1A7OH

Fv fragment of mouse monoclonal antibody d1.3 (balb/c, igg1, k) r96l deletion mutant on variant for chain l glu81->asp and chain h leu312->val
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
QVQLQESGPGLVAPSQSLSITCTVSGFSLTGYGVNWVRQPPGKGLEWLGMIWGDGNTDYNSALKSRLSISKDNSKSQVFLKMNSLHTDDTARYYCARERDYRLDYWGQGTTVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA D1.3 FV (LIGHT CHAIN)
publication title X-Ray Structures of D1.3 Fv Mutants
rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 30
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 1998-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a7oH00
4G3YL 5IROA 4P2RE 1A6AA 2B39A 1RUMH 3ARVA 1T5WA 4EBQH 4ZXBD 4O2FB 4L4VB 4AG4L 1JJUA 4NKOB 5I18L 4WU7A 2VDLL 1OGAA 2W0KA 2ESVA 1A4KB 2C3VA 4ODBD 3VFNA 3U4EA 3BPNC 3KXFD 3EBAA 5E8OB 5JDJA 5D71L 4ONFL 3SDXE 3C5SB 3PJSB 1K6QH 1NANH 2DQDL 1R3KA 5JOEA 4L4VE 1P5VA 5C1MB 4M48H 5C9JA 1CDYA 2HT4D 3I6GA 4PJFA 1T6WA 4KVCH 2BVQB 2UWEA 2F58L 3IDMA 3PUCA 4W4OA 3MZTA 4LBEB 2VR5A 4X9IA 2A73A 2R0ZL 3LQZA 2D7PA 3T4YB 3BQUB 4RMWA 3VGAC 1AR2A 1U8KB 3B9VA 4LNVA 3S96B 5DZNA 3RVWD 5MHSD 3FB8A 3BIBX 4NZRH 6FABH 1KPVB 1PEZA 1EIBA 2X42A 4ZTOL 1DE4A 3CVHB 4PJ5B 3BH9B 1FFRA 4U6HA 4B5EA 4JO4L 3V6ZA 1I9IH 2NY6B 4N5EC 2H32H 2CDEB 1R5VB 4D0DA 1VGKB 5T1MB 4NQXA 1F8TL 3DSNA 5D8JH 3SDXF 1RIUH 5SX4H 5B38G 1FHGA 4FQXA 4Z95H 1JI2A 3WFDL 4NZTH 3EZ8A 4NBXB 1XF5A 4OJFH 4ZXBC 1AGFB 1WTGT 3GDBA 3AAZB 1INQA 4X0KB 1XGRA 1AO7E 4KRPB 5IWLA 3TWCL 4ZAKB 2HJLA 5BCAA 1EHLL 1FO0B 2E9BA 1MFAH 4EDWL 3UJJL 2HAZA 4H8WC 1YC8A 5B4MD 1HXMA 2VXTL 3CJJA 3QIWD 2DM2A 1X3DA 2OR9L 2P43B 3V6OE 4Y5YB 1ORSB 4WW2B 2MPAH 4P48A 5K9JL 1NBQA 2EDJA 3NPSC 2HT4C 1FL6B 5KSAB 2CLZA 5LGKA 2N7BA 4AYFA 1YNTB 4LQFH 5TDOA 5GXBB 3PWPA 2WLZA 2EYTB 1HHKB 3H0TA 3VWJA 4I77L 2APFA 1T89A 3BFOA 5I71B 2A6DA 2ZUTA 5C07E 2QQNL 4F9LC 1P6FA 2GJZA 4HPOL 1E4WL 3PWVA 4O58L 3RVWC 3KPOA 5JUEH 3W0WA 3IDYC 1GZPA 5CMAB 4LRIA 1G7MA 1EHNA 1A4JA 4L5FH 1NDMB 1ORQA 4LPCA 2JIXB 3T09A 1QFPA 1BIHA 1CXIA 2EH7L 4L9LB 5CP3H 5MERB 3FRPG 3OPZL 1PYWB 3RX7A 1RZ7H 2Q1EA 3Q1SL 1SEQL 3LVEA 2FATL 2R2BB 5F7DA 3MRFA 1KJ3L 2CH8A 1JP5A 3MLZH 3E6HA 5E2JA 1TVHB 2H8PB 2V9QA 4HIXH 1SYVA 5DSCB 4PB0H 3VJ6B 1AQKL 3TA3D 5ISZB 3EYFA 2F54B 4L4TB 1S7VA 2IQ9L 1RK0A 2NZIA 1DN0B 1YA5A 2AQ3A 4AL8H 2J4WL 3P9MB 2Q86B 4CVZB 1HH9A 35C8L 4U1SB 2O61B 3QHFL 1YNLH 5T5FH 3PGFL 3GKZA 1DDHB 1K8IA 4PBXA 5E99H 1U8PB 4P3WA 4OZIF 2BZDA 4XP5L 1PLGL 5TQ2L 4QHKJ 2DI7A 3QIWC 4JFFA 1U3ZA 4P3DB 5DQ9A 1P9MA 2ADFL 3EDJA 5EZOL 1YMHA 1HHJA 3B8SA 3OF6A 5ISZE 1N5AB 4YIQB 1QNZH 2F54E 1JGDA 4L4TE 3SJVB 4AM0B 4HWEH 1CIDA 1WSST 4G7VH 4YHPA 4LSPL 4WWKD 3W5NA 4K3GA 3UTOA 4R0LA 4XTRD 5L2KB 4MJ6B 3H3KA 3OZ9L 4GSDH 1O0VA 5I8OH 1U3HA 1JMXA 3RUGB 5BS0B 1U8IA 5E03A 4FXGA 4G6JL 4WJ5B 5EOCL 4P4RA 2YK1L 1CCZA 4U1NB 1PSKH 1HCVA 2AXFB 5LAXA 1X5KA 3RRQA 1J8HB 4Z7QE 3QXUA 4F7TB 4MNGB 1D6EA 2R0KL 4UTAL 5ESQB 4X6CA 5EO0A 1T21B 3WNMA 3C5ZD 3TH4T 4MVBC 2MWCA 4DCQB 5DD1H 4PLKD 1YY9C 3RUGE 5BS0E 5D7LD 4GW1B 2ATKA 4XAKD 3QCTH 1CZ8H 3QUMB 5F70A 3VD7A 3RWIB 2DQEL 2VXUH 4UILH 4XPGH 1WWCA 1J0HA 3FB7A 3HNSL 5I76A 1J8HE 4LCWD 3O8XB 3TA3C 4HFWB 2FX8H 4H1LA 4MNGE 1N6QL 3MRNA 4LIQL 4RRPG 3SDCD 4HIIA 1SBSL 1KGCD 4OD2B 5I1HL 2RAMA 2CK0L 3U30B 3BPLC 1F3JB 2DI9A 4MCYB 2NPLX 2G9HB 4RX4A 5ETUA 4PV9B 1CDBA 3I75A 1T1XA 2X4UB 2ILLA 5DMKA 5BXFA 3RJDA 4JAMA 3JSSA 1MRFH 3S88L 1T20B 2AW2A 1ZLUK 4Y4HD 4WWKC 1WC7B 1QP1A 2ZJSL 2DQJH 3JTSA 3W81A 1F4HA 1GIGL 2OTWB 2GAZA 4YLQT 1HDMA 2E3VA 3QXAA 3L95A 5JA9A 1ZLVH 1IEAA 2OQJA 4UT7L 3GNMH 3DETC 4KKBD 5C0DA 4Q6IB 3THMH 2AJXL 4G9FE 3MO1A 4X7SL 4D9QD 4RGMC 5CJXC 2HRLA 4MXWH 2CRYA 3BVNA 3B9KD 1UB6B 3FO2A 3HG1D 5DURB 2VQTA 1OM3H 3C5ZC 1F58H 1S8DB 3QDHA 3LQAL 4ODVL 4ZSOA 1UXSA 1WWWX 5K33A 1ZA6A 5D96B 1XAUA 4PLKC 2W65A 4XWOC 3HMWL 3HZYA 5INDB 1Q9OB 4ZFGH 4TVPD 4WCYL 4UBDD 1UGNA 3KJ6H 4MB4A 1KLUA 3W9DA 1QUNA 4Z0XA 4DKEL 4KY1H 4DGYL 3QZWB 3H7LA 3MLYH 5FYLD 3BH8A 43C9A 3RL1B 3A0OA 3IXTA 4NN7C 4S1DC 3VFWB 3EO9H 3MYJA 4OCSL 3MC0A 4GAFB 4HS3B 2FLBT 4JQXA 3SKJL 2YMXL 2FEEI 5CS7A 3EDDA 4QGTA 5DS8B 1KTRL 3VE0A 3OR7B 4GBXD 4NWTH 5JMOC 5SWQA 2YWZA 5DVKA 5GGSB 5BW7C 2NZ9D 5KSUB 4KHTH 5CZKA 1M71B 4U7MA 2JK5A 3DUUA 4Y4HC 4U1IB 5EBLB 5ICYB 5IW6A 5E4IA 4P9HH 4G6KL 2LTQB 2IBBA 3JV6A 5IHLB 4DGVL 1S5HB 1NGXB 3T1FB 3MJ9L 4M5ZH 5IUSA 2W9LA 4HMEA 2DYPA 3RAJH 2F53B 2LE9A 5J9PA 1CG9B 2PO6C 3EYSH 4AZ8A 1JZ6A 4PJXF 3GSOA 2BHYA 3BI9X 1XF4A 4AMKL 1LE5B 3TCXA 3NFPB 3V95A 3IJSA 3B9KC 4AEHL 1DFBH 3U7AA 4OD1H 5GGTL 2Z31C 2AJSL 3OBAA 5GGVH 5IBLC 3X14B 4JANA 3PP4L 3ZE2E 2D03H 1KCLA 4ORGB 4NC1C 4OLVL 3REWB 1E27B 5JDSA 1IARB 2F53E 5DJ6A 4QY8A 1A6AB 4YDKL 2WP3T 3OG6B 1T5WB 4ZS6D 5J6HA 1HIML 3JVGA 5F3BA 3MQIA 4R4BA 1X5AA 5EC2B 4WU5A 1IQWL 4LEXL 1OGAB 2OS7A 2ESVB 4LCYA 5TF0A 2IANA 2C3VB 2MQ3A 4HG4K 1EBAA 3VFNB 1GOFA 2AK4D 3MV8E 2EO1A 4DAGL 2X1XR 3QXVA 1FNGA 4Z0BH 5DZLA 1VPOL 3BKJH 2VRAA 3VG0L 1Q9KB 4GRWH 4GBXC 2ICWA 2NZ9C 3OHXA 2HKHH 3MLSH 2DWDB 4DTGL 5T3XL 5C9JB 5KSBF 1JGUH 4PJFB 4M61A 4X7DC 4M6AA 4OAWB 1OGAE 2UWEB 2ESVE 4YHLH 1IM3A 3SPVA 