1A80A

Native 2,5-diketo-d-gluconic acid reductase a from corynbacterium sp. complexed with nadph
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
277
structure length
277
Chain Sequence
TVPSIVLNDGNSIPQLGYGVFKVPPADTQRAVEEALEVGYRHIDTAAIYGNEEGVGAAIAASGIARDDLFITTKLWNDRHDGDEPAAAIAESLAKLALDQVDLYLVHWPTPAADNYVHAWEKMIELRAAGLTRSIGVSNHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDWAAAHDVKIESWGPLGQGKYDLFGAEPVTAAAAAHGKTPAQAVLRWHLQKGFVVFPKSVRRERLEENLDVFDFDLTDTEIAAIDAMDPGDGSGRVSAHPDEVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 2,5-diketo-D-gluconic acid reductase A complexed with NADPH at 2.1-A resolution.
pubmed doi rcsb
source organism Corynebacterium sp.
molecule tags Oxidoreductase
molecule keywords 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE A
total genus 105
structure length 277
sequence length 277
ec nomenclature ec 1.1.1.346: 2,5-didehydrogluconate reductase (2-dehydro-L-gulonate-forming).
pdb deposition date 1998-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1a80A00
5M2FX 4DBUA 4JTAA 3H4GA 2PDWA 4HBKA 1IHIA 2CLPA 4LAUA 2ISFA 2QXWA 3B3DA 2NVDA 1XF0A 2PFHA 1PZ1A 3F7JA 4JIHA 4XZMX 3V0UA 2ACQA 2I17A 2IKHA 1YNPA 2NVCA 4GQGA 3CASA 1RY0A 4L1WA 2PDKA 1MRQA 4NKCA 4RPQA 4YVXA 2HE8A 4ASTA 4XZLX 4R9OA 1AH4A 4WDXA 3WG6A 4IGSA 4YVVA 1S2CA 4PUWA 1S1RA 3UZYA 3LD5A 5KETA 3H7RA 2C91A 1US0A 2IPFA 1EKOA 1AZ2A 1QRQA 3O0KA 3LZ5A 1T40A 1GVEA 1Z89A 4XVDA 3WBXA 3P2VA 3GUGA 4QBXA 1JEZA 3M4HA 3M64A 5LIUX 4QXIA 4GACA 2HEJA 1EXBA 1Z3NA 2IKJA 4Q3MA 3CAVA 4JQ3A 4WGHA 2PDQA 3FX4A 2BGSA 1AH3A 4GIEA 3DOPA 3R7MA 3MB9A 3R58A 1YE4A 3Q67A 2DUXA 3M0IA 4HMNA 1C9WA 3H7UA 2PDYA 4JQ1A 3V0SA 4JIIX 3V36A 3RX4A 3LBOA 3NTYA 1ZUAX 2FZ8A 4QX4A 3UYIA 1ZGDA 3MC5A 2R9RA 4F40A 3VXGA 2I16A 3GHSA 4XZNX 3UWEA 1Q13A 2AGTA 3RX2A 1MI3A 4DBWA 2PZNA 4LB3A 3UG8A 4WEVX 2F38A 3T42A 2IQ0A 2ACUA 4WDUA 3ONBA 5DANA 3R94A 1A80A 2ACSA 4L1XA 3R43A 5JH1A 1EF3A 1ADSA 3DN5A 5JH2A 1LWIA 3CV6A 3LUTA 4YU1A 2PDHA 5LIXX 2HVOA 4EXBA 1S1PA 4PRTA 1PWLA 2HDJA 4XK2A 2PEVA 2IKGA 4H7CA 1HW6A 3BCJA 3UZWA 3D3FA 4OTKA 4JQ2A 5LIYX 2PDMA 3LN3A 2VDGA 1M9HA 4JTRA 4WRHA 4JIRA 3EAUA 4GCAA 2PD5A 2FZDA 1XGDA 3QKZA 3LENA 4PUUA 2INZA 4AUBA 2A79A 4DBSA 3S3GA 4MHBA 5LIKX 5AZ0A 2PD9A 1HQTA 4QR6A 4I5XA 2INEA 4XZHA 1R38A 3Q65A 2PDBA 3R8HA 2BP1A 1QWKA 4H8NA 2WZMA 1VP5A 3BV7A 2FVLA 3EB3A 3UP8A 2WZTA 1XJBA 2PDXA 3LZ3A 3GHTA 4FZIA 1YNQA 4JTQA 4FA3A 1PYFA 3UZZA 3UGRA 1RY8A 2ACRA 2PDGA 3CMFA 1X98A 2IPJA 3UFYA 4YS1A 2PDCA 4WDTA 4PR4A 3N6QA 4PMJA 3WCZA 1OG6A 2PDIA 3O3RA 5AZ1A 5C7HA 4EXAA 4DZ5A 2HVNA 2HE5A 2J8TA 4JTCA 3BURA 2PDNA 2PDJA 3LEPA 2FZ9A 2PDLA 5HNTA 2IQDA 2P5NA 1ZSXA 3U2CA 1AZ1A 2F2KA 2HV5A 1X96A 3KRBA 1EL3A 3LQGA 4JQ4A 2ALRA 3LQLA 2R24A 2PDUA 1J96A 2FGBA 1PWMA 3EB4A 3ERPA 1AFSA 1MZRA 4ZFCA 3ONCA 4IJRA 4WDWA 1K8CA 3UZXA 3COTA 5HNUA 3GHUA 3LNMA 4ICCX 2DUZA 4LBSA 3V35A 1X97A 1Z9AA 4JQAA 2BGQA 2PF8A 4YVPA 1ZQ5A 4Q7BA 3FJNA 2FZBA 3N2TA 4XO7A 4PRRA 4JTDA 2IPGA 1Z8AA 4FAMA 1T41A 4XVEA 2PDFA 1AH0A 5LIWX 3BUVA 4GABA 4G5DA 1YE6A 3RX3A 3WBWA 4LAZA 5HA7A 1FRBA 3V0TA 4LB4A 3G1RA 3C3UA 1Q5MA 1RALA 3GHRA 2IPWA 2DV0A 4GA8A 4XZIA 1S2AA 3CV7A 3G5EA 4XO6A 3R8GA 4FALA 1SM9A 1IEIA 2PDPA 3CAQA 2IKIA 4GQ0A 4IJCA 4LBRA 2IS7A 3R6IA 3WBYA 1UR3M 1LQAA 1PZ0A 1VBJA 4XAPA
chains in the Genus database with same CATH superfamily
4S3GA 1TUFA 1U5HA 1W31A 2QPSA 2ESCA 3WD0A 2XINA 2J74A 3U5UA 3HG5A 1EF2A 5D30A 1G4SA 3N4FA 4O13A 3VNYA 2YB4A 1EA0A 1ZJBA 4RZ6A 4R5EA 4TX6A 3SADA 3KBWA 1YNPA 1G94A 3U57A 1QO5A 2OWCA 4W93A 3SCOA 3SFWA 3XINA 4AHPA 1W3JA 4KRTA 2E9BA 4GY0A 2DZSA 3KBJA 4HMDA 4N6FA 1UWUA 5GPRA 1OG0A 1K9TA 1V0LA 3N6JA 3GTIA 4CCEA 3R79A 1JL8A 1SJAA 3XISA 5HPOA 3W87A 4LY8A 3BJTA 4M7SA 4KKXA 1KTNA 1M03A 3O0KA 2SFPA 7REQB 2ZXDA 3CIXA 3L2MA 3II1A 3M7SA 4DWSC 1AJZA 2PWFA 1U83A 3VO0A 4QBXA 3M64A 5DMMA 4DLMA 4GY7A 3PZNA 3PB0A 1TSIA 7TAAA 2VL4A 3W1NA 4YIWA 5LIUX 3I4EA 4ECLA 1A3WA 1F76A 3E2QA 1EXBA 1B30A 2X30A 5EU9A 4MB5A 5BRPA 4E4PA 4FMVA 3P6LA 3LY0A 3AYTA 2FPYA 2BGSA 3VI2A 3UVAA 2ON3A 3ABOA 3GU1A 4GYJA 1ADOA 1VGAA 3FK4A 1XYMA 3UJSA 2FZNA 4WD0A 1Q45A 4CQ8A 1GYMA 4A05A 5G1YA 2J7HA 3AWNA 4H9MA 1XL9A 3REQB 2W4XA 2E6AA 5D9PA 1LG1A 3E0WA 2DDXA 3G22A 4BZYA 4FOUA 3E49A 4C6OA 1FWDC 1FDYA 4F0KA 4HA4A 5FJJA 1R30A 1LWJA 3VIPA 4JS3A 3S5ZA 2BV9A 4LH8A 1AD4A 5HWNA 2WQDA 1HT6A 5TD4A 5K9CA 4NF7A 1E70M 4Y9MA 2V5JA 1R2SA 2OKOA 2E77A 5IDZA 4P8XA 3ALFA 1KRMA 1E51A 4BEUA 5HJLA 2XPKA 1B54A 1X7IA 4CLMA 1TMLA 1BEUA 1E1CA 1BXCA 4H6QA 4UQ9A 4Y96A 4CQDA 1R3QA 2P0IA 4HQVA 1LOLA 3LV6A 1J0HA 3VOHA 4YTRA 3G0SA 4V28A 1YIXA 4ZGYA 2BVWA 2E5DA 1JUBA 1QBBA 3CXOA 1F8MA 2REQB 1YTKA 1XLGA 4UC5A 4WGXA 5REQB 4J27A 1Q65A 1R47A 3CT2A 3JUGA 2YJQA 3L66A 4HPJA 4NIRA 2OZTA 3TW9A 4N9CA 1S1PA 4J9JA 2HDJA 2PEVA 2WSKA 3WFLA 3B0VC 4GZ7A 3G24A 2BSLA 3R4IA 1Q6DA 1BYAA 2CZ5A 3NWRA 2KX9A 4D8AA 5AVNA 2HPIA 4JHMA 2IQTA 5A2AA 1AUSL 1M9HA 3EA1A 3CV2A 2WHJA 4NQ1A 1UZ1A 4EOUA 1N7KA 3IGUA 3F03K 3GY1A 4DBDA 3EAUA 1TRDA 3WJWA 4D1IA 3IVTA 3C4UA 4HT3A 5CAKA 3UT0A 2QEZA 3QKEA 1OYAA 4KWSA 2D73A 1E5JA 3B9EA 1V5XA 4Y8FA 3CWHA 1IEWA 3Q65A 3S9IA 3GU9A 1C9DA 4HPXA 