMA 1SEQH 2XN9D 2KKQA 2VXQL 5EN2A 3LEXB 3CPLA 4FQ2L 2BNQA 5DDHB 4XHQA 1FL3A 2GFBB 5BQ7B 3MYJA 3Q6FA 3O6KH 4KJPD 3QXWA 4NJ9H 1SJEA 5FHBL 4PD4K 1UH4A 4A6YH 1GCFA 1PZ5B 3ZTNH 4PPTA 2LVCA 3GFUA 4HWNA 4P4RB 4MJ4A 4U1MB 2EYTB 3L3HB 5SWQB 3MNVA 3CU1A 5BO1L 4L4TA 2V2WA 3IDUA 2FATL 4ELKA 3MXVL 3GRWA 4TSAH 4ZSOE 2L7JA 2WUBL 3CNKA 3E8UH 4L4TE 5B4MD 1BVZA 3EHBD 3R1GL 5L9DH 1LP9F 1XZ0B 4C56D 4LHJB 1V7NH 4TSCL 2QV2A 1WTGT 5C08D 4Z5RA 4G6JH 5H2BB 4LHUD 3MACL 3VGHA 5C71A 4HZLA 3T3ME 1UM4H 4UILL 4JM4H 8CGTA 4G9DB 4HT1H 1MCHA 5GGSB 1CCZA 5EFIA 2VLKA 4NNYB 2AXFB 3C6LC 4LU5H 5HDBF 5I30L 2XI9A 5CP3H 4B7LA 4TULL 5MEOA 3ZZ1A 1QBML 3VI4F 2W92A 5I1IL 5I75C 4AEHH 3H7BB 1G7LA 2X9YA 3QQ3B 1GVIA 4BZ1L 1AR1C 3BX7C 1TTUA 3IXAB 3NCEB 1B90A 2VISA 4FMKA 4CVUA 5KN5A 1T66C 5CBAA 1JI2A 1M71B 2KQNA 2CIIB 3I6KA 4PRIB 4AMKH 5GSVB 3STLB 5JPMA 1KTLA 4XCYB 2C3XA 3GMMB 4NZTH 4Y4KC 1VACA 2AXFA 5K9OB 3ELAT 4JPKL 3DUHA 1CD1A 1OTUD 5E8OB 2KUTA 2AEQH 5IK3A 2VOTA 2Y5EA 5K9JL 4OZHB 1WC7A 3LN4A 5L2KA 1I1AC 4PB0L 2DJUA 3GI9H 2O5YH 3SE9L 2C5DC 4DAGL 3BMWA 3VG9B 3CSYB 4M7JH 4ODHH 4MB5A 1I1CA 1KTRL 2GY7B 1AXSA 1AD0B 1ED3A 5I17A 3N1FC 5ADPH 5GS0C 4HCRH 2V2TA 3BW9A 4RBPH 1LDPL 2OL3A 3KPRE 5EZIH 4NQED 4UQ2A 4P59H 3IDGB 4V1DD 2JIXB 4MJ5A 4QHNB 3HN3A 3ARFC 5HGAB 3N85H 3QEQE 2HRPH 4KWUA 2YD6A 3BRDA 3QFJD 3GZKA 5HGHB 1EEZB 1JVKA 2A6KA 1PY9A 3UZVB 2YXFA 3UTQB 5DJ6B 1MQ8A 3VFGH 1LHZA 4XP6L 4LFHD 1FNSH 4NKMB 2W9DH 4PJIB 5BOPA 4R97C 1CVRA 3SPVB 4P9ML 3PDGA 2C3VB 3WFBL 1AO7E 2VSDA 4XB8A 1M7XA 3DV4A 5DJXB 3LDBC 1FGNH 1NEUA 5JA9A 4PV8B 2BNRE 2HLAA 4M48L 3SDYL 1CN4A 3N85L 4JRXE 4X6BB 1D5XB 1IAKB 1IC4L 1SYSA 4XI5C 3B9AA 1FBIH 5EZOL 4G6FB 4KAQL 5HGHA 1ZSDB 3REWB 1J8HA 3U7YH 3FB5A 3QDME 4U1KA 3IDMB 4N9GA 5E1AB 1FDLH 4HJGA 4H25A 3WFEL 4OGXL 1C12A 2PW2B 3QPXH 1JTOA 4OV6F 4P4KC 1A9EB 3T3PE 1FIEA 5JOEA 2VL4A 4Y16B 1IM9A 2MJWA 1FL3B 2OTPA 1UZ8A 3S3JA 2BCKA 1RIUL 4UBDD 4HCRA 4XRCB 4WW2A 5C08B 4OCRH 4ZAKB 2Z31A 1ZT7B 3T77B 4LSSL 1R3LB 2XN9E 2EYTA 4BYHA 1A6TA 3CC5A 5TF0A 4OJFH 3L7FA 5F3HB 5T1LD 5DRXB 2HWZH 3T04D 1F97A 2QL1A 1NLDH 1GPOL 4BQ9A 2DQCH 3MNWA 5CJ5A 3VRJA 1ZGLM 1OGTA 1NFDF 4WUUB 1LQSR 3ZDXE 2DIAA 5DTFB 3PWNB 4G8IA 4JM2B 4PS4L 4PRHE 1JRHH 3CH1A 4ZDHA 1HYRC 1YMMB 4LMQI 3VI3F 4WTZG 4LGRB 1A7QH 1I85C 1MCPH 4JQXA 1A02N 2QQNL 2WIMA 3IRPX 4A6YA 1MHHB 