1ZA3A 3PDGA 2Y6SD 1JHLL 3O4OC 5JHDE 4DKFH 3LQZB 5SV4A 1I3GL 3MBED 4JKKA 5KJRH 3KNBA 4BZ1L 1OP5K 3TVMB 2OZ4L 4HC1L 3FN3A 2VXSL 3R0NA 4JDZA 3OAYK 4U7KA 5J57B 1BVLA 1HHIA 4K7FA 4V1DD 4WFFD 4U6HB 4PJFE 4K3JL 4PR5A 2UWEE 3H9HB 3KPMB 1GGBL 4R90H 5KZCD 4OFYD 1OAZL 3MOAH 4D0DB 4MJIA 3MLRL 4JFXB 3KPNA 1DQDL 3MA9L 4FQXB 3NGBB 1JF6A 1XF5B 1V3KA 1IGFH 3EDFA 4ZS6C 4ZFOL 3GHEL 3VXUD 4L29B 4HBCH 4KQ4L 4E0RA 2GHWB 1INQB 5KVEH 3O2DH 4N90E 4XZUA 5JW4R 1WLHA 2FZ3A 4OFPA 5J0BA 2C7UB 4D9LL 2P8PA 5CCKL 2HJLB 1Q38A 4ETYA 5IT2L 1NCAL 2YD7A 3IETA 1DBBH 3Q5OA 2IBZY 1R0AH 2IGFL 4HCRH 2I9TB 2ED8A 2BVPA 2EIDA 2ERJB 4LSQH 1S7WA 1X5JA 3QEGL 4OI9A 4KI5E 1HHGB 2E9WA 4ODTH 3VFRA 4X6BA 3V79C 2D7MA 2DIBA 4KGLA 1DUZA 3DPBA 1YQ2A 1UM6H 4WW1B 2CLZB 4I5BA 3UYPA 5GS1A 5I17B 2PW2A 5TDOB 3PWPB 1DSFH 4Q97A 1RZKL 1QD0A 3HMXH 2Y6SC 3VWJB 1CBVH 2F9BT 3IB4A 1MQ8A 1MCWW 2GK0B 4YDVB 3CDFA 1QSVA 2E5EA 3MBEC 2VLRD 3VA6A 2GJZB 3X3GH 1IFHL 1AR1D 3PWVB 4KKLC 2BSRA 2E6JA 3W0WB 1SYSA 1XR9A 1J5OL 4UV4L 4BQ6A 1GZPB 4XP9H 1I9RL 1G7MB 3MJ9A 1A4JB 4NO2A 1CLYL 3QDMD 4H88L 4NJ9H 1G84A 4S2SA 4CNIA 3S98A 3AROA 4PV8B 3PWPE 1QRNA 4OGYL 2OJEA 3UP1A 2YZ8A 3D18B 2R56L 3L6FA 4U1MB 2YPLA 4B0MM 4Q9RL 1MCBA 2CK2A 3E6HB 3GBNH 4PD4K 3W0WE 3MLWL 1MF2L 1N3NA 4FXKA 4J3VA 1IILE 4X6FA 5GGTA 3O6FD 1OAUL 3RVTD 1SYVB 1QPPA 5CJOL 4XPAH 1R3IH 2CGRL 3QO1B 2D7TL 2UZXB 3MRHA 2P1YA 2A83A 2ARJQ 3PV7A 4LU5L 3EYFB 1S7VB 4QRQA 1RK0B 4WI4A 1JGLL 2W9EH 5EUOA 1BQHB 4KJPD 3U0TB 4DVBA 1K8IB 1TJGH 2WZPD 2YRLA 3S35L 4MHHG 4N1HB 2VLKA 5DD0L 2C4FU 5BRZD 1H3GA 4IIQC 2BC4B 5CZVH 1QFHA 4OQTA 5EO9A 3MR9B 5D7KD 2A6KA 1YMHB 4TYUA 1TETL 5CP7A 3X13A 1AKJB 3QDGD 1JGDB 2NY2B 3FONB 4JHWL 2I24N 4JRYA 4YHPB 3L3GA 2APVA 4LPYA 4R0LB 2AEWA 4YGVA 2Q8BH 3ULVH 3KDMB 2BHUA 1U3HB 1AR1C 2XPGA 4HKJA 5I8CA 2YS4A 4FXGB 4P4RB 4TUKL 5DJAA 4JFFE 4MMXC 1NPUA 4QCIA 1A0QL 1JRHH 3IDIA 3NAAL 4WFEE 3T4AB 3LV3A 3JZ7A 5DEGB 2VXQL 4HJGA 5DI8A 3MNWA 3HPLB 4XC3H 1D6EB 4MA3A 5ERWA 5J13B 4U2ZA 5EO0B 3VG9B 2OZ4A 3WO4C 4HC1A 1EEZA 5IVZB 3MYZA 3HFMH 3UAJC 3QIBD 3C6SA 2JJSC 1N5YH 2IPUK 2ATKB 2RB8A 3KPLA 3V5KA 2B1AL 3RVTC 4U1JA 2D0HA 2P44B 3TT3H 3FB7B 5I76B 4JO1L 1XT5A 1U93A 4QXGH 1VFBA 4H1LB 5H2BB 1TVBB 3MRNB 4BFIA 3IGAA 4Z5RA 1MJ8L 1FVDB 4YFEA 2JJVA 3X3FH 4X6CE 4KJPC 4ZFOA 1KB5A 2MNUA 3BKMH 3PL6D 3RA7L 5JQ6H 1BLNA 5EO1B 3KHQA 4NQCD 5ETUB 3O2VL 2A77H 3I75B 2PNDA 2VERN 1OTSD 5DMKB 5BXFB 1JWUA 3CGTA 3SO3C 3P73A 3WHE0 5H35A 1V3LA 5FV1L 4YHML 4CMMA 4Z7WA 1W72B 2QKIA 4NUGH 1OY3B 4M1DL 1MHHB 1OSPL 3MA7A 4K3EH 5C0CD 2A74B 1CFBA 3JTSB 4JKMA 3S37H 2OX5A 4JJHA 3UO1H 5D1XC 3ULUD 4EQ2A 1D9KD 2GAZB 1HDMB 3OB8A 4L8CA 1T6VN 5EFIB 3L95B 4NZUL 3BSZL 3BAEL 1IEAB 2VLLA 2OQJB 5HHOA 3RNKA 1N0XH 1FG2A 4RNRA 5C0DB 1OTUD 3AREB 4KJQD 5CINH 3UZVB 4J2XA 2GITA 1OHQA 4WO4A 4X6CF 3ZTJH 4JHAH 4JQVA 3CX5K 4UNUA 3MJGX 5IQ7L 3BVNB 3LS4H 5CBAA 1JCKA 2XXMB 5JHLH 4NGHH 4CJ1A 4NWUL 3QXDA 2HKFH 4ZSOB 3UCRA 1ZA6B 4QHNA 3QIBC 2W65B 3HZYB 4G8IA 5FF6B 4LCCA 3RGHA 3RKDD 3OAUH 3EAKA 4IRZL 4YXLL 1E6OL 1QBAA 4BM7A 1KLUB 1UQSA 3W9DB 3INUH 5KVMC 4Z0XB 1U42A 5GRVK 1NUNB 1KENL 5E94A 5I1IH 43C9B 2VZTA 2UY6A 4OGZA 4QHLA 3IXTB 3EYQD 3WIHL 3PL6C 4HLZH 1QSFB 4KXZH 1A9BA 4KTDH 3MYJB 4ZSOE 1EJ6A 2ZCKH 3H9SD 5BZWA 1MHPL 1ZTXH 4ZD3L 3ZDXE 3VFPA 3RPKA 1AIFA 5E7FA 4HXAL 3U0WL 3VE0B 4XX1G 2D4FA 2EDKA 5SWQB 3FO9A 1DQLH 3RX5A 2CIKB 3U9PH 4IDJL 4MD4A 3L5XL 4LGPB 3PF2A 3RNQA 3MCLL 2JK5B 3S97C 4AENB 3E2HB 1NJ9A 4R97B 3HE6A 5A3IC 1KNOA 3KPTA 3TCLB 1DR9A 1A5FH 2NQCA 3ZDYF 5GS0C 1C08A 1Q0YH 4U6VL 3ARPA 2DYPB 2E6QA 5J9PB 2IMMA 5JR1L 3DHMA 4KRMB 4X80H 2Q6WA 3GSOB 4FMFA 5H37G 1OTUC 3MLXL 3VFUA 1IGJA 1XF4B 4G42A 4LHUD 3H3PH 3IJSB 2IH1A 2QL1A 15C8L 2LQRA 5GS0H 3WCYA 2R2EA 3QIUA 5JNYA 3ZDXF 5T3ZH 3VXNA 4LLAA 3KPSA 2IFFL 1FFQA 5JDSB 1PBYA 5DJ6B 1EJOH 2J8UA 3O9WC 2V17L 1FBIH 4JFYA 1J0IA 1CU4L 5F3BB 2ZSWA 4KXZI 4J3XA 5SV3A 4TN9A 1TQCC 4HUUB 3NZHL 4WU5B 3EYQC 1U41A 1A22B 1RIHL 3OR6A 4LCYB 5E2TL 4I48A 2IANB 1IJ9A 4WDIA 3PWUA 1NEUA 4XBEH 2P5WD 4C57C 1YMMA 1NGQL 4HJJH 2FECI 4CRPA 3C6LA 1FNGB 4NQDD 3C08H 3BZ4A 4NNXB 5A2KH 4MX7A 4EVNA 3NPZB 5JW4N 2QHRH 3MJ7A 2VDRL 2YN5A 1T04A 1JTTA 1UJ3C 12E8H 4G8FA 1HZHH 1RMFH 1RFDL 1JNNL 1HKFA 4Y88A 4M61B 4S1RL 1CFQA 1DLFL 1DQML 1IM3B 2IANE 3JUYA 4OSUL 5HVWA 4FN0A 4P0DA 1KCUL 4PY8J 1PZ5A 2EDYA 3NIDE 4GKOA 3SOBH 2WBKA 3PQYD 4XBGA 4YX2H 1G0YR 4NQSA 1Y18A 4LIQE 4PY7A 3KNBB 4OCYL 2FRGP 2R15A 4GG8A 1D5IH 1JZ2A 4DQOH 2ZNXA 4RSVA 5C09D 1HHIB 4K7FB 3TO4D 3ULSB 4PR5B 4LVNB 1CLZH 4JFDA 3K2MC 4EI5A 1Y0LB 2WIMA 1IAIH 4U3HA 3KPNB 2HG5A 1C1EH 2CR6A 2F5BL 3ARBC 3WLWD 4V2BA 5KAQF 2OP4L 3NN8B 4UIMB 1RZJH 3O6LH 5I9QB 2X4NA 2WK2A 3WV0A 1AO7D 2JJTC 4G6FB 3EOTH 3WDHA 1IM9A 4XZUB 2MFNA 1U9KA 5E9DD 2P8PB 4R9HA 2DL2A 5GGQH 2DIAA 4XNMA 1K85A 4MJIE 4PRHA 3K46A 5DK3A 2UZYB 2BVPB 4OCLC 4X8JA 5HVHC 1S7WB 3CAFA 1CE6A 3WIHA 5AUMA 4XI5C 3VFRB 1SJHB 1FL3A 3T0EA 5C8JA 3LZFH 2Y36H 4R2GD 5GS3A 5DRXA 5F6IC 4ENED 4I5BB 3MRCA 5GS1B 2PW2B 1PDKA 4Y16B 1KJMA 4FFYH 2X89D 4FFWC 5I1KL 4AQ1B 5IGXH 3BWAA 3C60A 4X98A 3LKQB 4K55A 5A2IH 1NEZG 2BSRB 1F6AA 1SYSB 4F57L 1XR9B 2GFBB 4RQQA 