1A80A

Native 2,5-diketo-d-gluconic acid reductase a from corynbacterium sp. complexed with nadph
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
277
structure length
277
Chain Sequence
TVPSIVLNDGNSIPQLGYGVFKVPPADTQRAVEEALEVGYRHIDTAAIYGNEEGVGAAIAASGIARDDLFITTKLWNDRHDGDEPAAAIAESLAKLALDQVDLYLVHWPTPAADNYVHAWEKMIELRAAGLTRSIGVSNHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDWAAAHDVKIESWGPLGQGKYDLFGAEPVTAAAAAHGKTPAQAVLRWHLQKGFVVFPKSVRRERLEENLDVFDFDLTDTEIAAIDAMDPGDGSGRVSAHPDEVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 2,5-diketo-D-gluconic acid reductase A complexed with NADPH at 2.1-A resolution.
pubmed doi rcsb
source organism Corynebacterium sp.
molecule tags Oxidoreductase
molecule keywords 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE A
total genus 105
structure length 277
sequence length 277
ec nomenclature ec 1.1.1.346: 2,5-didehydrogluconate reductase (2-dehydro-L-gulonate-forming).
pdb deposition date 1998-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1a80A00
3R7MA 2ACQA 4XZIA 4GACA 1Z9AA 4WGHA 2PFHA 4XO7A 3H7UA 1AZ2A 4L1XA 3RX2A 2PDCA 4L1WA 1HW6A 2PDBA 4JQ1A 1Q13A 3EB3A 3GHSA 4XZHA 1VBJA 4WDWA 4PUWA 1HQTA 2IQ0A 4FALA 3D3FA 2PDPA 4JTDA 2R24A 3UZZA 2FVLA 4R9OA 3WBYA 1EL3A 2HE5A 4FA3A 3M4HA 2IPGA 3LD5A 4JQAA 2J8TA 1R38A 2INZA 3ERPA 1VP5A 4LB3A 1M9HA 3GHUA 2CLPA 2HVNA 4QBXA 3ONCA 2BGSA 4WDTA 3R43A 3UG8A 1QWKA 2PDHA 1S2CA 4ASTA 2P5NA 4GA8A 2IKGA 2PDLA 4PUUA 1T40A 3UFYA 1MZRA 5M2FX 3O3RA 2I17A 4WDUA 1ADSA 2I16A 1ZUAX 1J96A 4IJRA 4Q3MA 2HVOA 1X98A 2IKIA 4LBRA 4ZFCA 1ZSXA 2PD9A 4NKCA 2PD5A 3WBWA 4JIIX 4JQ4A 5KETA 5AZ0A 1XJBA 3S3GA 5JH1A 3MC5A 1Z89A 1OG6A 4JTCA 4GIEA 4XVEA 3R8GA 4WEVX 2IPJA 2HV5A 4LAUA 2F38A 3GUGA 5LIXX 4FZIA 1YNPA 1EKOA 3BCJA 3FX4A 1AH4A 4F40A 4G5DA 5C7HA 4PRRA 2PF8A 5DANA 3LEPA 3R58A 4JQ2A 3M0IA 1GVEA 2PDGA 2WZTA 4QXIA 1X96A 4OTKA 2DUZA 3UP8A 1AH0A 4YVVA 3CAQA 3LNMA 1AZ1A 1RY8A 4DBUA 4LB4A 1X97A 2DUXA 4LBSA 2PDMA 1XF0A 4XO6A 2PDXA 3V0UA 3BV7A 2IQDA 3ONBA 4YU1A 1PWMA 4JIRA 2IPWA 4GQ0A 4JIHA 1PYFA 4I5XA 3P2VA 1XGDA 4XZNX 3CAVA 4ICCX 4MHBA 1QRQA 5LIWX 2BP1A 1AH3A 2ALRA 4HBKA 3V0TA 3LQLA 3R6IA 2R9RA 2A79A 2IKJA 4JQ3A 2PDYA 4IGSA 1EXBA 2HEJA 3N2TA 2WZMA 5HNTA 1C9WA 5LIUX 2VDGA 2PDUA 3H7RA 1YE4A 2PDFA 3LZ3A 3B3DA 2HE8A 2NVDA 2INEA 3Q65A 2FZ9A 2IPFA 4YS1A 1IEIA 1YNQA 2FZ8A 2IS7A 3N6QA 3COTA 3CMFA 4XK2A 3UZXA 1RALA 4PMJA 4JTQA 3GHTA 4DBWA 4WRHA 2F2KA 3CASA 3LBOA 1S1RA 4H7CA 4JTRA 3CV6A 3C3UA 3T42A 1Q5MA 3Q67A 2PDQA 2HDJA 4YVPA 1IHIA 2QXWA 4H8NA 1K8CA 3G5EA 3R8HA 3UWEA 2FZDA 3M64A 4RPQA 3G1RA 2IKHA 2ACSA 1S2AA 4QR6A 2ISFA 5AZ1A 2FGBA 3LZ5A 1ZQ5A 3LUTA 5JH2A 4PR4A 4LAZA 3DOPA 3FJNA 4WDXA 3LN3A 2NVCA 1RY0A 3O0KA 1S1PA 2PEVA 2ACUA 3RX4A 3BURA 2PDKA 3UZYA 3R94A 3MB9A 1PWLA 5HNUA 3LQGA 4XAPA 4PRTA 3U2CA 3VXGA 1PZ0A 3LENA 2C91A 1Z8AA 3EAUA 3QKZA 1FRBA 1YE6A 3DN5A 4XZMX 1A80A 2PDWA 3CV7A 5HA7A 3BUVA 3WG6A 1Z3NA 1US0A 3EB4A 2PDNA 2BGQA 4JTAA 4GCAA 3UYIA 1MRQA 5LIKX 2PZNA 3NTYA 4DZ5A 4YVXA 3F7JA 1PZ1A 3UZWA 1AFSA 4AUBA 2ACRA 1LQAA 4EXBA 4HMNA 2DV0A 4XZLX 4QX4A 1LWIA 3RX3A 1JEZA 3WBXA 4EXAA 5LIYX 2PDJA 3V0SA 3GHRA 1T41A 2PDIA 2FZBA 4GQGA 2AGTA 1SM9A 3V35A 1MI3A 3WCZA 4XVDA 3H4GA 3V36A 3KRBA 1EF3A 3UGRA 4Q7BA 4IJCA 4GABA 4FAMA 1UR3M 4DBSA 1ZGDA
chains in the Genus database with same CATH superfamily
4BK9A 1UP2A 3QY8A 4G9PA 3PZNA 3NPVA 2ZZ2A 4XUYA 1AZ2A 1XDMA 4Q6XA 3BICA 1TTQA 1A47A 4ICMA 4C1NA 3EB3A 4IFRA 2WHLA 4E4PA 3DESA 2VXNA 3IJ9A 4N42A 4WKHA 4NASA 4GJJA 2FTPA 5FSDC 3VUPA 4K7VA 4WDWA 1V0MA 4GZJA 4RDWA 2WYSA 3VIJA 5CSSA 3DHUA 3DI0A 4UMCA 2OFJA 2ISVA 3KLKA 4H7VA 3CIWA 4AEOA 3T6CA 1I60A 1W37A 2J8TA 1UG6A 1VCFA 2INZA 4M80A 2VP8A 4AY7A 3UG5A 2ZZ3A 3TLQA 1LL6A 4LYQA 1HNYA 4QBXA 1SU5A 4LNCA 1JQXA 7TIMA 2GLKA 2R1PA 3SY8A 3U2ZA 1RCXB 3UG8A 1H7XA 3WLSA 1QWKA 1ALDA 3S4TA 3B9OA 2PDHA 1B30A 2WZIA 4EWJA 1L2UA 5I7GA 3VIFA 4GQBA 3B9DA 1MZRA 5DCDA 1XIHA 4AX6A 3CL7A 2I17A 1XDLA 2HXTA 4PEEA 4F2TA 1LDCA 2IKIA 2B0MA 3GG8A 1E55A 5D8WA 1HVXA 5C7VA 3BCDA 4X2RA 1IT7A 1BF2A 1QOPA 2XVGA 3WUGA 5JH1A 4UTWC 2GSEA 4JTCA 3OVRA 4REQB 4JTSA 2Y5JA 4CNNA 1JZ4A 4EXQA 4FOJA 2OSYA 5REQA 5I07A 3H2CA 4AIUA 2PI6A 4LAUA 4FZIA 1UH2A 3M0HA 3V3WA 1UD2A 1WUFA 4AZ7A 4PCFA 2A21A 2WMIA 3LBCA 1US3A 1FHLA 2VR4A 1O5KA 2G3JA 1K77A 1ELSA 3DDMA 3ZM8A 4ALDA 4EWND 1WOAA 2QUVA 4N7QA 1JXJA 2QGHA 1ADDA 4KGJA 1K7FA 5HQLA 1XQKA 2ZC8A 3GIQA 1EH9A 1XG4A 2QCLA 3ZJ8A 3OZOA 2YLAA 3QSTA 1AZ1A 3P93A 1B54A 4Z1YA 3PTDA 1VRDA 1E6NA 3UEQA 2XPKA 1JPKA 4RKAA 3KDNA 3MDUA 4HA0A 3AZRA 4U33A 3NJ3A 3IJDA 3LM3A 2YPIA 3TAKA 3WKZA 1SZFA 3CUZA 3HFYA 4AD1A 3PWIA 1KBKA 3PG9A 1DXFA 2OQYA 4YYCA 5DF0A 2WBGA 4UFIA 4PUNA 3CQHA 1EBGA 4UMBA 3GW0A 1KM4A 2QJNA 3E0WA 3AIRA 3KXQA 4JTHA 1V7YA 1B9ZA 1EA9C 1YXDA 4CD5A 3IK4A 1EP2A 3O63A 4TTGA 2OO0A 3B8DA 1P7TA 3B97A 4Y90A 4HU3A 1ZBWA 1XW8A 3O07A 4C6MA 1FXPA 2VTFA 4Z2HA 1IYXA 2AQVA 1I1XA 1CZ1A 1ONWA 4IIHA 3MJMA 5JIWA 3GBDA 4H7ZA 3PFRA 4PMQA 4QCFA 1W1ZA 3TC3A 3UWZA 2ZICA 4O1CA 3COTA 2PRHA 3NQDA 5TD4A 2Y62A 5BW6A 3OG2A 1W3IA 3VMNA 3R4IA 5A2CA 3GHTA 3C2YA 3P0XA 4F0HA 1Q85A 3G24A 4ZQMA 1HJVA 6ALDA 2VOMA 