1A80A

Native 2,5-diketo-d-gluconic acid reductase a from corynbacterium sp. complexed with nadph
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
277
structure length
277
Chain Sequence
b'TVPSIVLNDGNSIPQLGYGVFKVPPADTQRAVEEALEVGYRHIDTAAIYGNEEGVGAAIAASGIARDDLFITTKLWNDRHDGDEPAAAIAESLAKLALDQVDLYLVHWPTPAADNYVHAWEKMIELRAAGLTRSIGVSNHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDWAAAHDVKIESWGPLGQGKYDLFGAEPVTAAAAAHGKTPAQAVLRWHLQKGFVVFPKSVRRERLEENLDVFDFDLTDTEIAAIDAMDPGDGSGRVSAHPDEVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE A
publication title Crystal structure of 2,5-diketo-D-gluconic acid reductase A complexed with NADPH at 2.1-A resolution.
pubmed doi rcsb
source organism Corynebacterium sp.
molecule tags Oxidoreductase
total genus 105
structure length 277
sequence length 277
ec nomenclature ec 1.1.1.346: 2,5-didehydrogluconate reductase (2-dehydro-L-gulonate-forming).
pdb deposition date 1998-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1a80A00
3LUTA 4WDWA 3BCJA 4JQ2A 1PWLA 3H7UA 4EXAA 2PDGA 1RY8A 3EAUA 3WBWA 5LIYX 3UP8A 3COTA 3LQLA 1QWKA 4WEVX 4FALA 4DBUA 3KRBA 4PUWA 4XZLX 1SM9A 3CASA 3ONCA 3GHRA 1AFSA 2A79A 2IKJA 2PEVA 2HV5A 1XJBA 2PDFA 3CMFA 1Q13A 2R24A 3GUGA 3M0IA 3UZYA 4I5XA 2FZDA 2R9RA 3WBXA 1Z9AA 4IJCA 2PDQA 3VXGA 4WDUA 3BURA 4GQGA 3GHTA 3EB4A 2ACUA 3V0UA 3LZ5A 1HW6A 2IKHA 4H8NA 1S1RA 2FGBA 4QXIA 2HE8A 2FZBA 2NVCA 1ZGDA 4XVEA 3Q67A 4FAMA 2P5NA 1S2AA 1OG6A 3Q65A 1Z89A 1T41A 4DBWA 2VDGA 3O0KA 1JEZA 1MZRA 1EKOA 2IPFA 2PD9A 4PR4A 2PDIA 4FA3A 4WGHA 5HNUA 4YVVA 3R58A 4PUUA 4JQ4A 3B3DA 3BV7A 4JQ3A 1XGDA 4F40A 4PRRA 3GHSA 2CLPA 2INZA 3V0SA 2BP1A 2PDLA 3UFYA 2DUZA 4JIIX 1LQAA 1Q5MA 3ONBA 3G1RA 4GABA 1US0A 2ALRA 1AZ1A 3LEPA 5LIUX 4XAPA 1ADSA 2PDXA 1X98A 5M2FX 2PD5A 3LENA 1M9HA 2ACQA 4LBRA 2PDBA 1C9WA 2FZ9A 2PDWA 4EXBA 2HDJA 4NKCA 4YVPA 4HMNA 4XVDA 4LBSA 3UGRA 2PDCA 3P2VA 3N6QA 1R38A 4YVXA 1YNQA 4ASTA 3LZ3A 4XK2A 2IKGA 4ZFCA 3M4HA 1EF3A 4DZ5A 4LAUA 3WCZA 4QR6A 1ZSXA 3DOPA 3LQGA 4XZIA 2ACRA 2C91A 2FVLA 4G5DA 3G5EA 2IPWA 4JIRA 4IGSA 4L1XA 1RY0A 3LD5A 4Q7BA 1A80A 4DBSA 3R43A 2IPJA 2IS7A 4GIEA 3DN5A 4AUBA 1UR3M 3R8GA 1K8CA 2PDYA 2HVOA 5C7HA 4Q3MA 1EXBA 1YE4A 4WDTA 1GVEA 4XZMX 1YNPA 2AGTA 3UZXA 2I16A 2PDMA 5JH1A 3RX2A 3BUVA 4JTCA 3WG6A 4WDXA 4WRHA 1RALA 2QXWA 4HBKA 1FRBA 1MRQA 3V0TA 2F2KA 1PZ0A 4JIHA 4FZIA 3V36A 3MB9A 3LN3A 1QRQA 1XF0A 2PFHA 1J96A 3WBYA 2I17A 1S1PA 4JTDA 2FZ8A 1Z8AA 3EB3A 4LB4A 3F7JA 3H7RA 5LIXX 3UWEA 4QBXA 3R7MA 4R9OA 3UYIA 4XO6A 2WZMA 2PDPA 3FJNA 1ZQ5A 3U2CA 3R8HA 1LWIA 4XZHA 3QKZA 4LB3A 2J8TA 3C3UA 2IKIA 3ERPA 3GHUA 4JTAA 2BGQA 1Z3NA 1YE6A 1IEIA 2HE5A 1PZ1A 4RPQA 1AH0A 3N2TA 3UZWA 1IHIA 5HA7A 3O3RA 3LBOA 2INEA 1PYFA 3NTYA 4JTQA 2IQDA 3RX3A 3FX4A 5AZ1A 2PDNA 1MI3A 5JH2A 3D3FA 4XO7A 1PWMA 4GCAA 5AZ0A 4GACA 3S3GA 3H4GA 2DV0A 3MC5A 2PDHA 4YU1A 4ICCX 4GQ0A 3UZZA 4L1WA 4OTKA 4JTRA 2DUXA 2PF8A 1VBJA 3CV7A 3UG8A 3CAQA 3M64A 1AZ2A 4JQAA 4XZNX 1VP5A 4PMJA 4H7CA 2HEJA 3R94A 1X96A 3R6IA 5DANA 4QX4A 2HVNA 2WZTA 1S2CA 1T40A 2BGSA 4YS1A 3V35A 5LIKX 4IJRA 2PDKA 2PZNA 1X97A 2ISFA 5KETA 4PRTA 4JQ1A 1AH4A 3T42A 2NVDA 1HQTA 1EL3A 2PDJA 4MHBA 3RX4A 1ZUAX 5HNTA 2F38A 4LAZA 3CAVA 4GA8A 2IPGA 1AH3A 3LNMA 3CV6A 2PDUA 5LIWX 2ACSA 2IQ0A
chains in the Genus database with same CATH superfamily
4ZTYA 1WE5A 2EPKX 5AHNA 3H7UA 3MMUA 5HPCA 4XSLA 4W89A 1MQPA 1UASA 5JMUA 1NVMA 1JXJA 3COTA 1JF6A 3TNBA 1O7AA 1NDYA 2CLEA 1QWKA 4K68A 4WSJA 3THUA 4L9YA 2D24A 2A7PA 4MPQA 4EXQA 1SM9A 1RJQA 3B9OA 1W56A 4BEUA 4JEJA 1XJBA 1NAL1 3ZJ6A 1AD4A 5C9UA 3BAXA 2GLKA 3AU6A 1K8XA 4RV3A 2GYIA 4N02A 4ZVJA 5I0DA 4JTUA 3L4WA 3ZOAA 3V16A 1ONEA 2Q3RA 2WK2A 4GPNA 5HUOA 2RH9A 3W7RA 6XIMA 1F4HA 1XW8A 3GDRA 1H61A 2FZBA 4GQQA 4N0RA 4FEZA 1EWDA 2PE4A 2OT1A 1H50A 5TF0A 4I9AA 4JTGA 1GOWA 1S2AA 3GD6A 4ZO9A 2GJLA 5GJNA 5ABGA 3K13A 3F4VA 4YHEA 4QLJA 3WBAA 3CBWA 2RDXA 4LAKA 1W37A 3GXIA 5EMKA 3AMGA 4PYSA 5U4NA 3EPNA 3UFYA 1NP0A 3STCA 3NPUA 3ONBA 2ZC8A 3VM7A 3D0CA 1JYWA 3MVIA 2P1FA 1W3IA 1E3XA 2YBTA 2PDXA 3TNOA 3VDGA 1X98A 3LLDA 5M2FX 2DZUA 1H3GA 3JUGA 3R89A 2Z1XA 1B4KA 4I7VA 4ERGA 5EU9A 3HQNA 4B2DA 1QK2A 4PULA 3M0VA 1B5TA 3V5FA 1OZQA 4TOQA 1IWAA 1ELSA 1UB3A 3DIPA 2E9BA 3FJLA 3QJAA 4DNHA 2W63A 3UXLA 4LBSA 3N6JA 1WDWA 2D0GA 2ZX7A 3L66A 1X1OA 4MKSA 2HBXA 4L4OA 1B54A 1LM1A 2NUYA 1IEVA 4M19A 2Y2WA 4M8UA 1KO0A 1ISWA 2VX5A 2QVHA 3PSVA 4KEVA 3ABOA 2GGIA 4AG0A 2EEXA 2V8ZA 4TX8A 4OBSA 3H7VA 2QDDA 3WQEA 3P67A 4G5DA 4WKFA 5LNSA 1C9DA 3BICA 4LC6A 3VFLA 4GIEA 1V3JA 2VRQA 3SCTA 3DERA 2HVOA 3ZYZA 1R3TA 5IRPA 3NVTA 1UUMA 4HCDA 1TZ9A 1OHLA 1EUNA 3CWHA 3P8JA 4ORMA 3S9ZA 1EHNA 3VOGA 2VCAA 3OU8A 1BQCA 4TTUA 1ICSA 3C61A 3KW3A 4DUXA 4R7WA 1MEHA 3LBCA 4FP1A 4JFVA 5D2TA 4DXVA 3A9IA 3N12A 4JIHA 3F2CA 4B5VA 2V2HA 3N34A 3MB9A 2EAWA 1H63A 1HO1A 1E43A 