43CAB 2JJWA 4JFOA 5E6YA 3SGDH 5KVDH 3TO4C 3HS0B 3SKNA 2X1QA 4GXUN 2QHLA 1I8MA 4S2SB 4QOKA 1T03L 5FFLA 1CLCA 3I6LE 3B5HA 5DRZA 4KUCF 4NO0D 1HCFX 3F12A 2DTMH 3OMZA 4LVOB 5GZOD 2AJYL 2RR3A 1PW3A 3O0RH 3L6FB 2YPLB 4D3CH 2HMIC 4GAJH 4NFBA 2DN7A 3WLWC 3D3VB 4FXKB 1N3NB 5FYKU 1UWXH 4X6FB 1YJDH 1A21A 1S9YA 4OLXL 1ZLSH 5EORH 3MRHB 5F7YC 2A83B 3A6BL 1B90A 2F8XC 1LO0L 1QRNE 2VLMD 5EUOB 3F7YA 5C0RL 2ORBL 3NTCL 3CVHH 1ZGLA 3LRSA 1UC6A 4DVBB 3L1OL 4Z7OE 1QLEH 3TJHC 2YPLE 3V6OC 1QHPA 1IBGH 1XGQB 2VLKB 1U2CA 1JHTA 1ITCA 3O6KL 2JCCB 5EO9B 3MGAA 4ZAKC 1LDPH 4YXKH 2A6KB 5D1QD 4R2GC 4GUPA 3IAPA 1IGIL 2HLAA 3X13B 5I74B 4G8EA 5E2VH 2DQFA 3VGFA 5EUOE 4H20H 4ZO9A 2KDGA 4DN4L 1J1XL 4P5TC 3ZTNL 2M1KA 4XXCA 1T2JA 1AD0B 2NY1B 2J1KA 4Y5YC 2XPGB 3SGDI 1P53A 2WV3A 4HKJB 2Q3ZA 2EIZB 2VLKE 4K7PY 1YEKL 1FO0H 2GTWA 1H3XA 3QDJA 3R06A 4H5SA 3MZGB 1ED3A 3GSXA 3MOBH 4HGMA 3CH8A 4KUZL 3JWDL 3GMQA 3MUGB 4UNTA 3GSVA 2B1HL 4HJGB 4PTUA 5DI8B 1ZLWK 3MNWB 4NQEA 2AVGA 4F15B 4J1UA 4JRYE 4TUOA 3TNNB 3V9FA 3PNWA 2WBJA 4Y5VA 2BSED 4HS8L 5GZOC 1OQOA 2Y4SA 1DBML 3B9DA 5ALCL 1E6JH 2VUYA 5CJ8A 3UDWA 1GGTA 1W0WA 4OKDA 4NFCA 4Q7DA 3BESR 1F3DJ 3C6SB 1MEXL 1NMBL 2BMKA 3TFKD 3ARFA 3V5KB 4OB5H 4L9LC 4U1JB 1XR8A 4NNYB 4Y2DD 2QSVA 5EBMA 2HVJA 4QXWA 1NBZA 3A67H 3MV01 4OCWL 1JN6B 1U93B 5EUOF 2CRMA 1XGYL 2QV2A 4MS8D 1VFBB 2B5IB 5IFHL 3UTSD 1ZANH 1BQLL 1F3DH 4BFIB 3IGAB 1DP0A 4ZFOB 3B2VH 5ITBH 1KB5B 4X9GA 1BFTA 4ONGH 1GJIA 2X4RA 1BLNB 2NY5L 5L0QB 1RUAL 2NXZB 1TJHH 2E7HA 3OXRA 3O4LD 2G2RA 1JWUB 3P73B 3U82B 5H35B 1S3KL 5C2UB 2VB5A 1A3LH 1CL7L 1TZGL 4PJHB 5EZLA 4CMMB 2R8SL 4Z7WB 1N8ZA 4NOBA 2QKIB 5CHNA 4M5YH 2P4AB 3MA7B 2YD3A 3BYTA 1RJZA 4OM1L 5BO1H 2IWGA 3LEVL 4DVRL 2HJFB 1A1OA 4NKDA 2BXYA 1F4XH 3S5LG 4JFPA 1X5YA 3JWOC 5FV2A 3TV3L 1RU9L 4XBPA 4G9FD 2C4FT 3PP3K 5HHOB 2VLLB 3D1MC 4F37F 1ZEAL 4OT1H 4Z7WE 1A6WL 2XI9A 1MH5A 5E56A 3EW3B 1D5MA 4LEOB 1U8JB 3JWOH 4JPWL 5B38B 4LOUD 3AM8A 2XZAL 3QXDB 3CLFH 4Q9CA 1H0DA 3WN5C 2OI9C 3FQTA 4JPKH 3QI9B 4YE4H 3QRGL 2MHAA 1WAAA 3TFKC 2WUBL 3I6KA 2L4OA 2WP3O 3O11B 1MCKA 1LNUA 3E8UH 5HHOE 1MCPH 1UQSB 4LLMA 3PIQA 4XCYB 1BQUA 1C5BL 2AXJA 3D39B 3D2UA 4WI7A 3D85A 4M00A 3Q3GA 3B6SA 3W9EB 1T7YA 4WY7L 4LDEB 4HGWB 3I9GH 4QHLB 3SDAA 1CS6A 2DQTL 2ZSVB 4M62H 5LXGH 1E28A 3MRRA 3WJLC 2B0SL 1MFNA 2W9DL 1J7VR 4PJ9B 5BZWB 5IQ9A 1Z3GH 1NFKA 1ULVA 4FFZL 3VFPB 4OF5A 3QYCA 1AIFB 4I0PD 5HY9A 3WLBA 3O8XC 5I1GL 1YPZA 5F7KC 4YHYC 3MFGB 5FGCB 1Z9MA 2XT1B 4MZ2A 3MRBA 3VDBA 2VISA 4HDIB 2HRPL 4RGNB 4MD4B 3D0VA 2Z4QB 2BSSA 3RNQB 4F7CA 1ACZA 3QUMH 3U30C 2C1PA 1EUUA 4RISL 5FCUL 4Q6YA 1G9NL 3LPWA 5TFSL 1NJ9B 3WS6C 3MMEA 1UYWL 2FO4A 3DTXA 1KNOB 1NC4A 4JZJC 4Y19B 4FQCL 1LK2A 1C08B 1YEEH 1YEHH 1MFDH 3V0WL 5FGCE 3OJMB 1AGBB 5GSVA 3BIKA 3VFUB 2Z8SA 4O5LH 1IGJB 4G42B 2EEAA 4RGNE 2VSCA 3OX8A 3SDDD 5KW9H 3RZCB 2AEPH 4P4KA 4C83A 5HHME 3N06B 3TEUA 2AKRA 5LGHL 3V4VH 2ZG3A 4IRSC 2R2EB 4ONOA 4LOUC 4LLQA 1GPOH 4JB9H 4WWID 2XRAH 3VXNB 3L7FA 2XY2A 2Y5TA 3Q6FA 5GRVL 5T1DH 1FIGH 4Q74A 4XVUD 2X4TA 5HVGB 4N1EA 2J8UB 1BEYL 3HAEG 1RY7B 1B6UA 3VW3H 5JW4Q 2WAHA 4G7YL 1KFAH 1U3YA 2ZCHH 4R26L 2W60A 3LRGA 4NT6A 2CKNA 5A2FA 3MV8D 4I0KA 5D96C 4X7TA 1D5XA 1G0DA 4HQQH 4XGZA 5TQ0H 3U46A 4WDIB 2VDOH 1YMMB 3KPSE 3C6LB 5T1KA 3BZ4B 5IMLA 4F7EA 4I0PC 4WI2A 1BECA 2XZCL 2J8UE 5JOFA 4MX7B 4EVNB 1NLBL 5MEQB 1LE9A 3AMLA 3VRIA 2NY0B 1RUKL 3EDKA 3MJ7B 1TNNA 3UX9B 1X5FA 5E6ID 4MB5A 1T04B 1YY8B 1MQKH 1KCVL 3TF7C 1WT5A 1RSFA 4ZNEA 2XWTA 5F7EH 5JHDD 4BYHA 5CD3A 5CZXD 3HE7B 1CFQB 4LFHG 1QSZA 1YMME 1PZ5B 3RVUD 5GRWA 4XBGB 2X9XA 2FGWH 2R23A 4NKMA 4NQSB 4PJ7F 3ZHDA 3D9AH 5IV2A 1Z5LA 1FRGH 3Q6GH 1GL4B 1MAMH 5HHXL 3SDDC 3V5DA 2LTQC 4PRBB 3UJTL 2R1YA 4JRXB 1FH5H 4K8RD 5JW5A 4JFDB 5DD6B 4LARH 5SWSA 3I50L 1U6AH 4EI5B 1QHOA 1J87A 4YEFA 2CUHA 3QFJA 3VRJB 3C2AH 4L8BB 4XVUC 1UWGH 3MLUL 2JB5L 3H7BA 1XIWA 4NC0B 2X4NB 3FQNB 4NKIH 3STLA 3QA3A 5EU6D 1DJSA 1J88A 3FO0L 4UB0H 4LPUA 1IM9B 3KR3H 4Z7UA 1MJUH 4JFDE 3FOMA 4OBSA 5B39G 5E95B 3WS3A 3GMPA 5D72H 5IROC 4XNMB 4PRHB 2GUOA 4O9HH 4UDTA 1L7IL 5J89A 4DUXA 4BQCA 3GB7A 4CJ0A 1CDJA 5L88H 4RBPH 4X8JB 3B43A 3G04B 1CE6B 5ABDE 5AUMB 4DZ8A 3K80A 1U0QA 3ZE1E 1HQ4A 2XWBB 1H3WM 1FL3B 3T0EB 5E6IC 1WWBX 1EDQA 1TZHA 1Q72L 3L3HA 2DB8A 5C2BL 5CZXC 3MRCB 2XG5A 3TH3T 3W5MA 1ZT4A 2PXYB 3OGCA 2XYCA 1KJMB 1IRAY 1HOCA 1WFNA 4PRHE 4OIAA 3RVUC 1AHWB 3NA9L 3BWAB 3TPUA 4X98B 1MRDL 1ACYH 2BVOA 4Z77A 1F6AB 3V5HB 4RQQB 4NP4L 1KTLA 3HCVA 3QIWA 4JFOB 3OKDB 3T0EE 1EMTH 2WUCL 4JY6A 4NO3A 5JXED 4NCC1 1S9VA 4W4OC 3WD5L 1A6VH 3SKNB 4UMGA 4UNVA 1I8MB 4QOKB 5GRYA 4K8RC 4N9GA 1JYNA 1IMHC 1N7MH 4IMLA 1KT2A 5HDBF 3CCHA 5DRZB 3VXRD 3F12B 3U9UA 2L0DA 5KBNC 5BMFL 1LO2L 3ZE1F 2FJGA 3EYVA 2A9ML 1MJ7L 3E1F1 2YD5A 5J12B 2ICCA 1QSEA 3CFKB 1OVZA 1QFWH 4CKVX 5FYJH 1A7RL 4LVHB 4P3CL 1IZKA 3HC3H 1X5ZA 1EFXD 5DGQA 5AZ2H 4QRTB 5LGJA 1A14H 1JTOA 4QOKE 1UKQA 5E5RB 3FN9A 4KKNA 4HKZA 1MNUL 5I0ZA 4LHUG 3F7YB 3NGBC 1IGCL 1P4BL 4JGUA 2PR4L 2IC2A 1IQDA 3RIAK 3BMWA 5ESAB 5JTWA 3GJEA 1JHTB 1IAOA 3C5JA 4WUKL 1TITA 5IWLC 4OD3H 4WGWB 4K94C 2AJZB 4GH7B 2HLAB 2OSLA 1PEWA 1IKFL 4FZEL 4LPTA 