5MEPB 2EE3A 4RAVB 1JF5A 4RX4A 2EIDA 2IANA 1MLCA 3O3EA 1NGXA 1WITA 5F1NA 4HDIB 5MENB 4YK4C 1NCAL 4AIOA 5A2IH 3S36X 2NXYC 3J8F7 3BQUD 1WIOA 3JSSA 4A2LA 4HC1A 2AJYH 1WZ1L 5DRWA 4R7DA 1FLTX 1JYNA 3HZKB 4G8GE 4DGIH 2QR0B 2DBLH 1VB9A 4MD4B 1KTDA 2AV1A 4PP2A 4XNZC 1S9YA 1FV1B 4NIKB 4NQEB 1NBYB 4Z7UE 2LVEA 2VERN 1C5DA 3GMMA 4LBEB 5FKAB 4OIIH 5CBEA 1A7RL 2VZ3A 5LVEA 3HB3C 4WGWB 4C57C 5JOPE 3MCG1 3MRBB 1JGDB 4PYGA 1DSFL 2VN4A 2APFA 3PWVB 2I9TA 5HJ3B 2YD4A 3GJEB 3LH2H 5I1LA 4LSRL 5EG6C 4MD4A 5C0FB 4I5BA 5DGRA 4Z7VA 3CCHB 1HZHL 1NDGA 1QFHA 2APXA 2A73B 4PR5B 4RSVA 1T2XA 1Q94A 1M6OA 3QIBD 1CDGA 4LCYB 3JV4A 3BHBB 3UBXB 3GDBA 5LCVL 4XAKD 2ORBH 5FO9B 2Z35B 4AZ8A 2FBJL 4NWUL 1L6ZA 1QBMH 1IEAB 1MAML 1ONQA 2FX8H 5HJ3A 2AJ3B 2R29H 3KPSB 1FGNL 1K2DA 5T3ZH 2ESVA 3V8CA 1BBJA 3BQUA 3AGVA 4QY8A 3X17A 2H6PB 3UJTH 3C09B 1H5BA 3U0WL 5EO1A 4K94L 3VFNB 1A3LH 5JOPD 2DLFH 3UTOA 3V0VB 3QJFB 3RVXC 3IJYB 5I1DA 1OWRM 2XQYG 1EFXD 4XBEH 3JWDC 1ZA6A 2BNRB 3SDXB 3RY5A 3FFDB 3LIZH 3RWIA 1U93B 2YSSA 2FIKA 2BSTB 3FQUB 1HH6A 4QRPB 1BOYA 3BWUC 3BQUB 2P5EE 4JFYA 4H1LA 5JLZA 3KG5A 3EJZC 5HGBA 1GZPA 4W6XB 5ERWB 2ADJA 3GSRB 4RWHA 1JNLL 4MQXD 4LDLB 1F3RB 3C60C 3IDXL 3JWDH 4QOKA 3KLHC 1XF3A 1I3VA 5IMMA 5I73C 1AKJD 4MJ6B 2WUCL 1Y6MR 3G5ZB 1U8LA 2X4RB 4NQEE 1YN6A 3FB6A 3EKCA 1UB6B 5IBLD 2VAAA 3BOVA 5GS2D 2B0SH 1IM9D 1GSMA 4LSUH 1PD6A 2VLRA 5EA0L 4HK0A 3GBNL 1UKTA 3CFIC 4XC3L 3TWCL 1IAIH 1Z6JT 4Y1AE 1M05A 4N90D 2R2EB 3AVEA 3HE7C 1AD0A 3SE4A 3VWJD 3PWLB 4JZJB 5F7WC 4UB0L 5DK2A 3W2DH 2NPLX 4ELMB 4YLQT 3LKRA 3TZVA 4WCYL 3SKUD 4FQXC 1BGXH 3CDCA 3VMNA 2BX5A 1VPOH 5SWSA 4XAWH 5BZDA 4D3CL 4P48A 3NMEA 3CLEH 4Z7NF 3B9KB 1FVEB 1N2RB 1S7TB 2G9HA 3RVVD 4A6YB 3UP1A 3RIAF 5J9PA 1C12B 2EDRA 1A6VL 5DK3A 4M1CC 3TBSB 5BS0A 5F7DA 1NANI 2HKHH 3DUSB 3QUKA 3EZJB 2NYYD 4WDIA 3VDAA 4LVHB 4NT6B 2I07B 3DX7B 1F4WL 3GSXA 4HDIA 3L3OA 2HTKC 3QFJA 3DJ9A 2I27N 4OLYL 5D2LA 4DGIL 4AEFA 2A83B 4V1DA 3L1OH 5ITFA 1FFPA 2ITDA 4K8RH 3QHTC 4MZ3A 3TBVB 2JJSC 1UVQB 4PJAF 1R3KA 4OB5H 3D3VB 5T1KB 3ZDZE 1KC5H 2I9LA 5EC2A 1JJUA 1A6TB 1I85A 4M93B 1KB5L 5EORH 4L4JA 3GSOA 1PQZB 1HN1A 2W60A 1NAML 5EUOA 2R2HB 2Q3AA 3H7LA 5EOQH 1F2QA 3T0WA 3WFCH 3HMXA 4N8CH 2Y6SD 5HHVL 1AHWC 3FJTA 1D6VH 4OZFA 3CXHK 2IEPA 1DBJH 1GH7A 5C09B 4YXKH 2R56H 2BFVH 3BKCL 4EZMA 4X9HA 2O5ZH 4F9PC 1FVCB 