4KWUA 2JFEX 2YYTA 4ML9A 1SUXA 3DENA 5CCZA 4U2YA 4IXHA 5CG0A 3CS2A 1O1HA 3EDFA 4QGCA 4RE3A 2E68A 7A3HA 1TE6A 2GDQA 4CNUA 3VIKA 3OBEA 5I3KA 3W7NA 1DEDA 2FYMA 3L67A 1WDRA 3GWQA 3W71A 3NQBA 1W56A 3O3RA 5C7HA 3T78A 3SRHA 1JZ7A 3CZLA 2DQWA 1AQFA 1CI1A 2XYLA 3KX6A 1IT7A 1P4CA 3L4VA 2WC7A 3PTDA 3C8FA 3FXYA 5AFDA 2HVMA 2VZTA 4YNGA 2OQHA 5EY5A 4HNCA 4BA0A 1NF7A 1K1DA 3QMRA 1TUXA 2FGBA 3H24A 2D0FA 4IPPA 1D2KA 5FF3A 5G4HC 3NDZA 4HNOA 1FWIC 3ONCA 4E3VA 4N4PA 1X1ZA 3OLIA 1SMDA 3NQCA 5T9CE 1H0IA 4K7YA 1EC7A 1X6LA 1UASA 4Z08A 5TQLA 2BDQA 4S2CA 3PUDA 1QCWA 3FYYA 2J24A 3CEUA 2NXGA 2YFOA 3EWDA 3FJNA 2J7DA 4DM2A 1H7OA 2FZBA 4W85A 1LROA 4KMQA 1C8YA 2AOSA 1J6PA 3KCOA 5CZSA 4CCZA 3ATZA 4DUWA 5EYWA 2XG9A 4PMXA 1QNPA 5DEZA 4PMRA 4TQTA 3WBEA 2ZVIA 4BFAA 4AZGA 5JBFA 2A6NA 1JDCA 2QCDB 3G1FA 1RBLA 5JQ9A 2W92A 3CUIA 3NPVA 5KZDA 3LBCA 5K2ZA 4IIFA 3TAKA 2WMHA 5M03A 2E6DA 3R12A 4LB4A 4AH7A 3T0AA 3M6YA 3W28A 2FHBA 3I7QA 3DYOA 1XKYA 5IBXC 1M41A 4EF9A 4WSJA 3IK2A 4MFEA 1Y7VA 3FIGA 3SW6A 3C2YA 4L7ZA 2Z1BA 2X1IA 3H7VA 4DRSA 5DMYA 4DPPA 4WY0F 2YA2A 4GI6A 5HMFA 2V69A 4XAZA 3CC1A 1T8XA 3NQGA 3RPDA 1TR9A 5FF0A 1AQHA 2V30A 3QPZA 3TC6A 3H4GA 4A2SA 2CLPA 4JN7A 1MQRA 1EDGA 2NVDA 1JF6A 1Y0EA 3F2CA 3XIMA 4I5UA 3ID7A 3TYAA 4U33A 1SVDA 4UXDA 4WR3A 2PRHA 2XGZA 4O10A 5CBBA 1OFAA 2XVKA 3HPZA 1ZFJA 1XLCA 2DZTA 4JN6A 4KEZA 3VC6A 4R53A 3PPGA 4KERA 2WBGA 3V7PA 5C5YA 1AH4A 2I5IA 4PRWA 2WO5A 1AQMA 5M5DA 2WVVA 1OF8A 3EA3A 4XBKA 3WUFA 4NAEB 4CQAA 3NJ3A 1R9XA 1OFDA 3WMLA 4B2DA 4IX2A 4UFHA 5EFFA 3VD4A 1FUYA 3GVQA 3FEMA 2OVLA 3GDMA 1QHZA 5A8OA 4O1BA 2FZMA 4V1YA 1D7FA 1ALDA 1XICA 3VPLA 3UYCA 5EMLA 3UA4A 4PTDA 5K3VA 2Y5JA 5C54A 4TIMA 1WDSA 3IS4A 1K02A 1ICSA 2Z2UA 3W22A 3CUZA 9XIMA 3GXDA 1KV5A 4Q22A 4UTHA 3A3HA 2O4QA 4LRSA 1GGOA 1W2PA 3AJXA 3W72A 4C6EA 4BQ5A 3EDKA 3DOPA 4GJ1A 1BG9A 1E72M 3SY5A 5BMXA 1E71M 4X0VA 4IMDA 1UP0A 3B03A 2DFAA 5E0FA 5ABFB 5G1TA 5JU6A 4QX4A 4DUXA 3CMGA 3LTSA 1HF6A 2VX5A 8TIMA 1QAPA 2G4JA 4URIA 1W9PA 4OOZA 2WK2A 2Y2WA 1WOBA 2YCLA 3GBEA 1TR1A 3TQKA 4A3RA 5A6BA 2I16A 2ZUSA 1E43A 3EYPA 2GGJA 3KZSA 3W6YA 3CWOX 3NCOA 1OGBA 4UCGA 2YL9A 1WAUA 4UTWA 1MI3A 4NI3A 3SCQA 3ZZ1A 4U2ZA 3S1GA 4AX7A 1FH8A 4NJGA 4QNWA 2RJHA 4WDUA 3G1HA 1XINA 3IJIA 3ONBA 3W7IA 4H9YA 5LHEA 4D6IA 2V38A 2OGJA 4ZQRA 3MP3A 4PMYA 1EF3A 3E02A 4S3JA 2XVPA 3SIZA 3TTQA 4O14A 1AODA 2ZXQA 1TPFA 2ICSA 4C6CA 3AZSA 2PDHA 4H9UA 4IUOA 3ISIX 4XWUA 3MUXA 3IJ7A 4QM1A 4GBUA 4PRTA 1OX5A 3IAQA 3I6EA 1UD4A 1W9XA 3N6HA 1CTNA 4H19A 4NG3A 1M01A 2NV1A 3AYRA 2XGBA 2D2JA 2ZZ6A 3ZT6A 4WRHA 1GOQA 3ZQ9A 2NUYA 2Y7FA 3SGUA 4G8TA 4PUUA 3WLHA 3WQDA 3I10A 1F05A 2BVDA 3S5OA 4PTWA 1BKSA 1EOMA 4KPLA 5F1UA 1ICPA 4LALA 5LIKX 4U10A 4KRZA 3RPMA 3LSBA 3RPTA 3LHUA 3KL3A 4KWVA 1RP9A 1GVSA 3GR4A 1VH7A 1UOZA 2MNRA 1IGSA 2BVYA 1LRNA 3P84A 3N29A 3O2LA 4ZOEA 3LZ3A 3FY1A 2QCGA 1Z44A 4JIQA 4O15A 1NFPA 5BRBA 4KFNA 5CBJA 2NT1A 2FMOA 3ZJ7A 1PV8A 3BO9A 1TX0A 1TV2A 1S3HA 4JX4A 1KTCA 3E38A 1KRAC 4LS0A 4A6GA 2ACRA 1UWTA 3WK2A 2PBGA 3WDPP 4PMOA 3KHDA 1BLIA 3RCMA 2GWGA 4IFKA 1LP6A 1NOWA 5H2ZA 1OG6A 3AS0A 5BMWA 4ZB5A 3BE7A 1V6XA 4DZ5A 3WUGA 2E6FA 3QW3A 2HE5A 1FHLA 4JTCA 2PWEA 5FF2A 3A4XA 4W5ZA 7TIMA 2OSWA 1YBQB 2Y61A 1EHNA 2POZA 3SCTA 2OB3A 3OIHA 4YWSA 4JEJA 5A6LA 3S0CA 4BR1A 3VDAA 2FQIA 3ERPA 4GISA 4QE4A 1K9DA 4YTQA 3F2DA 2QJJA 2Y85A 3MDUA 1QPOA 3GNXA 8XIMA 4ZBCA 2GUYA 1SSGA 4R33A 1MDRA 3BCFA 5AB3A 2QULA 4X60A 1KM5A 3GYCA 1ZNNA 5J04A 4KQNA 3LM3A 3D46A 2A85A 3RM4A 2GYIA 3O06A 3KEHA 4L64A 4DELA 2QKFA 3DAQA 1D8WA 1FWNA 1R9ZA 3L68A 1A0CA 1GONA 4NXSA 4ENLA 4LUSB 4MVAA 1IV8A 2EO7A 4LPCA 1YDOA 4XO7A 2YL8A 4PRRA 1QATA 3K1GA 4O4VA 1LYXA 5JBEA 4JTDA 1PVNA 4MUZA 1TPH1 2REQA 1OK4A 1SJBA 1KXTA 2OQLA 2WNZA 4LYPA 4MDPA 3L65A 2E09A 4NRSA 3TSMA 3WFZA 5DT7A 2BMBA 4X0NA 3QV7A 4O1FA 4G5DA 4JGDA 3SUUA 1EH9A 3P5YA 4HNVA 4H2HA 3GDLA 2YZ5A 1V6UA 3POCA 1OCQA 5I2UA 4LOCA 4OV4A 1TA3A 1W5MA 3EPOA 1PXGA 1R5YA 1E4MM 3GHRA 4FNTA 4XZIA 4H9ZA 3MYPA 1NTHA 3EWWA 4W4QA 1O5XA 4GRSA 3LXBA 3GG1A 1UWIA 3KTXA 3R6IA 1LQAA 3QC0A 4XAPA 4UFLA 3UWYA 5I7GA 1VRXA 4IFRA 3K8MA 3PM6A 2PDWA 1XG3A 4GUGA 1WUEA 4MOZA 2P3EA 1BQCA 4M8UA 4B5UA 3BWWA 3DFHA 1TWWA 3RJXA 4H8HA 2DIKA 2ZUTA 3YPIA 3U3HA 4CKQA 6CGTA 1UIPA 3PP7A 4DJFC 3U4AA 2I56A 2ZUMA 3LV5A 4C65A 3AXHA 4JFSA 3TOPA 4YHGA 3VIIA 3KCLA 3EKLA 4K8EA 1IXNA 5G5IA 2QQ6A 3KDOA 3IGHX 4GC3A 4JFWA 1I0DA 4JKMA 1PYMA 4Z0SA 8A3HA 5CJ5A 1BSLA 1JFHA 4LYRA 1VR6A 3RFAA 5GNYA 1G67A 1RPKA 7ODCA 1XIGA 3ITGA 1VCGA 4JOMA 4E8CA 5AYYA 1UH3A 4GYPA 1D7KA 3V16A 2W61A 2W91A 3AXXA 3LA4A 4JYEA 4JTUA 2DQXA 4WGHA 1QHOA 2PU1A 1WBHA 3V5CA 1UC4A 4EXQA 5F7UA 4UR7A 3AISA 3R7MA 4F3HA 1RQEA 1LUCB 4TV5A 2WJDA 3RLGA 1BXNA 3IACA 5D2VA 3V36A 4E6MA 4CEXC 4LYQA 2PLCA 3WF1A 3TOYA 1RV8A 2CFFA 2CESA 4MZ1A 4P7OA 3UWVA 1PPIA 3TSBA 1JZ6A 1TV5A 4CD5A 4IGNA 4HHHA 4GINA 4F40A 3CUFA 3QR1A 2YL5A 5GQBA 3AMGA 1SQ7A 1T0OA 3OG2A 3RR4A 2OQYA 3N11A 1REQA 1J12A 4XZNX 4BJHA 1RVGA 4L61A 2NLIA 3UXKA 2C18A 2DVUA 1SSDA 2AGTA 3AMLA 2VYOA 1SFLA 4ROPA 1QOQA 2ZZ1A 1FHVA 4J2MA 1Z7AA 4NJIA 5AYXA 3QHOA 5F4XA 5HNRA 2H3DA 4A29A 2VOMA 1RPXA 4AD0A 1W1B1 5TBOA 1OC7A 3WQ8A 3GIYA 3AYVA 3UWUA 3EOLA 1PEZA 3VAVA 