5C2GA 1Y0EA 1TVPA 4HOZA 3G18A 1B1YA 3N9KA 1QUMA 3W7NA 3IJQA 3KTCA 1FCUA 1RR2A 1H62A 5LA0A 1NDVA 5CC7A 1J5TA 2YL8A 3PBUA 4Q4QA 2DZWA 4YWIA 3RHGA 2GVYA 4HA1A 3AYTA 3PZ9A 1THFD 2WB5A 5DRIA 4A2SA 1HKKA 1XYZA 2QJNA 4UFIA 1YDYA 3BQ6A 2E5CA 4C6DA 1BYDA 4GMEA 2A1YA 2VZSA 3T9PA 4D6CA 5AC7A 2J9ZA 3L4UA 1OFEA 3LU2A 4JTAA 2KZHA 4WQ6A 4PEEA 2BY2A 4L9XA 3PUOA 1R2RA 3N3MA 1QHOA 1IXOA 2XH2A 4GGHA 4PCFA 1HG3A 1S5TA 4LALA 3VD9A 5I3FA 1XQKA 4IMFA 3QFWA 2Z25A 3P0XA 4GACA 3TONA 3SUTA 3W1TA 4E2DA 4H3DA 3LTYA 4YHGA 4DI9A 3RU8X 5A8NA 3TC3A 3VUPA 4UQCA 1EPXA 3N4FA 5E6ZA 3FA4A 4H6EA 3TE9A 1CGYA 2OO0A 5FJIA 3PAOA 2RDTA 1LYXA 4ZFMA 3CAQA 1A53A 3BJSA 4LRSA 3VGDA 1JUEA 3HV9A 3F1QA 4QE4A 5C0QA 5B7ZA 1ZP4A 1XUUA 1JYNA 3CB8A 3AMCA 2XM2A 3EGJA 1X1NA 3P8IA 1V77A 4Q4MA 5HQMA 3GDMA 3HPAA 2BY0A 4QX4A 3WX7A 5CZSA 4DAIA 3CTTA 3QC3A 2PDKA 1LORA 1LWJA 1MEWA 2REQA 1RVGA 2AGKA 4WLCA 4ZQCA 3AXIA 3GVGA 4LX4A 4TVCA 4BZYA 4BK9A 4AEOA 3AWNA 3DBPA 2DSVA 3A4XA 4QEHA 1ZU8A 4E8GA 4KCWA 3MKCA 3W53A 3VU2A 4LS2A 3NEHA 4W8BA 1PX3A 3C0QA 4YNGA 4N2YA 1GOMA 1F6PA 3J7HA 1JIBA 3HBLA 3T09A 1NARA 3PSWA 4OZOA 5AKQA 2OSXA 4YJ5A 3T4CA 3VTRA 3URQA 5G5IA 4H9TA 4JQ2A 2C1IA 4Q32A 1ML1A 3CIWA 3LB0A 2FTPA 3AS0A 4H00A 4H04A 2VQTA 2PSNA 2OX4A 3I65A 4Y9NA 1IIHA 4TXEA 1M68A 1G7VA 1UKSA 3NZQA 3AMKA 3SCQA 1DXIA 3WLKX 3OLGA 2IKJA 2PLJA 4FIQA 4P8VA 2PA6A 1BWVA 2A5HA 5D37A 3PULA 1J01A 4HK7A 1X7IA 5LNRA 1OBAA 2ALDA 2Q02A 1S3HA 2FZDA 3R8RA 1ZJBA 3PFRA 1JI2A 3L5AA 2QVNA 5BOFA 3BQ5A 3KEHA 2DSWA 1E1FA 3SUVA 4NQ1A 2PDQA 4GE8A 3GR8A 1H7NA 4V28A 4NZ4A 1W3JA 5A95A 4BF9A 4UR7A 3A21A 1JPKA 4RNJA 4JTTA 3Q67A 4FF7A 1OG6A 3L0GA 4QITA 3O0KA 3GC5A 1ITXA 3TVAA 2J66A 3VABA 4O8AA 4JBRA 1LTDA 4A35A 2IPFA 5AHEA 1HGWA 4AMAA 3W74A 2G50A 3ZVHA 1MFVA 3C6CA 1Y5VA 4U3AA 4XX6A 5F2IA 2O4QA 3MMDA 1XYFA 3QV7A 2OQYA 3VZZA 2J62A 1P6BA 3CHEA 2J7GA 2DUZA 4EKJA 4KFNA 1LQAA 1W2PA 4X0VA 4GVFA 5LZLA 1M7OA 2QDEA 2MUCA 3QV9A 4LH8A 1BGAA 5TIMA 1QAPA 5C9RA 2BHYA 2TODA 4LS1A 3NQCA 2WM0A 4A05A 3GDTA 3TCSA 3TC6A 1FCVA 3A4WA 3GVWA 2X30A 2YL5A 2NV1A 4M80A 3UGRA 3O06A 3AHTA 1J2WA 3NFUA 1TZZA 3B0UX 4IFOA 1YNQA 4I7WA 3WDPP 4Y90A 3MSYA 3OGRA 4XKMA 1EF3A 1GNXA 3PJXA 1QPRA 2D20A 3AIWA 3WF1A 1G4EA 3O7UA 3MCOA 1JGMA 1I8JA 3Q2DA 4V33A 1CECA 2G8ZA 3OGVA 4Q8OA 1F61A 4I5UA 3N17A 2CU0A 3P84A 4DBSA 3KOZA 1DP0A 1OD0A 3QPZA 1OGSA 3R8GA 3GE7A 4GIRA 3W02A 3TJIA 5GNZA 3SCPA 1FVPA 4ZO8A 3ATYA 4RZ4A 1ADOA 4UNIA 3IUIA 1IXPA 4O52A 1R9ZA 3F2BA 1IWBA 1RJPA 1PS9A 2AL2B 3IJ7A 1RVKA 4A8NA 4GG9A 4KWSA 3DENA 2V3EA 4LTSA 4UZSA 4MNLA 2PWFA 4HBKA 3WJYA 4C6OA 2ZE3A 3BWWA 4O11A 1PZ0A 4PZVA 3SFKA 5K9XA 2V5LA 3NWRA 2DFAA 1DWHM 3G1HA 3BDKA 3SIMA 2O7QA 2PP0A 2POTA 1M53A 2ZUTA 3QYQA 4QCFA 4TR9A 5A1AA 4AIEA 1E5NA 4LB4A 1Z42A 2JGQA 5D2YA 3B9EA 3OZYA 1VD6A 4GLEA 5FKYA 1Q6CA 2NW0A 2FMOA 3GK0A 1MNSA 2PDPA 1OF8A 1XH2A 3U2CA 4P8UA 3W7PA 2GJNA 4GVHA 3N1AA 2OCZA 1R2SA 2Y7DA 1RPKA 3DU0A 5A6LA 2WVSA 4XQ6A 1HP4A 1Z3NA 3E2VA 1RSCA 4BI6A 2W9MA 4CD6A 3ARPA 4IXHA 3L2IA 1VH7A 4DYKA 2VEMA 5FF4A 1ZBWA 2ZZ6A 1S39A 3LTSA 2JKEA 1A5UA 4GI9A 4XO7A 2Z1SA 4FO4A 4OV4A 3ICJA 2VGBA 4LJ3A 4LYQA 4DPPA 2VFDA 3QPEA 2W27A 4YU1A 1DV7A 4FF5A 2P0OA 4GZIA 3VMPA 1Q3NA 4ZSUA 4P61A 1KKOA 2EG7A 1C90A 3LLFA 4KERA 2PU0A 5EL1A 3PN8A 3ABQA 1YW1A 1UPMB 1JUBA 1T8XA 4NX0A 4EACA 1M5WA 2DPEA 3NZ1A 1ITCA 2D23A 1JVNA 4Q8VA 3PZOA 5KSWA 1P0NA 2F6XA 1P4CA 2FMNA 1NJJA 3M47A 4Q8MA 1JCMP 3R6IA 1ZAJA 3OA5A 3W72A 1E15A 5LGZA 2WZHA 4K36A 4CVWA 2PURA 3M0HA 4DLMA 3TAOA 3QQ1A 3FFSA 1FWCC 4UQ9A 3TWBA 2MANA 1DXFA 2NVDA 4TIMA 4AWUA 3D5HA 3NOEA 4L6HA 4EWJA 1HTIA 1QK0A 3GXFA 5HNTA 3SQSA 1OC6A 1ALDA 3ZVHB 4QE5A 1WXYA 3CWOX 3HMCA 2GDVA 1NP2A 3WJZA 3PY2A 4OECA 4LWWA 1XYCA 3FSTA 2NX1A 3CQKA 2VEGA 3GNRA 4LYRA 3SGZA 3UY8A 4ZR8A 1HUVA 3O16A 1FH9A 1MXSA 3ARQA 2IPGA 2DIKA 3UJ2A 3CO4A 3QOMA 4MOZA 3RU6A 2YW3A 4HTBA 4U10A 3C2RA 2ACSA 1V3KA 3PZMA 1HKMA 1P0DA 4Q8TA 1DWJM 4UUIA 1FWBC 1QNVA 4KWVA 4Q22A 1KV8A 3IPWA 3W7EA 1HT6A 3TN3A 3BLFA 2Y7FA 1CCWB 3K30A 3UP8A 2VFGA 5FF7A 3WK1A 3AU2A 3HB9A 2GGGA 3CIVA 3K8KA 5XIMA 6REQA 3Q37A 1P0BA 1HL2A 4FLRA 1YADA 3AHVA 3BG5A 3WLRA 3ONCA 1PZ2A 3PTKA 4OKDA 4FNQA 3L4XA 3PJUA 3T40A 4HA0A 4WSHA 4QS6A 4NX5A 4HJWA 4AHOA 3EEZA 4LUTA 4E3TA 1FP9A 2BV9A 5FOOA 4HIBA 1R9XA 1W5PA 4RZBA 4QEEA 5HXMA 2J27A 3EWCA 3IV8A 4BF7A 4Q8UA 4GINA 3N14A 2ZZ5A 4XBSA 4XV0A 1GVQA 3VGBA 1Z7AA 3RLVA 1X38A 1QATA 3S1WA 1JL8A 4JIEA 3LOTA 3BG3A 3L65A 2YFOA 4F0MA 1XGZA 3KP0A 1S1RA 2V3GA 3T0CA 4FX7A 4MIMA 4J35A 6TAAA 1SW0A 4Y7EA 3GNNA 3CHDA 3FJ4A 2ATMA 4ZODA 3CZEA 1UP3A 2O9OA 1Z89A 4J3TA 2VDGA 1O5KA 1JEZA 3C4UA 4C6IA 1MZRA 1T99A 2B0MA 3F4NA 1PSCA 2P3EA 4GQBA 4WGHA 5LGXA 3LHWA 4PUUA 2V5CA 2QULA 2X05A 1PB0A 2OEJA 3ZS4A 1W3LA 5TD4A 7TAAA 1KCKA 4LCSA 3BOFA 2WSYA 3KTXA 4JICA 1A0EA 4M82A 1EIBA 1W17A 1ONRA 4DZAA 2BASA 2CLLA 2Z2BA 4E2VA 4HJFA 2OU4A 