1A80A

Native 2,5-diketo-d-gluconic acid reductase a from corynbacterium sp. complexed with nadph
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
277
structure length
277
Chain Sequence
TVPSIVLNDGNSIPQLGYGVFKVPPADTQRAVEEALEVGYRHIDTAAIYGNEEGVGAAIAASGIARDDLFITTKLWNDRHDGDEPAAAIAESLAKLALDQVDLYLVHWPTPAADNYVHAWEKMIELRAAGLTRSIGVSNHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDWAAAHDVKIESWGPLGQGKYDLFGAEPVTAAAAAHGKTPAQAVLRWHLQKGFVVFPKSVRRERLEENLDVFDFDLTDTEIAAIDAMDPGDGSGRVSAHPDEVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE A
publication title Crystal structure of 2,5-diketo-D-gluconic acid reductase A complexed with NADPH at 2.1-A resolution.
pubmed doi rcsb
source organism Corynebacterium sp.
molecule tags Oxidoreductase
total genus 105
structure length 277
sequence length 277
ec nomenclature ec 1.1.1.346: 2,5-didehydrogluconate reductase (2-dehydro-L-gulonate-forming).
pdb deposition date 1998-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1a80A00
2IQ0A 2PDCA 2DUXA 4WDUA 1MZRA 4DBUA 1PZ1A 4QBXA 3KRBA 4XVEA 2ACQA 3FJNA 3D3FA 3LD5A 3UZZA 3BCJA 3T42A 4Q7BA 2NVCA 2HE5A 4GQGA 1QWKA 2PDXA 3GHRA 4XVDA 2WZMA 3CAVA 1Q13A 3MB9A 4JIHA 3GHSA 3MC5A 3R7MA 4XAPA 3LENA 3LN3A 4QXIA 4WDTA 1LQAA 2HVNA 4GCAA 2R24A 4LBRA 2PEVA 3UGRA 3Q67A 3EAUA 4FAMA 4L1WA 4H7CA 2F38A 4ICCX 1HW6A 1PYFA 2FVLA 1EKOA 2IPJA 3R94A 4LB4A 1XJBA 5AZ0A 2FZ9A 1PWMA 3V35A 4I5XA 4XZLX 3NTYA 4IGSA 3EB3A 3CMFA 1RALA 3R58A 4RPQA 2PDQA 2DUZA 1AZ1A 1YNQA 1S2CA 3LEPA 4JQ3A 4DZ5A 2PDWA 2CLPA 3B3DA 2VDGA 3S3GA 4WDWA 3H7UA 1ZGDA 4GABA 2QXWA 3RX2A 3UWEA 4JIIX 1FRBA 4JTAA 2DV0A 5HA7A 1C9WA 1PZ0A 2J8TA 4YVPA 1S1PA 2I16A 1RY8A 4H8NA 3LZ3A 3ONCA 3BUVA 1ZQ5A 1HQTA 2PDHA 4LAUA 5KETA 3RX3A 4EXAA 4LAZA 1VP5A 4GIEA 3CASA 2C91A 3UYIA 1AFSA 1AH3A 5LIWX 1ADSA 4JQ4A 4ASTA 5C7HA 4G5DA 2ISFA 2PZNA 2PDLA 1X97A 5HNUA 3R6IA 2HE8A 1YE4A 1XGDA 2BP1A 4GQ0A 5JH2A 1Z3NA 2PDBA 3V0SA 4R9OA 2PDJA 3F7JA 1S2AA 2WZTA 1LWIA 1S1RA 3M0IA 3M64A 1ZSXA 4XZMX 2PDMA 2BGQA 4NKCA 4LB3A 4JQ1A 3LUTA 3RX4A 3CV6A 2IKIA 4PUUA 4JQ2A 4JQAA 1ZUAX 2PDGA 3V36A 2FGBA 4XK2A 5DANA 1QRQA 3H4GA 4F40A 1R38A 1X96A 1AZ2A 4JTQA 2HV5A 2FZ8A 3LQGA 2IPWA 4OTKA 3G5EA 4QR6A 3WBYA 3LZ5A 2PD9A 4DBSA 2F2KA 5LIXX 4JTDA 3CV7A 2PDFA 3UZXA 4ZFCA 4WEVX 2HVOA 3V0UA 4WDXA 2ALRA 3GHUA 4LBSA 5LIUX 1GVEA 1Z9AA 2IPFA 4AUBA 1YNPA 4PUWA 4HBKA 1EXBA 4XO7A 4XZHA 4FA3A 4DBWA 5LIKX 2INZA 2PDNA 3UFYA 4PR4A 1M9HA 1MRQA 3WCZA 1Z89A 2BGSA 2R9RA 4Q3MA 1IEIA 2I17A 4FALA 5JH1A 3N6QA 4HMNA 3ERPA 4L1XA 1T40A 4YVXA 3UZWA 1Q5MA 4JTRA 2P5NA 3UG8A 4JIRA 5M2FX 3C3UA 2AGTA 4JTCA 2IPGA 1SM9A 5LIYX 4GA8A 3H7RA 3R8GA 4XZIA 2ACRA 1US0A 3LBOA 2PDPA 1EF3A 4IJCA 3V0TA 3U2CA 2PDIA 3N2TA 3WBXA 2PFHA 2FZDA 3GHTA 3G1RA 3CAQA 3LNMA 1K8CA 1RY0A 1AH0A 2FZBA 3QKZA 4WRHA 3WBWA 4YU1A 4FZIA 4GACA 3DN5A 2ACSA 2PF8A 2PDYA 4PRTA 3UZYA 2HEJA 2IKJA 4XO6A 3M4HA 2IS7A 3LQLA 1PWLA 4XZNX 2INEA 2NVDA 3O0KA 4EXBA 3GUGA 1MI3A 3DOPA 1IHIA 3ONBA 3VXGA 4IJRA 1EL3A 4WGHA 4MHBA 1AH4A 5HNTA 2PDKA 2PDUA 3UP8A 3O3RA 2IKHA 2ACUA 1X98A 2HDJA 3WG6A 1A80A 3R43A 1XF0A 3FX4A 1UR3M 4YS1A 4PRRA 3COTA 2IQDA 3Q65A 1VBJA 3BURA 2A79A 4YVVA 5AZ1A 3P2VA 3BV7A 2PD5A 1J96A 1OG6A 1YE6A 3EB4A 1T41A 2IKGA 4QX4A 1Z8AA 1JEZA 4PMJA 3R8HA
chains in the Genus database with same CATH superfamily
4J4KA 1XR2A 1IE7C 3ABSA 4PUMA 4DWDA 4QSHA 1XCXA 3CMJA 1QFEA 3RK8A 4NNAA 2FGLA 1JPHA 4E8DA 2HPMA 3W7CA 1EBHA 3BDKA 2YCLB 3SCTA 4K8GA 4H9XA 3MI2A 1YADA 3PVFA 3H70A 3QMSA 2CHNA 3NOEA 3P62A 4KETA 4OU1A 1JPIA 1V6TA 4XAYA 4R85A 2B7PA 4PMXA 2CZDA 1R86A 1QJWA 1LL7A 4LV4A 4QGCA 4Q4KA 1OK6A 3Q67A 3QPEA 3BOLA 2WVUA 1R3RA 2Z2UA 3KCJA 4H7CA 4MTVA 3BW2A 1T8XA 1DJZA 3UZJA 1ZJBA 1LBLA 3EX3A 2YLAA 5BZAA 1VFFA 3A5VA 3AICA 5D33A 1F4AA 1PWMA 1VCVA 3PULA 2EEXA 1C9DA 4BJHA 2DZPA 1LQ2A 1HKJA 4LC8A 1IXPA 2XZ7A 5DRCA 3LHUA 1TZ9A 3SQLA 3WH9A 5CG7A 2OZ0A 4GUFA 3MI3A 2Z29A 4AIBA 5A8NA 1UWIA 3WBEA 1UBPC 3FGCA 2QV4A 1LDCA 1OFAA 2QXWA 3EB2A 2REQA 2E5BA 4PODA 3SCRA 3VKBA 4QS6A 1TV7A 2V0TA 1K8ZA 4AZCA 4UZUA 3WQEA 4BQ4A 2ZUNA 4P8VA 3DERA 3NQMA 4H8NA 1PHQA 2HVMA 4ACZB 4MB1A 3BJTA 1RBAA 3VNJA 3RCNA 1CGUA 1P6WA 3NPXA 3S1VA 3EDDA 3WQ4A 8XIMA 3W23A 2FIQA 2PTZA 1QW7A 3T78A 2HE8A 3FLUA 5BRBA 4J35A 5AC7A 4JIQA 4W7VA 1W6TA 2D22A 1AVAA 1KRAC 5IFTA 4R9OA 2GGIA 1CXEA 4O54A 1NFPA 3NWRA 2W67A 1IXOA 4GY7A 3O8AA 3T0CA 1XM3A 4DUXA 3W2NA 1PV8A 1NQKA 1T99A 3EKLA 1MEIA 3U2OA 2WWCA 5HMEA 4AC7C 5BXTA 1BFNA 3KDOA 4PMQA 4J9JA 9XIAA 4KCUA 2NXHA 4EAYA 4AF0A 1MXGA 3SY1A 2D2GA 4PB4A 1LM1A 3OA3A 1JZ4A 3GIYA 3UJEA 2HRWA 5LNSA 3HMJG 5LNVA 1FOBA 3OG2A 4URIA 1S3TC 4IMAA 4Q8TA 2A7RA 3URQA 2W63A 4CNSA 3BSHA 1EO5A 4H7ZA 4GCXA 1XIJA 4ALDA 2PDFA 4ZMGA 2PRMA 3EX1A 3LU2A 4RCXA 3ENLA 3R0KA 4GLEA 3D0CA 1RK6A 1OFOA 3Q37A 2QKFA 2BXYA 1E0TA 2TODA 1D9EA 5HJLA 3RPTA 3CV1A 4YL2A 3TWBA 3T0BA 4UQBA 4PR4A 2CLOA 3LMZA 1D3GA 2R9RA 1HKKA 2YJQA 1FHVA 3N6QA 3ITXA 1F3XA 1G7VA 5LZLA 3E0IA 1V08A 3CT7A 3AMKA 1W1IE 3HGSA 4OV9A 1RQEA 2XTKA 3ARVA 3OLEA 1W1ZA 4TX6A 1MEHA 1DJQA 2ZFAA 4K1GA 1KFJA 2CZVA 4AWUA 3GU2A 5J8LA 2DY3A 1K9TA 1DTUA 2PUZA 4ADUA 1M7OA 3KBNA 3WFZA 3KE0A 4MWAE 4L9XA 