1CDHA 1T3FA 4HW6A 2ERJC 4ONHA 1OWRM 4JFFD 4I3SL 4HH9A 5TE7L 4RA3A 4WFED 4NQTA 1F4AA 2GTWB 1HWHB 5LBSH 3R06B 4HZLA 2FWOA 4H5SB 1ED3B 3GSXB 1P4IH 1QLFA 2ZOLA 4D0CA 2DM3A 1WBXB 5JXEC 5E2WH 5FKAA 1NAML 1OAQL 3I2CH 4BH7B 3BGFB 3GMQB 4MSWB 3GSVB 4PTUB 1HKLL 4PGBA 4NQEB 3WEXB 3QULA 3TYGH 4TUOB 1BWWA 3BJ91 4N1CA 3PG2A 3NIGE 2JELL 4M43H 1W0WB 2BNRB 4LRIC 3GBMH 4WI5A 1F4WH 2BMKB 3ARFB 3QDJE 5C0AD 1MOEA 4CADA 1TJIH 1U8MB 1XR8B 2L7UA 3DGCR 5EBMB 3I84A 3SCMB 3SE9L 1AXTH 1JWMA 4NQEE 5FUOH 2GQHA 2B7DT 4JREB 3MRDA 2UV3A 3NCJH 3UTPD 3C5ZA 5LCVL 1BOYA 2ICES 3MRPA 3O3EA 1T5XA 1AC6A 1BM3H 1T80A 5D7LA 1WCBB 2VDQL 1LVEA 4PJBA 4KRLB 1BIIB 3WFEL 4A6YB 5LQBH 3N9GL 4XVTL 2FCBA 4K3HA 5ILTL 4YHKH 4LCUA 4LCWA 4GRMB 1N8ZB 4U6TA 3QCVL 4DN3L 1XH3A 3W11C 2V5MA 5CHNB 5I8KL 4LNRA 4ZUWA 1RJZB 1YEGL 4RAHA 3SDCA 1A1OB 5CEZL 4NKDB 3V0VA 3N85L 1F13A 4JFPB 1G7QA 3NBNA 1JPST 3MV7D 3OAZH 3DX8A 1DTUA 3HNTH 2NY2C 2AGJH 4AG4H 2AJVH 3RY4A 2VXVL 2YXFA 1MWAB 5CILL 1YUHB 2WQ8A 2XZZA 2Y06L 3MSPA 1Q8MA 5I2IB 1D5MB 1U3HC 4Y4HA 2R4SL 1YQVL 3OQ3B 4XCEA 1FAIL 2A38A 1OARL 3MXVH 2LFGA 4RZCB 1H0DB 4NO5A 3H3BC 3FQTB 3GMNA 5D71H 5I19L 2MHAB 4JFEE 3I6KB 4G5ZH 1JPFA 3LKNA 3IU3A 4LLMB 3PIQB 4PJCF 3D2UB 4IMKA 3WL9A 4XC1H 2ARJA 3VG9C 4NUJA 2C26A 2F58H 3T0AA 3SDAB 2HVKA 4UI2A 4ZFFA 1QBML 3V6FA 1E28B 3MRRB 4OGXL 3WNPA 1S7SA 2NXYB 1OP3H 2A1WH 2BRRH 3QQNA 5IQ9B 1TLKA 2R69H 1WAAE 1QBLL 5HY9B 3WLBB 1YPZB 3MUHL 1TTUA 2VITA 4M6OH 3KYKH 4ZTOH 3TC9A 1CFVH 3WSQL 2VISB 1FN4A 3D0VB 2BSSB 4OKVA 4JO4H 4OCNC 2IG2L 2C1PB 3BP4A 1U8QB 3MMEB 1A6UH 1DL7H 4QXUL 5DK0A 1MREL 4LP4A 3DTXB 1NC4B 2ADJA 4FQHA 2ITDA 4H1LH 1I7ZB 4H0IA 5IVXB 1LK2B 5IFJA 3BPNB 4CVXA 4OZGA 1GAFH 1YPZE 1SQ2N 5KS9B 3LKOA 3RTQD 4OCXH 5GSVB 1T0PB 4GBXA 1G7JA 4NFDA 4KAQH 2PF6A 2Q7NA 4P4KB 4C83B 4MA7L 2AKRB 1C8PA 4LLQB 1WJ3A 4XXDA 5C0FA 3L7FB 1NAMA 2Y5TB 1W72H 4WEBL 4P59L 2VXTH 5CWSA 4LSRL 3QG7L 1YNKL 2MMXA 3F58L 5EPMA 3VFGH 4BQBA 1UXWA 3RQ3A 4MNQD 5J4MA 3P30L 3HA0A 3BT2L 5J1AB 2W60B 4XP6L 2Q7YB 3U7YL 5CBEA 4NT6B 1QACA 4I77H 4KZEL 4X7TB 4IOFD 4PG2A 4RAVA 4UIKL 4XGZB 3U46B 1MFBL 4BZ2L 3TN0A 1YPZF 4HPOH 4YR6A 1CE1H 4LLVA 3TBSA 5T1KB 4PS4L 2DICA 5IMLB 3ROLB 4D2NA 4HPYL 4F7EB 4HULB 5C6WH 2H41A 5JOFB 4ERSH 5JPNB 1LE9B 3L3JA 3VRIB 4P2QD 3EFFA 3ARYA 4ZXBB 3CXHK 3TBYA 1I1FA 1TPXB 2VE6B 2D31A 1G7HA 1JBJA 1NC2D 4O2CB 3PE9A 4JQXC 3QUYD 2DLTA 3Q1SH 1WEJL 1TCRA 2Y25A 4K7PL 2FATH 1CXKA 4LASL 3IDXL 3GRWL 4JRWA 2CLVB 3MNZA 4X5XA 2AK4A 4X4YA 3KXFB 1JPTH 4NKMB 1BF8A 1IT9L 1UWEH 5E24E 4GMSH 5IV2B 1FCGA 2VYRE 3GM8A 1XF2A 2D0GA 3E2HC 1RI8A 1PAMA 3V5DB 2IQ9H 5J3HC 4ZNEE 1Q9LA 2DBJA 3SE8H 1B0RB 4E5XA 3NPSB 2J4WH 2VDPL 35C8H 3G9AB 3QHFH 4RFEA 4XNZB 1DZBA 1ZVHA 1NCUA 1J05A 2EZ0D 4UOW0 3VRLE 4XP5H 1BD2B 3MBEA 2FJHA 1V5JA 2A0LD 3ROOA 2ADFH 5DGRA 3H7BB 1BFVL 1AY1H 5EZOH 1RPQA 5CEYB 3QA3B 2PW1A 3CC5A 3CSGA 1IGYA 5EOCJ 3V7MA 3MACH 2I27N 1PKOA 2X70A 4Z7UB 1P4LA 4MJID 4IOFC 5GJTL 4KVNL 4DFIA 3OZ9H 3FOMB 4KUCD 5SWSE 3ZMRA 3M1BA 5FM4A 3WS3B 3GMPB 1JZ5A 3ZKMD 3QFJE 2GUOB 4UDTB 2OBGA 2ARWA 1S78D 3GB7B 1ZVSA 3P4LA 4L8DA 1F6LL 4QGYA 3QWRD 5J11C 3PDDA 4DZ8B 3NFSL 2PCPA 3FCTA 5C6TL 5MHSE 3VMOA 1RVFL 2L7JA 5HHQB 3VXUA 1TZHB 5CUSL 1HINL 3L3HB 5CGYD 1BFOA 4Z7UE 3QUYC 1Z6JT 2QSCL 3MODL 2OTUA 3OGCB 2R1WA 2DS4A 1A7PL 2OL3L 4WENB 3CFJA 1IC1A 3BZEA 2ICWJ 1Z9OA 1CK0L 2CIIA 2BVOB 3QPQD 4KFZC 4Z77B 3CPLA 1KTLB 3HCVB 4ALAH 4TNVF 3QNXB 3IDGA 3QIWB 3UTTD 2GIYA 4JY6B 4TOYH 4NO3B 3U36A 4IIQA 1S9VB 2X40A 3UBXA 3DYOA 1X9QA 4LLYA 4LIQH 3D48R 5GPRA 1SBSH 4MA8H 4J8RA 4N9GB 1K3IA 4IMLB 3ULUL 4JPVL 1KT2B 3VXPB 5EUKA 1VSCA 2VDKH 3V4PH 4NCC2 2E7BA 4QTIL 3U9UB 1G9ML 2CLRA 1R3LA 2JLLA 2PETA 2FJGB 4LF3A 2BDNL 3EYVB 5DJYA 2VLRA 1A6PA 2A0LC 4QHMB 3DVNA 4KJYA 4MDJA 1X4XA 5DMIL 3JV0A 4P57A 5I1JL 3K1KC 3MCKA 1AE6H 4ZDHA 2NTFA 1EO8H 5LGJB 4CW1A 4AJ0A 1QRND 4XH2A 1JGVL 4HKZB 3DLQR 3WUZA 4P23D 5F9JA 4ELKA 8FABA 5HYQA 3ZKMC 4P2YA 5I9QC 1IQDB 1S78C 3H9YA 1YEFL 2QBWA 5IJVA 3LQAC 1CYGA 1HILB 1NGYA 4Y1AD 1QSEE 4UT7H 2QJDA 5D93C 3GJEB 1QKZH 2QADD 2AJXH 1KEML 4QYOA 2C5DC 4R4FL 2E7LA 2YPKA 5F44A 3O6FA 3CSYA 4MGXA 3RIFK 3L9RB 2A2QT 1U92A 2M26A 5CGYC 4Z7VA 1IGML 2OSLB 4YXHL 4GG6F 1ZE3C 3TA3B 4WFGE 4WI9A 2DMKA 1T3FB 3PDOB 1CQYA 4ONHB 2FSEA 1YN7A 2FX9L 3HMWH 3LKPA 4XX1E 5IR1A 4HH9B 4HK3N 3BPLB 3QPQC 2H3NA 4JO3L 4HZLB 2NW3B 2FWOB 5E8PA 3UYOD 1KYOJ 1QLFB 5DLML 2ZOLB 5BRZA 5GS1C 4D0CB 3GRWA 4JRYD 5FKAB 1OCWL 4N8VA 2IADA 1LP9F 4PGBB 3TESA 1AD9B 3QULB 3HPJA 1A47A 1XEDA 3QDGA 4QTHB 4LPXA 2D7QA 4OCSH 5T3XD 4WWKB 4LCIH 4AH2B 1ZT7A 5BJTA 4TSBL 3BQUD 2YD1A 4BFBD 1INDL 2EDQA 3QO0A 5BVJA 2DLFH 5FHAL 2VR9A 2IPKA 3T2QA 4WHYG 1MIML 3B83A 3CFCL 4ZTPL 1CGUA 1O5DT 3F65A 3NZ8A 1J0YA 3JV4B 3WNLA 3G5ZA 4FQ2L 2AJUH 4M7LT 3CDGA 4JJ5A 1JWMB 4FP8H 5TE6H 5FA3A 3FOLA 4ODHH 2YOCA 4RGMB 1I8KA 3MJ9H 1S5IH 4HIHA 1UCTA 1WFOA 3MRDB 3P0YH 4KKAD 5E1HB 5FECA 4WTZA 2R29H 3C5ZB 5D5MB 3HI6H 4HGKC 4KROD 3MRPB 4HHAA 3O3EB 1T5XB 3BGMB 5F7WC 1T2QL 5D7LB 2QADC 4AMKH 4PJBB 4ZOBA 1G1CA 2FEDD 1VKXB 2FH8A 4WFHD 4U6YA 3GMMB 2EIEA 4HKXB 4ZOCA 1JGEA 4F33A 4LCUB 4KRPD 4LCWB 2V5YA 1KJVA 4LNRB 4C54A 