4GCXA 2NV2A 1B9BA 3SQMA 1IYXA 5I3JA 2PDBA 2QCNA 3W00A 1SMAA 1D2KA 2VZTA 1FWGC 1RBAA 2ZUWA 2O9TA 3IACA 3DHFA 4R5EA 1JAEA 3TOYA 6ENLA 5CG0A 4YTRA 4UWMA 5G4HC 1OZMA 1UD8A 2DGAA 3PBGA 3IVTA 2ZCGA 2GOKA 2QCLA 3DFHA 1R6WA 2FJUB 1I2NA 3TU9A 9CGTA 1NELA 4GNKB 3MDWA 5D9PA 3TDFA 1HNYA 5IBXA 2FZMA 3GM8A 1SVDA 3AIVA 1DWAM 4QR6A 1OFQA 4IP7A 4MB1A 1J4EA 1W9XA 1XG4A 3FV9A 1A0DA 2ZA1A 1K4HA 5LNUA 1UD2A 3GX9A 3T55A 4M7TA 3UQNA 5FEZA 4DELA 3L21A 4FSAA 2AMXA 1FHDA 2AAAA 3DN5A 3O9NA 4GY0A 1KM1A 4JEQA 3TZNA 1F6YA 3CMJA 3AJXA 3EX2A 1V6WA 3KDOA 3T2QA 4Q3MA 2JGYA 1YE4A 4LF1A 1YTKA 1XLLA 1SJCA 3DFTA 1G9HA 1I2PA 1SU5A 1KRCC 1VFTA 5CPSA 3KBNA 3L68A 5G4WA 4Y6GA 2Z1BA 1FFQA 3S2JA 3HM7A 4PBFA 1G94A 1ZCOA 2QDGA 4HPNA 3P82A 3V5CA 5I6SA 3S4TA 4HSOA 3AI0A 3V18A 4IF2A 4MLRA 3P61A 1TX0A 3VIFA 3KDNA 3PVFA 4IPLA 5JXQA 3U2EA 1UW9A 5LYRA 1JFXA 4PTVA 2Y4SA 3PZTA 2WZMA 4ZB5A 3UR8A 4AMCA 4O1DA 3HQPA 5E1QA 5J04A 2F61A 1P1MA 2E09A 4J9JA 3V1PA 3NM1A 4F3HA 3TQ0A 1IEQA 1KR0A 1JRCA 4OOZA 3WQGA 3NEVA 4JY9A 4H8HA 2J79A 2FB3A 1MNZA 1GOIA 1SW3A 1UZ1A 1HO4A 3VM5A 2W67A 3APTA 1AQHA 1WXJA 4DZIA 3WDIA 5GQBA 1AG1O 3RX3A 2CBJA 3WLPA 2ZX9A 4QHRA 1V6VA 4HU3A 2BVYA 4BA0A 2GGHA 3LCWA 3N2CA 3LLXA 3QF0A 4WK9A 4ONVA 6REQB 2C1HA 3NDOA 4DEFA 3M1ZA 4NP7A 3THQA 3VE9A 4OTKA 2PP3A 1SMDA 4ERAA 2V5JA 3SY5A 3W01A 3VKBA 2YB4A 5LA2A 4N4PA 1AZ2A 1TPVA 4AX7A 4J27A 3GH4A 5AC4A 4HNVA 4B5XA 1G0CA 5CPQA 2A3BA 4C5YA 3GDKA 1X96A 2BBFA 2WVVA 4WIWA 1WYIA 1F9CA 1L6GA 3ENLA 1CZ1A 3QC0A 4LU0A 3WF4A 2QHAA 1W54A 2R1MA 2PTXA 2PZNA 5G4EA 4ZE4A 1PL9A 3BV4A 4LXFA 3SQLA 4MF4A 1V4YA 4GJJA 5D2VA 1A0CA 2D3NA 1W8GA 4NXSA 4PBGA 2VEIA 3PAJA 3G3DA 3FKKA 1YX1A 3GIYA 3O05A 4Q8PA 4IIDA 3QQWA 3FYOA 1W1VA 1ZUAX 4Y9PA 4LBUA 1EBHA 4H1ZA 2OZ0A 1TTIA 2CFFA 5D8WA 3SZ8A 3PPFA 3LPPA 1XC6A 1UR2A 2VL4A 5AHFA 3WMCA 1M41A 1W5MA 2W4XA 5HMEA 3VIHA 4KGJA 4ACZA 4Q4OA 1OEPA 4EXAA 3AYVA 3QZ6A 5EFDA 4QQ3A 3CL8A 4DJFA 2ASHA 3GLCA 1S38A 1K8ZA 3SDOA 3MT1A 3KCJA 4PUMA 2CZ5A 1A4LA 5BNKA 5I24A 1NM9A 1XLBA 2Y85A 1PCKA 4MWAC 4FXRA 3WD1A 3N29A 1DBTA 4LOCA 3O07A 1KNWA 4AY8A 2PDFA 3CMFA 3EXSA 1A5MC 3UF9A 2Y5EA 1TE1A 4I5XA 3XINA 4LCQA 1FP8A 1ZY9A 3KZPA 1JPIA 2JEQA 2XGZA 4C1LA 1X6UA 1LQ0A 4H9ZA 3ARVA 4YLWA 4CU8A 3BMWA 4AX6A 2CBIA 4AZ7A 5PTDA 2KX9A 3PBWA 1TSIA 3LS9A 3TV8A 2V68A 2PC4A 4Z08A 4NSBA 3BAIA 1GVRA 4XWUA 2FGLA 3CUIA 4XAFA 2XDFA 3W2NA 1V0LA 3H6OA 1XWYA 1UIPA 1K6AA 4YVVA 1QASA 3WY1A 4AEFA 4MUZA 1QTWA 2ZFAA 4PTWA 1EOKA 3PTQA 7PTDA 4LS0A 1J0ZA 3LXAA 2PDLA 4E5TA 3CXOA 1GQNA 3EMZA 4M7SA 1UWSA 4Q8NA 5KMYA 4DUWA 1UQZA 4JTJA 4ZZ9A 1XFCA 4I90A 1A5SA 5H8MA 4HZ6A 1E0WA 3LEPA 3DG3A 3P5ZA 4LBRA 3M0XA 5DO8A 4WKHA 2NQHA 3UCCA 3N11A 1WZMA 5XIAA 3IEBA 3VIKA 1BFNA 2BHZA 4XKYA 3UJFA 1OX5A 3WUFA 1QI2A 3P2VA 1V3IA 1OJXA 4YVXA 1H5YA 2PTDA 3CUHA 4EP8C 2W66A 4W8LA 1KM5A 4L7ZA 1FHVA 2NQZA 3CYVA 3OVPA 4RJEA 3V3WA 2QCMA 1DJYA 1CBGA 3FAXA 3ABRA 3IK2A 3WCZA 1MRAA 3MI2A 1TPWA 1ZSXA 3L5LA 2WBGA 1B2YA 1HXJA 3GG0A 1UR9A 3GQYA 1FWTA 3G5EA 3T05A 5BRPA 1W3TA 1XDMA 2WZIA 1W3NA 1A80A 1X6LA 4DN1A 1M7XA 2B7NA 5C2CA 1LP6A 1K8CA 2E7FA 2RJHA 2ZZ1A 1GJPA 4HOXA 3VC5A 4WDTA 3O6DA 5CQ1A 3WH7A 2ZUNA 4GNVA 3BUVA 1D3GA 1RALA 3S9IA 3CM4A 3BJFA 4AZIA 1PIFA 3DG7A 1J8VA 2WZEA 1H0IA 1RUSA 1H1YA 2ZUUA 4QLLA 3TMQA 2WBKA 1SPQA 2OX1A 3W1RA 4LVFA 4PTDA 2WVVB 2VEKA 1XF0A 1W2VA 4RK8A 3WIJA 3P62A 1KCZA 3WYZA 3NO5A 4C6CA 3VINA 1IT8A 4CEUC 5HANA 3EWDA 2QZRA 5D9NA 3N2BA 4P7QA 1A3HA 4S2BA 3C0JA 1H0GA 1EYWA 2YGYA 5HWJA 1BYCA 1MO0A 1ODUA 8XIMA 1Q2RA 1U5HA 3U5UA 5D30A 2BMBA 1U22A 3O2LA 2Y8VA 1UKTA 3H24A 4UTKA 4HMCA 4F8XA 2DQXA 4LB3A 3APYA 3W1NA 1JYVA 1DJXA 1B90A 3BO9A 3FVDA 4AD0A 3U9IA 3TMLA 4CCZA 1GK8A 2CCRA 4R9XA 4A4AA 1FHUA 2P10A 5FEXA 2YL9A 4QDPA 2BTMA 3KHJA 4PH6A 4AHQA 5HA7A 4PSPA 3UG3A 4LAOA 3BTNA 3EX6A 1K3UA 4ACZB 4ZSTA 3AALA 2NUWA 5I09A 1JULA 2VHLA 4X9SA 1TUFA 3MHGA 5F4WA 3NQBA 2YIHA 2J78A 3QHOA 5I5RA 3H2EA 1KFKA 1XFBA 3NNTA 3E3HA 4CN6A 5M03A 3N4EA 3SO7A 3W7OA 2WHMA 2XN0A 1G1YA 3WH8A 3VOHA 3PP7A 4ZOEA 3WLNA 3CPGA 1VBHA 1TIMA 4QCEA 4TX9A 1BG4A 3WUBA 3W1UA 3XISA 3VKDA 3KCOA 2HEJA 1KQYA 2VEPA 1F3XA 1K77A 4C6MA 1K7EA 3FJ6A 3HURA 4Y8FA 3BLIA 1US2A 5A6AA 4GIYA 4DJDD 2CERA 1Q6EA 1JD9A 3S5ZA 1PVNA 1KBLA 4IT1A 1TTPA 1EL3A 5E09A 4MHBA 3T81A 3TJXA 1ZHAA 4AWEA 1X39A 2DIJA 1Q2SA 4Y96A 5HR6A 2QS8A 3ABSA 3QV6A 2B4GA 3QQ0A 1G69A 2XVPA 4RDZA 4M5PA 3G2GA 3DBNA 4RUBA 2QGHA 2GQ9A 4HU4A 2JEPA 3C0LA 4V27A 4E4PA 4KH2A 5F7UA 1VPQA 4MYAA 4A3YA 4RCXA 4CVUA 1WZLA 4O0KA 2Y8KA 2WC7A 4D6FA 4LCRA 1KFLA 3IANA 5F2MA 5HK4A 2QPUA 1IWPA 1FOBA 2ABAA 1UOZA 4H2HA 7REQA 3IK4A 1EZWA 3EDFA 4EPDC 3IJDA 3SCUA 2QV4A 3LHVA 4XKYB 3TFXA 4QP0A 1U83A 2ZWYA 4HZ8A 1HIZA 3H2OA 1AFSA 4UQAA 3FLUA 4G6CA 3A3HA 4H9XA 5CZ0A 4HN8A 1K02A 2A7RA 1DHKA 2DH2A 2OELA 2OPJA 1SUXA 4U5IA 2YLLA 1KLZA 2A3LA 2FH8A 4C65A 1XLDA 4PMQA 4IJCA 2A3AA 