1KWKA 1JCYA 1B3OA 4MMWA 3FIGA 3MUCA 4NP7A 3U2CA 2HNEA 4K3ZA 2YCEA 4GINA 1X6UA 4LQ1A 2CC0A 3WKZA 2JE8A 1TCDA 3EDEA 1VIZA 3QKZA 3P5ZA 2CBIA 3UESA 4GC4A 1AL7A 1VBRA 3WLRA 3BG3A 4AC1X 4BS0A 5JMUA 3W74A 3SRHA 1DE5A 1W37A 2WMIB 1XIHA 3HGRA 4GVHA 2Y89A 1QK0A 1XG4A 5FKYA 2J47A 4GISA 3AWOA 4M81A 3GUGA 1IHIA 4L56A 2RDTA 2OQYA 1C7SA 1UQZA 1L6FA 4JAWA 1FFQA 1DOSA 1F2JA 1B3ZA 2ACUA 1A80A 1XF0A 1OT1A 2NQZA 1G7UA 4LYRA 1VFUA 4GVIA 4DYEA 4B5SA 3CGTA 1EC7A 1BF2A 4IGNA 2PODA 4I7WA 1RVGA 3I68A 3L7RA 3E3HA 4JTLA 4MWAA 1D2KA 1XX1A 4HZ6A 3WNPA 2X8RA 4DIAA 2EKCA 1L2UA 2DSUA 3TTSA 2FB3A 3RG6A 3CC1A 1F05A 2YA2A 1YE6A 3ZYZA 1QBAA 4N42A 1OBAA 3L0GA 3N3MA 3GNOA 4EE9A 4P7LA 3HB9A 2QDEA 1BQCA 2P0IA 4FXFA 3E1F1 3GXMA 5DY3A 3GDKA 5K4ZA 3W7EA 3FV9A 1TUFA 1L8PA 3R11A 1A5OC 2J25A 2J7DA 3K30A 3SFWA 1O66A 2PI6A 1Z48A 2VVNA 1M65A 4MFDA 3AIBA 3HJZA 4F2UA 3NPVA 1SJCA 3WDQA 1A5SA 1XH0A 1VZWA 3JVAA 4XAPA 1V3MA 1JZ7A 2IQTA 1VYRA 4UTUA 2PPGA 2HQAA 1OX6A 2GOUA 4HYWA 3BAXA 2YDAA 1O5RA 4NF7A 4IMCA 5AYBA 1RVKA 2V2DA 4J40A 3FOKA 1HW6A 1KW1A 3UA4A 4F0SA 2Y4SA 1IT0A 3SM0A 2YX0A 3GVGA 3LHTA 3CTTA 1IWBA 2DZTA 3EOUA 1WZKA 3BGGA 1Q6GA 3M0VA 1MW3A 3W6MA 1SZEA 2VL4A 1TWDA 5CBIA 4Z0JA 4XIMA 1P5BA 4DZ5A 3ARQA 3BANA 1FWGC 4HHHA 3T4CA 2OXNA 2VFIA 3NR0A 1BVNP 1EBGA 3QC0A 3S1GA 3H7UA 1KM4A 4DJEC 3NIYA 3ES8A 1HJUA 1ZGDA 1WKFA 3CPGA 4RNIA 4GBDA 5HDRA 1Z41A 1ZHAA 4JTAA 3QVQA 5FJTA 2V3GA 3VKCA 4IPIA 1T7LA 3M47A 2ZXAA 1GVYA 1GVQA 1C7TA 1ZCCA 3GRIA 4QG8A 2FZMA 3UR2A 3SDOA 1AFSA 3GS6A 4Z1DA 1GJWA 2QIIA 4P7RA 4HU8A 2GJXB 4DJDC 5HWNA 5FIPA 1RPXA 4IH3A 1TWSA 3RMEA 4UTHA 3FXGA 3WH6A 2FHCA 1HVXA 1F7BA 3PF3A 1TTJA 1IT8A 3KBVA 2WHLA 4NI8A 5CLTA 4ADTA 3MSRA 3F7JA 1R3WA 1GWJA 4H7VA 5FJIA 2VEIA 4OHQA 4DWSD 1OJXA 4I6VA 1I2OA 2OSXA 5D9NA 2ZA2A 3OVPA 4XV0A 1QO5A 3ZLHA 4YYFA 5D37A 3E0LA 3AMGA 4B91A 3DGRA 4K2SA 3UJFA 2EG7A 3B8UA 3VABA 3VCRA 3AISA 4DZIA 3GXDA 1E6ZA 2G95A 4O53A 4XK2A 1A49A 2UWFA 3B0XA 3AXIA 2HV5A 1A0EA 2C0AA 1JDEA 4LAMA 1J0ZA 1RAKA 2EG6A 4RX0A 3QMRA 1E9ZB 1DWHM 1ITXA 4LTSA 4CD6A 1H11A 5LIXX 3RNDA 1XLBA 1DJHA 3L5MA 1OZQA 1EXPA 4Z2JA 1FX6A 1P0DA 2GVEA 3H54A 3GHUA 4AW7A 1GVEA 1W56A 1B3WA 1LG1A 3FSTA 1GTHA 2JKEA 4NX5A 4M19A 2PRLA 4IISA 1OC6A 3EA2A 3CUIA 3JUGA 5LHFA 4UMCA 1FWJC 5I3JA 1I2NA 3OOQA 1EWEA 4Y8FA 2VTFA 3TROA 5CJ5A 4EKJA 5AKQA 3VIPA 3IJLA 5CSRA 3TV8A 2VDHA 1U5HA 3WLSA 1GK8A 3BWWA 3QKEA 3C0QA 3UZWA 2NQLA 2E9MA 2OZ3A 2J7GA 1HGWA 3HQ1A 3L4YA 4LS2A 4JTJA 1EOKA 4LXFA 4CD8A 2D2HA 3OYZA 3JS3A 3KL5A 3KVKA 3S9YA 1XP3A 2WLZA 3SUUA 4UFKA 1SO4A 3BMVA 2ACRA 3G1HA 2HXUA 1SUXA 2PDPA 2OYMA 3WBXA 3WK3A 4C7FA 3IVSA 2WCSA 4CN6A 2AL1A 1CGXA 2PSNA 4WSKA 4UXDA 2QMJA 3QOKA 3CAQA 3LNMA 3BCFA 2GSEA 1ZU8A 2X41A 1RY0A 3MW7A 4D6EA 3EWZA 3TC6A 1EP3A 4LOCA 2JIWA 4TX9A 4F9DA 2UY2A 4KW2A 4AXNA 4ZO8A 1VPQA 2EKGA 1W5QA 4MG4A 1AK5A 5AHIA 2AQOA 3C3NA 1MUWA 3CL6A 3OZOA 3DHDA 3I4KA 1PZ2A 3ZR5A 4JFTA 1S5WA 1X7FA 1ZPTA 3MDUA 3RCMA 3WDPP 1IGSA 1M7XA 1E6NA 1EQPA 3O6CA 4V1XA 5I3DA 3UJ2A 2H8XA 5A2CA 4L6OA 4D6IA 1ESWA 2WXDM 4YS1A 3KP1A 3M7WA 3A24A 4DUVA 3TJXA 3DFOA 1N8FA 1SZNA 5HULA 1XSIA 1Q6OA 2XH0A 1UA7A 1VPXA 2AKMA 1D3CA 2ISSA 1AMYA 3LLXA 1SSGA 3AYTA 3GFZA 2HBXA 4DM1A 4H6RA 2GJNA 2P3ZA 3LCHA 5AC6A 1QHPA 3STFA 3HG2A 4HA1A 4MNMA 3UCCA 4H83A 4DY1A 2BMBA 1R7OA 2FKPA 1Q6LA 1HJWA 3M0LA 1PS9A 1PX8A 1F61A 2KX9A 1PE1A 3SUVA 3S1WA 3TC3A 1K8XA 5T9BG 4DPQA 2ZTKA 3ZZ1A 2YB1A 4PBFA 1XRVA 2X7VA 4DBUA 1UPMB 1O1HA 5FCZA 4IP5A 3FS2A 4GI9A 3GKFA 4UNLA 1ECEA 1K3UA 3UG5A 2PGFA 3FY1A 4V27A 1QWKA 3OBAA 3GHRA 4W8LA 3VIOA 1A5LC 3AIEA 4XVDA 2NT1A 3H2EA 3UZ5A 4RE4A 1Q13A 1H7OA 3MC5A 1EIBA 1H4PA 2Y0FA 2OWWA 1UUMA 3JR2A 2F8QA 4PSPA 4Q33A 1PZ3A 5GNXA 3AIVA 4M1RA 1UR9A 3CZKA 5G2IA 3QW4B 1NELA 2TAAA 3L67A 4Y8EA 5LHEA 4KWOA 1UMLA 1QK2A 4ICCX 4JNMA 3IK4A 4DB7A 5I07A 4OIFA 1KCZA 4UOJA 3DFNA 2FPYA 1H51A 3F4VA 4C5ZA 4L6HA 3W6LA 4LVGA 3WNMA 4R88A 4FR1A 3DH7A 4FHAA 2WANA 4BQ3A 1XUUA 3E6EA 3TFXA 2PGWA 2FB2A 1GQKA 5FF2A 5GNYA 3TA6A 3WDHA 4IWWA 4R33A 4PMNA 2HNHA 3M0XA 1PKMA 4MZ8A 3SJ3A 3UWWA 2NQ5A 1XYCA 5TF0A 3CZLA 5ABTA 3S5YA 5CPLA 3GIPA 5D9OA 4GABA 5AHNA 1P0EA 1CGWA 2YDQA 3NVDA 5HUPA 3NL2A 4MADA 4H8VA 1RY8A 3LZ3A 3H8AA 1ONXA 4ZQRA 1BAGA 2PDHA 4IIFA 2QDHA 1LCOA 1GPWA 3NSXA 3JW7A 1A5BA 3LS9A 4DXKA 3EPOA 3ELFA 1YBQA 2H3BA 1Q7QA 3VD9A 3L0NA 1F3EA 4GO8A 1TPDA 2XIMA 2ISFA 2PZNA 4C6QA 5GJMA 2VFDA 3B9AA 4O11A 1UD8A 2VP8A 4UMAA 1YE4A 7REQA 5IBXC 3MSDA 3MSGA 4JN6A 3QR0A 1RP8A 2VDIA 2PDBA 4GO9A 1KM6A 5DMLA 3BVJA 5EYWA 3G1VA 3OIHA 3UWVA 1KFCA 1VRDA 3CYVA 5A8QA 4C6EA 3EWBX 3E49A 1UD3A 4QAWA 4FPSA 3UQNA 5G2HA 4DNMA 3ECQA 3E9AA 3ARPA 1VBGA 5KSWA 3WEOA 3TH6A 3OTRA 3H4XA 2AMXA 4RE3A 2P50A 3CIXA 3LUTA 2Y63A 4GX8A 5BWFA 3NZGA 4IIEA 4ORIA 3GAYA 2A6NA 3TN4A 4JQAA 2XIOA 5A94A 2BHUA 3K1DA 3STGA 1M41A 4GY1A 2ZTJA 2IXUA 1GPFA 3IUIA 1KXTA 4HK6A 3NO3A 1IWPA 2WPGA 2ZXDA 3W07A 4IMEA 3EEGA 1HG3A 4K7YA 3POCA 4AHOA 3B8WA 3SCUA 3FN9A 4UNIA 5LKYA 3E2SA 2Z00A 1FDZA 2F2KA 2V5DA 2CLMA 2V8ZA 2VZSA 3BAYA 3R8RA 3ZMRA 1VLWA 2RJHA 2B4GA 1HL9A 3B8SA 5K7JA 4WKHA 2FPVA 4E5TA 2Y88A 3QY6A 1MNSA 2V63A 1X8CA 1S2UA 3EXSA 4MWAC 4IFRA 3G3MA 3RF9A 2CBVA 4IQDA 3AIWA 3BMWA 1UWAA 