2XM2A 5AYIA 1M3UA 5AOUA 3CZGA 2J77A 2PP0A 3GTNA 3QZEA 1HNYA 3W7JA 2NUXA 4PMDA 2ZZ3A 2EG7A 4NZFA 4DAIA 3GNPA 2CC0A 3CMJA 3PZGA 3DFNA 1DJQA 3GUWA 3MWAA 3NQ7A 1W0MA 1Q2SA 2Z7KA 4ZB0A 2WB5A 5AC7A 4N2YA 4PB4A 1W5PA 2JBMA 3GO2A 1GPWA 3LENA 4DYJA 1LZOA 4V1XA 2GVYA 4YXGA 4ML4A 2YCJA 2AQVA 2C6QA 1AQ0A 2Y89A 2DZAA 3FVMA 2EGZA 4AZ7A 2ZQ0A 4LFYA 5FACA 3EB3A 2YR1A 1H62A 3GG8A 4OOUA 2I9UA 1X1NA 2G41A 3QFEA 1IEVA 4XUGA 4EVZA 1UCWA 2CLKA 5DRCA 4MFDA 1PYFA 1S2UA 2QDHA 4AIUA 4FLQA 4B9ZA 3SIMA 1RY8A 3B40A 2J7FA 2WWDA 3NG3A 4XD6A 3OBKA 1CPUA 1GKQA 2V68A 5HMDA 4PFHA 3QF0A 2EG8A 3UFYA 2EPKX 4WDTA 3RN6A 4GYKA 4J3VA 4PMJA 5BWAA 4IMEA 1I0BA 3WQGA 4J40A 4MDOA 2HVNA 1OSEA 3ITCA 4DI9A 1B57A 2TODA 3QHMA 4DI8A 1DJZA 1BRLB 3O15A 1ITQA 4GUJA 4FO4A 3PY2A 1F8IA 2OGYA 5A6TC 2CZVA 3DZ1A 3R10A 4LCSA 2E8ZA 4JCMA 2CNCA 3LB0A 4B5XA 2VVNA 5CBIA 3IANA 3THQA 1C8QA 4LC8A 3KE0A 3W1UA 2JGYA 4HNNA 3P81A 1KO0A 1VFUA 3EWBX 3UR7A 4ZE4A 3P60A 4MY1A 2VOTA 1FCBA 4AZHA 3RK8A 3O6DA 2HQAA 1WDPA 2OPJA 2Z1VA 3W7MA 3LRLA 1PKLA 1ZCOA 4JQAA 3CL7A 1XYFA 4ERAA 1SO3A 4K37A 1KCZA 3UPWA 3DFSA 1AL8A 1C7TA 5E0CA 4AYSA 2IPGA 1TO3A 2W27A 2WSQA 2X05A 3M0YA 2NUWA 3B8SA 2PI6A 4O0QA 1O95A 1YNYA 4XZBA 2DSZA 2OSYA 3U6WA 3G1VA 1AH0A 3NDYA 3BVJA 1DJYA 3PUEA 5I3JA 1VJSA 3IPWA 4DHGA 1A3HA 2PAJA 3HJZA 1XP3A 1NDVA 5AHFA 3HG3A 1KKOA 4GKLA 3RRAA 3AROA 2AL1A 3KTCA 4RPPA 2DORA 4NSBA 2Z00A 4UTTC 4RE0A 4D72A 4Y6GA 3WLSA 2GGIA 3WLKX 1QTWA 5LKYA 5GNZA 2CBJA 1XSKA 4XO6A 1DQXA 1F3XA 2VQTA 2ZWYA 4W7UA 4PMUA 4Q6XA 3LS9A 1DQWA 3LCIA 4QFUA 1EZWA 5B7YA 4JTAA 5DELA 2HS6A 4X63A 1H2JA 5HQLA 5A8QA 2PFHA 3LHTA 1EJTC 4CNTA 3A64A 4NILA 4AD3A 1ISWA 2Y7DA 2D22A 1E3XA 2VO5A 1RY0A 2PDKA 1MRQA 3UESA 1H7NA 4HYVA 3P74A 3SCRA 4EX4A 3LGEA 1VPXA 5F4SA 1POKA 4MPQA 1FA2A 1TPEA 4YVVA 3E0VA 1VYPX 5DRIA 3LD5A 3GB6A 2VRQA 3KW3A 2Q01A 2R94A 3N1AA 1UG6A 4LQ1A 3IGSA 1DWGM 3VKDA 1QUMA 4EPBC 3LZ5A 3LLXA 3R0UA 1NEYA 1RLDA 3ANVA 3DH7A 1DKWA 1VRDA 3GUGA 4JTEA 3LCLA 1Q66A 1E0WA 3VDBA 4D6DA 3BG3A 2VCAA 4LYKA 1L6FA 4FNUA 3LTPA 4D8LA 4LNYA 3AXMA 3M16A 1F2JA 5A1AA 4B3ZA 1H11A 2QUVA 3GDTA 5L6UA 4JTIA 1GOWA 3EZ4A 3KBSA 2FHCA 4MWAE 3OQ8A 4IX0A 2PDYA 2ALDA 3QQWA 2XIQA 3LBOA 3A4JA 1LCOA 2I7GA 2Y7GA 4Y8EA 5EMUA 2C7FA 2IXUA 4IFOA 3TU9A 5DY2A 1LTDA 2WBKA 4L80A 4MNLA 1I75A 7PTDA 1XXXA 1GOXA 4US5D 2D2OA 5I3FA 2ZE3A 3OGVA 4Q4MA 3ZVIA 1BVNP 3GXIA 4UQAA 4YJ5A 4LB3A 4QDMA 5T26A 2X09A 2P0OA 4BQ4A 4K1GA 1H1ZA 1FKWA 1WDWA 4GYPC 1EQCA 2CLMA 2EXOA 1BYBA 2VKZG 1QASA 2HS8A 2ZZ4A 4PUNA 3DECA 2YCIX 2DW6A 2NVAA 1RA5A 5EMYA 3VX1A 3EXRA 3UZ5A 5DY3A 3GU2A 2Y62A 1B4KA 1ONXA 4E38A 2D1ZA 3PHAA 2R1NA 5BXRA 4I9MA 3WQCA 2C13A 4HA3A 4AISA 5FCZA 2R14A 3L21A 1EJRC 2XWDA 4KWOA 3H12A 1M5WA 2PD5A 3LM7A 4UFMA 4MMWA 4S3DA 1H5YA 3IJQA 2YL6A 5FL0A 4HZ6A 2B7NA 1OC6A 2PGFA 3CK5A 1PTDA 3VOFA 3PSVA 3F4NA 4XTDA 3L9CA 4G6CA 3W37A 3EDDA 1L8PA 3MI3A 3KUMA 2GOKA 3B0PA 4GH3A 2E4TA 1C91A 5FJOA 3VDCA 2PDXA 3EXSA 1ADDA 2AAAA 1U1HA 1WPCA 3SN4A 3LCXA 3MMUA 4YCOA 3WLQA 4MYXA 1A5LC 1CCWB 4W8LA 4NZCA 4GC4A 4HCDA 4IIBA 4PYSA 3ORWA 3UXLA 5BCAA 2YCKX 4FX8A 3BGAA 1IIGA 4FLOA 4PR4A 3S5SA 3GR8A 2WJFA 4Q8PA 4Z1DA 2ZADA 4B4HA 2WMGA 4OUIA 3G1AA 3W75A 1S5TA 1WE5A 4D6HA 2BGNE 1DWIM 2Q09A 2I5QA 1ONWA 3BARA 3CNYA 4NHVA 2ZOXA 4KWWA 3FA4A 1UQZA 3GFYA 3RDKA 3U2CA 3MHGA 2Z6JA 3I65A 1OF6A 1PBGA 4ZOAA 3W26A 2XISA 3EEGA 1GVRA 5AHNA 4DUOA 4OU1A 2PDUA 2GQ8A 3PZQA 1J96A 1HFBA 3W00A 1P0BA 1GQIA 4ZFCA 3TWBA 5G4EA 3UERA 3OHMB 2X0SA 5FI8A 1XS2A 1JJKA 4QP0A 3G18A 3M41A 3PFRA 3P14A 1NU5A 3TROA 2I57A 1V03A 3W23A 1NELA 1DE6A 1ZP4A 2V81A 3F5LA 1YRRA 3M43A 3WZ0E 3U2ZA 3UCDA 4PBGA 3LBMA 3D5HA 1TG7A 4H2CA 1VYRA 3FVDA 3QQ1A 1Z9AA 3M7WA 1LF1A 4XD3A 5D9NA 3F1QA 4HKPA 4HGXA 3EOEA 1BWLA 2DZPA 3VUSA 3OA5A 3W86A 2DSVA 4Q4PA 3GQYA 3SQLA 4U3AA 5KZ6A 1HO1A 2WHKA 4HHMA 1E4LA 3W25A 3N18A 2Y5SA 2H9AB 3WD2A 1RD5A 2V2DA 2O9PA 1CXHA 5EMKA 1ME7A 4CEUC 4EACA 3MUAA 4Z1CA 2G95A 1VFSA 3GDBA 2ZRYA 4NVTA 4B91A 3SQSA 3S9ZA 2F84A 4KESA 3NO1A 1VHCA 1Z42A 1OZMA 1NWTA 3N25A 2R82A 1TMHA 3WH7A 3FYPA 5DMLA 5I24A 5FIPA 1QI2A 4LBRA 3SCVA 4LX4A 3SRDA 1R7AA 2C1HA 4CNNA 2VFFA 1SZRA 1RZMA 2V3FA 5I3IA 3F4WA 4HP5A 2YDSA 4OKDA 1MYRA 5EL1A 2EEXA 1N55A 3QC3A 2YDAA 2IKHA 3HBLA 2JALA 1I45A 3WQ5A 3T0CA 3QM3A 4NAFB 5F2IA 3ZXWA 2QVNA 4ZXOA 3V5FA 2Z1SA 1S2WA 3DHPA 3FA5A 1U22A 4OFCA 3I6RA 4NZ5A 3OJGA 1Q7ZA 3GDKA 1EP2A 4HHLA 3N3TA 3W73A 2FGZA 2C91A 3S5YA 4FNRA 1QRQA 3RNDA 4KS0A 3BLIA 3MY9A 3IARA 3MDWA 4IIHA 3W1AA 1TVPA 1QNOA 3WF3A 3U5YA 6PTDA 1GEHA 3N9RA 3VNLA 4WIWA 2OFJA 2HEJA 2VURA 3S42A 3AU6A 1TE1A 2FB3A 4PTXA 1JIBA 5BXTA 3VIGA 4AZ6A 3A4AA 2VGGA 3VGFA 1H09A 1LG2A 5HOSA 2DUXA 1MNZA 3VIMA 4LCRA 4BF7A 2AMXA 3GH7A 4FOKA 1U5JA 4WK9A 1MW2A 2X1UA 4P7NA 1VB9A 1FXQA 2BXZA 1O60A 1V08A 3GAYA 3PBYA 3GAKA 4PEKA 2A7PA 5AC4A 4MKSA 4QG9A 3KS6A 1GZ1A 1YKWA 4FOJA 1O5RA 1ZBCA 1DQUA 4DYKA 3BOLA 4IG2B 9RUBA 1KCXA 2E5CA 1REQB 3LCGA 1PL9A 4K3ZA 3VYLA 5A2CA 3VKAA 1JCNA 1DYSA 3MSRA 3WNMA 1RBOB 4OV9A 4JEQA 1EEXA 3NL3A 4DBWA 4KH2A 3MBFA 4JNYA 6TIMA 4HU8A 2F38A 3N15A 3PAJA 1OJXA 2WSPA 4W7VA 2QUUA 1CXLA 1B0IA 5E9XA 3PBMA 1ZY9A 2G3IA 4X22A 2YLLA 1M7XA 4C6MA 3HU7A 2CLOA 2B0MA 2EF9A 4GIAA 