4W7WA 5BW6A 5DY2A 4IUGA 2J7EA 2OSWA 2E8YA 2R1PA 2JIWA 3UPBA 1EHAA 3LM3A 4XAYA 1TPEA 1KLYA 3MPGA 2HE8A 1WXZA 3R4IA 1K1DA 2XSAA 1CX9A 2VFHA 1ZGDA 2O9RA 4F2BA 3MWAA 1PUDA 2WANA 4DBWA 2HXTA 4PTMA 3W22A 3JRKA 4INFA 4S3FA 4W85A 3AIRA 3GDBA 4RE3A 2Y5SA 4FXJA 1X7FA 3EDKA 4A8IA 3V0SA 3H4XA 2W6RA 2V67A 4QRNA 4RDWA 3G6MA 4W9TA 4RE2A 3G6LA 5ABEA 4QNEA 1OX6A 1JCJA 4UTTA 3LRLA 4HN4A 1ZS2A 1IGWA 4GUHA 1OF6A 1L6WA 1ZB5A 4JL2A 2WMHA 3M0KA 1BKSA 1O5XA 1V0KA 4WZHA 4IQLA 2ZDRA 4NKCA 3MJYA 3CAKA 1KKRA 2G3JA 1E71M 3BAYA 1CXEA 1H7RA 3LXBA 2J74A 2PDCA 4NI8A 3T0AA 4QISA 3N6QA 3WQOA 1GOKA 1XBVA 2OZ8A 1A5KC 3ECQA 3SUWA 3CT7A 3RO8A 1U2YA 1BGGA 2HNHA 3KLLA 1VCGA 5HNNA 1M3UA 4Z2LA 2YSWA 2P0IA 3CWNA 4YYFA 5A6SA 1BXBA 2OKOA 1PO9A 1E6QM 2PGFA 2IPJA 3VPLA 5BXSA 5C9XA 2GJXA 4FR1A 3NSNA 3NPXA 4R27A 1A5AA 1KTCA 3NDYA 3WLLA 2C7FA 5HINA 2C14A 1OYCA 4HCHA 1WCGA 1R8LA 1KXTA 4WHBA 4ZOBA 3TYAA 4UTMA 2PDMA 4XISA 5I2UA 1FWNA 3WG6A 1QNQA 3I7QA 4ZQOA 3NSMA 4C6FA 4YTSA 1MFUA 4O15A 4O54A 3CZGA 1VBUA 5G2WA 2F2KA 1A5CA 3QKEA 3IJLA 2J9YA 1YIXA 4EPBC 1FY6A 1TV2A 4GHRA 5AC6A 2VVNA 4PGLA 2H6RA 3H2NA 4MB3A 4AVFA 3HFYA 2VWTA 4RDVA 2BB0A 2PFHA 1XRFA 2VNCA 2I17A 1P0EA 3CQHA 3H2FA 1JYXA 4S3JA 4BJHA 1F3WA 1O12A 1GOQA 3WD2A 5CGTA 2WCGA 3VOJA 3HPZA 2J9XA 1BAGA 3NPWA 3H7RA 1MW1A 3FYPA 1VJZA 2PP1A 1CGWA 1KM2A 4OQVA 3M5XA 4R7OA 3FW6A 3EKLA 2ZWZA 4Q4SA 5D4YA 4B16A 3R11A 1ZQ5A 1YDOA 4ZA0A 3LHUA 2V38A 4FMVA 4IGNA 4CU6A 5J5RA 4YWSA 2EJAA 1XG3A 3QKZA 2WAGA 1MQQA 1IR1A 3HA1A 2GVJA 2Z24A 3LV5A 3BW4A 2FPTA 4MSSA 4H83A 5BOOA 4B3KA 1IEIA 4KS0A 2C79A 3N2TA 3KBMA 1W5OA 4LV9A 3OPSA 1AL7A 1D7KA 4I6VA 5AB3A 4QG6A 1C8XA 4DF1A 4Z17A 1VHCA 1E4IA 1PWMA 2PBOA 3QFEA 4EK7A 5AYZA 2B7OA 1KFBA 3PK7A 3K5XA 5CSSA 3LX9A 1BSLA 3CUZA 1PPIA 3K4AA 4WR3A 3QY8A 3HG5A 4GYKA 1JF5A 4JTRA 5I00A 1UPPA 4FNTA 2CXGA 3TSMA 2P8CA 3W7JA 2O7SA 4PMVA 3U7BA 3WJSA 4N9BA 4XTIA 4C6NA 3H4WA 1GOOA 1MW2A 2NV9A 4KETA 2WLYA 4PMJA 4OFCA 1FDYA 2G41A 1R3RA 2PRHA 3KOWA 3WELA 3IAQA 3NQFA 4IGMA 5H8UA 3GTFA 2BGSA 4UQEA 2VMFA 4U3CA 5I23A 2C16A 2W5FA 2ZTKA 3WK2A 1W0MA 4J7RA 3EBVA 3T2PA 2C3ZA 1VQTA 1ZP3A 1J93A 3CNYA 1QMLA 2OFJA 2PBGA 3KRSA 4JQ1A 3W1MA 5IM51 4AISA 3A12A 3U6WA 1R9YA 3TXVA 3HPFA 4AC7C 1GQIA 1EJVC 3V5OA 5M3WA 1FTXA 3LSBA 4X3ZA 1VS1A 2F38A 1XLMA 3EWYA 3LPOA 1JJKA 2XJ7A 1PTAA 1IZJA 2J7BA 2ADAA 4NYYA 3WK3A 2G4FA 3AIQA 3CV6A 4MUPA 5A8PA 4MDPA 3WLIA 3G1XA 5LIWX 3N4AA 2NQJA 1QPNA 4PMYA 3WENA 3QGVA 4QJ5B 4PUEA 2DZPA 2EBNA 1HL8A 3VIGA 1JGIA 5HULA 1D9EA 3CU2A 3OQEA 1E4MM 1C92A 1N7KA 3W71A 3KRBA 2OYMA 3AHZA 3O63A 1NWSA 3VYLA 3TOPA 1LOQA 3C5QA 1V7AA 3R13A 4ZMGA 2HV5A 4KESA 3SRFA 4KPLA 3I10A 1Z32X 5AYBA 3RFAA 1Q4WA 3TW7A 4QE1A 2CW6A 3VKAA 3I4KA 4F4RA 3VXGA 4HPGA 4UC5A 2ZDSA 3GXNA 3WLHA 4PCNA 1HL9A 3MUY1 1OINA 3FS2A 1OC5A 2GJXB 3H2AA 1EDTA 3AIBA 4FI4A 3KLKA 4IIFA 4ORIA 3KRZA 1CW2A 4H41A 3QY6A 1H7PA 2ANUA 1BF2A 2EPLX 1OFDA 2XSBA 3C8NA 5A2CA 3MBDA 3URAA 2BVTA 4GK8A 2DVXA 2P8BA 2TRSA 4QJ3B 2WV8A 4L64A 4HKPA 3WK0A 4CKQA 2DZVA 1QO2A 2INZA 1TCMA 3G1RA 1Y65A 4S3BA 1AK5A 3L2MA 4ES4A 4ZENA 3REQA 1A47A 4LVAA 1CLXA 1ADSA 2ZYFA 4FX8A 3LHTA 4LANA 1TRIA 4ENLA 3STPA 3QMSA 2YOCA 2PDWA 5FJOA 1EF2A 1XSKA 2C19A 3GKFA 1KBJA 1OWQA 2I14A 1RCXB 3GIQA 4HSNA 5E9XA 3SBFA 1WDPA 1R2TA 1W3KA 4UOZA 4IPJA 1HJXA 3EWBX 4GY7A 3D46A 5A3HA 1K03A 1XDJA 2QNEA 5GVJA 3N15A 2EJ1A 1YEYA 4RE0A 4OWGA 5DX7A 2OLSA 1OIMA 3DECA 3RRXA 2DW7A 1H49A 4XZIA 2ZX6A 1W3HA 2DZSA 2XFRA 1HJUA 1XLFA 4DBDA 2BGNE 4KFPA 3UZ5A 3DHPA 3WQ6A 1CTNA 3SSJA 1R7AA 3R12A 1Q8JA 4PUKA 4RNHA 1J0HA 4J5NA 2Q8LA 3DG6A 5T91A 3CHVA 3G0XA 1TG7A 4JKKA 2E9MA 5C5YA 3CYJA 2E6AA 5DELA 1F4AA 3NQMA 2FFCA 4JN7A 2G3IA 1JZ8A 5M17A 3UZXA 4V2XA 2HK1A 1H51A 2XSXA 4JKMA 3U2ZA 3ARTA 3WD3A 5CAHA 3GVRA 1TWDA 5C55A 2C71A 2ZXDA 4EF9A 3LI0A 3TP4A 1V3HA 5CLTA 4IIEA 3BSHA 4KEZA 3BLKA 4DYJA 2A3HA 5CZTA 3WNOA 1BKHA 3S42A 3TZFA 3NQDA 2VFIA 1E3ZA 1VBGA 3S47A 5CZKA 4W93A 3G1YA 2YBUA 3BARA 4LSBA 1V08A 1K7FA 3FA5A 2QIIA 3W9ZA 4RX0A 2ZVIA 4Z42C 3ISIX 1Y5WA 3WF2A 3NL2A 1E55A 2I7GA 4OVXA 5J5DA 3RMJA 3PTDA 3F5LA 3OIXA 2F9RA 2X8RA 1RZMA 1U5JA 3TN5A 3TSDA 2FPVA 1YBQB 2VDIA 2PTWA 1L2UA 1BLIA 1Q6RA 3VNZA 3VZXA 2Q8XA 4LF2A 2IXVA 3NOYA 2PC8A 4EWND 3NTYA 5I78A 1GPWA 4F0LA 3HTWA 3I3BA 1JCTA 3ITCA 4H6QA 3W23A 1WPCA 2RDWA 5FI8A 4UMCA 2AOSA 2NXIA 3T6CA 1V02A 1XP3A 2YJQA 1J9YA 1DIOA 2UY3A 1EJTC 4JHZA 4MDOA 1QHPA 3ARZA 2HISA 4UNKA 3VO0A 3CL6A 3MANA 3F4WA 4MPKA 4O57A 1I0DA 3QR3A 1K4GA 3WLJA 3NAVA 3RDKA 4J2PA 1LRNA 3AISA 4HNTA 4RV8A 3M5ZA 1V3LA 4GFIA 3DZ1A 4MY8A 3AUJA 3HIJA 4LQ1A 5D09A 3F4DA 2WKGA 1RHCA 1NU5A 1ZZMA 2QEZA 3RGTA 3N04A 1VYRA 5FEWA 3VX1A 2Z7GA 3E5PA 3ZWSA 1JZ7A 1X8FA 4H9VA 2E3ZA 4GZ7A 2BXVA 4MNKA 5I79A 2D2JA 1TQJA 5AFDA 3OBEA 5CKSA 1XBYA 3MS8A 3R2GA 3T42A 3P60A 4QNWA 3QH2A 3WFZA 2PDJA 4M6VA 3EKGA 5K3VA 3BW3A 1M04A 3W7GA 3MTWA 3VKCA 