1UD4A 4QROA 1R9YA 1RK5A 2P8BA 1C29A 1ZP3A 3B97A 3I3DA 5AFDA 3STPA 4YVXA 2Y5SA 4WK9A 3LG3A 4A8NA 3GNNA 3ZVIA 3OHMB 4Z1CA 3W2UA 1A5MC 2PURA 4XQ6A 5HOSA 1XLIA 4HOZA 2J8FA 3DCPA 2Q6ZA 5LIYX 3R10A 6TIMA 3M6YA 4UQCA 4OWGA 2INFA 4CD7A 3NJ3A 4IJCA 1HJSA 3TXVA 3MHFA 4XTDA 4LWWA 4NZ5A 3T0AA 3ARSA 3I6TA 3OPSA 5D09A 2QGHA 3HPZA 3GXFA 1H1ZA 3W75A 2FVMA 2PTYA 1NM9A 4FZIA 2O0TA 3DN5A 3P7YA 5JQ9A 4CNUA 4JXCA 1TIWA 3IVUA 4RE2A 3BOFA 1PAMA 3B8TA 2NX9A 3W1PA 2DORA 4P61A 3IVTA 1CBGA 2Z0IA 1VFHA 3BJSA 3SZ8A 3NQFA 3CUHA 4AHPA 3VINA 1UR8A 3SRFA 1O6IA 4C6IA 1RD5A 3WF4A 1GOMA 4FNUA 4EF8A 1Q4WA 3HURA 4B3LA 3VUSA 3IUDA 3GNPA 3PANA 5E70A 3QSTA 1X98A 3VNLA 4Q7NA 2W62A 3LRMA 3WNKA 1HGYA 4QDMA 3W1TA 4LJ3A 3MUXA 3W1UA 3IGXA 3DENA 1UP3A 1JYXA 1QI4A 3LI0A 4S3KA 3L12A 4ZE5A 5F2IA 4IZGA 5AZ1A 4QDPA 4X61A 1B3YA 2Y5EA 2XFFA 5I3FA 2F6XA 3LYEA 2W6RA 1J0IA 1MMFA 4MAZA 1XGZA 1LOLA 2YL5A 2VX6A 5HR6A 2PD5A 3P60A 3BAWA 3T2PA 1AQMA 2XN1A 3KX6A 6CGTA 4PCPA 3R8HA 4L61A 4HSNA 4YPJA 3WF0A 1O68A 1XGEA 3MP5A 3MVTA 3OLGA 4X60A 3WN6A 4WDUA 4ACZA 1NQ6A 1P1MA 1PYMA 2OYLA 3KRBA 4H2HA 3SW6A 4DO5A 1A4MA 4S3AA 6REQB 2ACQA 3WO8A 3CTLA 5G4WA 1VENA 4Y6GA 3MKVA 2BLEA 3PBVA 1LBMA 3W7JA 1OFDA 4JBRA 3EEZA 1R46A 2WMHA 4GY0A 3MB9A 3TU9A 4UNKA 2LLEA 3USZA 1AG1O 2WW5A 3IAQA 3QGKC 1DKWA 2V69A 2R24A 2CXEA 3UG4A 2HMCA 1UWUA 3N1AA 3QRHA 4QNWA 1HUVA 2Z1XA 3FAWA 1B0IA 2E6FA 2EGZA 4ES4A 2NV1A 4H6KA 1SZRA 5AZ0A 2E3ZA 4IIBA 4FOJA 3V35A 4XZLX 2ZUTA 2W91A 5I09A 4C6NA 1M1BA 1SJBA 3O1NA 1WKYA 4IUGA 1K9FA 5BMXA 2QUNA 3VCCA 4DX3A 1QU4A 4GK8A 4AIEA 1WXZA 5KTLA 4DXVA 4N7QA 1AD1A 4KWUA 2C15A 3M5YA 2DZSA 1PCKA 1B30A 3UY8A 1SVDA 3W3OA 1GEHA 1W3KA 1C92A 2J6XA 1NDZA 1BSLA 5IFPA 1Q6DA 2AL2B 3NQVA 2OOGA 4YVPA 1Z42A 1GW9A 4JCLA 1SJAA 2WAGA 1AQHA 3KOZA 3UPBA 1NIUA 1JZ6A 2WCAA 2FTWA 2E1WA 2P76A 5EMLA 2WK2A 2PF0A 1K7FA 2Y7FA 4OBSA 1J0HA 2ALDA 3LTPA 4S39A 3CASA 2C91A 2H3DA 2OTDA 4PMYA 3ID7A 3CYJA 4IOTA 3SIMA 4ZXOA 2PDLA 1GG1A 3QYQA 1R3TA 3F2CA 2ICSA 3IJ8A 4B92A 1V51A 2FLIA 3CLWA 4MNJA 3U57A 1UH3A 4GMEA 3UXDA 3CBWA 4MKNA 5JH2A 3P0XA 2ZRZA 1PDYA 4KCTA 4CQAA 4XX6A 5HANA 4LAOA 1A5NC 2VWSA 4AG0A 1KM0A 3KRUA 3ARUA 3GFYA 4UQAA 3VNYA 3W87A 4I7UA 3VGBA 2PLMA 4JTEA 3IIOA 3ANYA 1TMHA 3KOYA 1J0JA 3TDFA 4US5A 4NXSA 3S2JA 1K4GA 4ICNA 3CL7A 2ADAA 2NLIA 1VLIA 2Q3RA 3ES7A 5F2MA 4HNOA 4TVCA 4WGXA 1O95A 3FK4A 3KVMA 2SFPA 1JDDA 1R38A 4J3VA 1YEYA 1E71M 1PXGA 3W0KA 4WKFA 2O92A 3A4JA 1G4EA 1EO7A 1TV4A 1QASA 4A3YA 2VR4A 2FJUB 2OZTA 3W82A 2WMIA 3HQNA 4DO4A 2YW4A 4RJEA 4FF5A 2BOGX 3C2VA 3PJWA 5C54A 3EWUA 3NL3A 3VIMA 4MKVA 2IXVA 1UOZA 4WEVX 3V0UA 3W27A 4WDXA 4WZHA 3EPMA 2I5GA 2W9MA 4K39A 3C86A 2OX1A 2IPFA 1TYGA 4ZA0A 1J0KA 4HBKA 3CXOA 1U1HA 3VIIA 1R5YA 2YCJA 3ITLA 4CEXC 5HWJA 2WM1A 2INZA 3UFYA 3WX7A 3O15A 3A22A 4FXRA 1XFBA 2UBPC 3C2OA 3SADA 4ZB0A 3W84A 2J7CA 2YZRA 1KGWA 1BD0A 4TTUA 3CEUA 1KA9F 4L1XA 4HU0A 2PS2A 4OQVA 1EUNA 3ZSSA 3C61A 5D2XA 5MKGB 2PU0A 4Z17A 3ZR4A 1KFKA 3VIHA 4E2VA 4JR5A 2GUYA 3W22A 4KFNA 4G9PA 4NUWA 1FCVA 3TSDA 3TVAA 1DE6A 5A8PA 4B5UA 1NY1A 4PMUA 3QV8A 4WUIA 4QS5A 3WMLA 2P88A 1V5XA 1JUKA 3H7RA 5BW6A 4HNTA 1G0CA 3LBOA 4ZQMA 4ONVA 1KTCA 3ANUA 1VYSX 2WJFA 4TTGA 3DUGA 1W31A 4FR6A 3MPGA 3Q45A 1FDYA 3M0YA 1BVWA 2WNWA 4K38A 1BG4A 4ICMA 5E6YA 3VTRA 4IP7A 1WZMA 1ISZA 3QBUA 1ML1A 3WBWA 5LA2A 1VJSA 2BBFA 3PAJA 3CIVA 5DY2A 4ZQOA 1HP5A 4L1GA 5CBBA 2POTA 1GVOA 4IQLA 1EWDA 2ZDSA 3EWDA 5F1UA 5FF7A 1KBKA 4PL1A 4AU0A 3QHOA 4NL1A 2OEKA 1XC6A 1CPUA 4L80A 1OC5A 3VXGA 5FOOA 3QN3A 3KAOA 1WDWA 1SYTA 4QFUA 1XD1A 3W7LA 5CC6A 2WSQA 1EEPA 2TMDA 5CGTA 3ZLFA 5KZEA 1W9DM 1DP0A 3V7PA 2UV8G 1QATA 2E8YA 2E28A 1O7AA 1F76A 4HP5A 2C14A 1UP2A 1B9BA 3PPFA 3E74A 4O4VA 2DVXA 1E6QM 2ZA1A 4GVFA 1N8WA 3ITTA 1T6MA 4J7RA 1K7XA 1NU5A 3THDA 4XUYA 3PZQA 4WQ6A 1TJPA 1GGOA 3R13A 1A5UA 2VRQA 4H2CA 4DM2A 2H9AB 2W79A 2V3EA 3CJPA 2J6VA 4MB4A 4X63A 2CU0A 4Z0SA 5T8GA 1NOFA 1JAEA 2J62A 2E9LA 3NDYA 4LUSB 1JYWA 2PTDA 1ZRQA 1B57A 1IIGA 3B0VC 2ZX9A 3C5QA 1J5SA 5JUVA 1XLGA 4A3RA 4UTWC 2XH2A 3UZZA 3DYPA 1GW1A 2X1IA 2NVCA 3SB0A 3KXQA 2GJXA 4OOUA 4JTIA 3CLMA 3WF1A 2J88A 1YXCA 5FAGA 1POJA 3T8LA 2FJKA 3B06A 2NSOA 2HVNA 3PFRA 4CQ9A 4REQB 3O0FA 1UPPA 1E4IA 4PCFA 4A8LA 3NOYA 4KMQA 1JF5A 2QQ6A 3R94A 2EG8A 3TXZA 4BI7A 2GVLA 4O12A 1RSCA 4CCEA 2YBVA 1KCXA 1QMLA 3CAKA 3PZUA 1ZAIA 2J7EA 1I4NA 3L2MA 4G8TA 2X30A 4A2RA 4EK7A 4ZXLA 1A3HA 1GUVA 5CJNA 5A2AA 4W93A 1NWTA 1M6JA 2VEKA 4LVFA 4OE7A 3F1QA 3E0WA 1GOWA 3A6OA 4AZCB 3FYOA 1B4KA 4MPKA 2J75A 2ZC1A 2VQUA 1PZ0A 2A3BA 2ZZ5A 4LUTA 4AEFA 1DEDA 1SFLA 2G3NA 1E4MM 2KZHA 4HPJA 1S2TA 3SRDA 2CZFA 4KEVA 1KXQA 1PKNA 4ZFMA 2O9OA 2XU2A 1UWRA 5GNZA 4LALA 3WLMA 1OD0A 3B9NA 1XINA 3QZ6A 1HJVA 1QOQA 3GU9A 3BAIA 4GC3A 5HNUA 3PJUA 3FXYA 1SU5A 4S3BA 1FBAA 5HWMA 4J3ZA 3QW3A 3H2NA 1DWIM 3C4UA 4QNEA 4DJDD 4TV5A 2WSYA 2RDXA 1WDRA 4KH2A 8RUCA 4KEZA 3W72A 2Z28A 4Y9AA 1S2AA 3U9IA 2FFIA 1LWIA 2ISVA 3M0IA 2BOEX 3L65A 4PUDA 3L4ZA 4BZYA 1FKXA 4AF0B 3NEVA 2PDMA 4C65A 1A5CA 4JKKA 1REQB 3GBDA 1TVLA 3WL1A 4CLMA 3BPWA 4JD4A 2RAGA 3EPNA 2CIPA 3NYDA 3M5ZA 5D9PA 1KD0A 1OFPA 1UA3A 4MJZA 3ARRA 2FGBA 2WV8A 4D71A 1W5OA 3UCQA 4AMAA 1UCWA 1KCKA 3W1LA 1Q45A 3HQOA 