3RQ3A 1DE4B 1IT9H 1FZKA 5I75B 4CUCA 4JDZB 2E7MA 3QIUD 4O2EA 1QOKA 2WV3A 5IVZA 2K9UA 1T1ZA 4I1NB 4HAGA 3KPLB 5HHPA 2NNAA 3TC9A 4YZFF 5EBMA 4L3CB 4JKLA 5T33L 5I74B 5C92A 5EU7E 1HHIB 4YXLL 2F8OA 5AYUH 1HKFA 1AHWB 5CKAA 2XTJB 3T8XB 4GLRH 4XBGA 5ENWB 4RDQG 1FIGH 3VG0L 3OJMB 5IG7B 3OXSA 1PG7X 2VLKD 1TVBB 1M1SA 1MCRA 3CFKB 3MUJA 4I18B 5T5FH 5HI5D 5D7JA 1JPSH 35C8H 3QFJE 3NTCH 5ESVA 1NBQA 1OAKL 4S1QL 4C56A 4YE4H 2GK0B 1SBBA 1UJ3A 3MPCA 4ZAKC 2BVPA 5I74C 4JFZL 1R3JB 3TT3H 4M1DH 1ZT1A 4LCYA 5A43C 4IJ3C 5HDQL 4NNYA 5E6ID 3FQTA 5I66A 5B8CB 5T1DH 3VW3L 1S7SA 1EO8L 4KUZH 4U1HA 3S34H 4F57L 2D7NA 1FAIL 1F6AA 3ILPA 2XKUA 1L7TH 2NW3B 3VRIA 4PJIE 4DW2L 5IROA 5HYSG 1KENL 3OWEA 5ADOL 5DHVA 4TTGA 4PTUA 1CDBA 4X5WA 3MJ8B 2IALB 4OBSA 2XN9A 4FQIL 1KCRL 2F5AL 3NCBB 3EO9H 5DD3L 1FQ9C 1G6VK 2X42A 3T3MF 4K71C 5GSRA 1EHLH 2LFGA 1OM3L 3S5LA 1M05B 3ULSA 3X14B 2YUWA 4AM0B 3BIAX 2Z93B 5IB5B 2B1HL 3H3BC 5HI5C 2OJZL 2H2SC 4NUJB 1NCDH 4MJID 1G9NH 3IJHA 3TV3L 3W81A 1NANH 1UA6L 4JN2B 3GGWA 5BZDB 3D0VA 5D72H 2VXSH 4LASH 3B5TA 3KPMA 4U1NA 4JFXB 1S5HB 3RP1A 5FHBH 1EUUA 5HVWA 3ALXA 1RK1A 1NKRA 2H32B 3FT4A 4ZO7A 3M17A 1L7IL 1U8KA 2MPAL 4HLZG 3PWPB 5E6IA 2AK4B 1NCDL 2W9LA 4JFPA 4OD2A 5FDWB 1YEKH 5JO5A 5SWZB 3PXHA 3GSVA 4R4ND 5T5FL 1FSKB 2VAAB 5HI4C 5D70L 3L5IA 4J7RA 5EU6B 4ODVL 3I50H 1CF8H 3RKDD 4ISVB 4O02L 3SGDH 4MGXA 1BZ7A 3CDFA 3MNZB 5D7JD 4U6YB 3MBEA 4OCNC 3C6SB 1W0YT 5FCSH 3FONB 4H8WL 5I1GH 3KWWB 4ZD3H 2FCBA 5T1MA 3MREB 2LTQC 4ZNEE 4EQ3A 3U2SA 2OTWB 4JFPB 1JWUA 4OD2B 5JO5B 3TZVB 1DN0B 4YHPB 3AMLA 4XVJL 4GRWH 2D0HA 4BELD 4PJGF 3QRGH 3BIBX 4S1DC 3VXNA 2G60L 2NX5E 1LP9A 4D3CH 1MFBL 3OF6A 3ARDB 1A7PH 1AGFA 5EBLB 3TF7C 1P4LA 2EE6A 3VMPA 4HD9A 4GKZA 1K8DA 2UUDK 3FRPA 5FCUH 3QIUA 3T0XA 4N90E 25C8L 3DHJA 2YPKB 4Y16A 3ZTNL 2F54E 4P9MH 5J1AA 3UJJH 1XF5A 2DWDB 2Q87A 2G60H 1OQXA 2J8UF 3QUXA 1FO0B 2VDLL 3WJJA 1KXTB 1X5XA 3CDGA 3KNBA 3KPNA 4OD1L 3A67L 5D1XC 5K9QI 2DQCL 3TV3H 3LH2L 4HFWA 2VN7A 1L4IA 4Z7QF 2ARJA 4CU6A 3QZWA 2X6MA 1KB5B 4H5SB 4PJIA 3TH3T 2G5RA 2XFXA 2V17H 3AS1A 3DUSA 3I75A 1F58H 3HNSL 3MUY1 2I5YH 1KT2B 5CFHA 4FQXD 4KJPC 3FCTB 3EYUH 1IGYB 4CKVX 2B2XL 5SWQA 4JCMA 5DJYA 5IV2A 2GTZA 3LD8C 2FWOA 1KGCD 4ZOBA 1BM3H 3I84A 4CU8A 2X7LA 3H9HB 3FB5B 2J8OA 4JZNA 4M03A 4XNQA 3GBMH 3FHQA 1T66D 4L29B 4FQIH 3ARGA 3BKCH 3DV6A 