5EZIL 1TCMA 4ZUWB 1BZ9A 5F7UA 3SDCB 1L7TL 3PL6A 3V0VB 3RU8H 5HGDA 1G7QB 4NQCA 3VD3A 4U1HA 3IKCA 5D7LE 4BZYA 1G6RL 3DX8B 4MMZC 4XAKE 4PJBE 3FMGH 5I74C 3MXWL 2OL3A 5IESL 2NCMA 2YA2A 1QOKA 1FZKA 4LCWE 1KEGH 4LEXH 3ZKXC 4N0YH 2NY1C 4XVSL 4Y4HB 4OQTH 3RBGA 4XCEB 2BXZA 3DRTA 2MJWA 1AQDA 2X4OA 1KGCE 3LCYA 3FL7A 1FJ1A 4XNUH 4NO5B 2W1NA 3NCFB 3GMNB 2Q8AH 2XTLA 5DYOA 4FQJL 3LKNB 3IU3B 1D9KA 1MI5A 3VA2C 3TH2T 3O45B 4WO4D 1CFNB 4F15C 2QR0A 1RUML 1DQJA 4EBQL 3WL9B 2HN7B 1J0JA 2ARJB 5B39A 4NUJB 4Z7NE 1OF2B 3TGXA 4F8TA 2WW8A 3WE6A 1KCKA 2HWZH 2HVKB 3GJFB 1CXHA 1JHLH 4O4YH 3B9KB 1N4XL 3HG1B 4XVJH 1I3GH 1WZLA 4I9WD 3VMPA 3K8KA 2EYRA 2NNAA 1ES0A 4BZ1H 4MNHA 2D9CA 3EJYD 3P4OA 3OKYA 2VITB 2OZ4H 5FHBH 2FEDC 2JB6B 1T7XA 3W2DH 5CSGA 4HKBA 4HEME 2H1PH 1BF2A 1GGBH 3BP4B 1EEYB 4HXBH 4M48L 3PWJA 1CR9H 3MLRH 2MQCA 3QEQD 5DK0B 1NEZB 4EUPG 5IKCA 2ADJB 1X4YA 2ITDB 3BP6B 3MA9H 4XRCA 5IFJB 1N26A 4OZGB 3H9SA 3VWKD 4XMPL 4HZAA 2KL6A 4KTEL 5GISH 1KB5H 3IDNA 3LKOB 4WV1A 1A64A 2W0FA 4GBXB 4NZRL 6FABL 1G7JB 3SJVD 1C12A 3HE6D 3QQ9D 3F5WB 4D9LH 5DD5H 2EECA 3TJEH 1S7XA 1ND0A 5IT2H 5EOQL 2IGFH 5C0FB 1G7PA 1I9IL 1I9JH 1T66C 1NAMB 4HK3J 5CKGA 1NSNL 2VL5A 4OZGE 3BDBA 3QEGH 1RIUL 4M1CD 4R96A 4WHDA 4WO4C 5EPMB 4HFUL 1C5CH 4Z95L 4NZTL 1UXWB 4JQVC 4XCFH 3WIFA 4OJFL 2BFVL 2YUZA 5D7SH 3QIUD 4LHUA 4LKCA 3V4UH 2GJ6D 5CBEB 5IHZA 1RZKH 4LL9A 2XTJD 4RAVB 3KPSD 1RULH 4LCCC 1TTFA 1E4JA 2QTEA 2DQUH 4IRJD 4KHXH 4YR6B 5F9WB 3TBSB 1MFAL 2ZUWA 3EJYC 4YWGL 1I9RH 1R6VA 5I1CH 5BZDB 1NQBA 1CLYH 3EFFB 5ID0A 4H88H 2IH3B 2JJTA 3QNZB 3ECBA 2MPAL 4YEEA 4OGYH 2AI0H 3MRJA 3ZYOA 2XNAB 1TCRB 3CK0H 1OSZA 3ARQA 1NCWH 3UPCA 4LQFL 2R56H 4JGJA 4RMVA 4ZNCD 4H26B 3G5XA 2P5WA 1P7KA 2AK4B 4X5XB 4X4YB 5LG1A 4NQDA 3D69B 4RGNC 1VCAA 5IOPB 4JG1H 1WFUA 4ODWB 5DO2C 5JUEL 2D7TH 3RL2B 3HE6C 3QQ9C 4L5FL 1E4XI 3S4SA 4WGVB 3GI9L 4CU6A 1G6RA 4KDTA 2KUTA 4RFEB 4LRNL 2X09A 3KAAA 1RZ7L 5C0ND 1J05B 2AK4E 5DD0H 3KVQA 4APQD 3PQYA 3MBEB 5I16A 3S8WA 1E4KA 3QB7C 4M1CC 4O02L 3BHBA 3ROOB 5F7NC 4PLOB 3MLZL 3QUKA 4G6ML 4LMQE 4U3XA 3WO3B 2WWKO 5CEZE 1X7QA 4OLWH 3QIUC 4HIXL 4YDIL 1IGYB 5DQDH 4JHWH 4EQ3A 4PB0L 1KUMA 3MTRA 5C09A 4KRNA 3TO4A 3UPRB 4V1DB 1P4LB 5HGBB 3QCUH 3AC0A 3WDIA 1B4RA 2JTDA 3M1BB 5DXWA 2XZQH 4G9DB 5BV7L 3S3PA 1VFAA 5KZCB 3VGEA 3O81A 5FOBA 5DK2A 3LH2H 1ZVSB 5E1AA 4L8DB 4OGAC 4TUKH 5T5FL 1N59A 2XG4A 3DX6A 4JR9L 2LAGB 3LPGA 3OKEA 2ZKHL 3NAAH 4C56A 4KV5F 5E99L 3NABL 3KWWA 4XMKL 3DO3A 3FCTB 3BEWB 4M7ZC 3VXUB 2J88L 3ZE0E 4WFFE 2OTUB 1QNZL 4HWEL 2R1WB 3S5LB 4G7VL 5E9DA 3ARWA 3CFJB 4YNYA 5AD0A 4GW4A 1JNHA 5IF0A 2YC1B 2CIIB 1H8SA 1JPGA 3K4AA 1OW0C 3P11H 4HJ0D 1JZ3A 2A9NL 3CPLB 4JO1H 4YFLF 1S7UB 1UB5B 3VXUE 4IIQB 4G8GD 1W8NA 4HMDA 4LLYB 4YPGB 3HR5A 3BN9D 5F3HA 3R8BB 1MJ8H 4J8RB 1GGYA 4YUEH 4WI8A 4YBLC 3IAQA 1MHCA 2VR4A 5C0NC 2CDFA 5HHNB 3Q5TA 2CLRB 5EBGA 3JXAA 4LF3B 4MA1C 5DJYB 4APQC 4U6XA 2O93L 2VLRB 5INCA 4EI6B 5DD1L 3MREA 3U2SA 3DVNB 3ZE0F 3QDAA 1IKNA 3EOYG 2AQ2A 4OZIA 1FIEA 1CZ8L 4P57B 3UJIH 1NFDF 3MCKB 5F9DC 4ZDHB 2NTFB 2VXUL 4UILL 4XPGL 2XACC 2EDFA 4EI5C 4JPIA 4NQVA 4XH2B 5CJQL 4HBQA 3QDMB 1G7IA 5D7JD 2FX8L 3WDJA 5F89A 4FABL 4NHUA 8FABB 5HYQB 1HEZB 4GLRH 1V7MH 3E6FB 4HEPG 3WO4B 2V7HA 3K7UA 4NZUH 4RFOL 5FB8A 3BSZH 1NGYB 1C7SA 3BAEH 5L6YH 1UM5H 1PKQA 1FORH 2DAVA 3ZL4L 2J8HA 1CLOH 1FLRL 4QYOB 3TBWA 2XV6B 3KYOB 3O6FB 3CSYB 1U92B 4Z7VB 1H8NA 5EZJB 5IQ7H 1BFSA 2FEEL 1MRFL 4DUVA 2F74A 4LGRB 4OZFG 1AH1A 5LWYH 2DQIL 4U0RB 2FSEB 3AUVA 5DUMH 4DKAA 1EUTA 3LKPB 5IR1B 1IC4H 2EDTA 3ORJA 5HTSA 5HDLA 3ZYIA 4HJ0C 2H3NB 3SGEH 5DRNA 2YKLL 4YDJA 4U05A 4R8WL 4U1GC 5BRZB 1TVDA 3M07A 4ZUSA 3M8OL 4LAQL 3GNML 1DBAL 3SKUD 3SO3B 2EC9T 3G6AA 4Z7VE 3THML 2UYLA 2IADB 5D1QA 5KAQG 5K9QG 3HPJB 3C60C 3QDGB 4FTVD 4XNXH 1RK1A 2E8YA 4KU1A 1Z0NA 1VESA 3DSFH 5ADPH 1ZT7B 5IVOA 1MHPH 3U79A 1OM3L 5HI4D 3HAEB 3QDJD 3QJHA 4J3OC 2GSGA 3QO0B 4J4PD 3DURA 3ET9F 5BVJB 3OKLA 1F02I 2IPKB 2ID5A 1I85A 1XCTB 4Q9BA 5D1XB 1RJYA 4ZQKA 3BUTA 4L3EA 1S9KC 1GOGA 1VFUA 4ZFGL 5BRZE 1CICD 2X5PA 2Y5EA 1A6ZA 3NZ8B 4Y4KD 3GO1H 1T0NB 2NR6D 3SBWA 3EHBD 3EYOA 1I7UA 3CDGB 4JJ5B 2WBJD 4KY1L 5FYKH 1D5ZA 1HH6B 3FOLB 4TVSa 3MLYL 3QDGE 1SJEA 1I8KB 1MCRA 3SO5A 4HIHB 3RWHA 3L5WA 2YUVA 4LVHC 3QEHB 3EO9L 4ZO7A 1EA9C 2O5XH 2FB4H 5CFHA 3WN5A 4HUXA 2WIIB 4HHAB 3QIBB 5JR1H 1X5GA 4LHQB 3MLXH 4J12A 4XB7A 1L6ZA 5DFWH 3AGVA 4U6YB 4Y2DA 1OB1A 4F33B 1JPSH 1OWWA 3C9NA 1IC7H 4KHTL 1KIRA 5F9OL 1KJVB 2D3VA 4TULL 1OP9A 3UTSA 1SJVA 1BZ9B 1HSBA 5ECJE 3PL6B 3QP3A 5IEKA 4M5ZL 4JCLA 4YBHA 4NQCB 5HGDB 4U1HB 3IKCB 1CFSA 1CU4H 5FGBA 3O4LA 4M4RA 3EYSL 1FZJA 2VOTA 2AJ3A 3D25A 1MVUA 3FZUD 4H25A 4XXCC 5AG9A 5EC1B 2MTPA 3X12A 4CBPA 5GIRA 1DFBL 4JE4B 5C0CB 4JFED 3R8QA 5HI4C 1FJ1B 2DD8L 5GGVL 1M4KA 4TQEL 2F5AL 4B53A 4JZJA 1JF1A 5DYOB 1SJXA 3UTZA 4NQCE 3EOBB 1I7TB 1ADQH 1D9KB 3X11A 1H3PH 4UTBL 4PUBH 3PWNB 2QR0B 2VAAA 1DQJB 1MRCH 4PG9A 2NR6C 4QLRA 4WNQA 1KN4L 5B39B 1JNNH 2WBJC 4Y5VC 5J56B 1RAMA 4S1RH 2EDXA 2F15A 3UTQA 3WE6B 1IEBB 4DFHA 1KCUH 3BZDA 3ARFC 2VMFA 3MBXL 6CGTA 5IBUG 3DBXA 2EYRB 2NNAB 1ES0B 5IMMB 4X4XA 4I3RL 3IU4H 2CKBH 4MNHB 1GC1C 