3THDA 1CX9A 1FFRA 1H60A 1I2NA 5REQA 3LUTA 1Y5VA 1IZCA 4MSSA 1KBJA 1X8CA 1BF2A 2W6RA 4DJDA 5CKSA 3TP4A 3JVAA 4HD5A 1K8YA 4A8RA 4HPGA 4G2DA 2ISDA 2VZOA 3W7KA 1U1JA 4BWLC 5HMSA 4GO9A 4E8DA 1UZ4A 4Y9PA 2ZC1A 3V18A 4M19A 1E0XA 1YBQA 4I7UA 3TJLA 3OQEA 1UKTA 2PTXA 1O94A 4PULA 3WMSA 1XUUA 3ZVHA 1WXZA 2OEJA 1OX6A 2GPTA 1XFBA 1HQTA 3QPEA 3O0FA 1V7AA 5FJPA 1FDZA 4Q4SA 3Q4DA 4QJ3B 1MEHA 2WZTA 1NSJA 1XJBA 2A21A 4RV8A 2C71A 3T81A 2H8ZA 4WY0A 3IJ6A 2JK2A 3MKKA 1L0PA 1VBUA 4R7OA 2QIWA 4FI4A 1W17A 1R3RA 3AFBA 4NNBA 4FA3A 4R7WA 1JPIA 1PDYA 1W54A 1JXJA 3VVGA 1FHUA 3AHXA 4XAYA 1HL8A 2QV4A 3NL2A 3KVKA 1M7PA 4WLCA 1GW9A 4A8NA 2XVNA 1O68A 4YS1A 6XIMA 1A5MC 1OT2A 3HF3A 3DYMA 1I6NA 1LQ2A 5MF5A 1WB0A 2WSRA 1KV8A 2TRSA 3OEXA 4FXRA 4TVUA 5FSEC 3BOXA 4IIEA 2YX0A 3BQ6A 4TVDA 1ZU8A 2Z1XA 3T07A 3KRSA 1GVIA 2ZFAA 4WSHA 4C7FA 5T8GA 4K2SA 2PE4A 5AN7A 2HROA 3L0GA 1P0DA 3ZOAA 2GJPA 3RO6A 5CEWA 1XQLA 1GNXA 2DVTA 2GWNA 5C8BB 3BK0A 2X7VA 3S2JA 3WNNA 3COTA 4LJ3A 1ZL1A 4GZJA 4N9EA 1VFMA 4PSPA 3VU2A 5DFAA 4EANA 5HUPA 1W5QA 4ZCWA 2VDHA 1NIUA 4ATDA 4A4AA 5LA2A 3TN3A 2J47A 4XBJA 2WKJA 3C61A 5A8PA 4H6KA 2HNEA 4DJFA 1YYAA 2DSWA 1JDAA 1LLZA 3FSTA 1JI2A 1LL4A 4PN2A 4A8LA 4JL1A 2QUNA 3LU2A 4IPJA 2WNNA 3V5OA 4M0XA 3VIFA 1GJPA 2UWFA 1TWSA 2A0NA 4ZQPA 2ZRWA 3CTLA 4PZVA 2VFHA 2PWDA 1RD6A 4OT7A 1PIGA 5IFPA 4LAZA 1F5ZA 4XD4A 3W53A 3G1RA 3PTQA 2XN1A 1YDNA 4EIVA 2PTZA 2E28A 4GA8A 1S2AA 1XCWA 1HUVA 2GUBA 2J6VA 3IWPA 4YTUA 3AWOA 2YOCA 3RLVA 1MWOA 1PIFA 4JIPA 2D3NA 2TMDA 3W74A 2WM1A 4XG1A 2ISFA 1YHTA 3SDOA 3WQVA 4P8WA 2VX6A 2VXNA 3GNNA 3GW3A 3M47A 1WOAA 2ATMA 4RZBA 3OOQA 1V77A 3WLTA 3GK0A 2EJ1A 4JIHA 3SN0A 4UTLA 1YADA 3WYZA 2BNJA 2NVCA 2ZA2A 5TNVA 2ASHA 1S3TC 2B31A 1OZQA 5CGQA 1A5UA 4WX2A 4YVXA 2XUCA 2ZZ5A 4GNKB 2J27A 5D8ZA 4TMCA 4PCSA 3MMDA 4R9OA 1CGWA 1A47A 3H2EA 2E40A 3GTXA 4HJWA 4J35A 4UMAA 3NZRA 2NW0A 1K4HA 3FJLA 1KGXA 3G0XA 6ALDA 1US0A 5GJNA 3GFZA 4H6RA 1POJA 1TPUA 1P6CA 3N9KA 3AHTA 4F0MA 1WDDA 1T99A 2E9LA 3FKKA 4GVIA 4N9DA 1JCYA 3DI1A 4IH3A 3QV9A 4MWAB 5D2TA 3FHQA 1XIFA 1VFTA 1DE5A 3M6DA 2A7RA 1TCDA 3PZ9A 1E4IA 4JFTA 2OLSA 1Z3NA 4R34A 3PWIA 1TV7A 4D6GA 2QCMA 3VGDA 1TTQA 1M68A 1X8FA 1V6YA 1H7PA 1XHGA 1V0MA 2DY3A 3QGAC 3UEQA 2CLEA 1FKXA 4ZL1A 3L2IA 4TX8A 1AD1A 1XLJA 1C9WA 1LRQA 1K9EA 4Q33A 3WQ4A 4NJJA 3GG0A 4JQ1A 4O12A 4JIIX 3SI9A 2QDDA 1ZUAX 4C5ZA 4D8ZA 3B8UA 1RQHA 2ZRZA 4HB7A 4HPNA 5CPSA 3HGJA 3SM0A 3UYIA 1Q7MA 3F4DA 4IISA 5U7SA 2VC6A 3AC0A 3CAWA 1NH6A 4I9JA 4E4FA 1BVZA 1YPXA 2QVHA 4AX6A 5CGMA 3KXQA 1XG4A 4H01A 3QYQA 4IL0A 1U1UA 1KWKA 3M07A 3P82A 3T55A 2GSHA 4AAJA 5A6MA 3OYZA 3N4AA 3JS3A 3WEOA 2WVUA 4HSOA 1VQTA 3GE7A 3L12A 3TONA 3TMQA 4DWSA 1OCNA 3BCDA 2IQ0A 4WKAA 3RF9A 5BU6A 4QNEA 1NWRA 1P48A 1XPYA 4J3TA 3NPUA 2Y24A 1I1WA 3TYCA 3TNBA 3L4ZA 4ZE5A 4ERIA 3MJYA 3PVFA 3RM9A 2TPSA 3CBWA 3PPHA 3THAA 4YU1A 4X2RA 4QAWA 4LCQA 4EXBA 5U4NA 4ZO8A 2H9AA 3BZGA 4LUIA 1EIXA 1EIBA 3LG3A 1HW6A 1XLMA 1LL6A 4OTKA 3VNJA 4FX7A 1WUFA 4DO5A 4FR1A 2CU0A 3I3BA 4UQDA 4LF2A 5BU9A 1DIOA 3REQA 4NL1A 1Q4WA 1XGDA 1MW3A 1ODZA 4JYDA 2W66A 4TXEA 1KM1A 3FNDA 3W2LA 2PLKA 1EDTA 3NGFA 3EMQA 5EB8A 1J2BA 4DJFD 2F6XA 3TMLA 4GVFA 1KR1A 1PSCA 1HXJA 3SQMA 5IBXA 2Y4SA 2G96A 2BP1A 4HYRA 3TC3A 3V1PA 4UQCA 3K8KA 4TOQA 2Q8LA 3WNLA 1NQ6A 3TNOA 1YNQA 4JTQA 2YA0A 3W83A 3H2MA 3NEHA 1RA0A 1KCLA 1J93A 4RCXA 3HURA 4IT1A 1X98A 5DX7A 1GG0A 4NUWA 3H21A 3TUUA 2WMKA 4PUDA 1R85A 2FDMA 1W32A 2Z25A 1E6XM 4KIRA 2BOEX 1ZJIA 3AIBA 4QDWA 5G1MA 3WF4A 3VGEA 1W1ZA 3OP2A 2F7FA 4NT0A 3WN6A 1KBBA 3APGA 5D33A 3M5XA 3B4UA 5FESA 1AW1A 5LNSA 1KFCA 2DT2A 1V4YA 1HX0A 3NL6A 5CPTA 1E5NA 2HJPA 2ZUVA 2WOQA 1E1FA 1KNWA 2D2GA 3NUKA 5DCEA 3O07A 2FMNA 4MGGA 1HKJA 3S8HA 4N7QA 4N9BA 2CKSA 3S4TA 1R7OA 1HKWA 4IJRA 1OADA 3GC4A 5K4ZA 2JKPA 4LAKA 2P1FA 4Y9OA 4BS0A 2VEKA 1FWCC 2JGQA 3QLDA 4MAZA 1J5SA 4E2VA 2QJMA 3IIOA 1PX4A 2PLMA 2X1TA 2Z4GA 3USZA 4XSLA 1JDFA 2WCSA 4L5ZA 5FJTA 2GGGA 4R3UA 3CHVA 4AWTA 4Q7BA 3JR2A 3ZT5A 2CLIA 5DXXA 3IIXA 1DXEA 2ABAA 4OBSA 4FNSA 2QDGA 5BRQA 2XH0A 1ZJAA 4B5TA 4XVEA 4C7DA 2CERA 3EWCA 4H4IA 3MVIA 4NZJA 4O0ZA 3DKLA 3O63A 3P3BA 2O9RA 5HUOA 1J11A 4O19A 4M3PA 3EPMA 2QT3A 3E0FA 3PNZA 2XJ7A 3QMSA 1XC6A 4UTWC 1YDVA 2EPHA 3QGKC 1Q6GA 3OA3A 4EP8C 4A8IA 1K6AA 3UG5A 2ZBTA 2G3FA 2ZXBA 1UR3M 4ZENA 2F6UA 1VBJA 3D3AA 4ORIA 3MZ2A 3R0KA 1QK0A 3N2OA 3S47A 2W9MA 1RJRA 4MJMA 1QR7A 1US3A 1IE7C 2BY2A 2W67A 4DPQA 4LUSA 3WD4A 1XF0A 1UR8A 3A12A 3L5AA 3F5KA 5GJMA 3MUY1 3B8DA 1GJWA 4ZVJA 1SW3A 3MO4A 4AEOA 4E8GA 4HNUA 4HNLA 2ZX8A 3WH6A 3W82A 3NXLA 2VEPA 1NOFA 3NZ1A 3SN1A 2R6OA 4J5NA 1E56A 3W6MA 1AW5A 4XIAA 2F8QA 2J8FA 2ZUNA 1KRCC 4IJBA 4AXNA 3ALGA 4WJEA 3KTSA 2RKXA 3VM5A 1LRTA 3EX3A 1FP9A 2UY5A 4LV9A 1QW9A 4ICMA 2NQ5A 4DWDA 5CLWA 2JKAA 4DVOA 1BGGA 5HK4A 1EZ2A 3G3MA 4ZSUA 3H4WA 2VR2A 2WZEA 3FGCA 3N34A 3ZS4A 1ZAHA 4EAYA 1W9VA 4F2UA 3E2RA 1LLOA 3VOIA 1LJYA 1IZJA 4GO8A 3CZEA 2G50A 4K7VA 2BOFX 1PCWA 1E6NA 4JIEA 1GYLA 4LEFA 4OBRA 4BY3A 4PMQA 4JQ3A 3WJXA 1QWGA 3KBMA 1R46A 2J79A 1A0EA 1X39A 3GVRA 5FOOA 3R58A 4ZMGA 3VKJA 4F2BA 1FFQA 3VNZA 3G77A 4UNLA 2Q3OA 4UTKA 1HJSA 1VZWA 4PA8A 5JXQA 1B9BA 5IXEA 4IIDA 3UVIA 5MKGB 2ZTJA 1CB2A 3QR0A 1P0KA 