4S3EA 1EC8A 1PYMA 1L6SA 3HG5A 1BYCA 1FFRA 4S3JA 1Q5MA 2FPYA 4OZOA 5BMWA 1VBGA 3I6EA 3Q45A 1K8CA 2DSVA 3UWEA 1F2JA 4NZCA 2IUZA 3VD5A 1VQTA 4JY8A 4IXHA 6ENLA 2OYLA 4DJDC 1TKKA 1V6WA 2I14A 4A8NA 3TJIA 1QWGA 3KBMA 1NWSA 4AF0B 3NPUA 5E93A 1Q6LA 3GS6A 4PB3A 4MLRA 1VS1A 4PL2A 1A5CA 1QUMA 1XISA 1XYBA 1B3ZA 3CZJA 3M7WA 3ARUA 4MWAC 5CBJA 2G50A 3CH0A 4GKTA 1S1PA 1UHVA 3RO6A 5BCAA 3T81A 4IHCA 1S5VA 1IXNA 4ZXLA 4ONVA 4OFCA 1R3WA 4D6HA 2ZCGA 1C9DA 2YBUA 1JZ5A 4PRTA 3P81A 4KMQA 3ARSA 2DZPA 4YLWA 1M53A 3IAQA 2Q71A 2Z25A 3CQ0A 1TRDA 3PNUA 2V3FA 1PO9A 4IICA 3MUY1 3UJEA 1FWFC 1XBVA 4WZHA 1J0HA 3VYLA 4KEMA 4QDPA 3BPWA 2XVKA 2PDWA 3CV7A 3B0UX 1E0WA 2XN1A 2XIBA 3IEBA 1ISWA 2PODA 4W7VA 5E6ZA 3L9CA 4N9DA 1E5NA 3LU2A 2JKEA 1NDZA 2H90A 1AFSA 1TPH1 3UNDA 3C0JA 4GMEA 3VK5A 3NM3A 3L5AA 1FCBA 2W6RA 1Q3NA 3CV1A 3OBAA 4QX4A 3ELFA 5I3GA 3BAKA 1OZMA 4JDYA 1UWIA 4UMAA 1OSEA 3TEVA 1XCXA 4JTIA 4GQGA 2XN0A 4XZBA 1WPCA 2CHRA 2BG5A 1NDWA 5EY5A 1W8SA 3LXBA 4MKVA 2Z0IA 3WQWA 1K9DA 2HMCA 3FHQA 1KLZA 3EDDA 2QPSA 3RR1A 1EF3A 3GQYA 3ANYA 3E2RA 3LV6A 4ZB0A 1QI3A 3M0KA 2QVNA 5H8MA 2BASA 2YA2A 2EAWA 4KH2A 4KRZA 3R7MA 3LCXA 1YDVA 4WGHA 2E68A 4A35A 1GW1A 1QOQA 1O95A 2YXXA 3GD6A 4PULA 3A6OA 3PZQA 1V5XA 1XLBA 1Q8AA 1R85A 3WK2A 3VABA 3G1SA 1UD8A 2WZHA 3TSMA 4MJMA 3DI1A 4M5PA 3K1GA 1V7AA 2VUYA 2PA6A 4JTDA 4AMCA 1ZS2A 2X09A 4IPPA 3W71A 1I45A 2J13A 2V5CA 2NQZA 1D8CA 1H1NA 3VDHA 4Z2GA 2DIEA 3REQB 4Q8TA 4YN5A 1JG9A 2C1IA 1A5OC 4XZWA 3K4AA 4AW7A 2XGIA 4WLCA 1HXJA 1QHPA 3AIWA 4O15A 3N13A 2OKOA 3RJXA 2GWGA 1KM0A 4AXNA 4XG1A 3CO8A 4H9ZA 1JCLA 3HPFA 4ILSA 4ZFMA 1DIEA 3VIOA 1GEQA 5GNYA 3UFYA 5FEXA 4BQ2A 1AW5A 5IRPA 3WQEA 2J7BA 3OEXA 1CGWA 1J4EA 2G96A 2JGYA 2FMNA 1GEHA 4Y96A 5A5WA 4GRSA 1NVMA 2ZADA 3W6MA 4Q4QA 4AZGA 4LXFA 4H1ZA 3FXYA 4R7OA 1FKXA 1OY0A 2BLEA 4MNKA 2AMXA 3BG3A 3S3GA 1W5OA 3S46A 5E1QA 1UD6A 3D6NA 4G7FA 3L0NA 4GIEA 1E6XM 3T7VA 3EZ4A 4HU0A 4NG3A 1GTHA 2FDMA 1TWIA 1J0ZA 2VR5A 3KVLA 1P4CA 2SFPA 2GUUA 2VRQA 4IQLA 2HZGA 3DKLA 2DEPA 2WJEA 1A53A 3NZQA 3LEPA 1UD3A 1IR1A 4S3CA 4K1GA 4XD5A 4GUJA 5F1UA 1WYIA 3EKLA 4ZQRA 4Y8EA 2DDXA 2J7EA 4ZO7A 4GGHA 4RNJA 1XX1A 3MWCA 1K9EA 3K8KA 3W23A 1PWMA 3N4FA 5DMMA 3TYBA 1KA9F 4DO6A 4TQTA 2D3LA 1UZ4A 1I1WA 2VMFA 2FVKA 3BSHA 3IIPA 2OEJA 1Q6FA 4U4MA 3OJGA 4DWSB 1OCBA 3L2IA 4ICCX 1DWHM 1C8YA 1FWWA 2YL8A 1EPVA 3W7GA 1J0JA 3T09A 4IT1A 4NYYA 3P74A 2V2CA 4QS6A 4DXVA 3DERA 1XYLA 7TAAA 3L5MA 5EMUA 1C9WA 1S3TC 3DG7A 4O52A 3H8AA 2V5BA 2R94A 1RCQA 2WNNA 2PDFA 3L5LA 4MYXA 3UJRA 2VFIA 4MPKA 4AFYA 3WH6A 1IEIA 2J66A 2X30A 4CCEA 3HJEA 4H41A 2VURA 3N9RA 2FZ8A 3MYPA 3R8RA 2YSWA 4PRWA 1XKJA 4LY8A 2J24A 2O92A 4GGBA 2VRKA 4JS3A 4NQ1A 4OIFA 3CHEA 1E4NA 4ACYA 3M5VA 1JXKA 4AEEA 1UJQA 2QS8A 4O50A 2ICSA 3FXGA 3OA3A 4S3AA 2XIJA 3H4XA 3NL3A 2FZMA 3BW4A 3G6MA 1KXTA 4C1NB 3T1GA 2VFGA 3GYEA 3M64A 2HWGA 4O19A 3QW3A 4Y9AA 4J7RA 2IKHA 1JCMP 3W9ZA 4MDPA 4TR9A 4Y9NA 3W2NA 1JNDA 4PFMA 4MY9A 3CK5A 2ISFA 4YTQA 1LT8A 3QM3A 4WX2A 2W61A 3L4WA 3MVIA 4DZAA 3H55A 1H4PA 2PEVA 2Z7GA 1TREA 4KFOA 4S3FA 4D6GA 2C14A 4IP5A 2BWGA 2Y63A 3GZ3A 4TIMA 3UVAA 5LA1A 3S9YA 2DW6A 3PBMA 3VM5A 5M3WA 1TELA 2ISDA 1E70M 5AC8A 1FDJA 2EJ1A 3H2OA 1D2KA 3OGRA 1FTXA 1VGAA 3KDOA 3GXPA 2A7RA 2J79A 4UC5A 3L0KA 3TU9A 4LGXA 5IM51 1Q4NX 3H26A 4US6A 4V1YA 1C8VA 2EPHA 3N34A 5AHNA 3TR2A 4JTAA 1ZB5A 3XISA 1MFVA 3NPWA 3BMVA 2ZWYA 2PZNA 1RBOB 3ZT6A 2QQ6A 4HYRA 4YHGA 3QPYA 3W7KA 2Y0FA 2NX3A 4DHGA 4W5ZA 2TODA 4IIEA 3IANA 4RDYA 4XZLX 5FF4A 2Q09A 4M0XA 2BXYA 3LHVA 4JNMA 1OFOA 3RX3A 3WF3A 3LSCA 2WK2A 1M65A 3MP4A 4IP4A 2D0GA 5LIYX 3C2FA 1X1OA 3VX1A 2XSAA 1OX4A 1Q7QA 3KOWA 2AGTA 1TMLA 4K38A 3AJXA 3W87A 4URIA 4WKFA 2GVJA 2H8XA 3QQ0A 4JD4A 4HNVA 2ZE3A 3BGJA 1UQYA 3VTRA 2FQIA 4GABA 3UNTA 4IH3A 1YX1A 3W22A 4RNIA 2A3HA 5I23A 2F61A 4HCHA 4JFUA 2VGBA 4AHQA 4GACA 4PN2A 1LP6A 3H7UA 4GQQA 2J7CA 2FH6A 5HMDA 1H5YA 3P3BA 4B9ZA 1P0BA 1R3RA 3IV3A 4KWUA 2PAJA 2NLIA 3HPSA 2CBIA 4E8DA 4XZHA 3O0FA 1E4IA 1LOQA 2O9TA 4NHVA 2WHKA 4ZODA 2A0NA 1MW0A 3BGAA 5EU9A 2GGHA 1FWEC 3UWYA 2W67A 4R9OA 3OGVA 4N2YA 1TZZA 2OELA 6REQA 3HIJA 2NV9A 1IEVA 4UBPC 2Y6ZA 3W7OA 1OT2A 4AD3A 2XFFA 4B5WA 2AAAA 4WSHA 4GUFA 4I90A 2BGSA 4N6EA 1VJZA 4L7ZA 4BF5A 1FWRA 4CQDA 4ASTA 1B0IA 2KAUC 2OQHA 4ORIA 4L4PA 4LVGA 9CGTA 3O3RA 2CCRA 1YDYA 1HO4A 3A4XA 3GVVA 1VEPA 2J9XA 3EYPA 4IJRA 3C2RA 2Q02A 3F5KA 4LW7A 3W1RA 1D8WA 3Q4DA 1AW2A 4GINA 3WLOA 1KFKA 1YKWA 1Z89A 3G1YA 2YCLB 2VL4A 3RITA 3W72A 4NI3A 3W28A 4ZE4A 4JKLA 4KFPA 1WKEA 2ABBA 4CD6A 3RIKA 3VIMA 3N2BA 5C2CA 4Y9PA 3M44A 1KKOA 3M46A 1FWBC 3LCGA 2WKJA 4NAEA 2QJHA 3B8VA 1CB7B 1YXYA 4GXWA 2JGQA 3LM7A 3N2XA 4NU7A 3ITYA 2PRLA 1O66A 2GZXA 4MB1A 3KL5A 4KEVA 1UP3A 2OLAA 1AD4A 5CBBA 2PU0A 4F2UA 1Q45A 4HIBA 9XIAA 3K1DA 5FJRA 1C93A 3NEHA 5BRPA 2XUCA 4LBSA 2GGEA 4XO6A 5JMUA 1IT0A 3OBEA 2ZXDA 5D09A 4PCPA 3H12A 2G3IA 1AUSL 1RP8A 3SCUA 4GY7A 4A05A 1U5HA 1DHKA 4Y9MA 2INFA 1H5VA 1TYGA 5PTDA 1HP5A 3DFTA 5HXMA 3W24A 5C9XA 4HBKA 1EWEA 1E1EA 5E6YA 5GQBA 2J25A 4ADSA 4CNSA 1IEXA 4HU4A 2WSYA 1F4AA 2R9RA 4JQ3A 1EXBA 3O7UA 1WXZA 1UIOA 3UW6A 1MFUA 3S6TA 1XGEA 5BU9A 1XYFA 3ITXA 1KTNA 3UY7A 1US2A 3ES8A 2JIEA 1SR9A 3EXSA 5F7UA 1DEDA 2A7NA 