1A3RL 3OGOE 3ULUE 4Z0BL 1MI5E 3BKJL 3DUSB 4FHBD 3EYUL 3D85D 1U8NA 5F88B 2RJMA 4A2LA 2P5EA 5IBTL 4PJXA 1CVSC 4JREC 1YECH 4HG4J 5DJ8A 1HXYB 1Y6MR 3CSBA 2YEZA 3L5JA 1JGUL 1R5WA 3PWJB 3MRLB 5DJ2A 5I1DB 2F5BH 3D6GA 2Z8RA 4XRCB 4DKFL 4IOSD 5AG8A 1IL1A 3H9SB 2NTSP 3JTTA 4I0PA 4L8SA 1ZHLA 1FC1A 1D6VL 3B8YA 4OTXL 1RZFH 2W0FB 4LKXA 5JOPE 3QXTA 1FNEA 5TE4L 3T3MF 1MY7A 2GSIA 4A6YH 1ND0B 1T22A 2Y07H 4RFNB 1KTDA 3QNYA 3DWTA 3QHZH 3FFDA 1G7PB 4B7IA 2B4CH 2ENSA 1B0GA 3BWUC 3HZMA 1QO3A 3H9SE 5DRWA 4HK0A 4R96B 2DTSA 4PJAA 1MCOH 1RQ5A 4AT6B 4YZFE 4MQ7A 2NW2A 4W4NA 1IGFL 2KKQA 3KJ4C 4HBCL 4LHUB 4LKCB 1WIOA 2Q3AA 3AM8C 1X5HA 5IHZB 5KVEL 1TTGA 5KSBA 5DHYB 4WI3A 1UG9A 1F45A 2BVTA 1YDPA 2EDOA 2PYEA 1MWAH 4Y5XA 1RHHB 4X6DF 3OAYH 3FT4B 1CGXA 1RZ8B 5M94B 3ALPA 4QWWC 4N9OB 1R0AL 4F57H 1T1WB 2N7AA 2P48B 3ZKSD 2R2HA 1F4YL 2E27H 2Q76A 4KI1A 3DIFA 4HT1H 5CLWA 4WUUA 5TDNB 3P9LA 4F37K 5ID0B 4ODTL 2DF3A 2YRZA 2EC8A 3ECBB 3MGOA 2V5RA 3VU2A 1JFQH 1I4FB 1UM6L 3MRJB 4PRIA 3HZVA 1GXEA 2AJYH 5GS2D 1UCBH 1DSFL 1X5LA 1P5UA 3HMXL 4OLUH 5E8NA 4RMSA 3G5XB 2P5WB 1E0OB 5I1LA 3SGJA 3IFNH 4YZFF 3ZSTA 4NQDB 3REVA 1GYAA 3SDXB 3EZJB 3QEUA 2N4IA 1FYTA 5DJXA 5C0JA 5HVHB 4KJWC 4JFZH 1BVZA 1RUPL 4XP9L 2XQYK 5EU7C 4W81A 1LO0H 5E6IA 3MUY1 3S4SB 1UT9A 4NJ9L 5F6IB 3NTCH 5SX5H 5JHDA 2XQYG 3L1OH 3GK8L 3BX7C 4FA8A 4NM8H 2IJ0C 5FM5M 2P5WE 4JY4A 3BO8A 2YD6A 4NQDE 5I16B 4Y8DC 1LO3H 3MV9D 3O6KH 3BHBB 1WISA 4NNPL 2VNCA 4P4KC 4NN6C 4JQIH 2XY1A 3KPQA 2P24A 4DUWA 3DO7A 1H3TA 4XPAL 5SWSD 4OZ4A 3JWDC 4M9OA 3TO4B 5I1EH 4UU9A 4HH8A 3QFJD 5HJ3A 1SY6A 1XF1A 3RIAF 3MNVA 1VFAB 4K9EL 3MUZ1 4PD4J 3S34H 1XIWD 5FOBB 5E1AB 1JIBA 3PQYE 1N59B 3DX6B 3A6CL 5HYJA 1IZJA 1TJGL 1MPAH 3KWWB 3RY5A 1WBYB 4S11A 2NX5A 5CZVL 1AO7B 5EU6A 1WBZA 2YPVL 5AEAA 5C09E 2ZWLT 2WQRA 2EDNA 2CSPA 5FYJU 3RGVA 3KPPB 5E9DB 4YNYB 1A1NB 5AD0B 1MEXH 4XMLH 3N1FC 1JNHB 2Q8BL 5IF0B 4RDQF 1TPXC 4JDVA 4OF0A 4C56E 1JPGB 3AS0A 2NY5C 3DJ9A 1WT5C 4JZOA 1BBDH 4OCWH 2APWA 1KPUA 1XGYH 4FQIL 4LVEA 5C6PB 3VH8G 1I1YB 1N2RB 4R2GB 1FDLH 4NRZA 4EEEA 4G6AD 4XC3L 1AGEA 1KG0B 5E9DE 1MHCB 5C07B 1NANI 2NY5H 2CDFB 3BP7B 4IBLT 3LY6A 1ZHKA 4P5TB 2IBZX 1H9VA 5INCB 4OI7A 3LSOB 4U1KA 3MREB 3U2SB 5BOPA 5J1TC 2H9GA 4F7PA 1N5YL 3IFOA 4PRPD 4OZIB 2ZUYA 1DLHA 4OCMC 4GT7A 1T2XA 1UZ8A 2R9HD 5JXEA 4XNZC 3F7PC 3FFCD 3P4MA 4NQVB 1BAFH 4H8WH 4HUVB 1NCCH 4QXGL 5IB5A 2BSTA 2NY7H 3L7EB 3PGDA 4GQ9H 1Q94B 4DVRH 5F89B 4NHUB 3ARGA 4NO0B 3VXRA 1QSED 3X3FL 1XIWC 2P45B 3BKML 3OXSA 5JQ6L 2W92A 1RU9H 1M7IA 3RBSA 3TIDA 4C55A 4CU7A 3ARDD 5E5MB 2A77L 1PKQB 2JE8A 4IS6A 4KK5D 4OZIE 1ZEAH 2C9AA 3TBWB 1A6WH 2YR3A 4WFGD 1EFXA 4MJ5B 5MENA 5SX4I 1OL0A 3GSNA 4EUPA 4PLNC 1UM4L 2F74B 4NUGL 4C4KO 3CZFB 3WHE1 4MHHI 4K3EL 4KPHL 5MEOA 3S37L 2WUBH 3GSRA 5F96L 5C9KA 5L8JB 3UO1L 4F58L 1PKQE 3SKMB 4YDJB 5JPMA 4S1SH 1KXQE 1A9EA 3JV5A 5DWUH 5D2NC 4MAYD 4ZUSB 5DJCB 3HMXA 5C92A 3G6AB 1EZVY 5D1QB 2Z91A 5JW3L 4UV7H 1IAMA 4G6AC 5J6GA 4JHAL 2B0SH 4TTDD 1MSPA 2W9DH 4M7LH 2GYSA 3U0PA 3GUTB 3LS4L 2VLME 4I0CC 1G9NC 5F1SA 5B4MC 4P5MB 5JHLL 3QJHB 4FFZH 2GSGB 4YGAB 2X4PB 3DURB 5I1GH 3OKLB 4FQPA 1DCLA 3ARSA 4W6YB 1RJYB 4ZQKB 3OAUL 2VN7A 4Y4FD 3GMRA 3CXDH 1KN2H 2ZUQB 5EDXA 3KYAA 3INUL 3EYOB 1I7UB 1F42A 3HUJF 1NCTA 5E00A 1D5ZB 4PREA 1UYWH 5I1IL 3L5WB 4ORZC 3V8CA 3O3AA 1EHXA 4F7MB 5I6XC 1XCQA 4KTDL 2APBA 2YA0A 4NM4H 3PWLB 3WN5B 3QRFM 3V0WH 3ARDC 2OI9B 1ZTXL 4K2UH 5HGGS 1H15A 3WFZA 4KK5C 4L3EE 3SEPA 3VFVA 4JM2A 5C0AA 1KPRA 5BV7B 1KBGL 4Y2DB 1OB1B 2FECL 5D2LF 4ZS7L 5IB3A 3U9PL 3ZT5A 5HHVL 1FL5A 3C9NB 1AFVL 1EPFA 1KIRB 4P2CG 1MAKA 4UUJA 3FT3B 1B2WL 1VEMA 1VFOA 3LEYL 1WK0A 1YN6A 1HSBB 5EBWA 1MCHA 1AXIB 5E8DL 3DECA 2DM4A 1UZ6E 1ETZA 1Q0YL 2P8LA 4G7YH 2B2XH 4XP1L 3IFLH 3IVKA 3O4LB 4QRUB 1U91A 4X80L 4YHYB 3X17A 3D25B 1MVUB 5MI0C 2EDWA 3MLTA 3QJFA 1G0XA 3LHPL 3H3PL 1LWRA 4TPRH 3RFZC 5D6CA 3UTSE 2RGSA 5GIRB 2FD6H 5F21B 3QPXH 1J11A 1ZOXA 2HFTA 3GMOA 2N56A 4MJ4A 3BZFA 2W0PA 5T3ZL 4JZJB 1FVCA 1JF1B 4U3CA 4Z6AT 1NLBH 1DBJH 3F7VA 1RUKH 3RWGA 3X11B 5FDWA 1OTTD 2VN4A 4QHKI 4FZ8H 4Y4FC 3TBTB 1EJOL 3MV7A 4G9FB 5GGRY 4UQ3A 2VAAB 2HFEA 1CXLA 3O4LE 4PG9B 2AK1L 1FBIL 4WNQB 5H37H 4S1QH 5IEHA 5A16B 1EV2E 1KV3A 2XA8H 4XTRC 1QZ1A 4GRLD 3GGWA 3UTQB 3WNKA 2P8MA 5MP6L 3FQUA 1UZ6F 4IRSB 3RDTD 4CUCA 3DBXB 3FQRA 5DUBA 4X4XB 4HJJL 3TNMB 2HT2D 5HDQH 3FTGB 1OT1A 4U1LB 5DT1L 2IEPA 1U8NB 5HHXH 2CRIA 3UJTH 4HUWA 2FHBA 4PJXB 1KLGA 2QHRL 4XPFL 1II4E 2J6EL 5FDYA 12E8L 1R3JA 1HZHL 5HYIA 4RBPK 4ZFZA 5DJ2B 3U83A 3C09B 3MLUH 1MCCA 5ELIA 1FNSH 1IL1B 3SOBL 4YX2L 2GEEA 3JTTB 4U7SA 3GKWH 4I0PB 4L8SB 4NRXA 1ZHLB 5FEBA 1R5IB 1UA6H 4LKXB 2P5EE 4RWYL 1FNEB 4PJXE 3QUXD 4EOWH 1D5IL 4CAGA 3SDCC 2GSIB 4NSKA 1SMOA 4DQOL 5EN2B 1T22B 1WTLA 1HN1A 1DUYA 1KTDB 1NAKH 3FFDB 1B0GB 3HZMB 1PFCA 1IAIL 1VENA 5IW1A 4HV8B 1LILA 1QO3B 5DRWB 5L7XH 1C1EL 4HK0B 4K3DL 2VLJD 3VI4F 3K4DA 4M6MH 3U4BH 4MQ7B 2NW2B 1BVKB 1Q72H 3O6LL 1I7RA 3RTQA 5AAMA 5F1IB 3EOTL 1WZ1H 5AYUL 3SDDB 4GRLC 5KSBB 2ZUSA 2F19L 4Y5XB 3ALXA 3NA9H 4F3FB 4GKZB 3RDTC 3TLRA 3ARTA 5GGQL 1I75A 4IMKC 4OUOA 4QEGA 4NP4H 5B22A 4KKBC 2MKLC 3SY0A 2P7TA 3EIFA 