1CXIA 2IPWA 4MLJA 1B5TA 2G8ZA 3AHVA 3MV01 3TSMA 3QZEA 4WR3A 4DNHA 4DBSA 3U5YA 5A6SA 3VK5A 4HA0A 4M0XA 4C6BA 4XD6A 3WD3A 1K8YA 3NYZA 1Z44A 2AQWA 2GPTA 1OYAA 2C7FA 3O9NA 1FWIC 4KESA 4QLLA 4MSSA 2WM0A 1EDTA 1TVPA 3M0ZA 4S3CA 1JXKA 1JFXA 1AJ0A 3AS3A 1M9HA 1RLCL 2W4XA 3KP0A 1WXYA 4XAGA 3PN8A 3BOXA 4LYPA 3N9KA 1Q6EA 4H9MA 3WUEA 3ZWSA 3L4VA 1DJGA 2OEMA 2E6AA 1BXNA 1W3LA 4LS0A 5I7GA 4DUWA 3K46A 4JIEA 3WFLA 1OFEA 2F84A 1UROA 3NURA 3KBJA 4ATDA 4HK7A 3USBA 2P5NA 3WEMA 1ZS2A 2BHZA 1H7RA 4O52A 1CECA 3KBWA 1CLVA 4LVBA 1QNOA 4YTUA 4Q6XA 3BV4A 1KGXA 3IJ6A 1VB9A 1K02A 3AMCA 4H41A 4LV9A 4F79A 4OBRA 4XBJA 3RILA 1UIPA 1OGSA 3P67A 2ZIDA 2FZDA 4HNLA 3PZMA 3KLLA 3G1RA 3ZJ8A 1UR1A 4JYFA 2V5CA 1BXCA 1F6PA 4RE0A 3CUGA 3G1DA 4LCRA 3GB6A 4IG2A 2HS8A 4JFWA 3S83A 1EPVA 4A3HA 1DIEA 1XBXA 1BLIA 3OGVA 4P2VA 3BK0A 3HPSA 4WXZA 1AD4A 1LT8A 4PUEA 2DFAA 4ADSA 3P14A 5IHSA 3GW0A 2NVDA 1R3QA 1EDQA 2CLFA 3RDKA 4IJRA 1VRXA 4HPHA 4MHBA 2R82A 3OBEA 3UP8A 3QC3A 2J74A 2FZNA 1B90A 3ZWTA 4X3ZA 4M80A 4QEHA 4H8UA 5CPSA 4ZTYA 2HTMA 3LY0A 5C55A 4Q4RA 1Q2RA 4N9EA 2BVWA 3TW9A 5J5DA 4CNPA 2X1UA 3VOGA 1E9YB 1R3VA 4AYGA 3MV11 2ZBTA 3VD7A 3GG7A 3TN6A 4HU4A 4JPGA 2CNCA 2AAMA 5CPOA 4IXHA 2MNRA 4FNPA 4B5TA 3VNIA 4AYSA 2Y7DA 1LBFA 3LCWA 2X09A 1JVNA 4HYRA 4EOUA 3HM7A 2OGYA 4I3GA 1KR0A 2QUUA 3QLLA 1EJSC 5JBDA 2CKSA 4JEQA 3T42A 4IL0A 3CWOX 3H2OA 2Q01A 1W5MA 3A5FA 1C8QA 2WKGA 3INPA 3MU7A 2BODX 3FDKA 3VDBA 4Q4PA 4W9TA 3LERA 5D2VA 4GGHA 2WZMA 4GZEA 1Q8AA 4PA8A 1U83A 4PTDA 3T07A 3KBSA 3UWZA 3TTEA 4GUGA 4GJJA 3HG4A 4ZZ9A 1EIXA 2QCCA 3FJ6A 3N25A 4QHRA 3IEBA 3TKFA 1VEOA 3OU8A 3N9RA 4O14A 2A7PA 4PGLA 3PNZA 1KQZA 1ZTVA 3LBMA 3GH7A 1NSJA 1TPH1 3PG9A 1TRDA 2FZ9A 1MFVA 4YMZA 1X38A 1G01A 3NTYA 1DYSA 3QEZA 1TQXA 1XLAA 1UUOA 4B9YA 5H2ZA 3BLLA 4GXWA 2R91A 3UF9A 3R2GA 1QNRA 2DUAA 3HN3A 1IQ8A 1S3HA 2A4AA 2CITA 3ZR6A 1TO3A 2D2JA 3HTWA 2ISDA 3S3GA 1XUZA 2ANUA 1JD9A 4WDWA 5BROA 1AW1A 1IGWA 4QAIA 4ZO9A 2Z7KA 3RX2A 4QDWA 3WQPA 3VKJA 4I8DA 2PAJA 2WNQA 3K5XA 1WUFA 2GL5A 2P0OA 2WKJA 5A6LA 3PZOA 3S2CA 2I16A 3K8KA 4MNLA 2EJAA 3VOIA 3NQAA 3W00A 1I2QA 1G6CA 3HA1A 3F4NA 1VP5A 3S1UA 3PBGA 3W7RA 3W7KA 3TQPA 1EFZA 5LIWX 3VZXA 4JQ4A 3SSZA 2YYUA 4F0LA 3P82A 4RR4A 4MUZA 3RHGA 4RDVA 2A2IA 1E73M 4XTIA 5I23A 2X1TA 3SQMA 4YLWA 3ITVA 2D23A 3SBFA 2DJLA 4WX2A 1BSIA 3HMCA 4MZ1A 1YXDA 5CC7A 2C18A 4HB7A 1H09A 3EXRA 3VNKA 1QNSA 2ATMA 3NQGA 4EPEC 2OVLA 4NKCA 5D04C 1MRAA 5FJPA 1OF6A 3HFYA 2D1ZA 1QI3A 1EB3A 2DEPA 3ZIZA 1JPDX 2ZRWA 3WLPA 1YTEA 5EFDA 1TV5A 3L5LA 4AZHA 3W24A 1ALDA 1R9XA 2C71A 3TMLA 1QRQA 1X96A 4UTTA 3B8DA 1W5PA 2RJGA 1H7PA 2FZ8A 3PTMA 4P8XA 3S1XA 1UKTA 2WMJA 4GXMA 2C8NA 1M7PA 3A9BA 3WBYA 2Y1HA 4XISA 5IOBA 1F6KA 2HCVA 1NWUA 1YQ2A 2VGIA 3MTWA 1SW7A 2HJPA 4YWSA 1Q7ZA 4LSBA 3KS5A 2JKAA 1CGVA 1EXBA 1UR0A 2F6UA 4UR9A 2E77A 2HS6A 4RK8A 4LRSA 3E2QA 4ATLA 4RXGA 5DCBA 2QT3A 1BG9A 1IEIA 1TX2A 1UD5A 1XCWA 4O57A 2G97A 3TLQA 3GE7A 2I5QA 1IT7A 1X6LA 2E68A 2ODOA 3WZ0E 1TRIA 1OCNA 4MWAD 4O0ZA 1QPRA 1Q5MA 1RA5A 3G8RA 2XH7A 4WOQA 3AYSA 4GHRA 4YCPA 2Y7EA 4JTCA 3PK7A 4Q8MA 1SM9A 4GE8A 4R9XA 3PUGA 2WBKA 2CLHA 2OKOA 4XAZA 4YCOA 4WJ8A 3PTQA 1XXXA 3A4XA 2A0NA 5A1AA 5CZSA 2R1NA 3WQWA 1JCMP 1V77A 1OFQA 6REQA 3WDIA 3MSYA 1CXFA 1CLXA 2PBOA 4Z2GA 3AUJA 4PUKA 1DHPA 3TAKA 1CZ1A 4H6EA 1M68A 4X22A 2NQJA 1E15A 3OLDA 1K8CA 4OUEA 4Q4QA 4IQEA 3LPFA 5BYWA 1THFD 1XDJA 2J13A 2R1LA 1FWFC 1FWHC 2ZZ1A 1BYBA 1KFLA 4Q8PA 5FA5A 2ZVRA 2PMQA 1JRCA 4CD4A 5A8MA 1PBGA 5DBUA 1XLDA 4NIRA 2EPHA 2FMNA 3NGFA 2D3LA 4NZ1A 3II1A 3O0KA 1TE6A 1BKHA 1VR6A 4HJFA 4AD4A 2OU4A 3LSCA 4Y9OA 1E5NA 4IQJA 2HDJA 3AIQA 2GUUA 5DT5A 4J5NA 3N19B 1B2YA 3UPMA 3KVLA 1FHLA 4ZQPA 4HZ7A 2E1DA 3WD1A 3TN5A 4EACA 5C8BB 1W3NA 1KRBC 1GKQA 1UQYA 4PTNA 1KGUA 4D1JA 1S39A 3SFKA 3UJRA 3W7PA 3W38A 1WV2A 3BICA 2AGKA 3WQFA 3LGDA 5CPNA 2EPMX 4GOAA 2WZIA 3EB4A 4KRUA 4HJWA 4DO6A 2GDUA 2E25A 3CS2A 2AL2A 3N14A 3VI2A 5I6SA 1US2A 3AAMA 4LUYA 1ADOA 3PWGA 2ZUVA 2ZZ6A 1MZRA 2IMRA 2V6AA 2IW0A 1J8VA 3QSRA 3MMDA 3WK0A 2ON3A 1AQFA 1Y8BA 2JBMA 4GZIA 4MJ2A 4AX6A 4OJYA 5C2CA 4GQGA 4E38A 3DHPA 3LDVA 2Y70A 3BLEA 3EA1A 1S2VA 3KL0A 2I1OA 4IX0A 2VOTA 3HV9A 1ICSA 4PB5A 1TV3A 1LQAA 3HU7A 3S5SA 1JUBA 3DKLA 3FEMA 5ABFA 5JVLA 1X7IA 4G2DA 1YTDA 3MMWA 1ZALA 4HNVA 2IPJA 1XHGA 5M5DA 4HHMA 1BWLA 1VEPA 1RPKA 4HHPA 1U1UA 2QNEA 2VMFA 2VC9A 1JNEA 4M51A 3UG3A 3W76A 3WUFA 4RPQA 4CN4A 3POHA 3T2OA 3LTSA 2GGHA 4JQ3A 4WY0F 2FHFA 1TTQA 2X0SA 1F8MA 3AFBA 3VGGA 1E0XA 3PUDA 1DTNA 3GH4A 2R94A 4JL1A 2PBGA 3O07A 1B1YA 4O8RA 2ATSA 2FDSA 5GJPA 4K37A 2VFHA 4OFCA 2VURA 3RJYA 2ZWYA 3S42A 3C52A 3GX9A 1KKRA 4XD5A 1NF7A 2WOQA 1PKLA 2PWHA 2QUVA 5EMMA 2YGYA 2WB5A 4O1AA 4HKPA 4JICA 4JTSA 2OWXA 1FWWA 4O18A 2HROA 1YBQB 1UZ4A 3AS1A 4YIWA 3KCLA 1DQXA 1X1NA 1N2VA 3LPPA 1H63A 3SCWA 2QGYA 1SW3A 1KNWA 1I60A 4ASTA 4NILA 1Q85A 4GG9A 4Q22A 3W7QA 1XIEA 4OT7A 3NDOA 2Z1BA 4N6EA 4OKDA 5CGMA 2ZDRA 4WKAA 2GVGA 3N13A 4E4PA 4BY3A 4XBKA 4K36A 1M03A 5I3KA 4IPNB 1FUYA 1ICQA 3ARZA 2ZWZA 1QT1A 1JYVA 2DZBA 3VKDA 4RPPA 2Y8KA 4HMCA 2ZX6A 1LJYA 5K3VA 2NUXA 5FSDC 2OPJA 1PX3A 1H0GA 3FJLA 3VVGA 1ZY9A 1QOPA 4RW5A 1XPGA 3MA8A 1JR1A 4YXGA 3UVIA 2YL6A 4GJ1A 1JD7A 4NZ3A 