1TJ2A 1IT0A 2UY5A 4L5ZA 1N8WA 4V1YA 3VGGA 5BOEA 4LAZA 3W88A 1GPFA 3U4AA 4G2DA 3KS6A 2NWRA 4D6DA 2UY2A 1GHSA 1QOPA 5IFTA 3REQB 3XIMA 3GRIA 2R1LA 3EDDA 3H22A 4KEUA 5LXXA 1ZJAA 1L8NA 4JZ5A 3TJ4A 2PWEA 3VC6A 1GT8A 3RJXA 1ZCCA 5LXEA 3WBWA 2E9LA 2VC7A 1NOUA 4ZB2A 4R3UA 3A5FA 4F48A 3SCWA 3MBFA 3TTQA 5G1YA 3OBAA 3STGA 5REQA 4JNYA 2XIOA 2BLEA 3S2NA 4PUWA 2PF0A 1E1EA 5IOBA 1B3XA 4AQLA 3CASA 4BKNA 3S5SA 2OLHA 3KTSA 1FUYA 3MP3A 3S2MA 3M0IA 1DL3A 2RHGA 4JXCA 1OGGA 5A69A 2WW5A 2Z29A 1ISVA 3W73A 1DWFM 3W29A 3TTYA 1NH6A 4PSRA 1GVYA 1W8SA 3GNPA 1VB9A 3FCPA 1EO5A 1LOLA 2YYUA 3IJ9A 1KWKA 3RO6A 1WDRA 3GHTA 4C7FA 2GUUA 3WDQA 4G1NA 4GZJA 1HW6A 2WWDA 5A6MA 2ZZ3A 3N25A 3P93A 4BQ4A 3QR0A 4ROQA 2FGBA 2QCFA 5DFAA 5DT7A 5TNVA 1SO4A 1UWAA 3DKJA 2QJMA 1RXOB 1OT1A 4IX0A 1T7LA 3VGHA 3WF3A 4DWSA 1FDZA 4Y9MA 3W38A 3ZFHA 3PZNA 2OGYA 2ZA3A 1FWRA 1XCFA 1GYLA 4AD2A 2DJLA 5AY7A 2DZAA 2I57A 4PMDA 2WNNA 4JIIX 5C7VA 4ZCWA 2FPYA 2BOEX 3W1QA 4CQCA 3TJLA 2ODOA 2OEKA 5H1WA 1LQ2A 4O53A 1EEPA 2NQLA 3GAKA 3H26A 4OOUA 4L56A 1I9CB 1H1NA 3VK5A 5CJMA 2E67A 3SM0A 4ZEPA 3LPFA 3G8EA 3GXMA 1BVWA 1KM0A 2PCEA 1HP5A 1EH9A 1EGVA 4NNCA 1CB7B 3KVJA 2DU2A 3FA3A 4GKLA 3W6YA 2WC3A 3ARYA 3UVIA 1R47A 2WQDA 3LY0A 2V2DA 4J3ZA 3TSBA 4WY0A 1UA3A 2BOGX 5DCDA 2YXOA 3B9DA 5ECUA 3LSCA 3PZGA 1E40A 1UMYA 3DDMA 3O15A 4I3GA 4XB3A 1PYMA 3VZYA 4WF7A 2ZICA 3VNLA 5CXPA 1WUFA 1ZRQA 1VAHA 2OKTA 1BVZA 2RUSA 4IGSA 1EIXA 4Q7BA 3OHMB 2A21A 2JK2A 3LHZA 1B3VA 1OG0A 3NL5A 4TQTA 2X42A 2CLFA 4GOAA 3NYDA 3E2RA 2X1RA 3W6LA 1E1CB 1GYNA 1TR1A 3GWQA 1TO3A 2V9DA 1HJQA 4B4FA 3HPSA 2VC5A 1RCQA 1KGWA 4KT2A 1BRLA 3RX2A 3QN3A 3ZSSA 1W1A1 1EDQA 3SECA 2D1ZA 3EX3A 4TV6A 1KTNA 2WO5A 1GG1A 3NQ8A 4FXFA 1C3FA 4UZUA 1V79A 1R0MA 5HNRA 2QQ6A 4ZGYA 2VENA 3EDEA 1R46A 2WKLA 4NZJA 3A23A 2FQIA 1ITQA 1QW7A 3W87A 3P74A 3F7JA 2GVGA 1P6WA 3UWEA 1DJGA 4GC3A 1H4PA 2JE8A 4O19A 5DBUA 3LCLA 1PXGA 2O56A 4NY2A 3AZTA 5F2GA 3W0KA 1AD1A 2VURA 4ILSA 4MFDA 5G2IA 4CNUA 1TA3A 4ZOAA 1XINA 1UP0A 1UR1A 4UB9A 2Z2UA 4KRUA 3HFTA 5BU6A 3IRDA 4Q4KA 4NUWA 1PZ1A 3WJWA 3M7WA 5AHMA 3GNOA 5GNYA 1H60A 4QTGA 1V51A 4AZCA 4M81A 1V0NA 2ZX8A 1B30A 4HQVA 2XTKA 3B97A 5I07A 1XBZA 1ZNNA 3O6YX 2GK1A 2PLCA 2F6UA 1ZPTA 5KTLA 4RE4A 2ZRVA 5MHBA 4G8TA 4CQDA 3TKFA 5REQB 3IGSA 3NDZA 2X09A 4LY4A 4GQ0A 4UMAA 5DMMA 3UZZA 3T8QA 3CS2A 2O55A 3GZ3A 2DUXA 3CV7A 3SURA 1GJWA 3A4AA 4ZXLA 2V5KA 1RBLA 4WCJA 4XZNX 1OIFA 1E6PA 2PZ0A 1O6IA 2R94A 1TWZA 2Y8UA 4LUSB 4XZ9A 4H7CA 1XM3A 3TAKA 4U4MA 1J0IA 1JCXA 1W1TA 1DTUA 3BMVA 2YL6A 5DANA 3AYSA 3QGAC 3P6LA 2DH3A 3OQ8A 1BG9A 2XVGA 3L9CA 3V35A 4HSHA 5XINA 1BEUA 3EMQA 3USBA 3VE7A 4O0QA 1Q6GA 7A3HA 4QG9A 5CBJA 1Q6OA 2WMFA 3VA8A 1F2JA 3DAQA 2X16A 2JKAA 4DWSB 3RX4A 4X0NA 3LGDA 4MNMA 4YPJA 2ISWA 3GKAA 2WJZA 3JR2A 4GZEA 5I3KA 1L6FA 4MJZA 3E0FA 4XD6A 1FWFC 3EOEA 2G3FA 3BGGA 3IAPA 3LUTA 2E8ZA 4CNOA 8XIAA 7ODCA 3RXZA 1MW0A 1NTHA 1A5OC 2OG9A 2J47A 1E9ZB 2YCLA 1QPKA 2FTWA 5LIYX 1XIBA 3SCSA 3DI0A 3ES8A 3LA4A 5HJYA 2XHYA 4AIBA 5ABTA 1OCBA 4WEVX 1EA9C 4MY9A 2QJJA 1OC7A 4F0KA 3NVDA 4AYSA 5LKYA 1J2BA 2ZXAA 4EIVA 3BLEA 3GFYA 1GGOA 4AIOA 4WY0B 4AD5A 4HNOA 1ZBKA 3GUGA 2ISVA 2KAUC 4IJBA 2GPTA 2WNWA 4PN2A 4IMEA 1XKYA 1GKRA 4Z1BA 2VOMA 2VYOA 4O1BA 1LUCB 4AIUA 3QBUA 4L6OA 4QLKA 3TYUA 1VEMA 3EB4A 3CK5A 4LVBA 4MZYA 2NVAA 5JU6A 3UPWA 5ENLA 2Z27A 1GVIA 3PANA 3KVKA 1Z44A 3ES7A 1XSJA 1YMYA 1K9TA 1EGMA 4AXKA 1OK6A 1GVFA 1TPFA 1H5VA 1M03A 3TYCA 3ZT5A 2P5NA 4DWDA 2E6YA 1EGZA 4MWAE 1BRLB 4L4LA 3MO7A 2Y24A 4S1FA 1QCWA 5A8OA 3BVJA 3WZ0E 4JQ4A 1UBPC 4EX4A 1DYSA 3NQEA 1BYBA 1YTEA 2CLHA 4KGLA 2EHHA 3A6OA 2CLPA 5HJXA 4GABA 1UKQA 3NZPA 1RQBA 4RKAA 3LNPA 4RNIA 3TXZA 1G4TA 2Z26A 2J7HA 5HDRA 4PMRA 3VNMA 3P81A 2QJGA 2HDJA 4ADSA 2Z7KA 4KRZA 1UR8A 4YIWA 3RCNA 3RG6A 1AQMA 3C2YA 1CNVA 3OW1A 1TA3B 3CEUA 4D71A 3B8UA 3QMRA 4Q4PA 4KCUA 1TTQA 6PTDA 2QPXA 2C13A 3GSMA 1TPB1 2R6OA 2Z1WA 3HN3A 4XZBA 3TR9A 1UG6A 2Q8ZA 4ATWA 2CESA 2POZA 4DJDA 1GHRA 3QSRA 5K4XA 4DJEA 3V7PA 4F0RA 4AZCB 3G1FA 3LQGA 4NZ5A 1CPUA 3CPUA 2WSPA 3E0WA 2PWVA 3NYZA 3AJ7A 3S1XA 2XVLA 3RR1A 1Z48A 4JIRA 5DF0A 4N9DA 1ICPA 1U5VA 4F66A 2CZEA 3FXGA 1JZ3A 1KBIA 3AUOA 5C7HA 2GOUA 1ISYA 5F1UA 3BSGA 3S5OA 1XGEA 3RPDA 2ZADA 4AEEA 4JOMA 4GIAA 1TPC1 3C3NA 2RDUA 3L5MA 4WDXA 5I7GA 6TIMA 1DJHA 4NZ1A 3LMYA 3QEZA 4CCDA 2QMJA 4DY1A 3ITOA 2WHLA 2J8FA 2J77A 4DHGA 2WNQA 4WJEA 1GVOA 1QRQA 5GJPA 3RUBL 4JHMA 2DIEA 2BHUA 3TW9A 2Y7GA 1TJ1A 3WBYA 2WPGA 2JF7A 2GSHA 5A8QA 1SJAA 1SO3A 3T8LA 2OLAA 1Q6QA 3C2EA 2Y1HA 2CHNA 4K7YA 4NJHA 2DSZA 2BOFX 2UY4A 2XVNA 1NFBA 1XLGA 5KINA 5D32A 4N7QA 2CEQA 5ABFA 3RK8A 5AECA 1H7OA 5IBXC 4AZHA 3CV1A 1WAUA 3KUMA 3RPMA 1C8VA 5JUVA 3M16A 5LA1A 1K6WA 1IXQA 3MUXA 3F4CA 1GWJA 3AOFA 4U2YA 5CBIA 1TCDA 4X63A 3OTRA 5AN7A 3G8RA 3KBVA 2BGQA 4JN8A 1I60A 4J4KA 3BG9A 4W5ZA 4RPQA 3W1AA 3UZWA 3EWZA 2NT1A 4JCMA 2QLYA 3ZJ8A 