2HT3D 4YGAB 1IGCL 4N0YH 1OOAA 4LCUA 5E2UL 2UY7A 4ZNEA 4HXBL 4IOFC 5BS0D 5B38B 2ZKHH 2W9DL 4KK6D 1FVDB 3U7AA 1BWMA 1HXYB 1KOAA 1KJ2L 2CPCA 4PJBE 3KPPA 1P2CB 4M6NH 4P2CG 4MQXC 1JWSB 1DUZA 3BPOC 4LSDA 4QHMB 4APQC 4CJ1A 2V5TA 5IF0A 1MWAA 2PXYC 1LO0L 3KGRA 1FO0H 2A74A 5IIEA 3EJZD 2JCCA 1EEUA 2B1HH 1C7SA 2X4UB 5D7LD 3VXMB 1KJVA 2BJMH 5IMOA 3RUGB 3AM8C 3S5LB 4OGAC 4WFEE 3OPZL 4OLEA 4DGVH 3S8WA 5IFAH 3VWJA 3CVHA 2HTLD 3GKZA 3S3PA 2XKSA 2V7HA 1DDHB 5E08H 2AJSL 3RDTC 1T1ZB 1VKXB 4S0SD 5D1XA 1HSBA 4M4RA 3BKJL 2JJTC 4FQXA 4YXHH 3B2UC 1N5YH 3HG1D 2AJVL 5GGQH 1BFOA 3OKYA 4OCYL 1S7XB 1CD1B 3LMJL 1U58B 4OZIA 3VDCA 3NIGF 1HYSC 4LSVH 4FQPA 5J12C 3HR5A 5DD5L 1T5WA 4NKIH 3MROB 5CGYD 2YUZA 5HHNA 3BXNB 1QLRA 1WIPA 3FQTB 1RJYA 3QUXD 3MXWH 5IJVB 3CFKA 1U3HC 3VXUD 2C3WA 5T3XD 4Y16D 4L8BB 1EPFA 2VKXA 2DQHL 2A6IB 2QSVA 3ROLA 5DRWB 3W2DL 3DWTA 2DN7A 3MRCA 3NPZB 3MUZ1 5GGRB 4FS0A 4PTUB 2GK0A 4LCWA 4LCIL 1QPXA 5ACLA 3DVGB 2H26A 5C07B 5E8PA 5ESQB 3MBEB 1LVEA 1RIVL 4UOJA 1RFDL 4Z77B 1MF2H 1J05A 3QEQD 3HB3D 3ARUA 4GBXA 1PKQB 1YMMD 2XG5A 1XMWA 4LEXL 1VCAA 2XYCA 1P53A 5H35A 4QXGH 2VDKH 5IB2A 1S5IL 4KI5E 4KI1A 3Q5TA 3MRGB 3C5SA 1W8NA 5DJXA 3DBXB 1PBYA 4KKBC 4X9FA 3IXAA 2R4RH 2QADC 4B0MM 2MHAB 1F02I 3SJVB 4JRYB 5D2NC 1D5IL 2HKFH 2E8ZA 1QLEL 5IVXA 2AJZB 5J6HA 4KMTH 4Z0XA 3S37L 5JUEH 1N8ZB 5GJSH 3PHQB 3X12B 2IFFH 3SDCA 4JFEB 3KVQA 1MSPA 1MPAL 1VSCA 5DD6A 4TPRL 4JEGB 4MCYA 3VD5A 4PJFA 1MIMH 3JVGC 1U8QA 4H5SA 2FH6A 4ZTPL 3DI2B 4F7CA 4XH2A 4HPYL 4KQ4H 5FYJE 4Y8AA 4FXLA 4APQA 3BYTA 3V6OC 1FFOB 2IAMB 5FUZL 3S4SB 3SE3A 3W82A 1HDMB 4ZSOA 3LPGA 3IT8D 2R8SL 4NKQB 5IBTH 2D4DA 5FECB 5IUSA 1B6UA 5LG1A 5I76A 1BLNB 4GOSA 1MFAL 3O2DL 4MXQC 3GIVB 4PGBA 5CEZH 5EBGA 1L9MA 2CXGA 1HQRA 1CDJA 3UDWA 1UCBL 2I07A 4XXCC 5JQ6H 1DQLL 1JPST 4UUJA 4F7PB 2AXGA 5JW4N 5F9DC 4G5ZH 5BRZE 2EH7H 5D7IF 1UG9A 1HXYA 2G2RA 4BH7B 1FNGA 2OR7A 4HAFA 1D5ZB 2B1AH 4HK0B 3C60B 3UAJC 3QJHA 4E0RA 4Z7NE 3W9DB 1B4JL 2PTVA 3PDOA 3NOIA 2H1PL 4M4PA 3DX8A 1D5XA 1YY9D 3F6IA 1YQVL 4DN4H 1NH6A 4KRPD 3CU7A 2ZJSL 4LLQA 4NJAH 1UEYA 2OXGA 5T3ZE 2G75B 2D2OA 5JW5A 3VWJB 1CFBA 3DX6A 4HJGB 3C5JB 4PBXA 5EWIL 4LLVB 1JYVA 5EZJB 3BISA 1BVLB 1KGCE 2G5BB 1R6VA 5IQ9A 3U46A 4WWKA 1BX2B 1D9KD 1Q9WA 4UMGA 1TIUA 1FCCA 4YIQB 4GRWF 1GGBH 3WD5H 4UT7L 1U58A 4L3EA 2YKLH 1JPFB 5D9SB 5HSFA 