2I7GA 5FF3A 3MUY1 3CV2A 2FTYA 3H55A 6ENLA 1UKSA 2G37A 1SZFA 2B7OA 1OX5A 4PTXA 3LX9A 4OTKA 5C5YA 1XBZA 3C2FA 2PWEA 1PPIA 1V3JA 3FVDA 3GTIA 4GUJA 3UXAA 2VGFA 4JTDA 3APGA 3AXKA 3DBPA 1RP9A 4PH6A 4U31A 3NG3A 2WMFA 3PR2A 8CGTA 1UR4A 4ML4A 2WWDA 4JX4A 3W26A 1EYWA 1VAHA 2BWGA 3AXXA 3SCSA 3MHUA 1XWYA 5BMWA 2G3MA 3D6NA 2VO5A 1DIOA 1YHTA 2DH3A 1PTAA 1PIIA 1MRQA 1UH4A 1RV8A 3NO5A 3PB0A 4Q3MA 3WD0A 3EDKA 2JIEA 4I9AA 1I2RA 1JXJA 1AW5A 3WQVA 4C6CA 3S5ZA 4K8EA 4QTGA 3MY9A 5KZDA 2NT0A 2XFRA 1XD0A 2XM1A 1S46A 3T0DA 5E6ZA 4B2DA 3A4WA 3DC0A 3LA4A 1S5NA 2RHGA 3OGSA 4JL2A 3ZXWA 3DBNA 1FXQA 1OZMA 3RO8A 2H9AA 2IPGA 2HXTA 2F7FA 2Y61A 3WBAA 4D8AA 2QYGA 3R8GA 4IFKB 4IHCA 1D8CA 1NTHA 5AC5A 1J2BA 1WQ5A 3KUMA 1X8FA 4LUSA 5I77A 2AAAA 7TIMA 2V3DA 3QGAC 3MZNA 3TNOA 2PFHA 1ME9A 3PSVA 1D7FA 1BHGA 2QAPA 3AUOA 1C8XA 5DCEA 4P8WA 1LG2A 1S2WA 4XWUA 3T1GA 1NARA 3WH5A 2V5KA 5I2UA 3W02A 1CCWB 3I10A 4PRTA 2DIEA 3AJ7A 4DHGA 3VO0A 3VNDA 4LS1A 4CVWA 3GC5A 3M4HA 4X2RA 4GH3A 3LQLA 3NQ7A 4DUOA 3IJ9A 3RLUA 4M6VA 2DZVA 3F2DA 2QDGA 3CM4A 3URBA 4REQA 1FQ0A 4P5UA 3B8IA 3R0DA 2RGMA 1WDQA 1QPQA 1W9PA 1HKIA 1YDVA 1OCJA 2DZWA 2WPBA 3R43A 3GNXA 2P53A 3HG5A 3HQPA 4Q8WA 4U33A 2IQDA 4JCMA 5C9RA 3B05A 3GYEA 1VBJA 1GTEA 2J27A 1EUAA 2DT2A 3SCQA 3W25A 3IV8A 3LHWA 1GOIA 3B4UA 1H61A 3VOCA 3W1QA 2B31A 3GTXA 5HJYA 3OODA 3W7GA 1T96A 3VDCA 2VCBA 1GNXA 3PSWA 1GVSA 2WVVB 3V1PA 5CCZA 4LYQA 3ARTA 1JYNA 3LCIA 3MP3A 4MYXA 4B5XA 4UOZA 4DF1A 4MF4A 1W54A 3BL3A 1RLDA 4L64A 5HNRA 1ODUA 3E96A 1Q7MA 3N17A 1U30A 4US6A 4CUCA 4XVEA 3SUWA 3WK1A 2V68A 3D3FA 3SRKA 1WAWA 1AJ2A 5FF0A 1JCNA 3VC6A 1MUCA 2G3IA 2OELA 3TJ4A 5HMDA 4V33A 3B40A 1UC5A 1NFGA 5A8GA 3W2JA 1V7YA 2X42A 1KKOA 1KV8A 3BAJA 4PULA 4LBRA 4TO8A 3CZGA 2PP3A 2JK2A 4LEFA 3SUTA 1FP9A 1TPUA 3DYOA 1W1PA 4WLCA 1EJTC 1OG0A 2FVLA 3AALA 5I3GA 5CZTA 4XIAA 1CIUA 5CJMA 5DQPA 3C0LA 3W01A 1DVJA 3N29A 4I7VA 1V6UA 4IGSA 1B3VA 1REQA 1EH9A 2G0WA 3G1AA 5ECUA 5HMSA 1FWNA 1RALA 1YDOA 2DZXA 3CB8A 1SO5A 5C9WA 1S2CA 2CBUA 3LPGA 2D0FA 4GWEA 3TYCA 5H8MA 2WHJA 5GJNA 2VDGA 1HL2A 3H21A 2A3LA 3SAZA 4FLQA 4WIWA 4KIEA 3ZO9A 4I5RA 2R6OA 3A3WA 4JOMA 4OGZA 4NZJA 5FAJA 3TA9A 1JQVA 3LPOA 4Q8UA 4FIRA 2AMGA 1QXLA 2GGJA 3PUOA 4UMBA 2MUCA 4GNVA 1TZ7A 3U8GA 1ZQ5A 5B80A 4EPDC 4HZ8A 1TR1A 1A53A 3G1XA 3RX3A 1XDMA 3SY5A 1RJQA 3VGDA 1AQ0A 5AVHA 2FVKA 1VCGA 3GVVA 4IPLA 2NUWA 2ONEA 3PUEA 2UY3A 2EHHA 4G5DA 4O4WA 4G7FA 1ZBCA 4LW7A 4GGBA 2I9UA 1QVBA 4CNNA 3CIWA 2F9RA 1FWRA 1KV5A 1WX0A 3N2MA 4L5ZA 4MYAA 1R3YA 2Z24A 3FDGA 2BY0A 1VFOA 3VU2A 1CENA 4NHVA 4XUGA 3S9IA 4BHYA 2DP3A 5DLCA 1LOSA 5EU9A 1TE1A 1YPFA 2EXOA 4D8LA 3T44A 3EOEA 1O5QA 4M6PA 1I6NA 4IXXA 4K8HA 2J24A 3GDLA 3HFTA 1UH2A 1K7EA 1I2PA 3OEXA 1PSCA 3W88A 1ITQA 1GZ1A 1ADDA 2Y24A 1XDLA 3F5KA 5MF5A 4KEUA 3DEQA 3SEPA 4D2JA 3LSBA 4G6CA 1W9BM 4JTKA 4GRSA 1U1JA 5DXYA 3KTCA 5D03A 2C16A 1O4UA 2ZXBA 4NI3A 1RCXB 1LQ0A 1PL9A 3TE9A 2VC6A 2EBNA 4N2YA 4DYKA 1L6WA 2W3ZA 3I3EA 4A4AA 2NX1A 3REQB 1WNOA 4N4PA 3RLGA 1NVMA 2F61A 4HNCA 4MDOA 1G4SA 1P0NA 5EKYA 4IGMA 4P7OA 5CZKA 3W28A 1XYBA 5IM51 2QEZA 4O17A 2BS9A 3ATYA 3SO7A 5JH1A 1ZFJA 4AVOA 1EC8A 2OT1A 3LCXA 3WLJA 3IAPA 4UFMA 3G1SA 5DFAA 3A47A 1S5MA 1EGMA 3S9ZA 3SN0A 3CZJA 4HSHA 2I14A 3DGBA 3AQUA 4PCTA 1CLKA 2VHLA 1W3TA 3BLPX 2HISA 4HT3A 2YCKX 4Q8QA 5EFFA 3H26A 1ISVA 3FA4A 1EF3A 4MLRA 4KCVA 5E0CA 1DJIA 3G24A 5HINA 1UHVA 2ZRUA 3LLFA 1VIWA 2XGZA 3OP2A 1W8SA 1BWVA 5A6BA 3K4AA 4H1ZA 1UKPA 4A21A 1WDPA 4NNCA 3FCPA 1QI0A 1GZJA 1P0KA 4HA3A 4LU0A 1YMYA 5CBJA 1R87A 5HQEA 1M5WA 4HNNA 5KINA 1PDZA 1A47A 4JHZA 5AY7A 1K4HA 4UTIA 3S6TA 3SGGA 1MI3A 1JZ3A 3ONBA 3RIKA 1EL3A 2QV5A 4WGHA 5FEXA 4XG1A 1FWCC 4EPBC 1AH4A 1H49A 2QCMA 2PDKA 3W85A 3NZRA 4S1FA 1PEZA 3VE9A 1O12A 3M0KA 3TYUA 3Q65A 3IACA 1DQWA 3SR7A 3P93A 4V28A 4F0MA 3ALGA 3DKJA 1GJPA 5FL0A 1G67A 1IWAA 3BURA 4K1WA 4M3PA 3BZGA 2XGIA 3EOLA 3LRKA 4UZSA 1F5ZA 3ZJKA 4GIRA 4GZJA 2VNCA 1AJZA 1SO3A 1TPB1 2YOCA 2V67A 4HIBA 4GYFA 2V2CA 1W2PA 3THQA 2VT0A 1OYBA 1MFUA 3AC0A 3BSMA 5A6TC 3PWIA 1ISXA 3VPLA 4A29A 4QBXA 4LEQA 4D1IA 5G1MA 5IRPA 3LD5A 2POZA 3TEVA 3MS8A 3BLDA 1I0DA 4RZ6A 3PBMA 3G0XA 4W7WA 4H9ZA 1Q6RA 3B9DA 4KFPA 3QJAA 3QLDA 5I06A 3CT2A 1V6WA 3EDJA 4GX9A 3PY2A 3R7MA 3F4WA 1A4LA 3LENA 3LN3A 3WD4A 3EYPA 4GQBA 5D30A 3BW4A 4D6JA 3I7QA 2CHRA 5CAHA 5G1YA 1I1WA 4NJGA 3TW7A 4TOQA 2OB3A 5D05A 4OOZA 4C6LA 1SQ7A 4AZ5A 1Q6FA 2DDXA 3QYSA 4IP4A 2ZZ7A 4AB4A 3OGRA 1V8EA 1BTCA 4JS3A 2BVYA 3QY7A 4US5D 2RDUA 3R25A 1RUSA 3PTKA 2PDQA 2DUZA 3HF3A 4DYJA 3LXBA 4GKTA 2HWGA 3RGTA 2Q8LA 1Y5WA 4QSFA 3XINA 4HD5A 4F66A 3GC2A 4B5VA 1GEQA 1K77A 1V3KA 3S46A 1XIDA 4JTFA 4KEMA 4CVUA 4LUTB 2Q3OA 3FKKA 1C8VA 2H8ZA 1XQKA 3S2NA 3TOYA 4RDWA 4IT1A 4NXKA 1C9WA 5DRIA 1W32A 2RFGA 3MYOA 4W4QA 2EPLX 1A3WA 3C8FA 3U2ZA 1HQTA 4Z2LA 5LXXA 5DX7A 5AHFA 1F07A 1FKWA 2YL8A 2R8WA 2ZOXA 1DWGM 1HO4A 4V15A 4CKQA 4IL2A 4MJ4A 2CEQA 3ABZA 1IEWA 2O7SA 7ODCA 3C2EA 3TLLA 4N0RA 1TJ1A 3QQ1A 5AN7A 4CQ8A 3N12A 4B4FA 2UY5A 2VM8A 3O06A 1BQGA 3M07A 4E8GA 1BF6A 5E93A 3LV6A 3GZ3A 4UC5A 4JTHA 4N02A 4IPJA 4D6HA 3UWYA 2F2HA 1HP4A 2GQAA 4QLJA 1S1RA 1VKFA 1UIOA 2ASHA 2J4GA 4CQCA 1OIFA 4NJKA 2E9BA 2L5HA 1ITUA 3I4EA 5CEWA 5C2XA 