1LOQA 1TJ1A 4DXKA 1DJWA 3CL8A 3VOJA 4LVAA 5C7VA 1FCQA 2GVJA 2ZUUA 1W5OA 1GYNA 4S3FA 1UUQA 2ZCGA 3VNMA 4RDYA 4AC1X 1YPFA 2JKEA 4Y9AA 1E6ZA 3FW6A 4K6AA 1QBAA 3VE9A 3NYDA 5D32A 1LL7A 4DBEA 4QQUA 1OK6A 3GNRA 3CB8A 1TZZA 3I3DA 3UG8A 2W79A 3IRDA 4NZ4A 4LNCA 4ZTYA 4L9YA 4GUFA 2AL2A 5D2WA 3R94A 1XBZA 2ODOA 4WZHA 1VFOA 2QZRA 3PK7A 3LXAA 2ZE0A 1GTHA 3AO0A 5K4XA 4RXGA 5IFTA 4F66A 3FJ4A 1ITXA 3A5VA 1JF5A 1LWIA 3CV6A 1EC8A 2CBUA 6REQA 4C1LA 1WDQA 1MEIA 4PH6A 4GY1A 1QI3A 1XYBA 1PWLA 3TEVA 1CT5A 2CIPA 2YGYA 1H51A 3GXFA 1JYWA 4CU7A 2XU2A 1K8XA 2D3LA 4JQ2A 4ZODA 5LIYX 5C9XA 2XIIA 4HYWA 1D3HA 3N04A 2PZ0A 3JRKA 3OZOA 3DDMA 4JY9A 2R1KA 3UQNA 1PKNA 2OCZA 2RGMA 2BHUA 2E25A 4K68A 3BH4A 3S9YA 3HJEA 2VZVA 3MHUA 2DIEA 3OYXA 5AZ0A 4BCEA 1OBAA 2WMIA 1GQJA 5T91A 4ACZA 3GTHA 3EDJA 5I5RA 3QEZA 5D9MA 2GVGA 4NJKA 3GDRA 1JZ8A 3KVJA 5CZKA 1IWPA 3UGRA 2C19A 3K4DA 1G4TA 3FKRA 1EO7A 1H7RA 4C6PA 1S46A 1D3CA 1XIHA 2IXVA 4E2OA 1T6MA 2NZLA 4DB7A 2PDCA 3AHVA 3CO4A 4HA0A 3VNDA 4M5PA 4CN4A 3I68A 3E12A 1XIJA 3W70A 3B0XA 3BW4A 3GR7A 4MNJA 4GVHA 1TELA 2PDNA 3E2VA 1VEMA 4RE2A 2PDLA 1E9LA 2GJXA 1PIIA 3MVTA 1UZDA 2HTMA 4QRNA 1GKPA 5PTDA 4MZ8A 4TX9A 1EL3A 3K13A 2ZTKA 5AHMA 2NSOA 4MLJA 2X8RA 1NARA 4JQ4A 2PP1A 3ZWTA 4K36A 1B3XA 2DT0A 4GFIA 5IHSA 3CZ8A 1LBLA 2X2GA 1CGXA 3CZKA 3ZWSA 3ARVA 4Q32A 3PF3A 1JGIA 1XV8A 3EX2A 2J66A 1KLZA 2NXHA 4DWSB 2POTA 1ZCCA 1UWQA 2C79A 3OLEA 3NGJA 2CLLA 2XFRA 2RJGA 4KF1A 2XFWA 3RG6A 1Y5WA 1CGYA 2PGRA 4O50A 4GZEA 3N2TA 3AYSA 3LRKA 1A53A 1E0VA 5BOOA 4FR6A 1DPMA 4J2PA 4DNHA 2VQUA 1XIIA 1VJIA 4AD4A 3BAKA 4AIOA 1RBAA 1M53A 1JNEA 1GQKA 1FDJA 4F0LA 4RLIA 3PBGA 2HRWA 3DYPA 3AIUA 2EPLX 4S3EA 4EF8A 4DXVA 5I6SA 5KITA 1EOKA 2TYSA 4W9TA 3W38A 2BS9A 2EHHA 3E1F1 3MO7A 3AQUA 5HDRA 4DYEA 2ISWA 2FKPA 3GXNA 2PTWA 4HSHA 3C3UA 2VNCA 1FCUA 4ZQOA 3OVQA 3DFTA 2J4GA 3GNOA 2QLYA 5D8WA 3CV7A 2Q02A 1ME8A 1R8LA 3P8IA 3R8GA 5I03A 4IL2A 4GQ0A 3SCSA 4EAMA 4L4OA 1RVKA 2PWHA 3LK6A 3O16A 3STEA 4RNJA 1BVWA 3H4XA 5C0QA 4K39A 4NASA 3UETA 3MA8A 3N2BA 4PB5A 1L6WA 2GDUA 2WCAA 3VD5A 3M5VA 3PN8A 2OSXA 4TV6A 1WNOA 4RNIA 2XFFA 3ZM8A 3LPPA 2C16A 3HOJA 5D38A 3NQFA 4GQGA 4L1WA 3IJDA 1ITUA 4RPQA 3DI0A 4JTSA 4K8HA 1JAKA 3ANUA 2OG9A 4WJXA 1B90A 3NFUA 4HMCA 4BF9A 4XUYA 1VFHA 4RXFA 4PB3A 1S1RA 5CC6A 3TX9A 3D0CA 3DESA 3CHEA 3W2UA 4CUCA 1AZ2A 4FSAA 2YBTA 3ANYA 2Y5EA 3RLHA 2AKZA 4LUTB 1A4LA 2W62A 2J9XA 3P2VA 1J0ZA 1JEZA 1S5NA 1A3XA 3S2NA 4IQEA 1XKJA 1LQ0A 3WQFA 1OYBA 1P43A 1B9ZA 3EKZA 2OYMA 2ABBA 3WL1A 3LSCA 4F2TA 3EWYA 3NM1A 1SGJA 5CC7A 4QG6A 3W88A 1XQKA 4F0SA 1GHSA 4KCTA 1MUMA 4MTVA 1ITCA 4UIOA 1EJSC 3G1SA 1THFD 4HZMA 1H49A 2P53A 1XPGA 3MB9A 1FWGC 5I79A 3CL6A 3GH5A 2G8ZA 1RLCL 4RX0A 4DUVA 1BTMA 5A6SA 4JTGA 1EA9C 2JIEA 2OOGA 3QBUA 2XN2A 4AB4A 1BSIA 1MVYA 2QCLA 1ZRQA 3DERA 5BOFA 1ZGDA 4B90A 1O4UA 1A49A 4MZYA 1GPFA 3M0ZA 2IMRA 2V63A 5I00A 4IGHA 4JTJA 2VELA 2WW5A 3A23A 1P7TA 3B9DA 1PZ3A 5KZEA 4Q6JA 2ZX7A 2PZNA 1GCYA 3JW7A 3S83A 3PNUA 3N2XA 2DEPA 2J78A 4PMNA 4DN1A 3CLMA 4NRRA 2HNHA 3THCA 5HR7A 4L4LA 3RUBL 1PCKA 1Z32X 5DANA 3OVRA 5E6YA 4PEEA 3M0MA 1KQYA 2NV2A 1RUSA 1XRFA 3C5QA 2X40A 4U31A 3WD3A 3CV1A 4B9YA 1KBIA 3DN5A 5JH2A 2OZ3A 3TDFA 4PUEA 1ICQA 4KEUA 3DGRA 4J28A 3M0KA 5T9BG 4JR5A 2EPMX 1SJCA 2FGLA 4UTFA 1KM6A 2G37A 1KKRA 4C90A 2C8NA 3Q94A 1S38A 1PDZA 2YKKA 4W86A 4AY8A 2C15A 1DORA 1UH4A 2VENA 3ARWA 5LGZA 4UMBA 1XYLA 1C92A 4L6HA 2ZXAA 3W2MA 3GG7A 3WLRA 1JNDA 1IWBA 2Y1HA 4FNQA 3AUJA 3UXAA 3CQIA 2VCBA 4BEQA 3SCPA 4HHPA 3SY1A 4P7LA 2JQXA 3QKZA 5FKYA 3PG9A 4B2DD 3SECA 3LHWA 2DUAA 4IP5A 3QRHA 3B06A 2CXGA 3LPGA 3B8WA 3CUJA 3R13A 3ZIZA 3Q58A 3O1NA 1T96A 3BLKA 2ZUWA 3S2LA 3CQ0A 4QR6A 4QLLA 3WLMA 3CHDA 2WWCA 3RYSA 3ITVA 1W6TA 2ZZ2A 3BOFA 3Q2DA 4QLKA 2XIOA 3R11A 3EKGA 2BVTA 2G0WA 2GOUA 4PUMA 1FWJC 4ACYA 4AWEA 3P0WA 3S6OA 3RILA 2A3HA 4HU3A 5LGXA 3C52A 5FF7A 1EUNA 3GD6A 3K8LA 1JQVA 3FA3A 1S5MA 2PPGA 1UYQA 1E6SM 2OYLA 2CBIA 2WXDM 2P76A 3EOSA 4WXZA 3G8EA 3WELA 3WDRA 1I2QA 1UA7A 4FXSA 5KSWA 4W5UA 5CQ1A 3IUDA 3QOMA 1XH1A 3IIZA 2CITA 1E6QM 2QJNA 2YXOA 2R1PA 4IP7A 4DAFA 3ECQA 4WXYA 1VBGA 1XX1A 3DC8A 2FZ9A 4HOZA 2FFIA 4QJ1A 3SR7A 1O1ZA 1J0KA 1KXHA 2NQJA 3DBPA 3MP5A 2J8GA 4J3UA 2EJAA 2R24A 2Q8XA 1DL3A 5HATA 1VD6A 2WNWA 1IEXA 4GPNA 2GJRA 4IPIA 4R85A 2X0HA 4V15A 1ONRA 4WDWA 1VKFA 1SO6A 2NWSA 3UZXA 4X61A 1CEOA 3K4WA 1E6PA 1KB3A 3KLKA 2CZDA 3ARZA 3MT1A 4ZB2A 4UNKA 5A2BA 1DXIA 4H1ZA 1TV8A 3GVGA 4ZO6A 4B4FA 1SZFA 4W8BA 2QMKA 4GUIA 4UFJA 2GLKA 3WLNA 2X16A 1U5VA 2X0YA 5J8LA 5BYWA 4L4PA 1JCTA 1T41A 1CXKA 3BMXA 4OUEA 3OVPA 3BUVA 4JKLA 4GABA 3FEQA 1HGWA 3DHDA 1XRSA 1G9HA 1ONEA 1JCJA 4V27A 1QK2A 5J5RA 4DNMA 4I7WA 4MB4A 3FSUA 3RX3A 5BOEA 5I23A 3M5YA 4GGBA 4S3BA 1R6WA 3BZJA 5HA7A 3ARPA 4LXFA 3CLWA 4H9XA 1UR0A 3U48A 1FY6A 1Q5MA 3N4EA 3TE9A 4KGLA 1Z69A 2Z1KA 4AD5A 1XR2A 4GBDA 3CAQA 2IKIA 1TTJA 3HGSA 3FYOA 4RNFA 1AL7A 2Y8UA 1MQQA 5HR6A 4DBUA 3QHNA 3R89A 1DV7A 1IHIA 3MCNA 1JPMA 5HJYA 1Q4NX 1SZNA 5TAOA 4AEEA 3BLFA 1JZ4A 1EYWA 2A4AA 4UNIA 1KFWA 3V0UA 3K46A 1JAEA 2ZDSA 5LXEA 3T1GA 1N8FA 3UXDA 1H4PA 1E1EA 2XVLA 2HE8A 2A1YA 3WEMA 1Q6RA 3RU6A 2XH7A 4IGMA 4YPJA 3WG6A 1UKOA 3N19B 1BF6A 5EGRA 5CSUA 1RCXB 1VCFA 3SGZA 