4POCA 4WD0A 3OIHA 3Q65A 1M7JA 3TTQA 3RO8A 2TSYA 2EGZA 1UKTA 3M9YA 2NX9A 3BLIA 1JFXA 4XK2A 1W3LA 4ORMA 1DQUA 3B05A 4DXXA 3WLKX 1L6GA 1VRXA 4ZO9A 3AMCA 3PJUA 1B4KA 1W3HA 2FTYA 1JDEA 3BOFA 1SFJA 2PGFA 1ITCA 1S1RA 1J79A 4OJYA 1R3SA 3T42A 6XIMA 3GNNA 1NM9A 5G4WA 2H9AB 2ZRUA 3WZ0E 5LNUA 1ZAJA 4WK9A 3T78A 1EUNA 2GGGA 5ABGA 4ZEPA 2YL6A 1Q6DA 1GNXA 3ARQA 3AWOA 4S23A 4Q7IA 1PHWA 1T5AA 1CNVA 3DC8A 2CFFA 1W1YA 4D6CA 1AVAA 4ZR8A 3CAKA 5A6KA 3WQOA 2YZRA 1S2AA 2PU1A 4HT3A 1UR2A 1XIIA 4TTUA 4L61A 4NZ4A 1QI0A 3RCMA 3STGA 1W1IE 2NVCA 2RJHA 3TROA 2X1TA 3DKJA 2YIHA 3L23A 2ACUA 3BURA 4JFWA 1OINA 2CLIA 2VUNA 8TIMA 4BA0A 1ZP3A 2PSNA 3CZEA 2BDQA 2D24A 5EPDA 5KEZA 4PUJA 1GG1A 2C15A 4ZENA 5KZDA 5HDRA 3MO7A 1OCNA 3OU8A 3NQEA 3L0GA 1T96A 1PZ0A 1F3WA 4GJIA 3S5OA 4MF4A 1YADA 1XD1A 4NI8A 4AC7C 3KP0A 3TWBA 2PTWA 3ABQA 1M04A 3P67A 3GR4A 4FSAA 4O1FA 1EJSC 3KM8A 4ZVJA 3M47A 2AKMA 2PLKA 4LVDA 3A4WA 4V1XA 1EXPA 4UNIA 3DBPA 1J01A 3TW6A 5BNKA 3G3MA 4J2MA 4H9MA 4S2CA 4YJ5A 4M1RA 3NL6A 4PUKA 4Q8QA 4DZ5A 1PZ1A 4KESA 4J3SA 3BMWA 3OHIA 1IZCA 3H7VA 3MUIA 5G2IA 5L9FA 1NIUA 3JVAA 4HSNA 1P0NA 5BZAA 4DJDD 2V0TA 1ITQA 5A6TC 1NOUA 1GGOA 1M7XA 1D7KA 1YDOA 3DEQA 1MSSA 3DBNA 1AJZA 1I4NA 3AO0A 3LHUA 2QCHA 3N2MA 3LERA 1RV8A 4X0VA 1WDQA 3VCCA 5LHEA 1XUUA 3P6LA 2QPUA 4QJ5B 3LOTA 2BHYA 4IQDA 2WC4A 4AVFA 3IGSA 4DBSA 2OEMA 1ZGDA 2E8YA 2I9EA 3JRKA 1FWTA 1XDJA 2YOCA 3PZIA 4W87A 5C55A 4FX7A 4BQ5A 2YLLA 3GC2A 4GO9A 3FJ4A 1R30A 1OX4B 4A2SA 3IIZA 3CM4A 4GZ7A 4A21A 1PJ9A 3T0TA 5IDZA 3FA4A 4RR4A 4AMAA 4IG2B 3NQ8A 1L8PA 1S5WA 1OF6A 1E51A 1WP6A 3D3FA 3GG0A 1TWSA 3CB8A 1FCUA 5KINA 3UZZA 1JUKA 4OE7A 2FGLA 4L9ZA 3CYJA 3V5FA 4S3GA 1VFSA 1EA0A 2PWEA 4CEUC 4WJ8A 5M17A 4JQAA 3WBEA 1ME8A 4MUPA 1JCTA 1F3TA 3GBEA 3H53A 3QF0A 4LB3A 5A8NA 2YW3A 3P5ZA 4HSOA 4B90A 3V75A 3GHUA 1WAUA 4N9EA 2QZRA 3N4EA 4AD5A 5IBXA 2IXVA 3O6DA 2UY3A 3FS2A 1KRBC 3TQPA 3UCQA 1W3TA 2CZFA 2PPGA 4HTBA 1Q6CA 2FPVA 1G6CA 3B8SA 3VOGA 1V08A 2FHCA 3E1F1 2CLMA 4XBKA 1QO2A 6A3HA 4LRSA 4NJIA 4EF8A 2OLHA 4YMZA 4LAKA 1TV8A 2CZVA 4HOXA 3AUOA 4AQLA 1ODZA 3O6AA 1NQ6A 1FWSA 3G1HA 3N3MA 1OC7A 1ZJAA 4LBRA 1ZSXA 4AVNA 2QAFA 4DELA 1QI5A 2REQB 3N25A 1VFUA 1P6CA 1MYRA 3ES7A 4JQ4A 1MVYA 3WL0A 4PEKA 5I02A 3QC3A 4E5TA 4B4HA 3W1LA 1GPFA 1BXBA 4U2YA 1XXXA 1Z48A 4EOUA 3IAPA 1QPNA 3W6LA 1S2WA 4LS2A 1X6LA 2NQLA 2ZRVA 5T91A 2WKGA 1ZJIA 1K7XA 4RZBA 4AD2A 3A9BA 1MUCA 4L65A 1PCWA 1L0PA 2QJMA 4CQ9A 4OHQA 5DBUA 2FH8A 1AH0A 4B3ZA 3QQWA 2CBUA 2GJRA 2XIQA 8XIAA 1X97A 3MWAA 3NFUA 2A3EA 2ONEA 1F8MA 2W4XA 1SFLA 3HQNA 1HP4A 4EAMA 3ZXWA 1VB9A 4C6DA 1MNZA 1MW1A 2IPWA 3QR3A 3JS3A 3KS6A 2FJUB 1DWAM 1XGDA 3PK7A 2CETA 3WX7A 1QJWA 4JFSA 3GXMA 4HA3A 4KF1A 4ZE5A 4R3UA 1UKPA 3ABOA 2QDEA 1K1DA 1OCQA 2ZUUA 3SUVA 1MQPA 2X42A 2GFTA 1OEPA 4LC8A 2JBMA 3GUWA 5LZLA 4OWGA 5FSEC 4AHPA 5AB3A 5F2LA 1IWAA 4D6EA 3MI6A 1CLVA 2AMGA 2CEQA 2Y7FA 3OO2A 5U7SA 4OV4A 1T0OA 4IMAA 4W85A 1VBHA 4GY1A 3IUDA 4MG4A 4CQAA 3MQTA 3PWAA 4H7CA 4AD0A 3ATYA 4JPGA 1F6KA 1F6YA 1L8NA 1XS2A 4U2ZA 2Z1XA 2HDJA 3WIJA 1IHIA 3QC0A 2FHBA 2P8BA 1MEHA 1VBRA 1EEXA 2WSKA 3A24A 2EBNA 2QDDA 2WWCA 3G1XA 3F2DA 3W84A 4GD0A 5AKQA 4CNPA 3VU2A 1BVNP 4GZIA 5GPRA 4LOCA 3WUBA 4CCDA 3QMTA 4P8WA 1CDGA 3DYOA 3F4NA 3BAJA 3W27A 3LUTA 3RF9A 1B1YA 3FJNA 5K9CA 3LA4A 5HK4A 1QU4A 3UG3A 3LLDA 2WPGA 1EJXC 5AVNA 1RH9A 4EP8C 1TR9A 1TJ2A 1TWWA 3NXLA 1G69A 2VX7A 3VZZA 1OADA 4IQJA 1TPDA 5D38A 2VC7A 3K2GA 1ZRQA 2ZTJA 2B31A 3NA8A 1TTJA 3HFTA 5HUPA 1UPPA 3INPA 4AF0A 1JQVA 4W4QA 3W2KA 1QPOA 1GW9A 3PF3A 5FIPA 1GOQA 4K68A 3USBA 5CG0A 4FF7A 3CUGA 1VKFA 2JEQA 1LOSA 1K3UA 3URBA 3IK2A 3LI0A 3OBKA 1OWQA 1NP0A 2QCMA 3OODA 4UNLA 5C9WA 2PDNA 2BGQA 1LQ0A 3SIZA 5LYRA 3NAVA 3NPXA 1U30A 3OLEA 4YVXA 3TCSA 1W9VA 4ACZA 4HMNA 2WVSA 4MMWA 5A8MA 5LHFA 4FX8A 3SQMA 3W7RA 1BD0A 3WBXA 1JDFA 1J2BA 3BLKA 3ZR4A 3EX2A 1BYDA 3B0YA 3F2CA 3FY1A 5A2AA 4DF2A 3NYZA 2PWGA 1B3YA 1I75A 4EACA 4R33A 4Z2IA 1FHDA 5I06A 1FH8A 4TX9A 2XJ7A 3SCQA 2X41A 3POCA 3TXZA 3KAOA 2WSPA 2OTDA 2XN2A 3V36A 2BY1A 2A7PA 3T8QA 8A3HA 3QZEA 4FAMA 3LXAA 4GISA 1YMYA 3CS2A 1Y5WA 3WUFA 3RFAA 2WJZA 1ZAIA 2VZOA 3I4EA 5EMYA 1KFLA 1YIXA 1OF8A 3W02A 2YBVA 3U8GA 4F79A 3WFLA 1GORA 1HW6A 4ERIA 5AYYA 3BLLA 3E0IA 2ZXBA 4E4FA 3VNYA 2DZVA 3LMZA 4LPCA 3SGGA 3M0YA 3GHSA 2PZ0A 2I9UA 3IGUA 2R24A 3FLUA 3RCYA 1MEWA 3QGKC 1AJ2A 2E1DA 1XL9A 3ISIX 4NSBA 1WV2A 1JYNA 3HOJA 2VFHA 2NW0A 1WX0A 4DM2A 2BVDA 3DHFA 3K5XA 5HBFA 1E3ZA 1M7PA 3TN6A 2VGFA 2HVNA 2UY2A 2J7HA 2AAMA 3WDJA 3AALA 3OOQA 3ONCA 4AZCA 2XFWA 4TVDA 2DUAA 4HZMA 2XSXA 4RPPA 2PE4A 1H60A 3O05A 4HN8A 2J74A 3UPBA 2GPTA 5CXPA 1TCDA 3PTKA 3WQGA 4DRSA 3WO8A 1BSLA 4DYKA 4UFJA 3HB9A 3ARRA 4Z17A 4G56A 3CO4A 2BVYA 1GZGA 4XV0A 1DQWA 2YCJA 3OZMA 4G7EA 4CNOA 1W32A 4GKLA 5AZ0A 3MC5A 1IEQA 2BVWA 5DT5A 3GC4A 2J77A 3BDKA 1FWNA 3T0CA 1GK8A 3W7EA 2D2OA 3M0JA 1PX8A 4HHMA 1VFFA 2V5LA 2WBKA 2F38A 3GUGA 1X39A 5A95A 1NEYA 2DZWA 5IBXC 2XINA 2VEMA 3LHTA 2OGYA 3GWQA 3S2NA 3LCHA 2PF8A 2ZUNA 5A6SA 1S3HA 1M41A 3WK3A 1XLGA 1UMYA 2J7FA 2OPJA 3FAXA 3PWGA 5AECA 2WZTA 3ZT7A 4QXIA 3HGSA 2NQJA 2LLEA 1WKFA 4JHOA 4O11A 1XLKA 2PF0A 5GJMA 1RY8A 1EJ7L 3GU2A 4GFIA 4MKNA 2ZWZA 2V8ZA 2PDMA 4US5A 3MYOA 