4XZMX 5D2YA 2ZRXA 4I8YA 3PG8A 3QMTA 3WSUA 3PBUA 4H04A 4O1CA 4YTSA 2IKIA 2OLSA 3WIJA 3OZPA 1Z6KA 1XIIA 4S23A 5T26A 1TA3A 3T9PA 2OZ8A 2BVTA 3FYPA 1CGYA 1E1CB 4F48A 4JFUA 4R53A 1Q2SA 4JTQA 1CXKA 3LNPA 3GNDA 5MHBA 3NNTA 1XYFA 3G5EA 6XIAA 2YXGA 3IIVA 4U3AA 1DXIA 2BASA 4AVNA 4AIUA 1Y5VA 3CPUA 2UY4A 2OR2A 3TSBA 3VC5A 4AUBA 4KGJA 3ARXA 1LL6A 1LWHA 1ZNNA 1SO6A 3GR4A 4KPLA 4ZOBA 4WF7A 3UYCA 5IDIA 3WCZA 1Z89A 3IRDA 2J66A 4ORMA 3GVQA 1TV8A 3VUPA 4BKNA 1B31A 3LXAA 1VJIA 2QUMA 2YB4A 1IIHA 4LX4A 4W87A 1TFVA 4Q8NA 4RZ5A 1DJNA 5G2WA 2DH2A 3NQDA 2Z25A 2ZVIA 5HNNA 4JTRA 5IHRA 2X05A 3MKCA 4DEFA 2DJXA 3VOFA 2XISA 5FACA 1CB2A 4F0KA 4AHQA 1A0DA 1E3ZA 4JTTA 3HGJA 4NJHA 4HA4A 4ACYA 2AGTA 4W8AA 2VR5A 3LBCA 5J04A 3NCOA 3NQ8A 2V30A 4INFA 3BJFA 3IJIA 1DORA 3OA5A 3XIMA 1GYMA 1JPKA 4XZIA 4NAEA 3V4BA 5BRPA 4MVAA 1QR7A 1R6WA 4PTMA 4C1KA 1FCUA 5XINA 4NG3A 4IG2B 1LT7A 4DF0A 3A12A 1L6YA 3B4YA 1DIDA 2FZBA 1ELSA 1WBJA 2VZOA 3ITGA 1S5TA 5BOEA 4JY9A 2RDWA 3GVRA 4JHOA 4O13A 4RKAA 3ZJ7A 3NSMA 1XICA 4N9BA 1VEMA 3VX0A 1HL8A 4AFYA 1SFJA 3GDTA 5D2TA 3ZSTA 2E6YA 1R7AA 3L0KA 1TR9A 3V75A 4EXBA 1W1B1 2ZUMA 1Z69A 4DJEA 2CKRA 3FYYA 5D38A 1XQLA 1EGZA 2E09A 5HNTA 2BGNE 1K03A 4FLOA 1RZMA 4AWEA 3U48A 1Q8JA 2HZGA 1UR3M 1DJWA 3KDNA 2YA1A 4Z42C 2XJ7A 1SMDA 1GYNA 1BRLA 3BAKA 4NASA 4KKXA 4N4QA 1MO0A 1GOKA 3S6DA 4C6DA 4IMDA 1XLLA 2Y2WA 2CW6A 1YW1A 1Z7AA 3S47A 3KL3A 1YPXA 2PLJA 2I5IA 3P2VA 4M7SA 1EJXC 1PO9A 2ZZ2A 3CL8A 7CGTA 1JL8A 2D3NA 2OT0A 3WJSA 2IKGA 3W83A 1UZHA 1GORA 1UJPA 4GYPA 4AISA 2QCEA 1ZZMA 2GOKA 1XLHA 1HJXA 3RJXA 3SJNA 1EX1A 1W1TA 4JY8A 3KTXA 3H2FA 4P7NA 4BI6A 1GOQA 3QXBA 4PUJA 3SGZA 2C13A 4UR8A 5DN1A 3O6DA 3F5JA 2ZADA 4QJ3B 3M0JA 4AY8A 5FJOA 2A7NA 2CETA 5A6MA 2GQ3A 3WMSA 1TUXA 3B03A 1UMYA 1UP0A 2PDXA 3LGEA 4LAKA 3GG0A 2A3AA 2W5FA 1UJQA 3RXZA 3A4AA 4S3EA 3NA8A 2CWNA 3B0PA 3O16A 5LSMA 1GVFA 4W88A 3NQ6A 1C93A 5F2LA 1DXEA 1YXYA 3TCEA 3WQ6A 2OODA 3WJWA 5I0DA 5KITA 1FP8A 2W61A 1B54A 5D8ZA 2OJPA 3B04A 1OX4B 1V3LA 2O9PA 2YBUA 1OADA 4IPPA 2PE4A 1EQCA 3NUKA 2F38A 5BOOA 3W2LA 1FCQA 3OBKA 4Q4OA 2GJRA 2WC7A 3W29A 1ZJIA 4XB3A 2V5JA 2XSBA 1UWSA 1WPCA 3GXTA 1A50A 1ZL1A 2EF9A 1X1ZA 1DJXA 3KHDA 2GWGA 1VJZA 1E9IA 4QP0A 5KZ6A 3N6HA 3N9SA 3DU0A 2PB1A 4MKSA 4HPGA 2V82A 5E1QA 1XIBA 1L9WA 5FEWA 4AX7A 2Y8UA 2PTWA 5G4EA 2BB0A 2X2GA 4I6KA 1VHNA 3VFCA 4GI8A 3S4TA 5A2BA 3A23A 1UD2A 4JFVA 4TXEA 4JYDA 5EMUA 3AYVA 4I9MA 4RNFA 4NZCA 3HJEA 4V2XA 4EANA 3SECA 2XUCA 1MW1A 2QPUA 2QF8A 1EOMA 1C3FA 2QDDA 3H4WA 3SY8A 1S1PA 3AHZA 4M1BA 5K9DA 4DLFA 4Y96A 1OT2A 3BARA 1E4LA 1R2TA 4C5YA 1LTDA 3QQWA 3M41A 3O6AA 5I5RA 4JX6A 3UYIA 3DYMA 4N9CA 1O94A 1CI1A 4E0CA 1KM2A 1K70A 3GY1A 3NM1A 3TJLA 3A13A 2WNNA 3RM4A 4R7JA 4MJMA 4Y90A 4D6DA 2Z6IA 3VYLA 4EP8C 2XIQA 2YBTA 1SFTA 3PPGA 4M82A 2OOFA 2JKPA 4BQ2A 1SSDA 1ZCOA 4JDYA 5ABEA 3TUUA 1TV2A 3P61A 5K4XA 3MQTA 3NFUA 1V0NA 2XGBA 4HN8A 3OW1A 2DW6A 4U5IA 4R3UA 3M64A 4GYJA 5EMYA 4Y7EA 4H01A 4GYKA 5JIWA 2DVTA 5BXRA 4IFKA 5HAOA 2YFNA 1UC4A 5CPTA 3QOMA 1EJVC 3F5LA 4H19A 1QCWA 4HPNA 1XL9A 3RX4A 3CQ0A 1E70M 1UKOA 1XS2A 4NAFB 3ZT5A 3GXPA 4GFIA 1TPC1 3TJIA 4EX4A 1EPXA 2BTMA 4J28A 5I3IA 2JQXA 1EJUC 3IV3A 1O1ZA 1D3HA 2CESA 1E6XM 1UWTA 3H4GA 1AZ2A 2GDQA 1W0MA 6PTDA 2XG9A 2D73A 2BY1A 4IIGA 4J2MA 2JFEX 3CH9A 3K8LA 1RBLA 3PFMA 4HHLA 1FY6A 3LZ5A 1G4TA 4CEUC 1QW9A 1SMAA 4GQRA 4ZFCA 2JEQA 1H5VA 1IEQA 2PLKA 4WJXA 2QHAA 4RDYA 6ALDA 1YTKA 5AYIA 6A3HA 4F3HA 4XKYB 3UERA 1SR0A 1DV7A 1TMLA 4PTWA 1NJJA 5E0KA 3FKRA 4MM1A 3DESA 2DSKA 4HQVA 5AYZA 2QCNA 5BRQA 1QNQA 2J77A 1LRTA 4PSRA 3M9YA 4C1LA 3IS4A 3O63A 3HPFA 1U22A 1A0CA 1XYLA 3W7DA 5HXMA 2BXZA 3BTNA 3P0WA 4JIRA 3UJSA 4FSAA 3F2BA 2PWVA 2WVVA 5XIAA 2C79A 2BSLA 5C0QA 3MWAA 3NQ2A 2OSYA 4C6MA 1OGGA 1EP1A 1JZ2A 3RPMA 3HPXA 1CB7B 1HKMA 3V0TA 2NLYA 3VNMA 1JZ8A 1S38A 2WJDA 2OQHA 4TVDA 4Q8VA 3ARYA 3HV8A 1W3IA 4A05A 3L4UA 1DL3A 2X0YA 3LCGA 4LUJA 3UZYA 1LLZA 3AU6A 3GC4A 1SW0A 5F4SA 3BSGA 3QHMA 2JEPA 1PWLA 5CSSA 3AO0A 3J7HA 4H9VA 1IR1A 1IEXA 3UXIA 4XSMA 2BY3A 3EMQA 1OEPA 4ERIA 5L9FA 3NL5A 3CWHA 3BGJA 1VFLA 3WG6A 3URAA 5HATA 3COTA 4GBUA 5EY5A 2BHYA 3N04A 1L2QA 3AS2A 1F6YA 3K13A 4ZO6A 4HMEA 4FNRA 3K1GA 3B8VA 1JULA 4ZB5A 3O7UA 5DELA 2PLCA 3N2CA 1TVNA 4TX8A 2J9YA 1E6PA 5LYRA 1CXLA 3VD4A 1R30A 2GK1B 2C6QA 3VKKA 1ZLPA 4DWSB 3FA5A 1J10A 1KXHA 3V5CA 2GYIA 2DT1A 1GHSA 2OSWA 2VJXA 1A3XA 2PDCA 1E55A 5IBXA 1ONWA 1ONEA 4MFEA 1OM0A 3BE7A 2CFFA 5AHEA 1VF8A 5A6JA 5CPQA 4Q6JA 3IGHX 1LP6A 4YWIA 1RQBA 3QY8A 3LMYA 4FXSA 4UR7A 2OLHA 3T8QA 3L5AA 2BDQA 5FEPA 9XIMA 5C9UA 2VCCA 2FFCA 1FA2A 3VGFA 2Z7GA 1KWGA 4H9TA 9RUBA 3M5XA 1T0OA 5ABFB 4CNOA 4S3GA 4F8XA 2BX7A 3I65A 1EHAA 4QISA 4V1YA 3CHFA 4RLIA 2BXVA 4D6CA 1VD6A 4C7DA 4QXIA 1L0PA 4WDTA 1GQIA 1KLYA 4B3KA 1BEUA 4GCAA 4Y2WA 3M7SA 2PEVA 4W89A 3OB8A 1OB0A 3CO8A 1XLCA 3EDFA 1V3HA 1EF2A 3AMLA 3SCOA 1YYAA 3V16A 3GNRA 1Q4NX 1KR1A 1PYFA 1EKOA 5KMYA 2CLIA 1KLZA 3BG9A 1K1DA 3ME3A 3KWSA 3EX4A 1OHLA 4R5EA 1G94A 4O0KA 3AWNA 2QIWA 2WBGA 1YNQA 2R1MA 3LEPA 3EZ4A 2FMOA 3Q2DA 4PFMA 3W7NA 2VGBA 3B0UX 3G1YA 4E3TA 2NSXA 4FNSA 1WXJA 3LV5A 4EWND 1KC7A 1PVNA 1P43A 3N2OA 3WQOA 4J3TA 3BQ5A 5D32A 4U4MA 3MCOA 4OV4A 1HFBA 3N18A 3W7HA 1C91A 