1YMYA 2X1RA 3N2MA 1Q6QA 2DGAA 5A69A 4ZOBA 2Z26A 5G2IA 3C2RA 4QHRA 2D0GA 4XVDA 5FJUA 4UR8A 1I2RA 3IJLA 5AVHA 1DHPA 1BWKA 1KFKA 1M7OA 5EBAA 4QQ3A 2F2HA 3NQEA 4PMVA 1BG4A 4CQ9A 1OC5A 1W1IE 3AS1A 3AMCA 1XM3A 4ADUA 3CAVA 3TLQA 5D37A 2GQ3A 1FVPA 4XAFA 4ZQCA 1MXSA 1O6IA 4CU6A 3A5FA 3WMBA 4R7JA 1L6YA 4LS1A 1KXQA 3H7UA 4O1CA 3V0SA 5SWUA 1OFEA 4C1NA 3F2BA 5IM51 4GWEA 3P7YA 4OBTA 4G7FA 3H8AA 3V3WA 3W81A 3KOYA 2V2HA 4CNSA 2WVVB 1XUZA 4H00A 1H50A 4OJYA 4GLEA 1DOSA 3BGGA 1YXDA 1Z41A 3TTOA 4C1KA 2QS8A 4XKYA 1JCMP 3P80A 2PGWA 1QNSA 3VIJA 3TN5A 4QE5A 3HV9A 5LNVA 4KGJA 3AALA 2VX4A 1VIWA 2GSEA 2C0HA 3H2NA 3UGVA 1P0EA 3B04A 3UWWA 2O56A 3UZJA 1XW8A 1BD0A 3WLJA 5H8UA 3MSDA 3CH9A 4EPEC 2PGEA 4O8AA 4O16A 3NVTA 3R25A 1T7LA 3S2CA 2HVOA 1TQXA 3INPA 2E8YA 3CAKA 5AC6A 1W9UA 1TJ0A 3HFYA 3LHYA 2DZBA 3SUTA 4PBEA 3S1VA 4CQBA 3LN3A 3KZPA 2Z2AA 5CSSA 4JTRA 5I3DA 2YCLB 5DXYA 4GCAA 3C2EA 1G0CA 2HWGA 3GTFA 3N73A 3EDEA 2DP3A 4DQWA 4K8GA 1ELSA 2FJKA 1TPC1 2RDUA 3NEVA 2JE8A 4JAWA 2VM8A 3H55A 3L7RA 1E6RA 1DWFM 1EO5A 1I2OA 5TF0A 1HL9A 3FAWA 1XLDA 5CPOA 2WMFA 1JULA 2FVLA 4JX5A 1GZJA 3L0NA 4DXXA 2XFYA 3QY7A 4KCUA 3C2VA 4HPHA 1E9IA 4RZ4A 1GVOA 1JZ3A 3LI1A 4NAFA 3T44A 4UUIA 4F8XA 3S5NA 3STGA 2E1DA 2IPJA 5F2LA 3H26A 1UROA 4A2RA 1C8VA 4MNKA 3KS5A 2VFGA 3G3DA 3WKZA 2GDVA 4FXFA 3W07A 2YB1A 3TJ4A 3KWXA 4A3HA 2O9TA 3AUOA 1FQ0A 3NZQA 4S1FA 3PSWA 3WDQA 4MWAD 1UOKA 1UB3A 3BPWA 1DWHM 4MG4A 2R1MA 4TR9A 4IZGA 4DLFA 3ABXA 4U5KA 4DF2A 1NDZA 1JUKA 1XISA 5A6KA 1JDEA 2CKRA 1RP8A 2GUUA 4O0KA 3A6OA 1EJ7L 2E1WA 2HBVA 1I8JA 1G1YA 3EA2A 1FWSA 1TB3A 5C55A 5ABTA 1WCGA 2WANA 5E0KA 3ZR4A 2FPTA 4C6QA 4DX3A 3TXVA 5XINA 2VC9A 3C6CA 2VEFA 2Y8KA 2AGKA 4UTJA 1GVFA 4M56A 2PP3A 1F6YA 2GGHA 2D69A 3CPGA 3M44A 5EBUA 4C6BA 2XIMA 3NZGA 1XIDA 3OB8A 4C5YA 2WPGA 3I6TA 1DWAM 1EUAA 3DBNA 5C2CA 4AD2A 3W1XA 4HZ7A 3LMYA 3ES8A 3LYEA 4US5A 4PUKA 1W9DM 1XGZA 3GXTA 3S1UA 1D9EA 2GJLA 2ZRVA 3TV8A 1B31A 3W85A 2YYUA 2DH2A 2VGIA 3H23A 2OODA 3WL0A 3A13A 1KC7A 4H3DA 3QZAA 2IUZA 3N3MA 1W8SA 4QJ4B 1HJUA 3A4WA 4UZUA 4IHCA 2DZXA 1ZLPA 3PUGA 5CPMA 1TWDA 4Q8WA 1I60A 2V6AA 1K7EA 2HZGA 2WJEA 7REQA 1FHDA 4FIRA 1L9WA 4UCFA 4WJ8A 1CYGA 1MNSA 4L6DA 2O7SA 3W7QA 3T9PA 3WBYA 1PX3A 4AU0A 3RIKA 1ZENA 3RITA 3GKAA 2CZEA 4FEZA 3RMEA 3W0KA 4IMCA 3R8RA 2NQLA 2WLZA 4LTSA 2BASA 3MBDA 2FTWA 3SBFA 2HSAA 1BPLB 4AY1A 1OINA 2ISVA 1TIMA 1Z6KA 2OMAA 4Q4RA 1VEPA 2J7CA 4UFIA 1VFFA 4E4UA 2WHLA 2ACQA 1J0YA 2I17A 2VMFA 5A95A 3CASA 3EBVA 4H83A 3CYJA 5M17A 4ZOCA 3VUPA 2V0TA 4A3YA 2GK1B 4I8DA 4AHOA 3IRSA 4JFVA 4QE1A 2W0UA 3P67A 1SFJA 4UQEA 5D4YA 3KHJA 5K9DA 1GVYA 2C14A 3T0DA 5AYBA 5DLCA 2VEMA 3HN3A 2WKLA 2V5KA 3BANA 1EKOA 4ZQMA 5CAHA 3KM8A 3UNDA 4FLRA 3MUCA 4ZA0A 4LUTA 3OPSA 1GVEA 3VFLA 1DTUA 2UV8G 4M80A 1IWAA 2NT0A 1V51A 1DJIA 3HV8A 4PC8A 2UY4A 4HNTA 5FA5A 2J25A 1NP2A 3DC0A 4G56A 3A21A 4UWMA 2XSBA 4XSMA 3W3OA 4PTMA 1ISYA 3WY1A 3TSDA 4ZZ9A 3KP1A 1A5CA 5EFDA 2FB2A 4D6FA 1CWYA 1AH3A 1WKEA 4QTGA 3WH9A 1HVXA 3E0LA 2HK0A 4UR9A 2VEGA 3RGTA 1P1XA 3N9SA 4AD1A 3OZPA 2H90A 4AVFA 3CQJA 5LNRA 3W6LA 3THUA 4F0HA 5HINA 1HVQA 3BXWA 5A5WA 1QPKA 1S39A 3LRMA 4O1DA 1TPDA 4P2VA 4QITA 1PX8A 1RCOB 2VTFA 1EYEA 1GJUA 1TZ9A 1GG1A 3QPYA 1QNRA 7XIMA 3TFCA 3BSMA 1TQJA 1J6OA 2QUMA 2WZIA 3EEZA 1QO2A 3JZUA 4P7QA 3QOKA 4OIFA 3CH0A 1V3HA 3ZT7A 4S23A 3OIXA 3C3NA 3MUZ1 3MI2A 4QAIA 1XRTA 1R3TA 1O5QA 2ACUA 1EP1A 4DJEA 5J5DA 1KA9F 4IMAA 1GK8A 4RDZA 3CIWA 3PFMA 1JGMA 3DEQA 4B92A 2WV8A 4LC6A 1BTCA 4QSFA 2Y88A 1ADSA 1MW0A 3MQTA 3OTRA 2LLEA 3TK7A 1JPHA 3H54A 3N12A 3B8VA 4RW3A 5E09A 3BJSA 3MU7A 3WLIA 2I5GA 1Q8JA 4HOXA 5EMJA 4BQ2A 4D9PA 1UJPA 2OX4A 1EXPA 3W7EA 2WAGA 3ZJ6A 4AWUA 2PBOA 3IK4A 4ZR8A 3QY8A 3VOGA 5G2WA 2QPXA 3PWGA 3IV3A 1KQZA 1ZS2A 1XH2A 2PCEA 2I14A 1Q2RA 2Q3RA 1UBSA 3CHCA 3H70A 1F4HA 4Q8UA 4Q8MA 3UJEA 1EGVA 4G7EB 3I7RA 4IMFA 1CXFA 1H1YA 3UG4A 1LDCA 1KFBA 3P93A 1B3VA 4J3ZA 3GH4A 4LUJA 1W3KA 4OVXA 5H8PA 2OO6A 1LT7A 4FZIA 1ZALA 1VS1A 2ZYFA 3TA9A 3EOOA 3UPMA 1S2VA 4CCCA 3ZMRA 2CPUA 1XCFA 4V33A 2P3ZA 1FWTA 2E0PA 4XISA 4GX9A 3USBA 2YCEA 1AK5A 2BOGX 5I3HA 2QAPA 1F4AA 4HCLA 1QPRA 4CU8A 4QJ5B 3QZ6A 1CNVA 4KEVA 4E2BA 1GKRA 3L4WA 2EKGA 4KCVA 1IF2A 2G4FA 3H6OA 3ZLFA 3WK0A 2NWRA 3H2OA 2IQDA 4BK9A 3A22A 2P5NA 2F2KA 4MWAA 4GXWA 4Q7NA 1MZHA 3VIOA 3LQGA 5E1QA 1V02E 3PTMA 1ME9A 3W24A 3IUHA 4DZHA 1AFSA 1RR2A 3TN4A 4YWIA 4R9XA 5G2HA 4W84A 1Q6LA 5HXMA 3FS2A 3GHUA 3SB0A 3BLOA 1NOUA 4UQBA 1QVBA 4ERGA 3AXIA 1H41A 4C1NB 4I90A 2BGQA 4GVGA 3W1LA 5D09A 2H8XA 3K5XA 3WF0A 3A3WA 4CGTA 2VUYA 1CDGA 1L2UA 4MADA 3T2OA 1I2PA 4Z2GA 4JFUA 3E6EA 3NOEA 1EJXC 5L9FA 3LHZA 5HAOA 2VR4A 3AJ7A 1QDSA 1E3ZA 1A5OC 1ZTVA 2VRJA 5ABHA 1YXYA 2GSJA 2RDWA 3MCMA 3EXTA 3ZR6A 1QNVA 1BRLA 2PURA 3LHVA 4AF0A 3AU2A 3OGSA 3PJWA 3CQKA 1CGUA 1QNQA 3POHA 3TLLA 3VK5A 1EDQA 1W1A1 1UR4A 1ZBVA 1E9ZB 3LPOA 3AZRA 1B3YA 1N82A 2DZUA 2DT3A 3KLLA 2AQWA 1KLYA 2E6YA 2ZRUA 1HJVA 3G5EA 1HIZA 1CENA 3C2FA 3S1WA 3UCCA 4FALA 1YLVA 4IWWA 1UUOA 4QS5A 3HG4A 3TTEA 1OFBA 1UBPC 4NNAA 4M6VA 5LYRA 1X6NA 3WBAA 5C2GA 2WVTA 3ENLA 2A3BA 3BLEA 3J7HA 1AMYA 1EQPA 2C1GA 4GXPA 3RJYA 4L4MA 4ILSA 1MO0A 2F61A 1HP4A 3B3DA 2YDRA 2O0TA 1KFEA 4HU4A 1PZ1A 1MXGA 3WJSA 