4Z42C 1SW0A 3S9IA 3MUXA 4RXFA 3EEGA 3G2GA 3RPMA 3MTWA 2Y7DA 2JK2A 3N17A 3NQMA 3ORWA 3TYCA 1PVNA 3I3DA 4J3UA 4JIHA 4QNWA 1PYFA 2I57A 2P53A 1A4MA 2Z27A 3GVWA 5EKYA 3A64A 4IUGA 3KS5A 1A0EA 3HM7A 4HA4A 1Q6RA 3GNDA 2CKSA 3ICJA 3V0TA 5LA0A 3UWQA 4F9DA 3LQLA 3N2TA 5HMEA 3GR8A 4Q32A 1GVFA 3MSRA 5CC5A 5EGRA 3B3DA 3QR1A 3N1AA 3TSDA 3HQPA 4H9TA 3USZA 5A6BD 1ICPA 2A85A 1FWCC 3AYSA 5KZ6A 1KD0A 5AN7A 3TZFA 5CPSA 2DORA 5CGMA 4Q22A 2ZZ6A 2F2KA 4MZYA 3WH9A 3LCLA 3AS3A 3H21A 4P7RA 4PUMA 3SCVA 3MS8A 3WLTA 4C7DA 5DMYA 4TV6A 4QROA 2VD9A 1DJQA 1D9EA 2XZ9A 4U28A 3I7SA 3S1UA 5FJOA 5F1VA 3KOFA 3LS9A 5I79A 2Z1VA 4EANA 3OVPA 4M7SA 4GNVA 4UTJA 5LNVA 4CN6A 4NNBA 2OKTA 3P7YA 4IMFA 3L4TA 4RV8A 3KUMA 4EF9A 2YX0A 4HGXA 3SCSA 2FVMA 5K9DA 3NWRA 4LUJA 3ABRA 3SR7A 1ZJHA 3FK4A 2GQ3A 4LANA 3TYZA 4ZQCA 4DM1A 3SUUA 4PZVA 3N11A 3THAA 4O0KA 5EMMA 4C6FA 3S2LA 3PUDA 2VEGA 3CUJA 4LQ1A 1KRMA 2OWXA 1L6FA 1JYWA 1UKOA 3M0LA 3PAJA 3U3HA 1EO7A 2ZZ5A 5JBDA 5LXEA 4UQDA 1W9BM 2WM1A 1OBAA 4RUBA 3QPEA 2NUWA 3CEUA 4LF1A 4C5YA 1E1CA 3EAUA 3QKZA 4B5VA 1VIWA 4KWOA 4HPHA 1FRBA 3NQVA 3BAIA 4Z2LA 3SFKA 5G1YA 5HPCA 1RCOB 4XUGA 4RLIA 3S5ZA 4N4QA 3A9IA 2JALA 3UF9A 1DXIA 1OYAA 1TPFA 5LSMA 4JYDA 1GPWA 2OWCA 1RD6A 2DIKA 1VFHA 1XG3A 3GLCA 4L4MA 1TX0A 3NQFA 3W7NA 2ZX5A 4I9AA 2GSJA 3GG1A 2Z00A 3R5EA 3URAA 3PPHA 4YTTA 4UWMA 3TC7A 4FO4A 4KGLA 4XQ6A 2WKLA 3W37A 3ZYZA 1ZCCA 4HMEA 4U10A 1JZ2A 1XLDA 1T41A 2UY4A 3BOXA 4PODA 4PTDA 1VHNA 3W25A 4B92A 4V2XA 9XIMA 1Y65A 4ML4A 3H4GA 4I3GA 1U1HA 2WMKA 4S39A 1V3JA 5AY7A 1DL3A 4LEFA 4FR6A 3VGDA 4DY1A 5FL0A 4K39A 5REQB 2W62A 1DJIA 1TA3A 3WD4A 4C6EA 3CQKA 4JOMA 4XO7A 6TIMA 4AB4A 3QYQA 2CIPA 3PUGA 2V5KA 3R10A 3B8IA 3E2QA 2OEKA 3PBUA 2G97A 4C7GA 2ZVIA 3TJLA 3DIPA 1QCWA 1KFCA 1V8EA 3NUKA 1XKYA 5CJMA 1A49A 3QQ1A 1GQKA 1JJKA 4MB3A 2E28A 2B7OA 2TPSA 2FVLA 5EMJA 3FIGA 3AZTA 3WBYA 2FTWA 4IM4A 4IISA 3ABZA 3TLLA 4P5UA 3P14A 1FWJC 1UMLA 4H01A 3NQAA 1QR7A 5JU6A 1HO1A 1ECEA 3QOKA 4DF0A 4FIRA 1R7OA 3TNBA 4J2PA 4XBSA 5U4NA 3LG3A 1EGZA 3N3TA 1EC7A 5M5DA 2DSZA 4XKMA 1R9XA 3GRIA 2P5NA 2PURA 2WMHA 5BYWA 3WQ6A 4TMBA 2GUBA 1WOBA 4UQCA 1K02A 1J96A 3ARZA 2C0AA 2HVOA 2I1OA 2QCDB 1OD0A 1GOMA 3PY2A 3GK0A 4TVCA 1L6YA 1GJPA 2C1GA 1BFNA 1XJBA 2F6KA 2PTDA 1QDSA 4P7QA 3TA6A 4GG9A 3R0DA 3ARXA 4FNUA 1KFJA 3QEZA 3R8GA 2WOQA 3GFXA 4ZZ9A 4BI7A 3NGJA 4O53A 1E56A 5A69A 2RGLA 5LIXX 3CMJA 3STFA 2OB3A 4E2VA 2BHZA 5E09A 1Y5VA 5D9NA 1OK6A 3KVKA 4TX6A 4ICNA 1CGTA 3F03K 1RVGA 5CAKA 2NZLA 1IE7C 1DXEA 3A3HA 3QFEA 1EYWA 3XIMA 2WCSA 4IUOA 1NWRA 4DWDA 4LF2A 4B5TA 2JQXA 4DIAA 3DXIA 3W75A 3VFLA 3NQCA 3PANA 3LBMA 2ZUTA 6CGTA 4GYPA 4YXGA 5A6MA 2VOTA 4RE3A 5FA5A 1WUEA 1FA2A 2B7PA 3FKRA 1WXYA 2EPKX 3DYPA 4OBSA 4GIRA 3BC9A 3HQOA 1GCYA 1ZP4A 1RK5A 5G1TA 3AMLA 4G8TA 3GU9A 2TAAA 1TCMA 3VDAA 3RU8X 4H3DA 1V93A 4LCRA 4O16A 4ECLA 1EHAA 4DXKA 3VKKA 2XVPA 1DPMA 4FPSA 2D3NA 3UWUA 3SEPA 5I3HA 2E6YA 3RMEA 5GNZA 1VEMA 1PTDA 5LIUX 4D8ZA 3MI3A 1JZ8A 3PZUA 1NWTA 2VCBA 3AMKA 2WVVA 2NVDA 2X7WA 3RUBL 2ZXAA 3NQ2A 1CTNA 3PZ9A 2Z1WA 2ATMA 1Z7AA 2BVTA 1F3XA 3N6QA 2YBTA 4BKNA 2G0WA 1H09A 2PBGA 3ID7A 4MWAA 2WB5A 3ALGA 3GDKA 5AC7A 1VC4A 1Z44A 1QBBA 4HU8A 2JKPA 4NZFA 3SCOA 4GUGA 2PTXA 3O06A 2UV8G 1H7WA 1Y5XA 1H7NA 3GKAA 3J7HA 3VGFA 4Z1DA 2BOFX 1JULA 3W1XA 5DXYA 1WO2A 2B7NA 4RPQA 1IIGA 1A5MC 1G4TA 3KLLA 1EZ2A 1GG0A 3QZAA 2V68A 2VC5A 4QR6A 1G7UA 2EG6A 5KTLA 2VFFA 1OGSA 1W1TA 2OMAA 4LYKA 1AD1A 1W9XA 3FKKA 4X63A 5LA2A 1E0UA 1HKWA 1PEZA 4REQA 3EXRA 2YDSA 2Z2UA 4LRTA 1C8QA 4OQVA 3KOZA 4JYFA 4O28A 1IR2A 3AZSA 1K8YA 1WAWA 3GVGA 4FXSA 2PMQA 3T4WA 1EX5A 4C5ZA 3A3WA 2EPLX 1BWKA 2NUXA 1KCZA 1IWPA 3RNDA 3LENA 1XWYA 4A29A 1AG1O 2QYGA 4FNRA 1PAMA 4LU0A 2IXUA 4H83A 2DJXA 2EPOA 2H8ZA 2X2YA 2FB3A 3DN5A 3W74A 5HA7A 4XD4A 1VYSX 3O8AA 4NZJA 3M43A 3BMXA 2XDFA 1H62A 2WVVB 4WXYA 4Y2WA 3UXIA 4QGCA 4HYWA 2HS6A 1ZENA 2GVEA 5H2ZA 1W54A 1XUZA 3PVFA 4Q33A 1NQKA 1SSDA 1EF2A 3AFBA 4UTTA 1QVBA 4W8AA 2WQPA 1O1HA 2D2HA 3FSTA 3FYPA 4P8VA 2HNHA 1SM9A 2CKRA 2E0PA 4NILA 1IQ8A 3AMGA 1QPKA 2CZ5A 2RFGA 1GYNA 1TZ9A 4FOKA 3MKKA 3KRBA 1DQXA 1PKMA 2FFCA 3MMDA 4NRSA 2HBXA 4KEUA 1HF6A 2QPXA 4KEZA 4XZIA 1Z9AA 2O9OA 4UZUA 5BOEA 4Z2JA 1DYSA 4C6QA 3HG3A 3CUFA 4JQ1A 3MI2A 1K4GA 2OOGA 2PTZA 4X2PA 3E5PA 5HINA 1ZBKA 3IJ8A 2QGYA 2WJFA 1R3QA 4LBUA 1E40A 1F4HA 3SCWA 4IPLA 3RR4A 3E6EA 1G94A 2PGEA 1NOFA 1R7AA 3GTHA 4O1AA 4RCXA 2VQTA 1TSIA 3R0UA 1Q7ZA 3RAOA 3EX4A 5D9OA 1K4HA 5A8QA 3F2BA 1I9CB 4CLMA 4ZO8A 4LUTB 2W91A 3SECA 1VCVA 5TBOA 4PCSA 3D47A 3PUOA 3QSRA 3WH8A 1WDRA 2QUMA 1PXGA 1REQA 4GZEA 4H9YA 2ZZ1A 1QHZA 1A5UA 3AHZA 1JL8A 3GIPA 1GYLA 2ZQ0A 3SCPA 1X98A 2OX4A 5FF2A 4LYPA 3LDVA 1EBHA 2OZ3A 2H6RA 1P5BA 3W70A 1OG6A 4MTVA 2GVYA 2VC6A 5TIMA 3TOPA 1IV8A 1GJWA 2D73A 3A12A 1E9IA 4LUYA 3VO0A 3BCJA 2R8WA 1MDLA 3KL0A 4FB7A 2WO5A 1S39A 3KZPA 5C7HA 4NJKA 3IUIA 1JDAA 4XKYA 2R1KA 1QNPA 3I3EA 4L6DA 1S5TA 2X2GA 4IPJA 1EHNA 3SN0A 3UBPC 3EX3A 1KBJA 5F4SA 1BTMA 2PRMA 3M0ZA 5JBFA 1R8LA 4K8GA 4XKYB 2FIQA 1J6PA 4MNLA 4DO5A 1AL8A 1VPXA 1GVOA 3QFWA 1GHRA 3OP2A 4D9PA 1AK5A 3WELA 1XF0A 4QEHA 2PC4A 2Q01A 3TKFA 1TIWA 1OFDA 3QJAA 5HMFA 1R46A 1V3IA 1DBTA 1TV2A 5HAOA 2YR1A 1SO3A 2POZA 3DC0A 