4FQLH 3PUCA 4W4OC 2R2CA 4G42A 3RKPA 1OAXL 3LPWA 1RUQL 2BK8A 3Q5YA 2FBJH 2N7AA 3SCMC 3RVWD 1NBVH 1TQCC 3PIQB 5E2JA 1RJYB 3WXVH 3V2AR 4UIMA 3OGCA 2CRIA 2FX8L 4WFHE 5DA4A 4ONHB 5E6IC 5DJDA 1CE1L 5TQ0H 5IVNA 4WEBH 4LKXA 4WI5A 3TJHD 3GI8H 4OCSH 2ZG2A 4JJHA 5FUZH 3UBXA 5IFHL 5HPOA 2VITB 4CMHC 3G5VB 4XPBH 1T3FB 2W60B 5EUOB 3GKWL 3KHOA 4JKPL 2FL5A 3TA3A 1NDMB 1CFSA 2HVJB 1GC1L 3P0VL 5KS9A 5CEZD 4HWUA 3L7EB 5MP6H 1A6VH 4ZFOB 1A6PA 5F7MC 1KULA 3A67H 5C0RH 4HEME 1FL6B 4PLJD 4QHMA 4HX1A 5BW7C 5SX4I 5E08L 3JTSA 2CD0A 1MHCB 2W0FB 1T3FA 4YDKL 1NBZB 5GGQL 3BKMH 1DQML 4JAMA 1OTSC 3HZKA 4O5LL 2CIKB 4UTAH 1T5XB 2FEEI 1RULH 2Q8AH 3U79A 2AGJL 5CJXA 3LD8B 5B8CC 4WWKC 3SKOB 3O9WC 4OQTA 5IBUB 4NO2B 1T0NA 1PLGH 1VEPA 4LLWA 4UTBH 4XWGL 1TPXC 5HHXH 5JHDE 1MHCA 5L2KD 3B2UD 3DVGA 3VXOA 3ZT5A 3TA3D 3ZMRA 3Q2CA 5E8PB 5DQJA 4QWWD 2FHBA 4V2CB 3VFUB 2Q8AL 3RWJA 5L0QC 3TN0B 1YEJL 2XG4A 4X4ZA 2A6KB 4YO0B 4NM8L 3O0RL 5FKPA 1NJ9A 4RGMC 2MQ3A 1S9XB 5EO9A 2PR4H 3CLFH 5IHZB 3CFBB 2DAVA 3KXFB 2BVTA 4CAGA 3I02A 1S7WA 3BE1L 2X5PA 4QF1A 1AGCB 1IEHA 3ULVE 3ZKNC 2CKNA 3O8XD 2WIIA 3HAEH 2KZ1B 2VDML 4L3ED 5INCB 3BRGC 1ZXQA 5E6IB 2FD6H 4ESKA 1D9KA 2I5YL 3TBYA 1AKJA 4YHYC 1XGQA 1KN4L 1ZLVK 1YYLH 1MCDA 4OFDA 4NO3B 5ESAA 1OPGH 2E9JA 2EZ0D 3EDJA 3TM6A 4YFLI 5AUMA 5I1AA 5F44A 1NC2B 4H8WH 1T22B 5J12B 1JNJA 4LCCA 4N0UA 1EZVY 3SDXA 3KYOB 1WLHA 1NGPH 4DKEH 5J89A 5FUCE 1AXIB 1RJZB 2RR3A 2UZIH 4F8TA 3LRSA 3WYRA 1JWMA 1HH6B 2GK2A 3THMH 4OCMC 4FZEL 4HS3A 2JF1A 4HPYH 4KQ4L 1Y0LB 1RU9H 3VXQA 1Q0YH 2IBBA 3BPLC 1CLZL 1EFXA 3L7FB 1KXVC 3LB6D 2ZUTA 3QYCA 5B3NA 1NLBH 1IGFH 2ATKA 3V7MA 1J1XL 3KPMB 1JL8A 1GOHA 2VR9A 4M61B 4P59L 5CUSL 4X7TB 4PJFB 2P24A 3BAEH 2ESVD 2GFBA 3B9EA 3WJLA 3QI9C 1IGJA 1K8DB 4FQJL 4Q97A 3IKCA 4PGCA 1N64L 3DYMA 1DEEB 4U1KB 3T0AA 1U8MB 3DXAB 1AC0A 3SKJL 1QKZL 2VXUL 3HAEA 3PWUB 4WWID 3O3BA 4PJ9A 1QSEB 4APQD 3BGMA 4MDJA 1UWGH 4PJGE 3QIBA 4F58H 4M02A 5I9QB 1AGBA 4JM2D 4P5TB 3W9DA 4X83A 2DD8L 3QZWB 4Y5VA 4XNZB 1KB9J 5JW3L 3TNNB 3DLQR 5FB8B 5KS9B 4ZUVB 5KVGH 4ZFGL 1I9JL 3DVFA 5IOPB 1T83A 2BNUB 1BVKA 3FFCA 4OF0A 1J12A 1FZOB 5CJ8A 4MDJB 2NY6C 3BSZL 4NHCH 2DRUA 3VRJB 1G1CA 5BRZD 5GS1C 2X7LB 3H9HA 3QO0A 4N0YL 5EBLA 3CPLB 4JREC 3CJJA 1C5CL 1I7TA 4WHYG 5ADPL 1YQ2A 1N59B 3PIQA 3KLAB 1F4HA 1TZGL 3KXFD 3ALWA 2OCFD 3JWOH 4EDWL 5AZEH 