2R2HB 3O41B 4PJAE 1HYRC 2WUCH 2ZPKL 3DIFB 5IK3B 3P9LB 5CIPA 3MRMB 2BOBB 3O3BA 4JO2H 4OZFA 4MNQA 4BH8B 2Y36L 1N0LA 3TN0D 5KSBE 4KQ3L 4UT9H 2PYEE 3MV8B 1QTYT 4OLYH 3SE4A 2K3TA 4I18C 1MJ7H 2BOCA 4FFYL 3H8NA 4UBDC 5I1LB 5IGXL 4FQ1H 1A7RH 3GJFH 3REVB 1I1AA 4QKXB 3R1GL 2UY7A 3QEUB 4MXVF 3NIFE 5AZEL 2QLVB 4OFVA 4WUUE 5DJXB 4CN4A 5C0JB 5JXAH 3MRKA 4P2QA 2XWJA 4WU7B 4M6NL 1ZVYA 5E6IB 4BSWA 5KVDL 4OUUA 1GH7A 3CUPA 1NC2A 4TVPH 4PRIE 4KC3B 5JHDB 1P4BH 3U4EB 4KMQA 4DZBA 4R6UA 3QUYA 3RZWA 3MJ8A 3BUYA 4PJAF 2DTML 4JY4B 2RCSL 4BA8A 5FYLH 4P2OD 2IF7A 1KIPA 2CDGA 2HTLD 5JMRA 5CEZD 4NCDA 4BUGA 1R3KB 1FYTE 3S36X 3GSUA 4HUNB 1D3CA 1YJDL 3KPQB 2P24B 2DWEA 3I6GB 3DO7B 4TRPL 4OZ4B 3IDMB 1IKFH 1ZLSL 2N1KA 4UU9B 5FA4A 5HJ3B 1XZ0A 1J1OH 2A73B 1SM3H 1QFOA 3MNVB 3F6LA 4N68A 5TE7H 3NIFF 2EDHA 4X8XA 3FB8B 1QLEL 3BRGC 4LLDA 3RIFF 2GI7A 1IBGL 2KZWA 3T2PA 5LVEA 1NAMH 1OAQH 1DE4B 2V2TA 5K9OA 4OFIA 4PG2C 1HKLH 5EU6B 1IC5L 1WBZB 1FV1A 4YXKL 4OLZH 3V6ZB 3TN0C 1PG7W 2X10A 5GRUL 5F9WC 3V7AE 4KMLB 3IDJA 4PJ9D 4NQXB 4H20L 3VGGA 2ZUXA 4MWFA 2J6EA 1ZGLM 2G5RA 2YA1A 2AERT 4LP5A 5HYJE 5D1ZD 4JDVB 3QWRA 4JZOB 1FO0L 3LKRA 4ELMF 1XGRB 1KPUB 2NX5E 1QFUL 3MOBL 3SQOH 1FCCA 3FN0H 5EU6E 4MCZA 4XCCH 5EOTA 1F11A 3S36H 5DHXB 3WJJC 4GRWE 1AGEB 3OAZK 4E42A 2NY4D 4PBWD 4X7FC 1HXMB 2CR3A 1ZHKB 1FFPA 2DQCH 4P2OC 1E6JL 2YSSA 5LJYH 4U1KB 1HWGB 2H9GB 3N9GH 4F7PB 3IFOB 1DLHB 4OB5L 5KVGL 2BK8A 1UZ8B 3UTTA 1LEGA 3P4MB 3A67L 3GM0A 4MLIA 3H0TB 3TZVA 3D5OF 3EFDH 1YEGH 3PGDB 4YO0A 5T33L 4NOFA 1ZANL 2A6DB 4MQTB 1FNFA 3VXRB 3N85H 3B2VL 5ITBL 1KIQA 5TDPA 3KPOB 4ONGL 2BY2A 4XPTH 3TIDB 2QQKH 3JWNC 3SKOA 2V7NA 5GRXG 2VXVH 1ORQB 5CILH 1TJHL 4JM4H 3PV6A 1EFXB 1F90L 2Y06H 1NUFA 5A2JH 5IJKA 1OP3K 4DGIH 3GEWB 1K3ZA 4GRWF 4PBVC 1A3LL 3LMJL 3GSNB 4EUPB 2Q87A 4JKLA 4XNQA 1OOAA 3G5YA 1OARH 5F7DB 3MRFB 3VXRE 4P23A 5MEOB 1CI5A 5J8OA 1UH3A 5BO1L 4BSJA 1H3VA 1SEBA 3GSRB 3VXMD 2XIDA 3I02A 3LPFA 1F4XL 4Y1AA 3QFDA 5JPMB 3DV4A 1A9EB 4LQ1A 5MENE 5C0BD 4NKOA 1FGNH 2Z91B 4EZMA 3CD4A 1A7NH 5J6GB 3HLAA 1HH9B 3H42H 5DFVD 2BCKA 3QSKB 1X6LA 1UENA 1QBLH 2BY1A 3CLFL 4JFFB 3CFEA 1WVZA 5DQ9B 1JNLH 4LPVA 4JPKL 3ARXA 4MD0A 3GMRB 1HHJB 2WNGA 3P9WB 3PGCA 3E8UL 4OIBA 1MCPL 2H2PD 1KELH 4MB3A 3BPOC 5E00B 1NCBL 4PREB 1MFEH 2M2DA 1MREH 3P3YA 1F97A 1A7OH 4M62L 2BNQD 5LXGL 2DMBA 1U8IB 3T2OA 4P9MH 1XCQB 4TSCL 3VXTA 3BQUA 3GZKA 3MPCA 3OV6A 5LAXB 1H15B 4JY5L 5C0AB 1KPRB 3HHRB 5BQ7A 4TNVK 1JNJA 4M8VA 1KJ2L 4PJ5A 4MA7H 5IB3B 3IAGC 1QEWA 1FL5B 4X4ZA 1GGUA 4X6CB 4UUJB 3QUML 1MFCH 1BMGA 3H9ZA 1YN6B 5BVPL 5T1MA 2E7LC 3F58H 3O6FC 2BX5A 1ZMYA 4YBQD 4AEEA 1YEEL 3O3DA 1QG3A 5HI5D 1YEHL 2IPUG 5C0AE 5E0QA 5AAWA 2Z93A 2I60H 1U91B 3U7YH 1IVLA 4X0KA 4XHQA 4ZO8A 2APTA 3QJFB 5GQBA 4HIIB 4KZEH 4U0RC 3S9DB 4UIKH 5KW9L 3O2WL 1MCQA 2UZIH 3QBTB 4HS6A 4PS4H 3BZFB 1GPOL 4JB9L 2XRAL 1T1XB 3UTPE 4ODXA 1FVCB 3LD8C 5FYKD 3EDEA 5T1DL 4JAMB 1GOHA 3F7VB 5FDWB 2X1OA 3MV7B 1FLTX 1P84K 4UQ3B 5DFTA 2DKSA 2HFEB 5K93A 5B3NA 3VW3L 3PABA 1MY5A 1FL6A 5IEHB 3WFCH 5KSAA 2DQGL 5DTFA 2ZCHL 1XGUA 1N64H 3GGWB 2P8MB 3WXWL 2EYTA 1JRHI 3FQUB 1HHKA 2VO5A 4M02A 4DK6A 1MELA 4HQQL 4NZJA 2AP2A 2OR8A 4K71B 1MI5D 1IT9H 3U7WH 5TQ0L 5JA8B 3QXAB 3FQRB 4JM2F 5DUBB 2VDOL 4U0QB 1AGDA 3MRIA 4LLUA 7CGTA 3MLVH 3MV7E 1NUGA 3HAEH 3MO1B 1QRKA 4XB8A 1Y6KR 3ABZA 4HUWB 4JFQA 1AXSA 1NDMA 1KLGB 1JZ7A 2JIXA 2W59A 3FO2B 5IHUH 2R4RH 1MQKL 3NACH 2AEQL 5MERA 5F7EL 1PYWA 1UXSB 2OXHA 4ZFZB 2BNUA 4PP1D 1OAKL 4U33A 2R2BA 5ITFA 4N5UA 4N0UE 4HLJA 4PGZA 5JOPD 3ZDYE 4UZGA 1BFVH 4YBQC 5I30H 2FGWL 5HI5C 5E08L 1DN2A 2H8PA 3VH8A 4NRXB 3D9AL 3ULVF 4MAUH 1XFPA 3BDXA 3BH8B 1BJMA 3Q6GL 3VJ6A 1MAML 5JQHC 2D7NA 4NSKB 4DW2L 5IIEA 4KVNH 3IS1X 3NOIA 5TPWH 2YBRA 4ISVA 1U8OA 1DUYB 1FH5L 2I07A 2WINA 4EN3D 4RA0C 2DKMA 3QEQA 1JF5A 3WFBL 1U6AL 1OTSC 5IW1B 1U8PA 3STBA 5DQJA 2FX7L 3NFSH 5C6TH 1J12A 1RVFH 1XF3A 3VWKA 1UWGL 2EDRA 3BDYH 1AJ7L 5CUSH 1I7RB 1HINH 3RTQB 3DUUB 1KB9K 4NKIL 5CAYB 3U1SH 4AEIH 5IW6B 2QSCH 5EU4A 1N5AA 3SJVA 2VSDA 3JV6B 2V9RA 3KR3L 1A7PH 5L2KA 1I9EA 3IFPA 4MJ6A 4EDXA 3ULUC 1D9KC 2EDLA 4YC2B 1CK0H 5D72L 3LS5H 4HWUA 4O9HL 1EBPA 1G9MC 4PJDA 2P7TB 4PJ7A 2OK0L 4KJQC 4U1NA 1P7HL 1UVQA 1VGEH 5CIPB 3BN3B 1FG9C 4OZFB 4MNQB 3ULUH 2KQNA 2GJ6A 3KHOA 4JANB 4JVPA 4QTIH 2LU4A 4PP1C 5D4QA 3P0VL 1T21A 3O6MH 2MOVA 3RKDC 4EKXA 2BOCB 3FAXA 1KJ2A 5H8DA 4QY8B 4DCQA 4IRJA 3CVIH 2CD0A 1ACYL 1NCDH 3WUWG 1FSKC 3QUMA 5J6HB 2EH8H 2W0LA 1CXFA 3RWIA 4R4BB 5J11B 1UKSA 1MCNA 3MRKB 1YC7A 4BK4A 4OV6F 2XWJB 2YD8A 4P2QB 4MNQE 1JGVH 5GZND 4JKPH 1EMTL 4FNLL 4BSWB 1A6VL 5F93C 1OPGH 3CUPB 4LDOB 4LSDA 2I5YH 1W8OA 2UUDH 4DZBB 4EN3C 3QUYB 3MJ8B 2UVFA 2IALA 1V8HA 4LSTH 3BUYB 4PRNA 2VZ1A 2OR7A 2G9HA 4WV1C 4PGEA 2KH2B 5CSZA 2CDGB 5FXCH 2ICWB 2H2SD 1Q0XL 3BGAA 1H3UA 1OAYL 3OHXB 3GSUB 4IM8A 1QFWL 1OW0A 3HNVH 5FYJL 3HC3L 4P2QE 2FBJL 4RFNC 2DWEB 1KYOK 1C16A 1ITBB 1A14L 2OTPA 3SPVB 1ZA3B 4E41D 3B3IA 3MX0A 1XZ0B 3A6OA 1Q9WA 2FX9H 3MROA 1L0XA 2GTZA 1B6DA 4Q0XH 1WF5A 4LLDB 5DLMH 4APQA 2FNBA 1J1PH 5DZOA 4JDZB 5FUCE 4BQ8A 5J06A 4XNYH 1BVLB 3HRZA 1DVFD 5D6DA 5K9OB 1OCWH 5C70A 4Q6IA 5T3ZE 2ZUUA 4OD3L 