3MZNA 3SCNA 4K1WA 2YCLA 4HOZA 3PBVA 3P2VA 5DRCA 1G7VA 3TW9A 1D3GA 5C2XA 2VJXA 3T4CA 3W7DA 3WMLA 1PX4A 3V16A 2F2HA 3TN3A 1THFD 1ONRA 4BCEA 4WSKA 3KCOA 3SRKA 1W56A 3K8LA 1JGMA 5ENLA 5CLWA 4EPBC 4Q6JA 1GQJA 1TO3A 5I3IA 2JFEX 2HCVA 1B90A 5HQMA 4AY1A 1J6OA 2P8CA 1VHCA 4IWWA 1A5KC 4UQBA 3NDZA 1ISZA 1OVDA 4V33A 5I3DA 4QLLA 4HYVA 1F5ZA 4GJ1A 3EOOA 1HL2A 1CEOA 1Q2RA 4WF7A 4GBUA 3M6DA 3CMFA 4D2JA 2QT3A 4Z1CA 1JDDA 4C6PA 2WMJA 4RNHA 2HXUA 2CBJA 1N8WA 3TQKA 4DUWA 2Z1SA 2BSLA 4W8BA 2CLEA 4OT7A 2DQWA 3R2GA 5LGZA 3M5ZA 2CHOA 2HS8A 4QQ3A 5D2TA 4KETA 5K7JA 3Q94A 3ZWSA 3NYDA 5DBTA 3UJ2A 2BTMA 4S3BA 5I0DA 3LLXA 3WLHA 4DO7A 4UNKA 1JZ7A 1OQFA 4E2BA 4JEJA 1W5QA 2QUUA 4RE4A 2ZX9A 1E6SM 3ARTA 1I2RA 1TTIA 4JR5A 1AQMA 1H7PA 2KZHA 3FYYA 2ZZ7A 5TAOA 2DZAA 1JVNA 1GOOA 3AICA 4HNNA 4WKAA 3S5SA 3GE7A 1LM1A 2Q8ZA 4J3VA 3P8IA 3MANA 3VUSA 1XSJA 3GG7A 3LHWA 1JGIA 3KX6A 1RY0A 4U5KA 5FJPA 4JHZA 5LKYA 3UWVA 1AMKA 2EHHA 1YPFA 5A6BA 3GY1A 3UZYA 3CTTA 3MB9A 5AYXA 3WN6A 1LT7A 1TRIA 3FGCA 1UJPA 3NOYA 4MLJA 1NDYA 3IS4A 4FNSA 3HMJG 5A94A 3NURA 4Z1BA 1XICA 4CGTA 2EPNA 1IZJA 5CQ1A 3T08A 2HNEA 4UTWA 1SFSA 1YE6A 2VZTA 2VZSA 3MJYA 1DJXA 3IJLA 3H24A 3TN5A 3WG6A 3CIXA 1R6WA 4NX5A 4ROPA 1PKYA 2O4QA 3WL1A 3WNNA 2PTYA 1DJHA 1UKQA 1EDQA 3KRUA 1GONA 1IXOA 2ZUMA 3AXIA 3NQ6A 3URQA 3LNPA 1J11A 4I7WA 2W9MA 1JEZA 2O9RA 2QV5A 5I2UA 1CENA 2G3NA 1QW9A 1S5NA 1RXOB 1DJZA 1V02E 4Q4SA 1MI3A 3GC5A 4CCZA 2BOEX 3H54A 2DPEA 1YRRA 1XLIA 1UUQA 1OFEA 2PC8A 1WNOA 1F61A 3MBFA 2ZFAA 3KTSA 2QCEA 1R2TA 4B2DD 3WDPP 4EIVA 3W7HA 4JICA 3BLPX 1RQEA 2PLMA 1P6BA 3W88A 3N6HA 4F9JA 1J0IA 1W2PA 1TPB1 5I77A 4L1XA 2OGJA 2R1MA 4L1WA 1A5AA 5I3KA 4MJ2A 1HJQA 3OTRA 4JTLA 4I8YA 2O9PA 2VEKA 3EWCA 1UR0A 4BJHA 5HWNA 4AD4A 3QYSA 4PUWA 4FALA 2V5DA 5J5DA 2P10A 3T0AA 3T40A 3QVQA 2A3AA 1GTEA 3EWYA 3NCOA 1EL3A 4GCXA 2HE5A 3KTXA 2RJGA 1HUVA 4S38A 3DH7A 2DH2A 1RQHA 3ZS4A 2CW6A 3SBFA 4Y6GA 1VP5A 3EPOA 4X9YA 1X38A 1MW3A 3PAOA 2GGJA 5DY2A 3S83A 2QCNA 1XYMA 3KBVA 1KBLA 2WNWA 1XYAA 5BRQA 1W6TA 2ABAA 3AS1A 2E3ZA 4FIQA 2GJXB 3M0VA 4OGZA 1ZJBA 3KHDA 4GOAA 1KLYA 4GVIA 5FOOA 1JFHA 1FDZA 5M2FX 3CJPA 4WDUA 4CQCA 3G6LA 4PMDA 5D02A 1U1UA 4JBRA 2EG8A 3B9EA 4JIIX 1FWGC 1H41A 3L12A 3F4VA 1W17A 3PBYA 1CLXA 4XTDA 4MAZA 2DZSA 1KCKA 2J7GA 5I03A 1MUWA 2B7QA 1XC4A 3EOEA 4INFA 3S6DA 3L4YA 3MO4A 4B5UA 4PSRA 1ZZMA 3BXWA 2D2GA 2NV1A 2E40A 4CNTA 1O7AA 2YDAA 4J40A 3W76A 3W7IA 4B4FA 3TW7A 3AHVA 3U5YA 4ZCWA 3WLNA 1O1ZA 3FGCB 1CW2A 1UOZA 2WAGA 3FVMA 3G1FA 4OECA 2VWSA 6REQB 3W7JA 5CH9A 4J28A 3WMSA 4KWVA 3CV2A 1H7RA 4Q4KA 1QHOA 2OCZA 4JFTA 4OKDA 1JRCA 4H2HA 3UZJA 5ECUA 1L2QA 4NZ3A 4IOTA 3UPMA 1C3FA 4Q8WA 1UYQA 1SO6A 2O7SA 1EDGA 1TUXA 1V0NA 2C16A 1KGXA 2DT1A 4J27A 4NJJA 4M56A 1QXLA 1KCXA 2XZ7A 3NNTA 3BV4A 4O12A 8RUCA 3BSGA 4ZB2A 1GVSA 1E73M 3VCRA 1QOXA 1R87A 4XAGA 1K7EA 4IX0A 4IGSA 4M6QA 5HNTA 2Y70A 5T9BG 4F8XA 3EWUA 1CIUA 1EC9A 2VDGA 1O5QA 4MWAE 4DYEA 3RK8A 4HB7A 4N9BA 3H2FA 3SCRA 2UWFA 1XLLA 2O55A 3ZJ6A 3MV01 4GI4A 3V1PA 4RW5A 5DY3A 4AEFA 3SB0A 2WXDM 2XG9A 1AL7A 1KXQA 4GC3A 3SUWA 2UY5A 4MNMA 5KZMA 2GWNA 3N18A 1CGYA 5T26A 4PCTA 3ITVA 1IWBA 1QNVA 4RNFA 3FJ6A 4AZ6A 2GYIA 2OJPA 3NIYA 3L67A 2YYUA 1HKJA 2BZNA 3GH7A 2CLOA 2CNCA 3B8TA 2X0HA 3TX9A 1N2VA 2FZDA 2YCKX 2VENA 3B4UA 1H63A 1Z32X 3G1RA 4F48A 1SJBA 2EEXA 4MY1A 2C19A 3TYUA 3WJSA 1I2NA 2VM8A 5JBEA 2CWNA 3KOYA 1OT1A 1LG1A 3EA2A 3I7RA 4US5D 3W4RA 4O4WA 4RDZA 4JL2A 3YPIA 3WENA 1QO5A 3LN3A 3T0BA 4P7NA 3I7QA 3BW2A 4MJZA 1BSIA 1Q6QA 2GK1A 1VJSA 3AJ7A 1G4SA 3RN6A 3OVQA 1KTCA 1F74A 1YHTA 2QVHA 1CGXA 1RBLA 3KFTA 3QV6A 4ATLA 1FVPA 4DJEC 3CWNA 2NUYA 1GQNA 4J3XA 1W31A 1CB2A 1H7OA 5DEZA 3W3OA 2D0HA 4DWSC 1X7IA 4AWTA 3ZR6A 1R2RA 1WBJA 3P84A 3PHAA 1XIFA 3CWOX 4E0CA 1YQ2A 3DFNA 1V0KA 4ATDA 4NAFA 3NDYA 2ZUWA 1US0A 3EB4A 2ZYFA 3O9NA 1K6AA 1WXJA 4HVXA 2ALDA 2QEZA 3QOMA 1CXKA 2E6DA 2KX9A 3ZR5A 2ACRA 1UZHA 3CLMA 4QAIA 3QH2A 1T99A 4JAWA 3CL8A 3PB2A 1EGVA 4IL2A 4D1IA 1PTGA 4IIGA 4W88A 2YDQA 4TXEA 1WDDA 3WJWA 1UB3A 1F73A 4W93A 2FZBA 3EDEA 3V35A 4GNJA 4ZSTA 3MDWA 3G0SA 3PZMA 1OCJA 5I5RA 3WD2A 1B3WA 3GAYA 2DVXA 4NRRA 3R79A 3NOEA 4AWUA 5DMLA 2VRJA 3G18A 3SDOA 3VKJA 4QQUA 5E9XA 1TVPA 2XH0A 3PZVA 3L2LA 4EK7A 1LOLA 3ZIZA 3RX2A 3F5JA 4AXKA 4XSMA 5EL1A 5EBAA 4ACZB 1M03A 3QTPA 4DYJA 5TNVA 9RUBA 4IQEA 1PX3A 1BLIA 4PMRA 3TWAA 1UWSA 2WMIB 3U4AA 1C7SA 2IQ0A 4O0ZA 2ZA1A 5CPMA 2V82A 1SQ7A 4ADTA 4DLFA 4QDWA 4C91A 4DUOA 4QDMA 3OIXA 1BTCA 1E5JA 3FAWA 1EOMA 2X0SA 1KQYA 3LRMA 3PM6A 2CLPA 2XIOA 3WF0A 1SZEA 4WDTA 4C6IA 3IRSA 4Q4PA 3LGGA 4D72A 1R3VA 3RPTA 1GKRA 3TTOA 4XD3A 3UETA 1S2CA 4GA8A 4I8DA 1M68A 4A8IA 1T40A 4LS0A 4CVWA 4JGDA 3CIVA 4DZIA 2O0TA 4HSHA 3VI2A 4JEQA 2IW0A 3P60A 3WLPA 2CLHA 1W0MA 3U48A 3OLGA 2ZA2A 1VIZA 3TIMA 1W8GA 5AVHA 3K8MA 3BAWA 3SM0A 4HPXA 2PD5A 2P1FA 1DHPA 2ZKMX 1HZYA 4B16A 3P80A 3A47A 4L5ZA 1K9TA 2VR2A 1E4MM 4GX8A 3GX9A 2O56A 4JTJA 3WMCA 2VT0A 4QJ4B 1O5XA 2R82A 3PP7A 1KBBA 4J35A 3S1GA 3WNKA 3SADA 3UXKA 2ZDRA 4DAFA 1CGUA 5HR6A 4F40A 3BG5A 2CERA 4HPNA 1NOWA 4JIEA 2GL5A 2WSQA 5MF5A 1OM0A 2GSHA 4R88A 4JX5A 4QSHA 1VAHA 2Q3RA 2YFOA 3QHOA 1JYVA 4PMXA 4R85A 7REQB 4FMVA 3BLDA 4LJ3A 2ZX6A 4JTEA 1MW2A 4PYSA 4X9SA 