1CFQA 4Q9QL 3QDMA 4WW2C 1KTLB 2BFVL 1CD9B 2NY0C 2B2XH 3P0YH 1UWXH 5LKNA 3QEQA 1QFUL 4U1HB 3E6HB 4RX4D 1A7NL 3JXAA 3RWCB 3HE6D 4UDUB 15C8H 4M3KB 4N8PA 3BKJH 5FM8A 5KOVC 4X6CA 5H2BA 4NZTL 1RZ7H 4JY6A 4LCWD 3ARSA 4P46D 4I3GA 1U2HA 4HKJA 4P2RA 2N7BA 2PTTB 2Y5TB 4AT6A 5IW1B 1CYGA 4PJBF 5DMKA 3V6FB 3QQ4B 5T1LA 3VXUA 3GO1H 1U8IB 2E7CA 3FFDA 2HN7B 3LAFA 3RY6A 2Z31D 5SWSE 3QCVH 4XZUA 3H9ZA 1OP5K 5ANMB 5KJRH 1WBZB 3PF2A 2XXCB 2OSLB 3D18A 4NQXB 1OP3K 4BK5A 1PSKH 3PL6A 4JY6B 3N06B 4HH9B 3GHEL 3L3IB 1DCLA 3HG1A 5GGVH 4FRWA 1KG0A 2JELL 2Y7QA 5D1XD 5B3JF 4HWEH 2AJUH 3VFSA 4M93C 2Q86B 2DQJH 4AG4L 4O51A 1X44A 1EA9C 1B3JA 5DMGC 4QOKB 1H9VA 1F4YH 3EJJX 2AJVH 3NIGE 2ZSWB 1J8HD 2A9ML 4Y7MA 4G43B 5FM5M 1H8OA 5IB3A 5GPRA 3MLRH 4I3SL 1Q0XH 1FLRH 5E1HB 3REVB 5BV7B 3D25B 3A6CH 1PG7H 4KK8D 2ADGA 4XBPA 5LAXA 3KPOA 5HY9A 2P5ED 3UXFA 4JFFA 3SGEI 5HPMA 2NY3D 4YWGL 2YN3A 2JE8A 5KVFL 3QPQC 1MCOH 3N1MC 5CZXC 2WANA 1NC4D 4O51B 4U05A 3X3FH 4D9QE 4ORZC 1T2QH 3MRGA 5I2IA 1PYWB 3VCLB 5HHNB 4NWTH 2PCPA 5KAQG 5IB3B 2NTFB 2WWKT 3B9KC 3HI1A 3MJ8A 1RIHH 3T1FB 4J2XA 4W6YB 3OGOE 3O6MH 4LCCC 1T4KB 5EZLA 3BRFA 5CJXC 4J1UA 3CC5B 1ND0B 4WNQA 1OGAD 4LEOB 4PGEA 3IDJB 1FN4A 3AMKA 4LCWB 5GS3A 4L8SC 5ABDE 4NWTL 3W11D 4OAWB 3GSXB 3VCLA 1DQMH 2ZCLH 3V5DA 2NQCA 2QSQA 5ANME 4I3RH 1RIHL 4X6BA 5CS7A 4JN2A 5D7IB 3MRQA 1U0QA 4TTDD 3MRMA 1XCQB 1VA9A 4JFQB 3D0LB 5E9DE 3DMMD 4OLUH 4M7KL 3ZE1F 4JPVL 4NZJA 1CQKA 4M9OA 4NKMA 3JWOL 2VLME 2HKFL 3QR2A 5B39G 3MRIA 4P9HH 4Z7VE 1CLZH 4KKAD 3IDNA 3JUYA 4HBCL 5FYJU 1IM9B 1AH1A 1XCTB 2BVOA 1CD0A 1G7MB 3PHOA 4YHNB 3DNKA 2XRAH 5JNYA 4JY4A 1Z9OA 3ISWA 5J0BA 2CR6A 4URTB 2QR0A 2FHCA 4M7KH 2F74B 2G9HB 3U7WH 1I9IH 1FC1A 2FECL 3ZDYE 1HWHB 1EV2E 4JQIL 1CXKA 1NSNH 3FKUS 5JHLH 3FQRB 3UTSB 3U82B 1DR9A 4P23B 1CTNA 2JB5H 1QSEA 3UEZA 3WDHA 1UWEH 4A6YL 1CGVA 1SM3L 3GMLB 2EEAA 5HD8D 3HRPA 3TVMC 3UBXG 4XHJC 4LLYB 4EBQH 3MBED 4XWOC 4JY4B 5JIPA 3MLPA 4X7FC 4JFHE 4XRCA 5DFVD 5C08A 2B4CH 4LQFL 1UFUA 4FFYH 5FA4A 4UTAL 4P2QD 2KZWA 3EO0B 1U8NB 4KPHH 1RZKH 1SBSL 1Q94B 4FMFA 2FZ3A 5GS0L 2NY7H 5LBSL 1F00I 3QFDA 4OLYH 1NL0L 1E4XI 2Z4QB 4IMKA 2X05A 3UMTA 2V7HB 4PV9A 3VFVA 4MA3B 2EDDA 3T1WA 1MCWW 3RHWF 1RIUH 5F72S 5DO2C 1TLKA 4YDJA 2X4QB 3AU1A 2YPVL 2EIBA 1S7XA 1F3JA 1A2YB 1Z3GH 2ESVB 5D2NE 5C9JB 3O4LD 4EDWH 2DDQL 2BVQB 4TSBH 