5GRZA 4FFVD 1KC5H 3IRPX 5F8RC 5IFAH 3IDJB 1UB6A 2DLGA 3QUZD 4FRWA 4MJIB 1GC1L 2NXYD 1INDH 2ZCLH 1GHFL 3CSPA 1URLA 4C56D 3B2UD 1MIMH 3CFCH 4ZTPH 1V3JA 3IKKA 4E0RB 2DDQH 4NN5C 3LKRB 2CXGA 2Z35A 2EXWD 4FQ2H 5D93B 2AABL 2FZ3B 1P4IL 4XPBH 5E2UH 4PTTA 3IF1A 4MCZB 1A6TA 4JN1H 3I2CL 5EG6C 1JHKH 1MCDA 1F11B 1MVFA 3BYYA 5EOTB 1WUNT 5IB4A 3RL1A 2VIRA 3CMOH 32C2A 1JE6A 3IETB 3G08A 3TYGL 3UROR 3HC0A 4E42B 5C3LD 1HSAA 3C8DA 2IPTL 4Q58C 1U95A 1CQKA 1FFPB 2YSSB 1ZAGA 1KACB 4M43L 1S9WA 1AP2A 1NBVH 4X6BB 3GBML 5FM8A 3ZDZF 4LSVH 1F4WL 1DUZB 1A2YA 2AAVA 4GAGH 5GGSA 4KDTC 1TJIL 3UTTB 1LEGB 3WBDA 4G8GA 1DBKH 1AXTL 3K81A 5IBUB 2J5LB 1NL0L 2DKUA 1OD9A 3VFMA 1S5HA 1E4KC 1DQQA 4DWHA 3T1FA 4YQXL 3K2UH 4PY8I 1KIQB 5TDPB 5TF1L 1INEH 3NCJL 1MCLA 3T0VA 3SKOB 2V7NB 4NO2B 1BM3L 1IAII 4CNIB 3PV6B 1FPTH 3UTTE 1BJ8A 3AS2A 1QRNB 2MKWA 5KN5A 2OJEB 2MSPA 2QSTA 5D7JA 4N5ED 1NCNA 4M7KH 3RWEA 4P23B 2RIKA 4FQJH 2NY3D 4TSAL 3REWA 4LPWA 1E27A 3I02B 3W82A 5L9DL 4OFDA 4Y1AB 3QFDB 1J8KA 3DV4B 4P49A 3UC0H 2EXWC 4B7LA 2QADB 3HNTL 2F8OA 3OB0H 3ESVF 4QRQB 2AGJL 2QEJA 2AJVL 4WVRA 4WHTA 5EC2A 3EJZD 4RMTA 3HLAB 1N4XH 5CGTA 1JUFA 2BCKB 3DARA 3G5VA 1CD8A 3GSWA 5EIQA 2ZZUT 3MXVL 5HPOA 1KLFA 2EEBA 4X9HA 3CFEB 1WZMA 1Q9KA 4Y1AE 4MD0B 3AB0C 4G5ZL 3PGCB 5CP7B 5HYSG 4ENEC 4J3TA 2DWDA 1EHAA 4JRYB 4H0GA 1AGCA 2OJZL 3L3GB 4YHOH 1VB9A 4XC1L 1YYLH 1RZGA 4OAWA 4YGVB 1FAKT 3ZKXB 2XN9D 4FTVA 4FQQA 2MCPL 3BKYH 1IKNC 4NJAL 5I8CB 5I15H 1BD2D 4L3ED 2E9JA 4XMPH 3VXTB 2A1WL 4KTEH 5IVNA 5DJAB 2BRRL 2XKSA 4QCIB 4J4PA 3IDIB 1OLZA 5HGHA 4JDTL 3LV3B 2R69L 4PGJA 1YEJH 4WI6A 5E70A 3TVMA 5BQ7B 4GW5A 4M6OL 4QRPD 1CICA 3KYKL 3DXAD 5GRJH 1T4KA 4Y4KA 1CFVL 4MA3B 5ERWB 4LSSL 1QEWB 1B3JA 5EOQH 3H9HA 1EEZB 3KPMA 4M93C 4PGCA 5T3XE 1NSNH 3WKMH 1OLLA 3O3UN 1A6UL 1DL7L 4JFXA 4Z9KB 2NY3C 3KPLB 1T1YA 1P2CA 4KROB 4HFUH 5DMYA 3O3DB 1BGXH 1QYGH 5C71A 1GAFL 2BFVH 3BE1L 3AS1A 3T2NL 4L29A 2Z93B 4DK3A 4OCXL 1KCRH 4XAWH 4PJCA 4PJ5E 3EJZC 4OM0L 5A43C 5DEZA 4Z5RB 4KAQL 2C7UA 2WSKA 3NA4A 5B21A 4HS6B 1T7ZA 5GGUA 1MLBA 2VQ1A 4YWGH 2EYSA 4ODXB 2I9TA 1W72L 1Q1JH 5D1QC 1HHGA 4YHZH 1M05A 2K1MA 3VFGL 5DD3H 3PABB 5GGRA 4WFHE 3CZJA 3GIZH 4WW1A 3S6CA 5DTFB 2E7MA 1CT8A 4PFEA 1XGUB 3V52H 4GXVL 5I17A 4N0FA 1PX4A 4PLJD 1I85C 4FOMA 5C08D 4YDVA 2GK0A 2FGZA 3HC4L 4JFEA 4L8CB 3UYRL 2ZUQC 1PG7L 1CE1L 1AGDB 3MRIB 3RNKB 3SBWC 4LLUB 1KULA 3GI8H 4RNRB 1FG2B 4OIIH 4ERSL 2GITB 4WO4B 4JFQB 1AXSB 4MQSB 3GI9H 1U2HA 5CBAB 3UBXG 4PV8A 3DOSA 4ZPVA 4LRNH 4XP4H 4BQ9A 2WBWB 4X7CC 2BNUB 1P7QD 4QHNB 4L3AA 3MCG1 1BBJA 4G8IB 2R0WL 4WEUD 3D18A 4LCCB 5D70H 1ERNA 5ITFB 4U1MA 3NVQA 4MVBD 4O02H 5BV7C 3BP5A 5BOZG 1YY9D 2P5ED 4Y2DC 4G6MH 1JPTL 2YUXA 3DUHA 3CXHJ 1UWEL 3VH8B 4GMSL 4YDIH 4MS8C 3WHXA 5E94B 4L1DA 3QO1A 5IIEB 5EA0H 1JYWA 2XQBH 1M7XA 3SE8L 1A9BB 4A2MA 2YBRB 4ISVB 5BV7H 1U8OB 2I07B 4DEPC 2WINB 4XWGH 1BQHA 3U0TA 3SHSA 3QEQB 3VFSA 2VTFA 4H0HB 4I9WE 4JR9H 5FGBC 1JK8A 2ZKHH 3T04D 1S7TA 3NABH 3D0LA 5DQJB 1BQSA 4WW2F 4XMKH 3FO9B 3B9EA 5DUPH 2WM0A 1XF3B 3VWKB 3AXLA 3B4NA 1JYXA 3I3DA 2BC4A 2J88H 3HI5H 2O5YH 4UOW1 1AY1L 3MR9A 1NMAH 1TXKA 5HHMB 3GMLA 1BHGA 5EU4B 1AKJA 3FONA 3MACL 3HE6B 1BZ7A 2BJMH 3VGBA 4GAYA 4PLJC 4Y2OA 2COQA 3STZA 4KZDH 3IFPB 3AVEA 4EDXB 3QEQE 3TBVA 3T65A 4P46D 3KDMA 1J86A 2A9NH 5FKPA 3TT1H 2Q6WB 1K4CA 4PJ7B 4PJDB 3IYLW 3VGDA 4GMTL 1UVQB 3AS3A 3T4AA 3MRGA 3DETD 2IH1B 5DEGA 4D8PA 2O5ZL 5ALBH 5CD5D 1V7NL 2PYED 3V8OA 3HPLA 3SJVE 3QIUB 5JNYB 4PPTA 4N8VG 2GJ6B 1AI1L 1GRWA 5L2KE 2XTJB 3KPSB 5EWIH 4KWUA 5IVZA 1KJ2B 4WUUD 4IRJB 4XWOD 4PJDE 4PJ7E 3LIZH 4JFYB 4ZPTA 5KVFH 2ZSWB 2R0LH 1UACH 3V0AC 1KF9B 1CF8L 1LQSR 5CJQH 4PRID 4ALAL 4LSUL 3FHAA 4TOYL 5F71A 3OR6B 4M7ZB 5H2BA 1TVBA 3CX2A 4I48B 2GJ6E 1ZK9A 3C09C 4FABH 3PWUB 2Z8VC 1NLDH 4S1DD 3FJTA 4MA8L 1FVDA 2XTJE 2G60H 3KYNA 2IALB 2VDKL 3V4PL 4RFOH 1RJCA 4PRNB 4L8SC 5EO1A 1FYTD 4PGEB 3P77A 4WTZG 2PTUA 5CSZB 3ZL4H 4Z7QF 1FLRH 4QO1A 2FL5A 3RI5K 2CJUL 4G8FB 2V5TA 4J6RH 1C16B 1AE6L 4HAGA 1EO8L 5J1SC 4D9RD 1W72A 1MHHA 3B3IB 2DQIH 2A74A 1Q9WB 3RUGF 3MROB 2GTZB 1Y18B 4P46C 4PJDF 3Q5YA 4YBLB 3S3SA 4PY7B 2YKLH 1GGCH 4MA1B 4GG8B 4R8WH 5EFIA 4APQB 1CGVA 3MUJA 3MV9A 3M8OH 4LAQH 2LABA 2PO6D 1DBAH 3HRZB 4LHJB 2IMNA 1QKZL 4M3KB 3AREA 5FOJA 5CD5C 4Y5XC 1LD9A 1CVRA 1CTNA 4ODSL 3KPRD 2K7PA 3ISWA 1MIEL 2DM7A 1W0VA 2Z31D 5IBLD 2HG5B 5HYJD 1FZMA 1LK3H 1FE8H 3IJHA 5FF6A 2NX5D 3U6RA 3BISA 4YDLC 1OAXL 2Z35B 3WXVH 2J7LA 1KCSL 4PTTB 3IF1B 3RGVD 5SWZD 1A6TB 4HF5L 3F62A 5IB4B 2VIRB 3HRPA 32C2B 3V2AR 3G08B 3SGJC 3HC0B 5HDBE 1HSAB 1QSFA 2X1PA 4LCIL 5DR5L 1U95B 5C7XH 4P9HC 1NMCB 1S9WB 4R3SA 1AP2B 2DLFL 5IB1A 2OMNA 5C8JB 1A2YB 5DRXB 2CIKA 2VH5H 5D2NA 4U1GB 1WGOA 5F9OH 7FABL 4XPHH 4G8GB 4TULH 2AJUL 4AENA 4FP8L 5TE6L 4GG6A 3TM6A 3QAZC 4ODHL 2FBOJ 3VFMB 4UOJA 3C60B 3NCYS 1DQQB 3TCLA 2HH0H 1S5IL 4UT6H 3P0YL 1WV7T 2VC2H 4JZNA 2R29L 2CXKA 2ZOKA 3HI6L 4B50A 2YXMA 1BX2A 4GS7B 4HWBL 4WHYH 5DMGD 2EDDA 4NBZB 4PRPA 3DROA 5HGAA 3TYFA 4JG0H 4G8GE 3AY4C 3ARGD 1N6VA 4KMTH 5KN5B 4ZODA 3FFCA 3WIIH 1LP9A 3V6BR 2MCG1 2DD8H 2E9IA 5D7JB 3WKNA 4TQEH 4ZYKA 2F5AH 3RWEB 2A6IA 2VDNH 1YYML </