3RLUA 3KEHA 3CAQA 2CESA 4JFVA 4M3PA 3DZ1A 2D69A 4AHOA 1P0KA 2J7DA 4K3ZA 2VNCA 4KERA 2HPIA 4FR1A 1FXQA 1N8FA 4TV5A 1DP0A 5FJUA 3GXDA 1RHCA 5DT7A 5K4XA 1DWFM 5FF7A 1F8IA 3HG2A 1OD8A 4GBDA 2ALRA 4QEEA 4AYSA 3WLMA 1DE5A 3G77A 1ISYA 4GYJA 4M6PA 1LROA 1YNYA 3CYVA 3F4DA 2G37A 1UBSA 1EYEA 1OYBA 1V6TA 1SJCA 3I65A 3S1XA 3GKFA 3H7RA 3STEA 3WQ4A 4GIYA 2Z28A 4GK8A 1S2VA 5AHIA 3QXBA 4UTHA 4M7TA 3E38A 2X1UA 4HMCA 5GNXA 4LT9A 2XH7A 4LAOA 2GVGA 3QY6A 4PUEA 2XWDA 4I5UA 4O17A 4QG8A 1LL4A 4JNZA 1H0GA 1TWZA 3LY0A 1UWQA 1LBMA 1M3UA 1VLWA 1WZMA 3VMOA 3VM7A 3F4CA 4G7EB 4NF7A 2HRWA 3WF4A 1C29A 3C3UA 3HN3A 4GH1A 3S47A 2R91A 5BU6A 2VHLA 3APGA 1BRLA 4HNCA 1R5YA 1Q2SA 5AC5A 4J3TA 3FOKA 4UOJA 2QXWA 2Z29A 4H8NA 1N82A 3TJ4A 3EKZA 4K7YA 3WD1A 2Z24A 4WGXA 5F4WA 5M1TA 4TX8A 3OLDA 4IMGA 3OW1A 3BO9A 4P7LA 2HTMA 5CPOA 4PGLA 5FF3A 2F84A 1GKQA 4MZ1A 5I6SA 3LSBA 2GQ9A 2FGBA 1UPMB 2DP3A 3C2OA 1LJYA 3G1AA 3UWWA 1LZOA 3CAWA 4JN6A 5E9AA 2W63A 3QR0A 4UOZA 3O0KA 2E4TA 2VKZG 1OFQA 2NT0A 2HK1A 3CUXA 5I24A 1EB3A 2YB1A 3HZ3A 1GZJA 1J0YA 1FCQA 3O15A 3LCWA 4H9XA 4F66A 4HTYA 2V67A 1XQLA 4ZSUA 3MKCA 3VGBA 2PGWA 1RR2A 3SFWA 3S8HA 4M24A 2NXIA 1K03A 3THQA 2VZVA 5FEWA 1Z69A 2WQDA 3VXGA 3T8LA 1QBAA 4HZ8A 5G4EA 1TE1A 1U33A 4V28A 2ZC1A 4GI6A 3GTXA 5CC7A 3W00A 3PZOA 3EBVA 2AL1A 4F0MA 4MZ8A 4PC8A 2QJJA 1F3EA 4PBEA 2VYOA 4UFLA 3WJZA 2X1SA 1NJJA 3BJTA 1Z6KA 4U3AA 4FLSA 5EFFA 2G3MA 3ZZ1A 2RDXA 2JF7A 3UZWA 4FXJA 3D3AA 3W6YA 4DQWA 2W27A 3AWNA 3ENLA 3EX6A 4YIWA 3WQFA 5CJ5A 3H2EA 1CLKA 5FJTA 3TC6A 3T0DA 4BY3A 4NZ1A 3NSMA 2ZIDA 3HV9A 1JYXA 1QAPA 3WQ8A 4A2RA 4GYPC 1G4PA 3EWXA 1UKSA 1YW1A 1XIDA 1X8CA 3VNZA 3TONA 2YJQA 3B06A 4Q8UA 2PWDA 4NYUA 2QJGA 4KWSA 3CTLA 1EDTA 2J78A 3AIQA 3W2MA 3MV11 4CQ8A 2VFDA 3ZVIA 4M81A 3FA5A 5E70A 4KIEA 2VEPA 4P7OA 3PPCA 3WBAA 1E4LA 1FWHC 4FXRA 3RM4A 4D1JA 1VH7A 3WSUA 4E38A 1PZ3A 3UCCA 2Z7KA 4M6VA 5DN1A 4GVGA 4DBEA 3DU0A 1A3WA 4DUXA 1IF2A 3CT7A 3R13A 2Y88A 1HGWA 2X7VA 3WF1A 1WKYA 4AWSA 4RV3A 2WHMA 1JUEA 4IFKA 2ESCA 3CU2A 3MZ2A 5AFDA 2ADAA 5D9PA 2J62A 3ZMRA 2GDQA 3AIUA 4E8CA 1KKRA 1TPUA 2Z6IA 1Z42A 1KXVA 3GAKA 5A6JA 3VNKA 5BXRA 2A4AA 3KCJA 5BRBA 2OZTA 4OU1A 3WDQA 2XM2A 1WZLA 2OSXA 4IIFA 1CT5A 1M9HA 3CXOA 3DENA 4UR8A 5MKGA 3FW6A 1ESWA 5CG7A 3QV8A 1F7BA 3GW3A 2A5HA 4YCOA 4L1GA 4FNTA 1S5MA 4PB4A 3B03A 3AHXA 1T8QA 3WFZA 5F2IA 4LS1A 4PUUA 2TRSA 4FF5A 2XGZA 3AXHA 4TO8A 1E6QM 4M6UA 3N19B 2TMDA 1TPVA 4Q8PA 3CHVA 3TTSA 4C6OA 3C6CA 3GU1A 2A6NA 1GYMA 2OZ8A 2J47A 1TB3A 3M5XA 4XISA 4JZ5A 5FD0A 2JF6A 3UZ5A 3VNDA 5GJPA 4J9JA 3HG4A 3GO2A 3WQ5A 1C90A 4XAZA 4M19A 5AOUA 3RRAA 1A3XA 4Q4RA 4XVEA 5DFAA 1IXQA 1JF5A 1PIFA 2PGRA 3UU0A 3TCEA 3EEZA 3K46A 3F1QA 1OHLA 1BF6A 4E3VA 4G5DA 2YZ5A 1EX1A 4A3YA 1SPQA 1U22A 4JIPA 2VWTA 3NO5A 5DELA 1NY1A 1JPHA 4BI6A 4JQ2A 4O13A 4XIMA 4JTKA 1ZAHA 4PCNA 1XLCA 2PDGA 5FF0A 2XTKA 1V3MA 3LPPA 1F9CA 4YVVA 3ZLHA 3U4FA 1B9BA 4IZGA 2V3GA 4EVZA 2C8NA 2XIMA 7ODCA 1ECQA 2IQDA 2VX6A 1RAKA 1VPQA 1DTUA 2YCEA 4IIBA 4UXDA 4QIUA 3WY1A 3LPGA 1TPEA 4GQ0A 3GR7A 3WUEA 1V0LA 3QMSA 4M29A 1ME9A 2XH4A 3HBLA 1O68A 4MDOA 2DT0A 1R9YA 3M5YA 4QS5A 1BQGA 1CXFA 1XIGA 2ZRXA 1W9UA 3JUGA 2NSXA 1FCVA 4ZBCA 3BCFA 1Y7VA 3W7MA 4H8HA 4CU8A 3P0WA 2E5DA 2Y61A 4AAJA 2VQUA 4BWLC 4DAIA 3GNXA 4Q4OA 4PUDA 3K4WA 3G1DA 4BZYA 5C71A 3IRDA 1GZ1A 1J9YA 1GWJA 3VC6A 1NDVA 3VD3A 3MHGA 4DEFA 1YNQA 3CH9A 3M0XA 3BLFA 5CEWA 4HZ6A 1TJPA 2AL2A 3SN1A 3GM8A 1ZALA 4PTWA 1AQFA 3VKAA 3PR2A 1ZBVA 4GI9A 4JYEA 1R0MA 2B4GA 4QFUA 4DB7A 1G01A 3ZT5A 1TQJA 1CBGA 4E6MA 1LRNA 1Z41A 1EWDA 4P8UA 1OJXA 3DFPA 2DH3A 1EJUC 3WYZA 4BQ3A 2AKZA 1UZDA 3AUJA 3BE7A 3MUZ1 3TYAA 4WQ6A 3AU6A 3P5YA 3A21A 2FZNA 4PBFA 1S2UA 4DJED 2GJLA 4LUIA 1GOWA 4HQVA 4RJEA 1I6NA 4BWLA 5MKGB 3FYOA 4ZQPA 5RUBA 2UZ9A 4C6CA 1KM3A 3TVAA 1EO5A 1VFOA 3AISA 1LUCA 3B4YA 1ZBCA 1XV8A 3VIHA 3PS7A 1KBIA 1HL8A 3AHTA 1Q7MA 4R9XA 3L4VA 2J6XA 3QLDA 2C91A 2E25A 4NZ5A 1FH9A 4NJGA 1OC6A 1A80A 1UBPC 4PTXA 3H22A 4YYFA 3GSMA 2R1NA 2E5BA 5GJNA 3NQGA 3Q2DA 5CC6A 3TYDA 3WMBA 1MO0A 3WH5A 3XINA 4IIDA 3ZFHA 3FDKA 4AUBA 2GUYA 1HX0A 3MVTA 2DVTA 1P43A 1S46A 2FKPA 4LUSA 1A5SA 2RAGA 5I3FA 1HKIA 3WD3A 2VEFA 3WDHA 2C6QA 3L7RA 5HJXA 4IMDA 2WJDA 1A50A 1KQZA 2J27A 3H23A 3MT1A 1LRTA 4GLEA 4UB9A 4GFSA 3C0LA 3G3DA 1QNRA 2QCGA 5HUOA 3RDKA 4XVDA 2A6LA 1VZWA 3O16A 2E5CA 4LCQA 2Y8KA 4EX4A 4IJCA 3OYXA 2J9YA 4C6LA 4GYKA 1UR3M 4HK7A 4I9JA 3VC5A 1G67A 4WY0B 2FDSA 1YPXA 2ZDSA 1O6IA 4EE9A 3PJXA 5G2HA 1QK2A 4L9XA 3R0KA 4HKPA 4LCSA 3SY5A 2I7GA 4FOUA 2V2HA 1OFBA 1P0DA 4QJ1A 1UH3A 5E0KA 4QLJA 4H9VA 1DWIM 1JAEA 3CC1A 3U0HA 1B57A 1JCJA 4HCDA 4LY4A 3LRKA 2GOKA 5HANA 3W01A 3HV8A 1ONXA 2RUSA 2IPGA 3HPXA 1VJIA 5I78A 3LHYA 4MYAA 4M1BA 4LSBA 4Y8FA 2CPUA 1GOKA 3FDGA 4D71A 3G8EA 5CPNA 1YBQA 4D8LA 4UFKA 2NSOA 3GDTA 7CGTA 3U2OA 3QW4B 1ML1A 4TUFA 3ZLGA 5FL1A 4LWWA 5TF0A 3W73A 1DJNA 4O8AA 3UD6A 5C54A 3WQPA 1ADSA 2ZZ4A 2HJPA 1KFBA 1UWUA 1TVNA 1KWKA 4M8UA 3VPLA 1UCWA 4UIOA 5D2VA 1JPMA 3JU2A 4AZHA 4JIQA 4KT2A 1CECA 2XHYA 1E9YB 3N29A 1POKA 3L4ZA 5CC3A 1KO0A 3A23A 4L80A 4N4PA 4UTTC 1YDNA 4FS9A 5A8GA 1YNPA 4O8RA 1PKNA 4RZ4A 3GDBA 4E2DA 4NT0A 1LG2A 2EQDA 5B7ZA 2NQHA 4JX4A 3VD4A 5CSRA 1HL9A 3I6RA 4MWAD 4PRRA 