1NBYA 8FABA 3D9AH 1PG7L 4MJIA 4LSTL 1FZKB 3K4AA 4RGOH 4Z6AT 1X5HA 5D93C 3GMOA 3FOLA 3JV0A 4TUOB 3MRDA 3O9WB 2CDGB 1ZA6B 2BNRA 4I0CC 3BUYA 1U3HD 3AY4C 2GJZB 2X41A 4DKDC 1KCLA 5E8NB 1UZ6E 1I9RL 3B9VA 4M48H 1AHWA 3S36L 1UXSA 3HI5H 4Z7VB 4XNMA 1MELA 5CBAB 2H32H 2VB5A 4NZDA 3G6JA 4QRQB 4G9DA 4MB3A 5ESQA 5GRJH 3RVTC 1J11A 1VFMA 1AQKL 3P2TA 4F7EB 1AGDA 2Z91B 4QRRE 1NSNL 5MEOB 4GFTB 1VFAB 5L6YL 2X1QA 4HUXA 1BQHB 3T2NH 5DS8A 3DRTB 2HLFD 1Q38A 4LF3A 4JM2C 4LK4A 1GC1C 4WI3A 3WUZA 5EZIL 1U8OA 4X5XA 2BSSA 4ODXB 5JUEL 4ODTH 3LV3A 4NPYA 4HGWB 4ODVH 5EU5B 4QXUL 3ULUH 4BFGA 1S7RB 3IETA 4FZEH 5KW9H 4K2UL 5IMOB 4J1UB 4WNQB 2X89A 5I66B 4IS6B 3SCMB 3M1BA 2J4WH 4MQ7B 4PJ9C 2YPLB 4IRZL 4DUXA 4JPVH 1A22B 4GKSA 1JZ2A 4KJQC 5J13C 2P5WA 5DO2D 3HS0A 1WFTA 2AJUL 4LIQE 1WBZA 4UQ3A 1DUYB 1D6VL 5LWYL 3RWJB 4YHLL 4BUGA 4EVNA 3NIFF 2BOBB 4M6AA 5BVPH 1HK6A 2OR9L 4EUPG 1MCPL 3RVVC 4EDXB 2E7BA 1BZ7B 2X10A 1IQDB 3BE1H 4N0UE 4FHBD 3L9RA 1KG0B 3MFGB 1G9NL 1J1OL 3UTSD 3VFSB 3P4NA 4K71B 1VEOA 3IJYA 3OKDA 1VADB 3WFEH 5IBTL 3BD3A 2IGFL 4GW1B 4NFCA 2XQBH 3LEVL 3K80A 3JZ7A 2LTQB 5EUKB 1R5IA 1INEL 2YSSB 1JP5A 5D8JH 3FB6B 4FABL 5HGDA 4ZOEA 3N0PB 1X4XA 1GGYA 5I76B 3BEVA 4XPHH 4XBPB 5C70A 1W72B 3OXRB 3D3VA 5T1KA 1F90L 4UV4L 2CO7B 4XVJH 4WY7H 3LDBB 4Z7UA 3BO8B 4HSQA 5DR5L 4JQVC 3GM8A 4Z18A 5I8CB 1J7VR 3QI9A 3KPSE 4Z76A 4PJHB 4OUOA 3F62A 1RZJH 3AS2A 4OCRL 4ODWB 1IGML 3PWPE 1U8PB 3DGGB 1UB5B 5L2KB 4LSVL 2UV3A 2DWDA 5IB4B 1QBLH 3V6ZA 1BQSA 3PABB 3ZTJH 1RZKL 3RZCD 1MJ7H 4AK1A 3KJ6L 3GK8L 5DEGA 3QUYA 4RGMB 3S88L 1R3LA 1EAPA 4LNRB 5DJAA 3F12B 3PQYE 3HMXL 1JE6A 4AG4H 4Z8FH 1ZLUH 1AXSB 2XKNB 2FZ3B 4NWUH 2V6HA 4X80H 3JWNC 2P5EB 1OGAE 4C58B 1U42A 1D6EA 2K3TA 7FABH 2VH5H 5EIQA 4AY0A 1EGJA 4UTBL 4XWGH 4YPJA 3F7YA 5HHOD 1FO0L 2P5WE 1FFPB 1QFWH 2ITDB 3MFFA 3TBVA 4YDVA 3KDMA 4MAYB 1I1AA 3MJ7B 3WLBA 4FQCH 4CJ0A 1QO3B 4NYLA 4FNLH 1CG9A 5C9JA 2C4FU 5SWSD 3AXLA 1T03L 4MSWA 3TZVD 5IEKB 3L3DB 4H8WC 2C4FT 4NKDB 4TRPL 2GSGB 4TUOA 2GYSA 1R3IH 3B9KD 3T3PF 4BH8B 2WWKO 3GRWH 2P4AB 4GW5B 5I9QC 2GEEA 4Y1AB 3KLDA 3QA3A 5D1ZB 4NQTA 5F7YC 5C86A 4M1GH 1NMAL 2X4NB 1CE6B 3V0WH 1A9BB 2DLIA 2FEDD 2VLRD 4HGMA 4XNMB 3EO0A 4PLJC 3WIHA 3O6FC 2MFNA 3KPQB 1AE6L 5F7EH 5IOPA 3J7HA 3ET9F 2IANB 1SY6L 3B5GA 5I18L 3W5NA 4MX7A 5IJKA 2FECI 4KUCD 2DQDH 2GY5A 4XMLL 4AENA 