4B16A 3WQCA 3TQ0A 4LCSA 3TAOA 4XD4A 3REQA 3STEA 4LRTA 3WL0A 4UQDA 3CHVA 3EWYA 4LAZA 1TZZA 4LANA 1HN1A 1AH3A 3CUXA 3PZTA 4J27A 1ADSA 4KWWA 3GFXA 2C1IA 3WLHA 3WELA 4MZYA 4RDZA 2VX7A 1KXVA 4NRRA 3LCLA 1CYGA 3R6IA 1D7KA 4QQ3A 3WF3A 4WCJA 3G1FA 3W73A 1KRCC 2BP1A 1EEXA 4Q7IA 1HKVA 4D6FA 3AJXA 4ZR8A 1NOUA 2B7QA 2XVPA 2PDJA 4E6MA 5BU9A 3IPWA 1ECQA 4YHEA 5HMFA 3T4WA 2Z4GA 3OVRA 5CZJA 2AQVA 3TWAA 3U2EA 2QULA 3MCNA 5I24A 4C6OA 1SJDA 3UETA 3VGEA 2CBJA 4RNHA 4G1KA 3DG6A 2XFYA 1BYDA 1UW9A 3MJYA 1XG3A 1GJUA 4PUUA 1W9XA 4B3ZA 2EPNA 1MUMA 4BR1A 4HVXA 5D02A 3DFYA 1B9ZA 3W7IA 3GM8A 4DVOA 4KIRA 2VXNA 4Z2HA 2DSVA 4CU6A 4DQWA 4H6QA 3SCNA 1EYEA 4QR6A 1NFBA 3NEHA 4IF2A 3ZS4A 3F03K 3AU2A 1F74A 3ZVHB 4X0VA 5GPRA 3PZNA 4D9PA 3MYPA 1Z9AA 4LBUA 2Z2AA 3L4WA 1TB3A 3TCSA 4FF7A 1D8WA 5JU6A 4ECLA 3TC7A 4DBWA 3W1RA 3UGVA 4L9YA 3N4FA 5EBAA 5CPMA 3N2XA 1XH2A 5C9XA 4NZ4A 3CAWA 5A6AA 4WHBA 4ZBCA 5CQ1A 4L4MA 4XBSA 3EA3A 3GR8A 1CDGA 2PGRA 3N3TA 4AWTA 5CZ0A 4W8BA 3BW3A 4XKMA 3GXIA 1FH9A 4GYPC 3W1NA 1W2VA 2VI0A 4AY7A 3WEZA 3DFQA 4AD5A 2OEJA 3APTA 1Y65A 4A8RA 1R0MA 1LUCB 4R7WA 4W7UA 1VBHA 2VRKA 3D46A 1POKA 3WJXA 3WH7A 7TAAA 4ZTXA 3JU2A 1OC7A 2J78A 2ZYFA 2JALA 4C6JA 3I6EA 3WJZA 4OVXA 3DFHA 1PHWA 2WSKA 5FL1A 1VCFA 3CHCA 3APYA 2ISWA 3DC8A 4HOWA 2V9DA 3D5HA 9CGTA 5BCAA 4DZHA 4RNJA 4XZBA 2GUBA 4Y9PA 1QI2A 4GACA 2ACSA 5H8UA 2FQIA 3PZ9A 3DHUA 2HEJA 1NF0A 2J7FA 3IGSA 1YRRA 4G56A 2RUSA 3C8NA 1J0YA 1J6PA 3S0CA 5BXPA 4AEEA 3FW6A 1KTBA 3GKAA 4JFSA 3GQYA 3BLFA 5PTDA 2O4QA 3THAA 2IKHA 1KFWA 1L6SA 2ZQ0A 5CKSA 5C9ZA 2HPIA 3QR1A 3CQIA 3W2MA 3OZMA 3PZIA 1B4EA 3AHTA 4R27A 2HBVA 3NVTA 8A3HA 3NZQA 1NH6A 3SI9A 1G1YA 3TIMA 2GVYA 2YDSA 1Y5XA 3S5NA 2A79A 4W85A 1P7TA 2DVUA 4JNYA 5HR7A 4AD3A 4POCA 1ICPA 4XD3A 1JPMA 2YDRA 2QF7A 4JIPA 4L4OA 3FSUA 4WSHA 1OG6A 5CAKA 1T41A 2E7FA 1Q6QA 3VZYA 4BA0A 2Z6JA 3OJGA 1W1VA 4QX4A 1IXQA 3DECA 2JF7A 3O05A 1RQHA 2Z27A 5DMNA 1W3JA 5HPCA 2D20A 3UR8A 4AZ7A 2G41A 1GQJA 3M0MA 3G6LA 2A3CA 3UU0A 1UYQA 1MWOA 2ZUSA 4AZIA 1WOAA 4UTJA 3N15A 4LYKA 3VIJA 4JNZA 4HPXA 2OO0A 5REQA 3GTHA 3KWXA 2G3FA 1EHNA 3B9EA 3AMDA 1TJ0A 2AKZA 1X6NA 2QCDB 3H22A 3MANA 3BLOA 3IUHA 3WNNA 3OHIA 3W37A 4DAFA 3LB0A 1BYCA 3CAVA 4GIAA 2DIKA 1HJQA 2X16A 3RUBL 2WJZA 5AYXA 5AYYA 3KRZA 4ERAA 1IR2A 1FWAC 2VZVA 1BGAA 3DI0A 4M56A 5DEZA 1G69A 2OO6A 1BTMA 1PTGA 4O1FA 4XZ9A 4JDBA 4BQ5A 4A2SA 4RV3A 3VKAA 3UBPC 2CXGA 1XYMA 1UASA 2EAWA 4I5XA 2IUZA 4EXQA 1W8GA 4LH8A 3A64A 1XISA 1Y7VA 4KWSA 3RR4A 3WK2A 3R58A 4AEOA 3T40A 5G5IA 2YA0A 3BG5A 2X1SA 3OO2A 4DF2A 1XYAA 4EF9A 4LF1A 3DI1A 4Q8OA 5FF4A 3PBYA 2PDWA 2CLPA 4M6QA 3B3DA 2QUTA 3GSMA 4PMDA 4GI6A 3L21A 4A35A 1AUSL 3MT1A 2XYLA 2JGQA 4A3QA 2XPKA 2OLAA 1E1CA 1MQPA 2PWFA 5E09A 4GUHA 2VR2A 2ZX5A 3UWEA 1ONRA 1I45A 1DWJM 2ABAA 2ABBA 4JIIX 1XSJA 1FRBA 3HO8A 2WHKA 1FH7A 3LM7A 3PPCA 2GZXA 1Q63A 1TTPA 1KRMA 2J8TA 3E2VA 2O9TA 5F1VA 3BUVA 3GZAA 4MY8A 4W5ZA 4GIEA 3AZTA 3WDJA 5J5RA 1EX5A 2ZX7A 3ITCA 5FEZA 1CTNA 2Z1SA 2GGGA 1SFSA 1XI3A 3UR5A 5U4NA 1Q65A 2R1PA 4DXXA 5AHMA 2E67A 3BC9A 4Z1BA 2R1KA 1X97A 3QFEA 3UCDA 1JRBA 1WDDA 3W71A 4L6DA 2C0HA 5D2WA 4C6KA 4GUIA 3VDAA 3AZRA 2QW5A 3UVAA 4N6FA 2PWGA 2NUYA 3M5VA 4H8HA 4B2DD 1XKJA 2VD9A 4UFIA 4ROQA 4DLMA 3WD2A 5KEZA 5EGRA 5EMJA 3W81A 3WQ8A 3I7SA 3R79A 4H9UA 2UZ9A 1OWQA 3U0HA 3ABRA 3NGJA 5FSEC 4TV6A 1V0KA 4NX0A 4RV8A 3RN6A 1ZAHA 2D0HA 2W27A 2J7BA 4J3WA 2PDGA 4C6PA 3UA3A 3TX9A 4IFOA 2GJPA 1EC9A 5K9CA 5I78A 4F40A 4HK5A 3RFAA 3URNA 4DJFD 1RBOB 4UCFA 2QJJA 1PUDA 1AODA 3GBEA 4KBXA 2PD9A 4Y9NA 5G4HC 1R9ZA 3JZUA 2NWRA 4FNTA 3D47A 4XAFA 3UZXA 3TZNA 5LNRA 2VZTA 2WSPA 1HO1A 1ME8A 3M1ZA 4H00A 1UZDA 1YPIA 4ATWA 2HK1A 3BGAA 4HGXA 4XZHA 3W6YA 4HU3A 5TQLA 1FWSA 1RXOB 3PHAA 2Z1WA 2W0UA 3CEPA 3G6MA 1R3SA 2BGSA 4IJBA 5E5CA 4IMGA 2ZRVA 4A22A 2VENA 2JGYA 3EMCA 4CU7A 1O5KA 3ERPA 5LNWA 4Z2IA 3MUAA 1HTIA 4O15A 4PMRA 4BEUA 4FXJA 3IJ7A 3T0TA 4UTWA 3M0HA 1TPVA 5ECVA 3TYBA 4QJ5B 3ZOAA 5BXSA 4IM4A 2ZRYA 5M2FX 3IK2A 4IIHA 3QPZA 4UFLA 1RR2A 3LHYA 5HPOA 2B0MA 2ZUUA 1R2SA 4GA8A 2QR6A 2A5HA 2CZ5A 4C6FA 5CLWA 4C1NB 1US0A 3BMXA 2OX4A 2VFFA 5H6HA 3IIZA 5DMMA 5EBUA 3RPDA 1H41A 2WZHA 3G0UA 1ZP4A 1SZGA 3GHTA 3TR9A 2J9ZA 3I6RA 4YN5A 2FYMA 4AQLA 4U10A 3QFWA 3UEQA 2XN2A 1RCOB 3KRSA 5F7UA 4MPQA 3MJMA 4O16A 4YU1A 4AZGA 3BXWA 1E4NA 1BPLB 3CWNA 3Q94A 1DQUA 5HJXA 1H7XA 1KQYA 4S3DA 4QIUA 2X1RA 4QG6A 3CUFA 4UTMA 5K9XA 1GOXA 1VYPX 1IZKA 1VQTA 2ZKMX 4XZNX 4GJIA 2CLEA 2O4MA 3ISIX 1OX4A 4NJIA 2OG9A 3DG3A 4CCCA 1BYAA 2W92A 4DBDA 4MDPA 2PGEA 4O1DA 4MUPA 1E51A 4BI5A 3KCOA 4ZGYA 1LRNA 3OYXA 3O3RA 3W7OA 4GZ7A 4WD0A 1SGJA 1ODZA 4UIOA 4FOUA 4M5PA 4U28A 1M04A 1UR2A 3EOOA 3H7VA 3WQDA 3L68A 7PTDA 1MDLA 1NOWA 1HIZA 2ZZ3A 2D2OA 3VIGA 3MUIA 4S38A 4O1EA 3E5BA 1FCBA 1BVZA 4L4LA 1I1XA 3PJXA 2ZA3A 1R85A 5FJRA 2HK0A 1OYCA 1PIFA 3ZJ6A 1HX0A 2WVSA 3NAVA 3FNDA 4GI4A 3PAOA 1VFTA 2V38A 1EZWA 1JZ5A 3VA8A 3QHNA 2IQ0A 2EQDA 4X9SA 1SR9A 1W3HA 3VIKA 5TD4A 1NAL1 2XFWA 5EA9A 4XZWA 4QEEA 2YCIX 1UBSA 2OWCA 4UQ9A 1BKSA 4LVDA 2AOSA 1LF1A 4WY0B 2YFOA 3VX1A 1TWZA 2HE5A 2FGZA 4AY1A 3FHAA 2QPXA 1WP6A 2YCLA 1E1FA 1H1NA 1GONA 8XIAA 2G96A 1JI2A 5DBTA 2OFJA 3A21A 3O2LA 5AHLA 2O7QA 4MY9A 3SUSA 