4W89A 3KVMA 4A22A 3DYMA 3GIYA 3M0IA 1FP9A 3S2CA 3W1MA 1VBUA 1ZLPA 1H0IA 3RILA 4UR7A 1O12A 3LNMA 4KQNA 4IGHA 4L64A 4DBUA 5EBUA 4CVUA 1BKSA 3V0UA 3KCLA 2D22A 3H2NA 2V5JA 5JVLA 3REQA 1M6JA 2NXHA 1C92A 3NEVA 1H11A 3W1NA 1B31A 1UUOA 1QFEA 3C5QA 2HISA 2Y8VA 3OA5A 1WZAA 4KCVA 1JI1A 3NR0A 3VKDA 1NFBA 3MMUA 3NSXA 4BI5A 3PZTA 4BF9A 2BP1A 2X8RA 1AH3A 2JEPA 2E6AA 5H8PA 2VZUA 3LPFA 3EPNA 4DLMA 4WOZA 2G8ZA 4NX0A 4W86A 4FXFA 4LV9A 5J8LA 5AYZA 3R6IA 4O10A 3WJXA 3D5HA 1W5PA 3UQNA 3IUHA 3VDGA 2QJIA 1E9LA 1FFQA 1DIDA 2ZX8A 4B5SA 1S2TA 3VVGA 5BWFA 5LNRA 4NJHA 2P0OA 2WZEA 4ZXOA 4LUTA 3VOHA 4AZIA 3H6OA 1TV3A 3WNOA 3M7SA 2D23A 3W26A 3SSJA 4AVOA 3VE9A 1V6YA 1I2PA 5D33A 4LEQA 5K4ZA 3LHZA 2WLZA 2PLCA 4W9TA 3LBOA 1F6PA 3NVDA 1LLZA 3CV6A 2EPMX 1ITUA 3AS2A 3PPGA 3UESA 1FQ0A 2BOGX 4QTGA 4LAMA 2CYGA 1EPXA 5EB8A 1H2JA 3G5EA 1V6UA 1HFBA 1V77A 3R89A 2GGIA 4PTMA 2PCQA 4NAEB 2I5QA 3I4KA 2CXGA 5E0CA 4FX6M 5H91A 2B81A 3NG3A 3O6CA 5A1AA 1XCFA 4OV9A 4XIAA 5KITA 1J93A 1DORA 5HWMA 1AMYA 1UUMA 4LAZA 3N73A 4MADA 4BEUA 4BFAA 4AYGA 3O1NA 3AU2A 4TVUA 1RK6A 5C9UA 1VD6A 2YCIX 1XLMA 3W53A 3EWWA 4QE4A 4MVAA 2QDHA 3FV9A 1EQCA 3HO8A 3QBUA 1A4LA 3HGJA 4P8XA 4KBXA 4XAPA 1A0CA 1U2YA 1AQHA 1Z8AA 3AIBA 3ITTA 4XX6A 4CU7A 3CB3A 5CZKA 1EJWC 4PE8A 1EOKA 1P1XA 4I9TA 1HG3A 1XM3A 3ZSSA 4C65A 3OG3A 3C3NA 4R7WA 1LTDA 1KR0A 3N14A 5IXEA 3KBJA 1JPDX 1JD7A 3QGAC 3C86A 4AX7A 4YL2A 1TX2A 3BAYA 5B80A 1YEYA 3ZSTA 1FBAA 4BF7A 4DI9A 2BS9A 3VZXA 2E67A 1VENA 3ARPA 1E0TA 1XGZA 3ALFA 1QT1A 2CLLA 3NQ7A 1JCYA 1SYTA 4S3DA 1VYPX 2QDGA 3UCDA 2P76A 4DPQA 1IGWA 4LX4A 2H3BA 1OYCA 4GVHA 3WK0A 3LRLA 5A2BA 1E71M 3KRSA 4QHRA 3WCZA 1YTDA 3EA3A 2FHFA 2DT2A 3ARVA 1NELA 2NT1A 3K13A 3IVTA 3T9PA 3NZ1A 1QI4A 3VNIA 4D6JA 3PULA 3MBDA 1U1JA 2J75A 1E6ZA 3WEZA 3A5FA 1UWTA 2ZRWA 4UUIA 3TAOA 1IEWA 1QATA 1YYAA 2EF9A 5CPQA 4ES4A 4A8RA 3PSWA 1V3KA 1UWAA 1RPKA 1MQRA 5AHMA 3IVSA 4HPGA 3K4DA 4J5NA 4IPNB 3PTQA 4U3CA 2Z6JA 1UZ1A 1AJ0A 3VOCA 1MMFA 2C13A 4HJFA 3TZNA 1AQ0A 4WSJA 2X40A 3BH4A 1XBZA 2C79A 3UG4A 3C8NA 2GJPA 3GNRA 2WVUA 4AZ5A 1U83A 5IOBA 3WLQA 4HJWA 3ITGA 1W91A 2OG9A 4IFOA 3UR2A 4FA3A 4W7UA 4WJXA 4ZGYA 3B8WA 4MAVA 3ABSA 2CC0A 6XIAA 3BZGA 5XIAA 2Y5EA 3W1TA 4CD4A 3TK7A 1E0XA 4XWUA 2FJKA 3TNOA 5IFTA 3E02A 6PTDA 2VELA 5C8BB 2XU2A 1O4UA 4FLQA 1V02A 2WLYA 3EPMA 4LNYA 3LV5A 2DVUA 1MNSA 4C60A 1JAKA 3QGVA 3H4WA 2GQAA 4G6CA 3VNLA 4JY9A 5DO8A 4IX2A 4ZQNA 4H2CA 2V81A 1R47A 3GFYA 1O60A 4OUIA 3WQVA 4P2VA 2A1YA 3WNPA 5KMYA 5FAJA 4UQ9A 5SWUA 1PPIA 1YBQB 2DQXA 3CHCA 2V69A 4KRTA 1OG0A 3VOIA 2ODOA 3CQJA 3WFAA 1ZY9A 1SO4A 4GX9A 1EKOA 3U9IA 2Q3OA 1DJYA 3HGOA 3C56A 2MNRA 4GNKB 1RUSA 3VD7A 5BWAA 2Y8UA 4JTTA 1J0KA 1I0BA 3NQBA 4M82A 4WVXA 2QMJA 3MP5A 2C1HA 3UT0A 1OX5A 1ADOA 2RDTA 4C6KA 2BY2A 3EOLA 1X96A 1GKPA 3SCTA 4S3KA 4K8EA 2R6OA 1T8XA 2ZBTA 1XIJA 4QISA 2XIIA 4JN8A 4QG6A 2QHAA 1XFBA 3MY9A 5F4XA 3I68A 2V3EA 4DWSA 5BXTA 3FSUA 3QRHA 4WXZA 4JIRA 1P7TB 4QJ3B 5HR7A 4WY0A 1HKVA 4QG9A 1RVKA 3W7LA 1FY6A 3HU7A 3CAVA 2XYLA 1RA5A 5C70A 4N02A 1TJ1A 3N9SA 3R25A 1SW3A 2QCDA 3M6YA 2YGYA 4IGMA 1PIIA 5CAHA 3MSYA 2XVNA 4CU6A 3SURA 3GTFA 1C7TA 4AU0A 2J88A 5CZ0A 2A79A 2GDVA 3CUIA 2PUZA 4J1OA 4O57A 1SZRA 2PDUA 3W1UA 1YLVA 3E96A 4Q8VA 4Y9OA 1GQIA 1ZU8A 2YDRA 5D32A 3DFYA 2INEA 1SVDA 1DIOA 1W9DM 3IIOA 2EO7A 3EA1A 1EEPA 3GXNA 3VOFA 2OXNA 4DF1A 5AC6A 4MGGA 1EP3A 4KPLA 3H2AA 2P0IA 1JZ6A 5D05A 2VFEA 3GTNA 4WRHA 3V1HA 2YA1A 2VGIA 2Y7GA 3UA4A 3NDOA 4MIMA 1KM1A 5TQLA 1X6UA 3S2JA 2W79A 3ARWA 2VEIA 1SZGA 1W3KA 3HA1A 4K36A 1H50A 1XLEA 1DWJM 1TV7A 3IV8A 1KRAC 1F05A 3VFCA 3IIXA 3KWXA 2DW7A 3R8HA 3SRHA 4AIEA 1OABA 4XB3A 4D6IA 1XSIA 2YL9A 1DKWA 2W66A 3QPZA 4CKQA 4BHYA 4DJFA 4XTIA 3I10A 1ZPTA 2ACSA 1OFRA 3GDMA 3RLGA 3EWZA 1XSKA 2QIIA 3T05A 4JTGA 5AHFA 3O6YX 4X3ZA 2ZTKA 4MFEA 1WKDA 3RLVA 1ZL1A 4KRUA 3SI9A 3MPGA 3DG3A 4I9MA 3LI1A 1KGUA 2AL2B 2QF7A 4JXCA 2BBFA 5C9ZA 3MW7A 1GQLA 1P1MA 3SGUA 3VGGA 4ERAA 3OYZA 4X61A 2PBOA 2F7FA 3M16A 5JQ9A 3UXDA 3U2CA 3EKGA 1KC7A 4FK9A 4E3TA 1UA3A 1OFPA 1FHUA 2C18A 1GVRA 4DVOA 4UCGA 5IHRA 4HD5A 1VLIA 5DXXA 3HQ1A 2Y2WA 4DJFD 3E0LA 3OHMB 4HA1A 1Q6OA 1NF7A 2I5IA 4PMOA 1W1B1 4UQEA 3CBWA 1TR1A 5FKYA 3AMDA 4H6KA 1J12A 1MRQA 3C0SA 3KBWA 1Q4WA 2VO5A 2ZRYA 3W2UA 2QLYA 2DY3A 1E15A 3F7JA 4XSLA 1HJSA 4KIRA 4X22A 4MB4A 4DNHA 3ZQ9A 3A4JA 3II1A 1LQAA 2DV0A 4ADUA 3WDRA 4NL1A 3QTGA 4R53A 5H8UA 4F0LA 4EXAA 4DZHA 3MHFA 3PZGA 1UQZA 3T2PA 4R7JA 5CZJA 8XIMA 4I7UA 1J8VA 4QP0A 3LB0A 3KE0A 1VEOA 3NZRA 2POTA 2VX5A 2WWDA 3W7CA 1EGMA 4KS0A 1JCNA 5KZEA 2CLFA 1NSJA 2VD8A 4QE5A 1LCOA 5K2ZA 1A5LC 1D3CA 4Q7BA 2DU2A 3BG9A 3POHA 4ZQOA 4XD6A 1DIKA 3S1WA 1QPQA 2WCGA 1ZTVA 5KSWA 3ME3A 3WF2A 2E9LA 1S38A 3LK6A 2ACQA 2OR2A 3ANUA 1ICQA 1ZNNA 2C0HA 3PJWA 4L56A 1K6WA 4DUVA 2PFHA 3E5BA 3P62A 1CXEA 1HTIA 4H8VA 3E0VA 5FACA 2D20A 5LXXA 3RMJA 1Q13A 2RH9A 3C0QA 3IJ7A 4TU1A 1V6VA 4L6OA 4KKXA 3C61A 1XH2A 4DJDA 2OQLA 1GOIA 3VDCA 3HURA 3RRXA 4WIWA 4JTUA 2QCCA 5BXSA 1V03A 2AQOA 5H1WA 4UTMA 2CZDA 1DE6A 3IACA 2P3EA 2ZXQA 4OOZA 3VIIA 2P50A 3M4HA 4R27A 4X60A 3S2MA 2Z2BA 4O1BA 5CBIA 1BYBA 5CGQA 1KWGA 1R38A 1XHGA 4MFDA 3ITCA 4OOUA 3ZLFA 3IWPA 1VFLA 3CGTA 3N9KA 3T55A 2BV9A 5A6LA 2X0YA 