5GGVL 3IGAB 4ZYKB 1UH3A 3LKQB 4L4VE 3MJ9A 4QOKD 3I6LE 3QO1B 1I3GL 1W0VA 5TDPB 3GI9L 4N0CC 2J4WL 1I3RA 4MXVE 4LVOC 1RUPL 2R23B 3TFKD 5FXCH 1CIUA 5JORB 3T09A 3PP3K 1V7NL 1KB5H 1DVFD 4ZUWB 3VI3E 5HDQH 4X5WB 4PR5A 2ORBL 3M07A 3UROR 1T1WB 3PQYB 5E24E 5DRXA 4Z7WE 6CGTA 3WLWC 3E3QE 1S7UB 3VFTB 3H9SA 1OLLA 3L3KB 5GHWL 4UBDC 1SYVA 4NRYA 4UNUA 4YAQB 1C08B 4CN4A 4LHUG 1WBXB 4OZIF 5F7FA 1J1OH 3QHFH 3BQUC 3P9MA 4Z9KB 2EDXA 5CD3A 4HUMB 3ROLB 3OKMA 1IEBA 1N5AB 2X4QA 1LE9B 3VGFA 3PGFH 1IMHC 2N56A 4D0BB 2QJDA 4KK9D 2CIIA 3I6KB 4DOHB 3X3GL 3S35H 1T80A 3MOBH 5JR1H 5J6GA 1CXLA 1KCVL 4GXUM 5HYEA 4NDMB 5F1IB 2DIJA 2XZAH 1G9MC 3L6FA 2D31B 2BSRA 2HG5B 4K8RL 2EO1A 3NFSL 1BQHA 1K4CB 5CJOL 4JG1H 5GRXG 2IWGA 3FO2A 3MJ9H 1T21A 2H1PH 3O6LL 1Q1JL 2CGRL 4CU7A 1HNGA 2CLZB 1KCVH 1S7RA 3IETB 1DQDH 3TLRA 4PB0H 4KDWA 2CDFB 1Q8MA 2NY5C 3SDDD 4ZFGH 1ED3B 2ADFL 3BN3B 4EXPX 3GMRB 4LARL 1RMFL 1FFNB 5CEXA 4WJ5A 4MHHI 2MWCA 5SWZD 5DRNB 2WAHA 5B21A 2X4RA 4S1RH 4S2SA 1QYGH 4H26A 1G7IA 1T04B 4LF3B 2OL3L 5ACZB 1JTPA 4QOKE 4ERSL 4M6OH 5F21B 1LP9B 1HEZA 3ABZA 4UB0H 5CWSA 4GS7B 5C0NC 1SVCP 2UUDH 4LVHC 2F54D 2R69L 5C07A 4O2CB 4PRPB 1H3TA 3ZL4H 2YPLA 1INDL 4G9FD 4CDHA 5CEXB 1QLFA 3OAYH 4MNQD 3DSNA 1QYGL 3RA7H 4GS7C 3WSQL 3G5ZA 3ULUE 2DQUL 3F65A 4LU5L 3TBWB 5CINL 1JGVH 2CLRB 2IAND 1A1MB 1UWXK 2EXWC 1PEZA 4PJFE 5IB2B 3T4YA 1FRGL 1SMOA 1EHNA 3AFLA 1W72L 1JHLH 3GMNA 4X8JA 1BF2A 4P9HC 4JZJA 5AEAA 1HOCA 4U1LA 5DVLA 4M1GL 5HHOE 1OB1A 3R0NA 3NN8A 5HYQB 4YHML 5GS0D 1HQ4B 4V1DB 4NQVA 1IBGL 2AVGA 1TENA 4OUUB 1FRGH 3OKOA 3P30L 1RUAL 4S1SL 4K23L 1I1FA 4RIRB 5C3LD 4JO1H 1WT5C 4KMLB 4EI5B 4RRPG 3BP5A 5EIIB 3MODL 4JFEE 4B53A 1GOFA 4Y88A 4J12A 3TBSA 3BP6A 1N4XH 2NY3B 1ZHBB 2B39A 1N5YL 2V7NB 3DV4B 4WEMB 1JNLH 2XZZA 4LAQH 3A0OA 2FJFA 1OSPH 2Q76B 3OR7B 1R5WA 5INDB 1DQJB 3GHBH 5CIPB 5E56A 2HMIC 3G08B 4OB5L 3RWHB 1KBGL 2BRRH 3D48R 4JN1H 4ELMF 1EK3A 4RGNC 1I8IB 4ZUWA 3RX7A 5KSAB 2OZ4A 3C5ZC 3VGEA 2EIZB 4MYWB 5ALCH 4L8SB 4F3FB 4LRIC 4YQXL 2VL5A 1S9VB 3HLAA 4PJHF 2YZ1A 2V7NA 1CWVA 5CUSH 1AP2B 4E41D 4NKOB 4QT5B 2W9EL 1SJHB 5BVJB 3CH8A 3E6FB 2CUMA 2ID5A 3QXDB 1SHMA 2VQUA 5CD3B 3GB7A 2ZUQB 4K8RD 2QTEA 4MAYA 5K9JH 3MLTB 1A9BA 4D8PA 1QQDB 5MHSE 3BH8A 3ZT6A 3MV01 3UJJL 1NFIA 2EC8A 3HI6H 3LKOA 4MA8L 1S9YB 3ZDZF 2GITA 1ZA3B 1LD9A 4NQEA 4CL7A 4OF7A 4NN7B