3UGRA 2E40A 3WF2A 5L6UA 1TJ2A 1HXJA 3CZ8A 2CLKA 4X2PA 4CN1A 4F2TA 3V5OA 3HZ3A 3E02A 3RYSA 4YNGA 5HBFA 1UKQA 3VIFA 1QI5A 3WJYA 3CMFA 1H60A 1QO2A 3XISA 3W7MA 3VNZA 1JJKA 1P6BA 4PRWA 4DO7A 2DSZA 4NAFA 3L9CA 3LCFA 3E0FA 3QPYA 1EJWC 2WNZA 2NVAA 4FP1A 4JYEA 3HG3A 2C3ZA 4NQ1A 3TQVA 1CT5A 1VC4A 2Y62A 3N4AA 5CC3A 3AXMA 3THUA 4QQUA 5HA7A 1N55A 1M53A 1BGGA 3EXTA 3E12A 3PP7A 4YYCA 4QE4A 3ONCA 5T9CE 4O8AA 3H24A 3STCA 3SIZA 3MVIA 5A5WA 1GOOA 4MB5A 1VS1A 4KRTA 1JGIA 4NSBA 2X2YA 4GQQA 3B9OA 4XKYA 2OKTA 2C1GA 2QPSA 3MDWA 1E40A 1J9YA 3PZVA 2CERA 4YTQA 1U5VA 4J1OA 1XGDA 2NW0A 4GQ0A 4L9ZA 1Z3NA 3CQKA 2WQPA 1K6AA 1ME7A 4ZCWA 1M7JA 4HZMA 3UWUA 3V0SA 3IJQA 4E2OA 4FOKA 1VH7A 3S2MA 1TPWA 3NXFA 1H0IA 1OINA 2P8CA 5AB3A 5M17A 1LLWA 3W4RA 4U3CA 4PUNA 1JF6A 1QNPA 3VOJA 5AOUA 4DN1A 1DJYA 1HVQA 3GXNA 1WE5A 5LNUA 1CNVA 4AIOA 2QJNA 3HGOA 3TW6A 1TA3B 1J79A 1QOXA 2BZNA 2VX5A 3PJTA 4QJ1A 3BCDA 1H5YA 1PKYA 2X40A 3TN3A 4FX6M 3C0SA 3Q58A 4ILSA 1ZUAX 3TOPA 3TFCA 5A6BD 1IF2A 3DDMA 5AC8A 1ITCA 1XYZA 4IUOA 1XLFA 4JKMA 3OQEA 1E43A 1LRQA 4OBTA 2WCGA 4G7EB 1W1YA 2GQ9A 4MIMA 1WKDA 2Y8VA 4HTBA 3TYAA 5C2GA 1TMQA 3WLKX 3H2CA 3KZSA 1MSSA 3SGUA 3P81A 4AWSA 4JHMA 4XO7A 5EMKA 3NQEA 3E0VA 4E4FA 3P80A 3DZ1A 1LL4A 3SCVA 2A3EA 4QRNA 1I0BA 3U7BA 4RZ4A 3VILA 1Y0EA 1W9VA 1RHCA 4HMNA 5CGQA 1E5JA 4U2ZA 2HSAA 1KO0A 2B81A 2GLKA 4CQBA 4NRSA 4QG9A 2E5CA 3ARWA 3AZSA 1A5KC 1YDNA 4R7OA 4TUFA 2E6DA 4A8IA 1GYLA 3UG8A 4IMFA 4ERGA 4L65A 1E0VA 2GK1A 1VFMA 4BCEA 2VELA 1PJ9A 3GDBA 4DWSA 3C3UA 4NAEB 4UWMA 2VD8A 4FLRA 4FO4A 3T81A 3UNTA 3W53A 4A6GA 2VEFA 2I9EA 2PC4A 3THCA 3R89A 3PZGA 1LORA 1XLKA 1JI1A 3QZAA 3R0UA 3ATZA 4ZO7A 4HCDA 4ZQCA 1V79A 1U5JA 5E0FA 1EDGA 4CCZA 4FI4A 1LZOA 1ZBWA 4P8UA 1B3XA 3N34A 5D8WA 3N4EA 1TX0A 1YKWA 3HBLA 3TP4A 1LYXA 1J93A 4D72A 2DIJA 1QPNA 2YR1A 1JCLA 5A8OA 2EPOA 1E6RA 2CYGA 1XIGA 2YW3A 3ABOA 4Y9MA 4O50A 4UFHA 2WJEA 4KFOA 3W9ZA 4JZ5A 2GSHA 1BRLB 3CQHA 1V0LA 3CQJA 2DZUA 5CG0A 3TR2A 4M8UA 5H8PA 3TMQA 1OFBA 2QCFA 3A3XA 4XSLA 4LGXA 3FJ4A 1GG0A 2D0GA 4UB9A 2PWUA 2DT3A 3SN4A 2O56A 2WSRA 3KS6A 2GFTA 2VRJA 1TWWA 1WOBA 1J6OA 2OCZA 2XN0A 4YVVA 1K9DA 3OG3A 2XSXA 1FFRA 3EBVA 2XH4A 5LA0A 3QM3A 1DXFA 3GW3A 3RRXA 1OGBA 3BLKA 3EOSA 1S5VA 3KOXA 2A1YA 1TCMA 3KFTA 4AAJA 1ZBVA 2BG5A 1MQQA 3UWQA 4PMJA 1OK4A 2Q8XA 2TRSA 5HUOA 1N7KA 2TSYA 3ORWA 5EL1A 5GQBA 4WJEA 3KTSA 1PZ1A 5ABHA 2J9XA 3DFSA 4LY4A 4WVXA 3NZPA 1RD6A 3ITYA 1IYXA 1X39A 4Q7BA 1H7NA 3MBFA 1QTWA 3O6YX 5XIMA 4EWJA 1I75A 5A95A 3MUZ1 3TNBA 3HOJA 4CD5A 3CK5A 4JIHA 3A3HA 1F8IA 1XRSA 5AECA 3EWXA 1DBTA 3WLLA 3EGJA 2XWEA 5I00A 4I90A 3W1MA 5KZMA 3EAUA 1F4HA 1M3UA 4FAMA 5IDZA 2XZ9A 3TQKA 1VPYA 1MDRA 4NJJA 3N11A 2V5LA 1MQRA 5C7VA 1PTDA 5CSYA 4JN7A 3VGHA 1O60A 4NNBA 4ZB2A 3EB3A 3R12A 4QITA 4EPKA 1WYIA 3NPWA 4OZOA 1GVRA 4YTTA 4GXPA 5FI8A 3QV6A 1GQLA 6XIMA 5I02A 1L8NA 4MAVA 3H53A 3WDRA 2G4FA 4W86A 4BF9A 1JQXA 3WMCA 4F4RA 1KM3A 1P1XA 3PPHA 5TNVA 2PU1A 1WZLA 3KHJA 1QAPA 4ZL1A 5B7YA 1AMKA 5BNKA 1H50A 4IICA 4QM1A 1E3XA 4E4UA 1EZ2A 2OMAA 3ZVHA 2BFGA 2V81A 2GQ8A 1OCQA 4LAUA 5A69A 5HQLA 4EXAA 1BXBA 3OVQA 1TSIA 4PCSA 2CPUA 2Z26A 3WQ5A 1XRFA 3SCPA 1E56A 4HMDA 3R1ZA 4A3UA 4GKLA 4BF5A 3DFPA 1G5AA 3GG1A 3VMNA 4KS0A 4DBEA 4KF1A 3A9IA 1JDAA 5DCDA 1YDYA 2VQTA 4LCQA 3W2KA 1MXSA 3GTNA 3N6JA 4QCEA 4AD2A 1TPFA 2G50A 3GDMA 3GUWA 1XBVA 1MW0A 3DAQA 4UUIA 4I9JA 1MXDA 4H9YA 4N9DA 5BOFA 3MMUA 4D6GA 2WZTA 3RR1A 4FB7A 1OFRA 1E0UA 1QUMA 3CNYA 3S5OA 2I57A 1LUCA 5EPDA 1TQJA 2BGQA 4WOZA 2PZ0A 1JCTA 4S2CA 4X9YA 2FDMA 1T8QA 4JQ1A 3PNUA 3KM8A 4ROPA 1N82A 2DQWA 4EVZA 3PB2A 5TBOA 1F73A 1RJPA 4JQ2A 4DJFA 3FAXA 2Q8ZA 4JX5A 3V36A 2VWTA 1WBHA 1JGMA 3NSNA 5C6MA 5FJJA 1GVIA 3MMTA 3VD5A 4PN2A 3AYRA 3FGCB 4K7VA 2O55A 2DSWA 2REQB 1K6WA 4ZSUA 4J2PA 4U2YA 1JCJA 2PP0A 1KM5A 1V02E 2G5WA 3CV7A 2WKLA 2HVOA 2X0HA 3I7RA 1VBUA 4DI8A 4MY1A 5LIUX 3VE7A 4DJED 4PUWA 2DU2A 3R4IA 2WLYA 4K68A 4MNKA 4PL2A 4PMZA 4X0NA 3EKZA 1KBIA 1KM1A 7A3HA 1TREA 1Q66A 1DWAM 2PDNA 1KFEA 4BK9A 4UFJA 2E0PA 4S3JA 3H12A 4OECA 2E5DA 1F3TA 4LY8A 3Q4DA 1T40A 2Q09A 4ZVJA 5GVJA 1FWBC 2XVKA 1TPEA 1NDWA 1NWSA 1ISYA 1WAUA 5LA1A 3V1HA 1SPQA 3RMJA 2RH9A 4L7ZA 4H4IA 2PP1A 3LRLA 3PWAA 4LC6A 2ZZ4A 3L2IA 1FHUA 2C1HA 1OD8A 3KOWA 4HOXA 2A21A 2Z1VA 3P74A 4BWLA 3R5EA 3KOFA 1V93A 3N2TA 2ZE0A 1XIFA 3WMBA 1QW8A 1UD6A 1V4YA 3T09A 4PMVA 5B7ZA 2YL9A 4PEKA 2Z2BA 1WO2A 3G18A 1H62A 1XLEA 1V02A 4O28A 3P3BA 3NPUA 1O5XA 4PMOA 2DZAA 3EKGA 1AH0A 1V7AA 3VD3A 4WRHA 2QCDA 3G8EA 3VM5A 1XLMA 2PF8A 2PDYA 1TTIA 2W66A 2O9RA 3W1XA 3WLIA 3IIPA 3BLIA 2NWSA 4J3XA 3M44A 1XLJA 2IS7A 3JRKA 4BF7A 1E9LA 1H7WA 3GIQA 3WYZA 1OQFA 4LFYA 2XVNA 4FX8A 3WUBA 1DHKA 1UWQA 5AVNA 1RCQA 2OGJA 4D8ZA 1JNDA 3MCMA 3EMZA 3K4WA 4J3SA 4TMBA 2FH8A 2QZRA 1CXHA 4UTTC 1F9CA 5I79A 3G3DA 1WA3A 4PRRA 1PB0A 4ZQNA 1W5NA 2XINA 3DG7A 3MHGA 3K2GA 4UTFA 4F0HA 1V0MA 1JUEA 2E8ZA 2GJLA 3W1AA 2V5BA 5H91A 3ALFA 3CHEA 4M6UA 1W91A 4NYYA 3U5UA 2B7NA 4LUIA 1EJ7L 2NV2A 3ZT6A 4W5UA 1IXNA 3GO2A 1TELA 2R14A 3RO6A 3ABXA 2VC7A 3HPAA 1KB3A 1JDFA 5JIPA 3TYEA 1R47A 4U5KA 2VZUA 4FNQA 1QBBA 3QGVA 3VM7A 3GG8A 3F4CA 7XIMA 1ZBKA 3FJNA 4B9ZA 1HNYA 1I8JA 4M24A 3RU8X 2P3EA 1TIMA 2EJ1A 1LLOA 4IGHA