3PBWA 1CXLA 4RDVA 1X1ZA 1N7KA 3VILA 2C7FA 5HNNA 4D6FA 2XVLA 1Y0EA 2VI0A 4IF2A 1HJXA 3P82A 2Z1KA 3MUAA 5JIPA 1XLJA 3ANVA 1Q65A 5AYIA 2WC7A 3B0XA 3E3HA 1VYRA 2WNQA 3SO7A 3U6WA 5AHLA 1LRQA 4LH8A 4LTSA 1EQPA 3B8UA 4HMDA 1XINA 3HF3A 4NP7A 5FJJA 5CGTA 4ZA0A 4S2BA 3THCA 1LUCB 1ME7A 2DSUA 1V4YA 4MM1A 3BARA 1TMHA 2A3LA 3T2OA 5DQPA 3GNPA 4TMCA 1O5RA 3LTPA 5HJLA 4ZOEA 2NV2A 4Z2KA 1ZHAA 3SJ3A 3AHYA 4HZ7A 3KBSA 1V3LA 5ECVA 1LL7A 5C9RA 4ZTXA 2ANUA 5CSUA 2A2IA 3RXZA 3CPGA 4HNTA 1BEUA 5D4YA 2G3FA 4WUIA 1PTAA 2G41A 4UQAA 1HVQA 3R11A 3UP8A 1VFMA 5CZSA 5J5RA 5D37A 4H00A 1D3HA 2DUXA 4UTLA 3UXLA 3O2LA 5XIMA 2WNZA 2AQWA 4OVXA 1H1ZA 5D30A 2A3CA 2BB0A 2OX1A 1YTKA 2EKCA 3BANA 3LGDA 4LVAA 1REQB 3RJYA 3W7PA 2Q8XA 1E1CB 1MUMA 2WSRA 4I6KA 2YFNA 4HHPA 3W83A 1PV8A 1CCWB 3U57A 3G22A 4RW3A 1EIXA 3DGRA 2IKJA 4GO8A 3QV7A 1O94A 1XLFA 5I09A 1EFZA 1BG4A 3A5VA 7REQA 2WZMA 1KNWA 1KW1A 1XBXA 4PMUA 5DMNA 5AHEA 2E8ZA 2REQA 1MRAA 4YWSA 2Y5SA 2QNEA 1YE4A 3LZ3A 2VVSA 1GVQA 3NL2A 3BW3A 4D8AA 4YTRA 2NVAA 4MPQA 5M03A 1C8XA 2IS7A 3UERA 3H2MA 3KP1A 3UZXA 4GXMA 5G2WA 4A6GA 3CPUA 4CN1A 3F5LA 1W1VA 2HVMA 1RLDA 2PB1A 5HATA 3RGTA 1BXNA 4B2DA 3ITOA 3LYEA 3H70A 2IQTA 1NFGA 1PIGA 2HROA 1PUDA 5DCBA 3Q37A 4JDBA 2PDQA 1P0EA 1XLHA 3EB2A 3RLHA 2GOUA 4XAFA 3RYSA 2V6AA 4DX3A 2GJXA 3WH7A 5IDIA 1RA0A 3THUA 1KV5A 1TA3B 1B3XA 1PBGA 3HTWA 3TOYA 4UTFA 1IZKA 1XH0A 3TTYA 1QNQA 4NXKA 1UC4A 2V9DA 3ECQA 4NIRA 1B5TA 1I8JA 1UR8A 3GFZA 3IPWA 1ZQ5A 5JH2A 3GH4A 3OVGA 3A4AA 1QNOA 3TFXA 5H6HA 1H61A 2PWFA 4G1NA 5JUVA 4CD8A 4S1FA 1W5MA 3QLLA 3B40A 4KCUA 4F0SA 3RX4A 2YYTA 2NWSA 4H6RA 4CEXC 4M51A 3LPOA 3R94A 1PWLA 3QHMA 3S5NA 3NVTA 3V18A 5HULA 4PTVA 4KFNA 4V15A 1KFEA 3BLEA 3UGVA 2QW5A 3AXKA 1UASA 1OGGA 4PL1A 3OQ8A 2XSBA 5EYWA 1L6WA 2OT1A 4L4LA 3TQ0A 3SSZA 3TJXA 2BY3A 1E72M 4XZMX 3W86A 1U5VA 1DWGM 5DCEA 1Z3NA 2DZTA 2WC3A 3ZVHB 2WANA 3UR7A 3JZUA 2F6XA 4GCAA 3GXIA 3TMLA 1WE5A 3N2CA 1B4EA 4JHMA 3P8JA 4Q8NA 1ENUA 3UA3A 3N6JA 4IP7A 1KCLA 5FI8A 1U5JA 3W29A 2BY0A 4FP1A 4XAYA 3BJFA 2OOFA 5EFDA 2WW5A 5I3JA 3EMZA 5E0FA 2D1ZA 3GHRA 3PB0A 2PDIA 5FAGA 4MKSA 3WLLA 1ZFJA 3M0MA 2W0UA 2Y85A 1H3GA 4BQ4A 2C71A 3MCOA 1NFPA 3VGEA 2P3ZA 3FN9A 3SW6A 3C2VA 1K8XA 2VX4A 4UFMA 4GUIA 3W82A 1GUVA 1XRVA 3R1ZA 1T6MA 1L9WA 2VVNA 1H51A 1B3VA 3GNOA 3EDJA 4EKJA 4IL0A 4ZOBA 3BQ6A 4DI8A 4GH3A 1XC6A 2X16A 4GUHA 5BOOA 1MXSA 2PDBA 2FGZA 5E5CA 3UR8A 2ZE0A 2F8QA 3VZYA 3FNDA 4H04A 2XFYA 1VBJA 4OUEA 1G5AA 2NXGA 5CKSA 1HQTA 2BNJA 2JKAA 3FJLA 4PMNA 1WCGA 2O4MA 4JCMA 3QY7A 1J2WA 5A8OA 5C5YA 4N6FA 3LXCA 4FNPA 1MZHA 3RPDA 3STCA 4O14A 2PS2A 1A5NC 2Z26A 3BZJA 1FDYA 4HNUA 3V7PA 2RDUA 3ERPA 1QI2A 4L4OA 1RQBA 4HHHA 4Z08A 1KR1A 3NL5A 1BKHA 3IIVA 2XISA 3EGJA 4J3WA 2E77A 1FWDC 3R43A 1DVJA 3BAXA 3U7VA 4O1EA 2E1WA 2VC9A 4AH7A 1CGVA 3A22A 4WOQA 2OT0A 2GK1B 1PKLA 2HQAA 5BOFA 3EX1A 4B3KA 1FWIC 4KW2A 1G0CA 2OODA 3VNMA 2PCEA 1XPGA 2X05A 4Q3MA 3FFSA 4H6EA 5CSYA 1XD0A 1LBLA 4H9UA 4ERGA 2J4GA 1XRSA 4QM1A 4YTSA 1KV8A 1SZNA 3C8FA 3URNA 2VCAA 1K70A 3L4UA 2CBVA 3QZ6A 5ABFA 1X8FA 7PTDA 3D0CA 3RCNA 2XFRA 1IGSA 2C3ZA 2OVLA 3MP3A 5HOSA 1XBYA 4B5XA 2HV5A 4AY8A 1AA1B 3FX4A 2HBVA 2Y4SA 4PSPA 4I6VA 1NP2A 3TV8A 1NU5A 5HMSA 3BJSA 3MMTA 1PB0A 3R58A 3UJFA 2MUCA 2NQ5A 3WQCA 4OTKA 3UVIA 2ZUVA 1SGJA 2NWRA 2NX1A 4H4IA 1EP1A 4Q4MA 1X7FA 1MDRA 5D04C 2YKKA 4GPNA 1V6XA 2QCFA 1IXPA 3GVQA 3ONBA 3U2EA 4YU1A 3AXXA 1UD5A 5MHBA 1K8ZA 3SQSA 2DSKA 5CCZA 1QW7A 3EMQA 3DFQA 3DX5A 4UCFA 1HGYA 1OB0A 4I5XA 1E6RA 1WDWA 3OZYA 2PLJA 4XZNX 2ON3A 4W5UA 4BR1A 4MHBA 2WHJA 1QRQA 5FCZA 2J9ZA 4D6DA 4RZ6A 1MEIA 3CZ8A 3CWHA 3TA9A 3F4WA 2DFAA 3CL6A 1XRFA 3VD9A 2VDIA 2CXEA 1QASA 4UTIA 4F2BA 3T44A 4MSSA 1UIPA 2ZRZA 3CPRA 1JF6A 4ZMGA 1GHSA 2HPMA 1BXCA 3IGXA 4MNJA 2BX7A 1EJRC 3SZ8A 1KFWA 4WJEA 3T2QA 3B04A 1MWOA 4F4RA 1JI2A 2V3DA 3APYA 2I56A 1DOSA 2J8FA 2IMRA 5J04A 1EJTC 4LFYA 4G1KA 4EPEC 4FHAA 2OLSA 1WZKA 1RALA 4LYRA 3PBGA 1NF0A 4CCCA 1I2QA 1R86A 2ZVRA 3VE7A 4DBWA 3EMCA 1HKKA 1DV7A 3FHAA 1KB3A 5G4HC 4JTRA 3OB8A 5D8ZA 3VNJA 3NO1A 4ROQA 1FP8A 1W3JA 3DHPA 3Q67A 5FJIA 3SAZA 3AOFA 2WCAA 1HIZA 4JKMA 3PG8A 4AZBA 2J8GA 3IVUA 2OSWA 3TMQA 1QMLA 1RLCL 3DAQA 3W38A 1NARA 3CHFA 4E8GA 1GVYA 1LQ2A 4QNEA 1AODA 1TIMA 3BLOA 3LZ5A 1NTHA 4IGNA 5CLTA 3UR5A 4KWWA 4F3HA 4UOQA 5A8PA 4NNAA 2ZX7A 4A3UA 4W8LA 2PDKA 3PFMA 3OZPA 4E2OA 3LGEA 4QRNA 5LGXA 3E12A 2AOSA 3W7QA 3WNMA 2X1IA 1KGWA 4MJ4A 4K2SA 4YCPA 4DPPA 1OZQA 1GT8A 4OBRA 4JTFA 3L4XA 4K8HA 3TP4A 5CPTA 5C6MA 3FCPA 1MQQA 1PHQA 1UROA 3MUCA 1BG9A 2Y7EA 3SUSA 5C0QA 1R3TA 4O1DA 4YHEA 1CWYA 1G1YA 3QHNA 1E6PA 3E2VA 4DN1A 4BS0A 3S1VA 3ZJ7A 4JN7A 3AROA 4W7WA 1XI3A 3ZO9A 4MUZA 2NQ9A 4MY8A 3W81A 1XR2A 1J5TA 4HNOA 3MSGA 3DFSA 3S5YA 5FEZA 4J3ZA 4EXBA 3LX9A 3KRZA 3AQUA 2E9MA 2A3BA 1W1A1 3NZPA 4GYFA 7ENLA 1LWIA 3OGSA 5D03A 3E49A 1GOXA 3BSMA 3QMRA 4QAWA 4FNQA 1X6NA 1MXDA 3IARA 1Q6EA 2PDJA 3S0CA 4RZ5A 1XLAA 5D2YA 3BQ5A 2ZA3A 3MKVA 1VR6A 3U7BA 2Z1BA 4ZB5A 1XP3A 4EPDC 3M41A 1LLOA 1V3HA 3WEOA 4B91A 3GH5A 3VKBA 2J6VA 4LALA 3UGRA 1BAGA 3WLJA 4A8LA 4AIBA 1JDCA 3PPFA 3NSNA 3C2EA 1EIBA 4RX0A 5T9CE 4GQRA 4WHBA 5T8GA 4R34A 1R3YA 2Z2AA 4EPKA 3GZAA 3PC0A 4A4AA 4GY0A 4L9YA 3DECA 2Q8LA 4A3HA 5G1MA