1OK4A 5C9WA 5MF5A 1KA9F 4UTWA 3LXCA 2X7VA 3S2LA 5D04C 4DM2A 2YCLB 3IGXA 3FYYA 4LV4A 4BR1A 3VIIA 1EJUC 1FXPA 2PWGA 3BPWA 3L4TA 1KC7A 1DHPA 1R85A 2VGIA 3B40A 1DVJA 3MA8A 2DV0A 3HJZA 1WP6A 2DZTA 4KBXA 5HMFA 3IJIA 1MUMA 5HPOA 2YDQA 2TAAA 2ISSA 1UJQA 3KVMA 3ATZA 4QJ4B 4IMGA 1DWIM 5HBFA 4OGZA 3S8HA 2DORA 1DIKA 3G1SA 3MY9A 3GH5A 4MMWA 4NRSA 3VCCA 2OEMA 3UU0A 2J6XA 4W5UA 1RAKA 2VD9A 1F05A 1QNRA 1WDDA 1HJSA 1S2CA 4YS1A 1VRDA 5E0FA 2ZZ2A 3W3OA 2E6FA 3CUJA 3W7CA 1F07A 5BYWA 3UZJA 4O28A 3AYRA 3UPMA 4PTNA 3OODA 4D8AA 4CUCA 6XIAA 2WJEA 1NEYA 1GYMA 2CC0A 1SYTA 2VX4A 4C6EA 1EOMA 3C86A 5TQLA 3T0DA 2G3MA 3BAKA 2P53A 2F6KA 2OWWA 3ZMRA 5CC6A 4Q33A 1PKLA 1JAKA 3KZSA 2YZ5A 5FEPA 1CDGA 1U30A 3UXDA 1RBOB 3TQKA 3W7QA 3LGGA 1VYSX 1SFSA 4NILA 1AH3A 1G4PA 5E6YA 1NOFA 5EMJA 2PB1A 2Y62A 3N73A 2B7PA 3GTHA 3UESA 4C6JA 2OWXA 2VGFA 1ZJIA 1T5AA 4PUDA 3EA1A 2V69A 3GTIA 5D8ZA 3AIEA 3G1AA 4HU8A 2C18A 3QOKA 1A50A 1O1ZA 2PEVA 1FWHC 5CPLA 2LLEA 3UCQA 4DVOA 3V1HA 2HMCA 3VNKA 4YTQA 1W6TA 1Q13A 3NUKA 3UWQA 4XBJA 1W31A 3WNLA 2HS8A 4KKXA 4AH7A 3U3HA 2E68A 4MKNA 4UCFA 3HF3A 1RD5A 2D0FA 4Q6XA 1S2WA 3NM3A 3PBMA 3V0UA 4W7VA 4GRSA 2DZXA 4H9YA 5LNVA 3V4BA 4OU1A 3T1GA 3CIXA 3H2MA 1CLVA 1TYGA 3CH9A 3AHYA 3WQFA 4GJIA 3MYOA 3U57A 4D6JA 2DT3A 1EKOA 2EG6A 4PMXA 1TPH1 1MVYA 4B15A 3WL1A 4HCLA 1UD3A 1U1HA 5I77A 1CWYA 2GFTA 3CT2A 1ZBVA 3QZEA 4AFYA 5G2HA 5A6BD 1UKPA 2JIEA 3L23A 2BP1A 4J3VA 3VI2A 3CLWA 1TMHA 4DJFC 2NX3A 3UG5A 4OE7A 3DC0A 4WVXA 3RRAA 2XIIA 4GVGA 4H4IA 5FJUA 3IIPA 2OSYA 2REQB 3GYEA 1Y7VA 1ZAHA 4D8ZA 2ZIDA 4KQNA 3S6OA 4AHPA 3HOJA 2F8QA 3STEA 1XLKA 2V82A 5KZMA 4Z0JA 2D0HA 2NQ9A 1OFAA 4RW5A 2UBPC 3W84A 1VFUA 2HSAA 1IZCA 1DE6A 4C5ZA 1WOBA 3KVLA 3B0PA 5HWMA 1T96A 3LZ3A 3WQ8A 4FHAA 4IPNB 2I9EA 1Q8AA 1XYMA 5KITA 1OABA 2Y63A 2FHCA 2YYTA 4K6AA 4UQBA 1WDSA 3MSRA 2ACRA 2Y5JA 2C91A 3DFOA 1TJRA 2ZRWA 4O14A 5DY3A 3ZLFA 1G7UA 3UR7A 4DZHA 2NWSA 3DHUA 3PWGA 4AUBA 5BMWA 1VIWA 4B92A 4DI8A 4HHMA 4I7UA 2TYSA 3CL7A 4IFRA 3S1UA 3N2MA 3L4YA 4DRSA 4CQ8A 4Z2JA 2XH7A 1RV8A 1DIEA 3S5YA 2J6VA 1FRBA 1DIDA 1KFWA 1R3VA 3UWYA 4FZIA 4PB3A 3M6DA 1CT5A 1TMQA 4GYFA 3VUSA 1D8CA 4XD5A 2O4MA 3R0KA 1Y5XA 4ZQRA 2YXGA 4HNLA 4FOUA 4D1IA 4JTDA 3ARSA 2YR1A 4K8EA 3D47A 3Q58A 4UR8A 2PRLA 4ATLA 3W70A 4JTFA 2VUYA 3WLSA 3UYIA 3IARA 2NT0A 3M07A 4NHVA 4JGDA 4K1WA 1LCOA 1V6YA 2CPUA 4TMBA 1JI1A 3MCNA 3FJNA 3W76A 3TUUA 1FWWA 2ONEA 3N2XA 4OV9A 9XIMA 1LT8A 4MY1A 5CBBA 1QVBA 3UXKA 4JFWA 4EOUA 2YCJA 2PWHA 2G95A 2EQDA 1U1UA 3RILA 3GHUA 4MNJA 2PUZA 3BGJA 2CLMA 1SQ7A 3H55A 2HNEA 4QFUA 3NG3A 5CSYA 3OVQA 3VAVA 6A3HA 2VX7A 5FAGA 2D22A 1UD5A 3OVGA 2CLOA 3F5JA 4HNUA 3A4JA 4H9UA 1JQXA 3CLMA 3HGJA 1B57A 3UXIA 4B9YA 5CPTA 3EOSA 1QI3A 2RFGA 3MI3A 5LNWA 2ZTJA 1VBJA 2XUCA 4KCTA 3QLLA 1MSSA 4CN4A 1K70A 3MSGA 3K4WA 4MAZA 3OLIA 1VHNA 1JDAA 2VELA 2WXDM 3B8VA 2FDMA 3NGFA 4HVXA 4CCCA 3M46A 4HHPA 2WPBA 5FL1A 1WKDA 4ADUA 4M1BA 4C6KA 1DPMA 3CC1A 4LFYA 4LNCA 1ENUA 5LIKX 2CWXA 3ZM8A 2NXGA 4ZTXA 1EJXC 4YYCA 3LTPA 2BS9A 4HNNA 3IVSA 4R53A 1RA5A 3ZR4A 2WSRA 4GYPA 4F0SA 2WCSA 3E2QA 2P50A 4PFMA 1WZAA 3EKZA 4P7NA 4UMBA 3WFLA 3UR5A 3CQIA 3ORWA 4DIAA 1N55A 3HJEA 1SW7A 2EPNA 1YKWA 2XZ7A 1B9ZA 4DO5A 3GTNA 3WMLA 3S9YA 1E0TA 1I4NA 4GYJA 4NL1A 5AHLA 1LL6A 3EOOA 1G4SA 2UWFA 2H3DA 3PBVA 3EZ4A 3PB2A 3GW0A 2CXEA 4JS3A 4UFJA 2PGWA 3EPOA 4M1RA 1E6RA 1SFJA 3N13A 4WDWA 4PE8A 3MQTA 2ZUMA 3QY7A 2E5DA 3S83A 3UWUA 4E8CA 5A6TC 3UJRA 8RUCA 2OZ3A 5E70A 4GD0A 3G3MA 3S1GA 5KEZA 2JALA 4XZLX 3B0VC 1IEXA 3P80A 2QCHA 4CCEA 2FH6A 2I56A 1DJQA 1ECEA 1JDEA 4PODA 3FVMA 3GXDA 2OJPA 3TFCA 5FF0A 3MCMA 1NWTA 4M51A 4GISA 1C29A 4TX6A 2YPIA 1V6XA 4JTIA 1GKQA 1E56A 3DH7A 3DYPA 1GKPA 3RM9A 1EJ7L 1ECQA 2VVSA 3H23A 1QDSA 3KL0A 5FJPA 3ANYA 4FXSA 3M0YA 4O1EA 2YX0A 3HPXA 2ZRUA 5F1VA 3NGJA 1PKNA 1XSIA 1ITUA 4JY8A 3E49A 4ZBCA 3G1VA 1AJ0A 2JFEX 2VRJA 2ZKMX 1T41A 3VCRA 5B7YA 2DT0A 3RM8A 4A3HA 3S1VA 2V30A 4UTJA 5HNUA 3KWSA 2BY1A 5BWAA 2R14A 2XH0A 5LSMA 1IEWA 2D3LA 4Q7IA 1XIMA 3H53A 4KF1A 1TMLA 4L65A 1S2TA 1UWQA 4LVGA 2P88A 3NZGA 4PEKA 3KL3A 2AMGA 2PD5A 1JFHA 1M9HA 2ACQA 3RPTA 1YNYA 7TIMA 4Y9OA 4PFHA 5IDZA 1V03A 2GQ3A 1UUOA 2BY3A 3LHYA 2VGGA 3PPHA 1GTHA 4NI3A 2BVWA 1HX0A 1UH3A 1FWJC 2WC4A 4A2RA 3R10A 1UKOA 4HMDA 5H91A 4DWSD 1X6NA 3HGSA 4AZGA 3AS2A 2EPMX 3VDAA 3K46A 4QDWA 4XAGA 1VF8A 5FL0A 1N2VA 1GONA 2AQOA 4ZFCA 2PWDA 4N9CA 1EYEA 4CLMA 4DZ5A 3WFAA 2Z6IA 1QI0A 3W85A 3W27A 3DOPA 3FOKA 3HU7A 2BDQA 2FVLA 2H8ZA 1VFFA 3L2LA 3DCPA 3HGOA 5EMLA 1AMYA 1KRAC 3SN1A 2V81A 2HROA 1FWEC 2PDYA 1HJWA 1VFOA 1LLZA 3QSTA 1AW5A 3SFWA 1GVEA 1J12A 3ZO9A 3AS1A 2VRKA 3BOXA 4I8DA 3NA8A 4LUTB 3B0XA 3CEPA 4HD5A 2ZQ0A 4S3AA 4WRHA 3I7RA 1WZKA 4G56A 1NOWA 4DO6A 4UTTC 4WD0A 2PMQA 4BI5A 3PZQA 1MRQA 1XC4A 4E4FA 4OT7A 1XXXA 2HRWA 1GCYA 1OFOA 1XYLA 3CB3A 3AXXA 3CH0A 1S1PA 4H19A 2HVMA 3QLDA 4PCPA 1DEDA 3CZKA 2PLKA 