2KZHA 1UR2A 1SR9A 1XYZA 5JBDA 1R86A 1IT0A 2W5FA 3ITOA 1GOKA 1V0KA 3PBVA 2VFEA 4XQ6A 3U4FA 1KWGA 3ARSA 1FWAC 5ECUA 3LCHA 2VR5A 5FF4A 4ASTA 3QN3A 1C93A 3VTRA 4C7GA 1MUCA 1OVDA 2V5CA 5HWMA 3CT7A 3NQMA 2KAUC 1JRBA 1PJ9A 3H7RA 2C1IA 2Q6ZA 2EAWA 2IPFA 3OLDA 3ZJ8A 3KBVA 4L9ZA 2VUNA 5FD0A 2V82A 3T0BA 1A4MA 3QR3A 2YLAA 3Q45A 2QCCA 1XDMA 1J18A 2VC7A 3ZO9A 4D1JA 4JN8A 4XZ9A 3W01A 2ZKMX 5MHBA 3OGRA 2ATSA 3AS2A 1BYCA 3UR5A 4YTTA 1WKYA 5AHLA 4UFKA 1XD1A 1PTGA 1XYCA 3UD6A 2WJZA 3RXZA 2A3AA 3VINA 4DZIA 2OT1A 3TCEA 3WUBA 2QW5A 5HNNA 4GUHA 4GG9A 1WKFA 3ZSSA 2X41A 1YPIA 1UP2A 5BROA 1VAHA 1IYXA 2XVGA 1XBYA 2AMGA 4MLRA 1TWZA 1YQ2A 3NR0A 3JU2A 4M24A 4LU0A 3FLUA 2OOFA 2XN0A 1EJVC 5AC8A 3W7HA 4N42A 5DCDA 5I3GA 1YEYA 4AY7A 1OFPA 4EWND 5CXPA 1EX1A 3PZIA 3U9IA 4QEHA 3M5ZA 4DO7A 2BG5A 4L65A 3UWEA 2Q8ZA 1PKYA 2YXXA 4L56A 4RZ5A 1CGVA 4HVXA 1FWFC 3NQ2A 3GX9A 1OIFA 1C7SA 4KETA 2QYGA 1NM9A 4M1RA 4DF0A 1TPVA 3B8IA 5D9OA 2J7GA 1A80A 2AL2B 4JHZA 3H22A 1E73M 4L1XA 1FWBC 4RW5A 4WKHA 4ADTA 5JH1A 5JIPA 2DIJA 5JIWA 4Z1YA 4QSHA 4GHRA 1RK5A 2ZX6A 4FS9A 4O52A 2V9DA 1F74A 1CLKA 2XWEA 1TFVA 2IKGA 1H3GA 3LX9A 3MKVA 3TW6A 4C6DA 5C2XA 1DIKA 1FP8A 3C56A 5EPDA 1O66A 4YL2A 2PDMA 2VDGA 3VGBA 3HPSA 3KBNA 1RSCA 1W1PA 3DXIA 4JIRA 4TVCA 4ES4A 5RUBA 1M65A 3RR1A 1TYGA 4S3AA 4QS6A 3CB3A 1A5SA 1UKPA 3MJMA 4BI7A 2WHMA 2NX1A 2D0HA 3HO8A 1G7VA 4O11A 1KBLA 1TCMA 4PCFA 3GVWA 1XDLA 3HQ1A 2PS2A 1Q63A 4XZHA 4ZXLA 4GK8A 5D02A 1OY0A 4H8NA 1VLIA 1ZAJA 1VP5A 2OU4A 4C6KA 2FTPA 4GGHA 1Y8BA 1NWUA 3PULA 4IQJA 2XDFA 3BW2A 4NYYA 4BQ3A 4M6UA 1R3VA 2WSYA 3GC2A 6XIAA 1TV4A 2OEMA 1J4EA 1H61A 2OKTA 1OGSA 5HULA 4AZCB 1JDDA 2Y63A 4C6LA 2DU2A 2FDSA 1GOIA 3WCZA 4KFPA 1I1XA 1UC5A 1OB0A 2NSXA 4AFYA 4HN4A 2BY0A 3HQOA 1OD0A 1IIHA 4TTUA 3AHZA 2PF0A 4G1NA 1NFGA 2O4MA 3LEPA 4M81A 5A3HA 3U2EA 4IQDA 2XM1A 4J4KA 4NP7A 3GS6A 1G4PA 1V6WA 2R1LA 4XV0A 1JYVA 3STPA 3W29A 3KRBA 1SZEA 4M6PA 4OZOA 1TRIA 1XSJA 4UB9A 3QSTA 4UOZA 3UY8A 1XD0A 2BX7A 1LM1A 2BXVA 3CTTA 3G6MA 3UU0A 3BW3A 4GIYA 4JDYA 4LBUA 5HNUA 4B3KA 1A5NC 4X9SA 3WNKA 1KCKA 1W91A 2W63A 1QJWA 3T0TA 4HMEA 5C71A 3HM7A 3Q37A 1J79A 3V35A 5XIAA 4LRTA 4PBFA 1H1NA 3STCA 3BJFA 1QI0A 3PZVA 4KW2A 1EGZA 3LNPA 3GC5A 1CBGA 2OZ0A 3VGGA 1RH9A 1CXEA 4PUJA 1L2QA 3ZR5A 1VLWA 3MKCA 3UA3A 3PZMA 2D24A 2ISSA 4ZFMA 3G1YA 4DO4A 4X3ZA 3QV6A 2X2YA 4C6IA 5A94A 1LOSA 3WSUA 4KEMA 3WBWA 2D20A 4I7VA 1JXKA 2WC4A 3PB2A 4G9PA 1GORA 5CZTA 1DIEA 2Z27A 4E2DA 3MSYA 2B7QA 5FJRA 3HPAA 4HA1A 3ARQA 4GQRA 4W8AA 4IJCA 3NPXA 3UPBA 4BKNA 3VZZA 4BI5A 1PZ0A 1K9FA 3LPFA 3SUSA 4Z17A 2TSYA 2WQPA 1SYTA 3GVVA 1ZAIA 4TU1A 1B3ZA 4JTLA 5CGTA 2XTKA 3NDOA 3OODA 4GD0A 4RV3A 2JF7A 2RGLA 4PTNA 3UXIA 1FBAA 2PWUA 1XFCA 3KCJA 2CYGA 5CC3A 4ZTXA 1FX6A 1OEPA 1F73A 3KWSA 1F9CA 1UZHA 4MUPA 1PB0A 3QY6A 4KCWA 4CNPA 3W02A 4ACZB 3HPFA 4REQB 1I4NA 4LANA 3VD9A 2ZX9A 3SJ3A 1JQXA 1H5VA 5KTLA 1Z89A 2ZA1A 3DG3A 3MMWA 4RUBA 1DJXA 3WH5A 3WEZA 1B3OA 3WQ6A 3S1XA 5I78A 2DSKA 3ITTA 1QOPA 3NQDA 2XH2A 3BAXA 4GACA 4IQLA 4KRUA 3RLUA 3BG9A 3PR2A 2IKJA 3HIJA 3ME3A 4QLJA 4AVNA 4I3GA 4N0RA 2OO0A 4FXJA 4JNMA 4D6JA 4FIQA 4Z0JA 3NQAA 4DJDC 4H6EA 5LNWA 3UF9A 5F4WA 4W87A 3UJRA 1QMLA 3BAJA 4GYFA 2WPBA 1NVMA 2CEQA 4US6A 3MPGA 1F07A 2GJXB 1WKDA 2PU0A 2XIJA 3T08A 4ZSTA 1MSSA 1U33A 3V75A 3TQ0A 5GVJA 4Z2LA 3H2FA 2WMIB 1J2WA 5G4WA 3SRKA 4B5WA 3HA1A 4ATWA 2HXUA 1IXOA 2PUZA 1T5AA 3HGRA 4ORMA 3VDGA 2CZFA 3P61A 2GFTA 3EMZA 4TTGA 1U2YA 5FEPA 1EC9A 1EB3A 3C8NA 4J3WA 2CHRA 3AAMA 4A22A 2EPOA 3L23A 1WZMA 4QCFA 2BB0A 2VGFA 1VBHA 3ELFA 3B4YA 2WM0A 1GWJA 4RNHA 1FWRA 4OGZA 2AAMA 3PPCA 4U3CA 3ATYA 3FDKA 4GCXA 3UG3A 1AW2A 2PA6A 3NQVA 3F5JA 3QH2A 4F4RA 2ACSA 2YW3A 3TR9A 5K7JA 3SUVA 1PZ2A 1CW2A 5FEWA 4B5NA 1SW0A 4NYUA 2UZ9A 1TTPA 4RJEA 2IW0A 1UWSA 2V3DA 3S6DA 1X38A 2PMQA 3LERA 4RDVA 4JBRA 4Y7EA 3SFKA 1EX5A 1XRVA 3VOCA 1UIOA 1A5AA 4Z1AA 4X2PA 1HL2A 3VM7A 3E74A 2E9MA 2QUTA 3LLFA 3SCNA 3L5LA 3WUEA 2ANUA 3LGDA 1V7YA 3OLGA 2FZDA 1A50A 4FNPA 1MDLA 1EWEA 4E5TA 1IZKA 4DBSA 3GYEA 2OEKA 4MHBA 3AHYA 2VFDA 2CETA 3W1QA 2EBNA 2INEA 2RHGA 1R38A 2DW7A 5AC5A 1YX1A 3MYOA 2YA1A 2WZMA 4ONVA 4HJFA 1P5BA 2VZSA 3BICA 4RL3A 2OZ8A 5ECVA 1HKKA 3ARRA 3L2LA 3E0IA 1NWSA 6TAAA 3DCPA 3M0LA 5D2YA 3UZZA 3URQA 3RCYA 1TVNA 2Z28A 4LY4A 4WQ6A 3CMFA 1JCLA 3ICJA 4ZQNA 4Y2WA 3G1DA 4AZCA 2G3NA 1SO5A 3N6QA 1XLAA 1SZGA 2ZICA 2OELA 1HJQA 5JMUA 2QGHA 3V1HA 2J8TA 3KOXA 1JYXA 4MJ2A 1N8IA 1HN1A 3BSHA 3UWQA 4Y90A 4WHBA 1UQYA 1JPDX 3UJ2A 1IXPA 5IRPA 4EWJA 2C3ZA 2ALRA 2GVLA 3LQLA 4D2JA 4MM1A 1TPWA 4AYGA 4B5VA 1V93A 5XIMA 1CB7B 4HZ8A 3JZEA 1PKMA 1TREA 2X42A 3L0KA 1K8CA 3TZFA 4A3QA 4LT9A 2OYKA 2OLAA 3ES7A 1GTEA 1XLLA 1GT8A 3NL5A 2ZRXA 1QPNA 2FJUB 1UA3A 3T7VA 4LF1A 3DFOA 4BF5A 1E1CB 1KRBC 2VI0A 1RHCA 3WK3A 4DWSD 1KXVA 1UWRA 1H7WA 1BAGA 5ABEA 2A3CA 1B5TA 1WXYA 4JTTA 1XI3A 1TKKA 2GZXA 2F9RA 1Z8AA 1U30A 4IIGA 4CD4A 3PZUA 3WLOA 1DTNA 1YXCA 4CVUA 3CYVA 2PDFA 3RAOA 4Z2KA 4YYFA 5K9XA 9XIAA 1JD7A 9CGTA 4EK7A 3TYZA 1UH2A 3LLDA 3VZXA 1V79A 1YE6A 2RAGA 2Z24A 4PSRA 3BC9A 2VFIA 4NX0A 3WNPA 3FN9A 4YCPA 3P8JA 1F61A 1VJZA 3NYZA 1R3YA 3IJ8A 3TFXA 3T4WA 1JR1A 2J9YA 2VWSA 4Z1BA 2WC3A 3DFPA 1VYSX 4UOJA 5ABGA 3IGXA 3PS7A 1O7AA 