1JZ5A 4X9YA 1VLIA 3A3WA 4DB7A 1BQGA 5K9CA 1I0BA 1E51A 5F2LA 3RLGA 4XIAA 1E9IA 5CJ5A 4C7DA 1VJSA 1YPFA 3C0SA 2Q01A 3TTOA 3ARXA 2H9AA 4DX3A 3WDJA 2OB3A 4KW2A 3W2UA 4J3SA 2W0UA 5FA5A 4ALDA 7ENLA 3C2VA 1QI5A 3BAWA 2PGEA 2QV5A 1GVSA 3GFXA 3O8AA 3MMTA 4H9MA 1UA7A 2VZVA 1ADDA 1KWGA 2HE5A 3WEMA 2EG8A 1N82A 2VXNA 4K8GA 4GVIA 4JPGA 3EA3A 3NJ3A 2PAJA 4AWSA 1XR2A 4GUIA 3HZ3A 3FX4A 4B5UA 4Y9AA 4GO9A 1MW3A 3PZVA 1R87A 1VEPA 2Z1VA 3WNPA 4QAIA 4NXKA 1K9DA 1IZKA 1I2RA 1Z6KA 2BVDA 2YFNA 3GBDA 4LW7A 1K7XA 4JR5A 3M43A 1F5ZA 5DXXA 1AQ0A 3VMNA 4WXYA 3MC5A 4NT0A 4AB4A 4BWLA 3RITA 4JTHA 2OZTA 3DGRA 1UMLA 1TELA 4MKVA 1QR7A 3RM4A 1EP2A 4LEQA 1KM4A 3L12A 1XRVA 1EP3A 3HG3A 4LNYA 1TWSA 1OFRA 3N9RA 3UXAA 4F9JA 4LC8A 3LI1A 5C6MA 4AY1A 4Z2KA 3W6MA 3GC4A 1SJBA 2YDRA 4B5NA 4PTXA 2A3EA 4WGXA 1OCJA 1OD8A 1GORA 5D38A 4G9PA 2J13A 5DMNA 3W2LA 4JCLA 2J7CA 4PRTA 1KR1A 3FXYA 3HQOA 2PU1A 1TV3A 4Z2GA 4DO7A 2IW0A 1SO5A 1SGJA 4D6GA 4R88A 2HZGA 1JR1A 2IQTA 3Q45A 4PC8A 1G67A 1ISZA 3CMGA 1CGTA 1Q6LA 3E6EA 3QMTA 1M6JA 2VOTA 2YKKA 4IGHA 3WH5A 3CAVA 3KBSA 2VP8A 2VCCA 5CC3A 4GI4A 3EWWA 4ZQPA 3HQ1A 1MDRA 3W25A 3WLQA 1FWDC 2HJPA 5AVNA 4FLSA 3MHFA 3A24A 2VT0A 1SZRA 3OJGA 3MJMA 3UA3A 2YZRA 2HPIA 1DXEA 1WDQA 3R1ZA 1C7TA 3ALFA 3LYEA 3SJ3A 3AC0A 4QSHA 3HV8A 2Y89A 1S3TC 1FWSA 5IHRA 1VPXA 4XD3A 1P43A 1H1ZA 3THCA 2QUNA 1OADA 1L9WA 4UTIA 4S23A 3R79A 4LYPA 2Y88A 4UFKA 1RQHA 1PJ9A 2R1NA 4NRRA 3MUZ1 1W32A 1W9UA 2AL2A 3AXHA 3OLDA 1MEIA 3E0VA 1G6CA 2PI6A 1OFBA 4PRWA 1P48A 2UV8G 1NQKA 5FCZA 4O13A 1D8WA 3AZSA 3GZAA 1EWEA 5BROA 2ACUA 4TUFA 4OBRA 2X0YA 4TTGA 1Q7ZA 3JS3A 5I3HA 4DAFA 3TYDA 5C70A 1E6ZA 4I9JA 4JTKA 3M5VA 2WVUA 2NVCA 4A21A 3GXTA 2CZDA 4GUGA 1O94A 1EJWC 2GGJA 3Q65A 4PBEA 4RZ6A 1EX1A 4Z1CA 2GUYA 3W86A 1BWLA 3WD0A 2FHBA 5CGMA 4F0HA 3ZXWA 4GX9A 4KFOA 2RGLA 3VX0A 3S5NA 4HGXA 2PDIA 4M0XA 4ML4A 4O50A 4HPHA 1PV8A 2ZXBA 1W5NA 2B81A 5IDIA 4AXNA 4CQBA 2E1DA 5A2BA 1OFPA 1US0A 5E93A 1FH8A 1GW9A 4BY3A 1KRBC 2D2HA 4C1KA 3Q4DA 5B80A 4H6KA 1PHWA 1ZENA 3I68A 1C9WA 5CGQA 1XIDA 4MWAD 3HG2A 3CO8A 4IMAA 4NNBA 3BANA 2ATSA 1XLHA 1A5LC 4XVDA 1HKWA 1XLIA 2H9AB 4LUJA 2E77A 1WBJA 4Z1YA 2TPSA 3ZSTA 3ABZA 4W8AA 1ZL1A 3VFCA 4OUEA 3C56A 1KB3A 3LCHA 3JVAA 5ABHA 2CKSA 1Q6DA 2E5BA 1GTEA 1PBGA 2C1GA 4O10A 4UFMA 3FN9A 4N9EA 4HHLA 3KP1A 3KBJA 1YTDA 6ALDA 3MW7A 3KOYA 3MKKA 1K9FA 3OYZA 3LD5A 3W7IA 8CGTA 4RL3A 4MJ4A 2IS7A 2CHOA 2ON3A 3UA4A 1XLAA 2EKGA 1BPLB 2V63A 1UQYA 4DF2A 4MJ2A 3NSXA 3WEOA 3R5EA 1WB0A 1Q85A 3WSUA 1BVNP 1Q66A 3U8GA 2XINA 4L9ZA 1L8PA 4HU0A 4KCVA 3CTLA 3VDHA 1TV4A 1SZFA 2DP3A 2CLIA 3FY1A 4AZBA 3UT0A 1U1JA 1MQRA 3TLLA 3BLLA 3KFTA 1R86A 5DRCA 2WHKA 3ZJ7A 3GNDA 1O60A 1GEHA 4DJED 3B03A 3BAJA 3KAOA 2VO5A 2F84A 4DQWA 3KBWA 3EB3A 4K38A 2XIQA 5D05A 1S46A 4NG3A 2FZNA 4WY0F 5DMLA 1SR9A 4KWWA 4LUIA 2X0SA 4R34A 1DJZA 2CETA 4GKTA 5C8BB 1E6NA 5AC5A 3UD6A 5L6UA 1AJ2A 1E0XA 1V7YA 4ERIA 2D2OA 2A3CA 2ABBA 2XWEA 1M65A 3LPGA 2A7NA 2W62A 4P8WA 2C0HA 3A13A 1JZ2A 1VBRA 3FAWA 3TN6A 1E72M 1D3CA 1FH7A 1PYFA 2XPKA 3UCDA 4AD1A 1KQZA 3T07A 2FVMA 2WLZA 2J24A 5EMMA 2G97A 5E5CA 4BHYA 3TWAA 3SI9A 3EYPA 3WNKA 2CNCA 1EFZA 4ZOCA 1LZOA 5JH2A 5CPOA 3H70A 3WQWA 3R0DA 1XYAA 4GCAA 4TVUA 4B5WA 3QV8A 4IPPA 5CC5A 1KGUA 2IXUA 1LROA 4O8RA 2A85A 1XDLA 4ICCX 5K2ZA 3O1NA 3STFA 2A0NA 4L1WA 3SN0A 1VCFA 3ITLA 3ZR6A 1IV8A 2H3BA 5AOUA 2VUNA 3MUIA 3M64A 4FK9A 2HS6A 4QG8A 3T44A 3W26A 2ZRXA 5LHEA 3E5BA 2Z2AA 4IQEA 1ZAIA 2FFIA 1DTNA 3LV6A 2XIJA 5JIPA 1CENA 2R8WA 4A3QA 3GW3A 1WBHA 2G96A 3QGKC 4GGBA 3ZLHA 3RCYA 1EO7A 3CUGA 4L4PA 2XIBA 3T2OA 2H8XA 3HGRA 4TU1A 1D7FA 4IIGA 3RCMA 4JHOA 5A8MA 3VOFA 1X97A 5KETA 2VTFA 5FJRA 4BFAA 3OOQA 2DSUA 3SADA 1F3EA 3UJEA 1CXKA 3AQUA 3I3DA 3TQVA 3RLUA 1H7XA 3GU1A 2WSQA 7XIMA 5A8GA 2V2CA 1XIHA 5FF3A 4IIHA 3SGGA 1PAMA 1UWTA 3LRMA 1GUVA 1CXLA 3IGHX 4D6EA 1FXQA 4PCTA 3MI6A 3OA3A 1NWUA 3UWVA 5A2AA 1GG0A 1LF1A 2DDXA 4N6EA 1WKYA 1OYBA 3LNMA 4JX6A 3O6AA 1Q4NX 4OIFA 1TWWA 3DESA 4NIRA 2PDUA 3E96A 1ONWA 4XIMA 4D8LA 2CIPA 2J7FA 4M24A 3BCJA 3LDVA 2YDSA 2P3ZA 4AVOA 4W88A 3MU7A 3SJNA 3SRKA 3MWCA 3GH7A 4RPPA 4I5RA 5I3DA 5E0CA 2QGYA 1TIWA 4R7JA 4MFEA 3DYMA 4HZ7A 3VIJA 3DC8A 4CGTA 1O5QA 4GY1A 5CPMA 4ACYA 3OGSA 1POKA 3EXTA 2X2YA 4AZ5A 3GHRA 2J75A 1P5BA 2PPGA 4L6DA 1OCQA 3SSZA 5DT5A 3K2GA 2ZZ4A 3N19B 2FYMA 1YRRA 4NASA 1LBMA 4GXMA 4EPEC 2GGEA 5JQ9A 4WDUA 3P14A 4F2UA 1B3YA 4GQGA 9RUBA 4XAZA 4H8NA 5SWUA 1TVNA 1C91A 4QXIA 3RF9A 1LL4A 2QF8A 4MB4A 3O0FA 1E9LA 4L61A 5H6HA 3DFYA 1KBKA 2OMAA 4IFKA 3S6TA 2PD9A 1UZDA 5CH9A 4H8UA 3M7SA 2PLMA 3AAMA 1VFMA 1IF2A 3B3DA 3SIZA 3B06A 4PL1A 4PRRA 3K8LA 4X60A 3TQPA 3N6HA 3OVRA 1HN1A 4MJMA 5CG7A 4K8HA 2ALRA 2GUBA 1AZ1A 2Q6ZA 4P7LA 4HK6A 4E2BA 2E40A 1VKFA 3IIOA 4FIRA 1RLCL 2VX6A 3CUXA 5JBFA 1RQEA 4D72A 3L4ZA 3QR1A 5DXYA 3U48A 4YCOA 2CYGA 3JZEA 3ZT6A 5T9CE 1QXLA 3II1A 3K1DA 4TVDA 1L6SA 5TAOA 