4R88A 5CPQA 4EE9A 5D05A 1ZB5A 4H8VA 1N2VA 4OECA 3O8AA 2ZDRA 1DP0A 4JPGA 3QVQA 3APTA 4CN6A 4Q4OA 1GEQA 3AIWA 2QF7A 4HBKA 4IF2A 1AG1O 4LAUA 3NSNA 5AHIA 4DZAA 3O6AA 5KMYA 3A24A 3ARUA 4YTSA 1JZ2A 4WCJA 3ARTA 1TJPA 8XIAA 1K77A 4JKKA 4TO8A 1C90A 3B0YA 4AMCA 4I6KA 1IT8A 4LVDA 3FHAA 3W84A 1UKSA 1Z48A 2RDTA 3WO8A 4XZLX 1X1OA 1TTIA 5CPNA 5LA1A 3A9BA 3NSMA 1ZBWA 4PUWA 2QF8A 3QXBA 3ABZA 3S6TA 4I5RA 2FPVA 1M7JA 2VZUA 3FXGA 1T40A 3DX5A 3WBXA 2V3GA 3AMDA 4FB7A 1SFSA 4UTTA 3FDGA 4FP1A 3DKJA 1Q6OA 3RRXA 4DJEC 5JVLA 3U7VA 1DXFA 1TJRA 2GGEA 4G1KA 2A5HA 3W1MA 2ZWZA 5A6BD 1W37A 2VWTA 1D8CA 1JRCA 2EKCA 2J7BA 4H7VA 3BAIA 3FX4A 5I09A 1UWAA 1FWHC 2VVSA 5I0DA 5DBUA 4TMBA 3TYBA 2DPEA 3M0IA 7ENLA 2BFGA 3NZPA 3BV4A 1W3HA 4U28A 3K4AA 3O05A 2DZWA 5I02A 3DG7A 1AJ2A 3TJIA 3GW0A 4QG8A 4PE8A 3URBA 1MUWA 3IVSA 4ZEPA 3VXGA 1Q3NA 4LWWA 1KFJA 3ARYA 2BODX 3RMJA 4M6QA 4D6CA 2VP8A 1XBXA 4E3TA 3CQHA 3TQPA 2CWXA 4MPKA 1E4NA 3MI6A 5DF0A 4JZ5A 3RX2A 3WJYA 3TYDA 3FJ6A 2GQ9A 1ZPTA 2BHZA 1CGTA 4Q8TA 4D71A 3GSMA 1Y65A 3R1ZA 5E9AA 4CNOA 1WV2A 1OQFA 2ZIDA 5H8MA 2WCGA 3O6YX 2FVMA 2A2IA 4LV4A 3SJNA 2DT1A 1G4EA 3TH6A 3AIRA 3PZOA 3GNDA 1UJQA 3HG2A 2PRMA 2OT0A 4N6EA 2CCRA 1J8VA 1J10A 4LS2A 1OD8A 3VZYA 2XH4A 2Q71A 3KP0A 1O5KA 3LXCA 5IHRA 4GQBA 4GI9A 5KEZA 1JPKA 2YPIA 2J75A 3KL5A 4XBSA 1PE1A 3BCJA 4MB3A 3UZWA 3CIVA 4POCA 5DN1A 2YFNA 5CZJA 1HKMA 1ODUA 1TWIA 4RK8A 4MWAC 4I9TA 2Y6ZA 1W1VA 2DJXA 2V5LA 3I3EA 4L6OA 3MCOA 3S3GA 3SAZA 4UTMA 2EG6A 2PC4A 2I9EA 3W7LA 3G2GA 3KOZA 2WMJA 6ENLA 5C9RA 2FIQA 4MNMA 1KFLA 3VD7A 3PJXA 4AZBA 2D2HA 4REQA 2CXEA 3OVGA 4Q8QA 3C0SA 3PAOA 4LVBA 4QROA 2QJGA 4HOWA 1DHKA 4C60A 3AXKA 5DBTA 1OFQA 3VMOA 4H7ZA 4GOAA 4O54A 1X7FA 4S2BA 1JG9A 3P0XA 1ZZMA 2HMCA 3ITXA 2J62A 4P61A 1J01A 5HWJA 1HJWA 2CW6A 2J6XA 5E93A 2CHOA 3BGJA 3EB2A 2VGBA 1EBHA 4AIBA 3M1ZA 3OZMA 4NI8A 5E5CA 1P6BA 1ZHAA 1TVLA 2HISA 4MY9A 1K8ZA 1NQKA 4R27A 4GZIA 4EPDC 4IPLA 4IXXA 3SSZA 5ABFA 4HTBA 1ZSXA 5CJNA 3P62A 2VRKA 1EFZA 1KM4A 1W8GA 1FCVA 3PJUA 1Q85A 1OT1A 1QU4A 1V3LA 3WK1A 2X1SA 3MWCA 1B1YA 1MZRA 2PTDA 5LXXA 2A6LA 1H7XA 3MP4A 3W1TA 1FXPA 4LEQA 4XKYB 4S38A 4RR4A 3FCPA 3ZVHB 4AXKA 1XLKA 3EPNA 3MANA 3SRFA 4IICA 1CLXA 3ARXA 2Z1WA 3KFTA 4PTVA 1E55A 2HPMA 2VD8A 3BLPX 1OCBA 1ML1A 1R3WA 3L5MA 3G6LA 4KIEA 2L5HA 3PANA 1BYDA 2QCFA 1K4GA 1BFNA 3KL0A 1ECQA 3NAVA 1MEWA 2OTDA 5D03A 2QIIA 3TZNA 4CN1A 1UW9A 3VKCA 4H9TA 2MUCA 3T8LA 4XX6A 3TIMA 3MMTA 5LIWX 4JTKA 2YW4A 2DSUA 1V3JA 4QCEA 4AHQA 1W3NA 2WNQA 1XCXA 1R0MA 5CH9A 3CJPA 2V2CA 2O9OA 3OU8A 3O6CA 4JD4A 3RU8X 1KM3A 1UKQA 1RALA 1HJXA 5A6JA 3AZTA 3T05A 2Z2BA 2ONEA 3O7UA 4V2XA 3W4RA 3VA8A 3PZTA 3MUIA 3NIYA 1GW1A 2J13A 2QCNA 5LNUA 5C9WA 5E70A 4O8RA 2E5BA 3E3HA 2XSAA 4PL2A 1TMQA 3CO8A 3WDHA 3H2CA 1ZBKA 5LHFA 1QW7A 3TAOA 2VX7A 3WF2A 1SR0A 4W88A 3F7JA 1XDJA 1OFRA 5IOBA 1WA3A 4WKFA 1KR0A 4XTIA 3URNA 4JICA 3VNKA 2DJLA 4NKCA 4ZO9A 4LVFA 3L4XA 3OBAA 3WQOA 1NP0A 3NO3A 5ENLA 3BMVA 2PWGA 2AKMA 4IOTA 3KDNA 5EA9A 3L4YA 3W1PA 1MQPA 1JCXA 3UZYA 2XZ9A 5TIMA 2VJXA 5I07A 4XIMA 3ZLHA 2EPNA 3T4CA 3F4VA 2UY2A 4JXCA 1L6GA 2PCQA 3VCRA 1VPQA 2G97A 4GI4A 3DUGA 4B5SA 3RCNA 3NVDA 1YTDA 4DJED 3VGHA 1K7FA 1F6KA 1JVNA 4HCHA 2QDEA 4GIEA 5CZ0A 3V4BA 4TUFA 3Q67A 1UR1A 2A3EA 3IJ9A 1GVQA 4NX5A 4FLSA 3NQ6A 1VHNA 3K2GA 4DF1A 2DH3A 4A3UA 4JCLA 2HCVA 3RX4A 1JYNA 1UMLA 3TTYA 3NXFA 5MKGA 1YTEA 3UWZA 4GE8A 3CGTA 1ECEA 5I06A 3RM8A 4AEFA 5BZAA 1M1BA 1SMAA 3WFAA 2FFCA 5IDIA 3W9ZA 1G69A 3LTYA 3M0JA 3HQNA 1J9YA 1Q13A 3QJAA 3DG6A 3ZYZA 4MAVA 4H8UA 8RUCA 2PLJA 4JY8A 1SPQA 4WEVX 5BWFA 3VMPA 1PAMA 1QFEA 3BAWA 4PMZA 1B3WA 3T42A 2XHYA 3U2OA 5HQMA 3PC0A 2XIBA 5LA0A 3WJZA 2YDQA 2XSXA 3WH8A 2EQDA 4MJZA 4O28A 3PG8A 2WYSA 4XAGA 4H41A 5GJPA 5DQPA 2PB1A 1IXQA 3BG5A 2VDIA 1KW1A 3W7PA 1HKIA 3K30A 3WDIA 4UOQA 3GIPA 5DT5A 3NSXA 4XK2A 1XC4A 3ZJKA 4M7TA 3VX0A 3GZAA 2NX3A 4H7CA 2NX9A 3UBPC 1WZKA 5F1VA 1Y5XA 2DZVA 4N02A 5H91A 1VBRA 8CGTA 1TA3B 3VDHA 2HBXA 2NQ9A 3S2MA 2JEPA 1VFLA 3W7GA 4D6EA 4S39A 5M3WA 1MFVA 3L4UA 1QI4A 1KGWA 3PJTA 1BKHA 2PD9A 1K70A 5C6MA 1P0NA 2DVXA 4Y9NA 2PDBA 2TAAA 3DHUA 4Z2IA 3BV7A 3BDKA 3BLDA 4WY0B 4FX6M 1D3GA 5DCBA 1L6SA 5C70A 5FEXA 2HXTA 3HZ3A 2CLFA 3ZLGA 1SW7A 1RAKA 4P5UA 4FK9A 4MF4A 2PDGA 1OABA 4CD7A 1UD2A 2OX1A 3VD3A 2B7OA 1GOOA 1YW1A 3GZ3A 3DFQA 1XWYA 3GRIA 1XLBA 2GQAA 3OHIA 4GJIA 4P8VA 2CLHA 4AG0A 3QTPA 2PDIA 1UUMA 2G5WA 2Y0FA 4UZSA 1GHRA 1M6JA 3EX4A 4XKMA 5E6ZA 3H53A 4QIUA 3OO2A 3HPXA 4MYAA 3IVUA 4JTFA 5AY7A 1EGMA 1T8QA 3G1XA 2D23A 3SO7A 5C9ZA 2JIWA 4MJ4A 1X96A 3R2GA 4EKJA 4E0CA 2QJHA 1WO2A 3SCWA 4WF7A 1PWMA 2J9ZA 3TWAA 4ADSA 1P1MA 3KRZA 3GIQA 4YYCA 4P7RA 1TPB1 3VFCA 2PWVA 3LNMA 4GFSA 2E7FA 4ICCX 3I4KA 3AMKA 4GMEA 5M1TA 3VNIA 3GKFA 3VKKA 3SURA 3M0VA 3MZNA 3TTSA 2R8WA 1E9YB 4A21A 3GM8A 3CUGA 2G3JA 3B8TA 4L9XA 1AMKA 3C0JA 3IUIA 4OE7A 4MB1A 4YHEA 1H0GA 2I1OA 4HIBA 1V0NA 1L8NA 3SZ8A 2FH6A 1K03A 1US2A 3ABSA 1IR1A 1R87A 3SUWA 2P8BA 3W1RA 3W27A 5B7ZA 4IPNB 3HB9A 3TQVA 3T40A 3FGCB 3W7CA 4M29A 2JF6A 1MXDA 2FLIA 2BBFA 1QW8A 4GXMA 3B9AA 1RJQA 1OX4A 4JL2A 1FRBA 4GJJA 2BHYA 2XZ7A 5AKQA 3T09A 4DJDD 2QV5A 2ZA3A 3QTGA 1UPMB 3QGVA 4AC7C 3TJXA 2INFA 1CLVA 1SM9A 3CWNA 4LGXA 3QW4B 1K6WA