1BYAA 1W9PA 1AODA 1W1ZA 2AKZA 3IV3A 1Y8BA 1PHQA 1EP1A 1ME9A 2CWNA 3H12A 1WNOA 1IE7C 3AICA 4H7ZA 1FFRA 3VOCA 5E0KA 2Y0FA 3OZMA 1UOKA 4AAJA 5MKGA 4V1XA 1NY1A 4EPKA 5LHFA 1PTGA 1XIGA 1B31A 2GVEA 2C15A 3NXLA 2YLAA 7REQB 5IHSA 4CNTA 2IPWA 1IQ8A 1YLVA 3B8WA 4J40A 4DWSC 1S5NA 2ESCA 5BWFA 3TA6A 1QBBA 3H2CA 1UR3M 3DFSA 3B8TA 1G01A 1TV7A 2GZXA 1XIEA 4EE9A 1CXHA 4HPXA 4J3UA 2QW5A 5I3IA 1KFCA 4XZMX 1EA0A 2AGTA 5CCZA 3LG3A 1CB2A 4DM1A 1XIFA 3KWXA 1B3ZA 4S2CA 2BXYA 1N8IA 3VCNA 1GZJA 3B4UA 1FWAC 4RLIA 1P7TA 2GSJA 2WM1A 3I4EA 4FX6M 3UGVA 2Z28A 2NX9A 4LAMA 3SCVA 1RH9A 3WF0A 4JNMA 4W84A 4M3PA 4LUYA 1X8CA 2BX7A 4QBXA 3NQ7A 3U4FA 1BD0A 3MDUA 2SFPA 2A4AA 2B31A 4XUGA 4S3EA 1AW2A 3TTSA 3GB6A 3SY8A 4IUOA 4EVZA 5E9AA 1TUXA 2W92A 2NSOA 3R8HA 3NL3A 3KL5A 1A5NC 3WBEA 4IICA 5FACA 5BXPA 3F2DA 5EBUA 4QJ1A 3T4WA 3FHQA 5H2ZA 3MZNA 1XUZA 4WUIA 3C3UA 3ERPA 3SRHA 4LY8A 3VKKA 1JZ6A 3EB2A 3IIVA 3ZQ9A 1KGXA 1H7WA 4NZ3A 5HQEA 2QJIA 2W61A 5EFFA 3N3TA 3KHDA 4HTYA 4ZXOA 4V15A 2QCDA 1ISXA 1WKEA 1RK6A 2AL1A 3D3FA 4CN1A 4M6QA 5F4SA 3IIXA 1NF7A 1KXQA 1V93A 3GVQA 1JD7A 1E0VA 3MKVA 4UOQA 3RR4A 2BFGA 3GDLA 4O17A 3CGTA 2PDHA 3IRSA 4PUNA 2FVKA 3SB0A 1OYAA 1UP2A 3PF3A 5A6BA 4O12A 3BLOA 1F3TA 3AS3A 2A6LA 3CAWA 4FB7A 3GBEA 3KE0A 4QQUA 3OZOA 4A6GA 4QDMA 1H09A 4W87A 3S0CA 3PG9A 1N8FA 2ZRYA 1LG2A 1VZWA 3OLEA 1P0KA 3E02A 1W91A 2WMJA 3W7MA 1J79A 3CQ0A 2UZ9A 3WLMA 2RKXA 2QCGA 3L0KA 2WSKA 2R82A 2VQUA 5HQLA 1MUCA 3TR2A 4JYDA 3GU2A 3P0WA 4BS0A 3DUGA 3NO3A 2O9PA 1BSIA 1XIIA 4J3WA 5HUPA 3PR2A 3UG4A 1IXNA 2OT0A 2OOGA 4H01A 1ZALA 1E5JA 4CU7A 2WMIA 4IFKB 1JNDA 3WL0A 2NSXA 5C2XA 1ZBCA 2R91A 4JIPA 1D3HA 1JXKA 1TFVA 2QYGA 3WUEA 5KZ6A 1W1PA 4PMZA 3BH4A 4MZ8A 3ZR5A 3ITXA 2EPOA 4AYGA 5C71A 4I9MA 4K37A 6CGTA 3B9NA 1PCWA 4E4UA 1F8IA 2F2HA 1PWLA 7CGTA 4UCGA 1KRMA 4KIEA 2CLKA 4HZMA 3WDRA 3CQJA 3EAUA 2FJKA 3EEGA 3H54A 4R33A 4O18A 4YN5A 2ZA2A 4O1FA 1YHTA 2PWUA 4DBUA 1LRQA 3FDGA 4R85A 3TK7A 1UZ4A 3MMWA 5EGRA 4N6FA 4P7RA 3DEQA 3SUSA 5AVHA 5MKGB 5CEWA 5TBOA 2D2GA 4M56A 4C6PA 1T6MA 3JW7A 4A8LA 5I03A 2J4GA 3N18A 1NF0A 1C8QA 1DQUA 4XZWA 2F7FA 1TV8A 3BW2A 2OYLA 4W4QA 1ODZA 4IOTA 1TJPA 4D1JA 3VGEA 3W7HA 4AVNA 3MYPA 2H90A 2Z1KA 3GY1A 3CV2A 1RCOB 1L6YA 2XGIA 4MM1A 5DCEA 4YCPA 1LL7A 3TCEA 3BJTA 1NSJA 4IH3A 5JBEA 1XLJA 5K4ZA 2PTZA 2DJXA 2JF6A 3UEQA 5BRQA 1GW1A 3LM7A 4NAFA 3R25A 4EAMA 2I1OA 4XSMA 2ZRZA 1P7TB 1PX8A 4IXXA 3VOIA 5G1TA 1FQ0A 2RAGA 5BMXA 1RLDA 1WKFA 4ZQMA 2XISA 3NQVA 1YXCA 5EA9A 2PGRA 3PJTA 5LIUX 3AZRA 2VC6A 5EB8A 3UETA 1WOAA 2ZC1A 5GJMA 2BWGA 1XI3A 1VFHA 4Z1DA 4WJ8A 4GX8A 4GO8A 1NDWA 1QJWA 2VR4A 4HMNA 3WN6A 3W83A 3OG2A 4LGXA 1VYPX 4A8RA 2C8NA 2XN1A 5G1MA 4KWOA 4JDBA 5DQPA 4DPQA 3EXRA 4FS9A 2VDHA 3RYSA 3BLDA 4URIA 1SZEA 5D33A 4TMCA 1O66A 4UBPC 1QW8A 3KS5A 4XK2A 4MADA 4IP5A 5U7SA 1XX1A 2IKGA 3IJ6A 2I5QA 4MAVA 1M7JA 3Q94A 4J28A 3M4HA 3PBYA 3TX9A 3WNNA 2CZFA 5EY5A 2TSYA 2JQXA 4AU0A 4BI7A 1JDFA 3URBA 2QCDB 2BNJA 4US5D 4JYFA 3EWUA 3WNMA 1GQLA 5A94A 3NIYA 3DXIA 1Q7QA 1B3OA 3GR4A 4M6UA 3I6TA 1XRSA 1EXBA 4H2CA 3VILA 1BXNA 2NLIA 1Q65A 1YNPA 4QM1A 4C6QA 5JH1A 1TREA 2WNZA 2BG5A 3PUGA 3H8AA 3PUEA 1EJRC 3OHIA 1RK5A 4B4HA 1IR2A 3UBPC 1NIUA 4BCEA 5CPNA 1KD0A 2I5GA 3FEMA 4C6LA 1PKYA 2MNRA 2G4JA 2O0TA 2XYLA 1R3WA 1GJUA 4S3CA 1TB3A 3SN4A 4YTTA 2PCQA 3DHDA 3MUCA 1XBXA 2DW6A 2FZ8A 1Z8AA 1EX5A 2OYKA 1Z41A 1CYGA 3CJPA 2X1IA 2R1KA 4JTSA 3ANUA 3WKZA 1WV2A 2VCBA 3L4VA 3LMZA 1DE5A 1UD4A 3G24A 3UWZA 1M01A 3L67A 2VD8A 3PUDA 2OGJA 4P8XA 4Y8EA 4DJDC 2WMIB 1ZJHA 4DJEC 2DEPA 2V5BA 1SFLA 1M7PA 1XPYA 4XZHA 1WQ5A 4PUJA 3OZPA 1W9DM 4FLQA 3BL3A 2J8TA 3BZGA 4MZ1A 2HK0A 4UIOA 4FOKA 4RZ5A 4S38A 1S2VA 4LYKA 5M5DA 2EXOA 1YE6A 4QS5A 4CNPA 1AH0A 1VPYA 4CD7A 1IHIA 2YA1A 3M9YA 3O3RA 2INEA 4MVAA 4E2OA 1YPIA 2GWGA 1TVLA 1V6UA 3DGBA 1J11A 1MI3A 4YMZA 1XH0A 5FF2A 1P1XA 1QU4A 2GDUA 5D03A 3ITTA 3W4RA 4DXXA 3W1LA 4XG1A 5H8PA 1M1BA 2X41A 1BTCA 2QF7A 4CD8A 2V5DA 4BQ5A 3PJWA 4B2DD 3BLPX 1OGBA 3EX4A 3EMCA 3OB8A 4PMOA 1HKIA 1UWRA 3ITVA 1XIJA 3GAYA 3IWPA 2ZOXA 4WKAA 4FPSA 3QRHA 1F76A 1E73M 1UROA 2CBUA 4HNCA 2I9UA 3W37A 3EWXA 4IQJA 3R94A 3S6DA 4Q4RA 1VFSA 3LCIA 4IZGA 2WZTA 1T40A 3OEXA 3PWIA 3TN4A 3I6EA 3I6RA 1ME7A 1W9BM 1HJVA 1EQCA 2ZUSA 4FNRA 2QUTA 2HTMA 1DQWA 2WVTA 3MUAA 2G37A 2ICSA 1LG1A 1BF6A 4QIUA 1EZ2A 3SUUA 4NAFB 2X0HA 4MB5A 1QNSA 4A3RA 5AYXA 1B3WA 1MWOA 2VEFA 4UTWC 2XFYA 4WOZA 4J2MA 4Q8WA 2OO6A 5HAOA 1CGVA 1XV8A 1JDCA 1UH4A 4U2ZA 2XGBA 2WOQA 4FNPA 4F9DA 2E0PA 1TZ7A 3EOLA 3P7YA 3WH6A 1I2OA 2GJRA 2XVKA 1GZ1A 3ITYA 1ZFJA 5L9FA 2AQVA 4IHCA 4UTUA 1W9VA 3UWWA 4L1GA 4KEMA 2QJHA 4PCSA 2FB2A 1J18A 4AW7A 3VDCA 2A79A 1POJA 3TW6A 3QM3A 1I2QA 4BF5A 4Z1AA 1K9EA 5CLWA 4ZB0A 1Q45A 1HKJA 3BC9A 1MXDA 4NU7A 3M0JA 3WBXA 1Z9AA 3WUGA 2FDSA 2ZUVA 5BXRA 1WUEA 1UC5A 1VEOA 3MO4A 1JZ4A 3MP5A 3FK4A 1VJIA 3BOLA 1PE1A 3ZIZA 1PDYA 1R3QA 3ARWA 2IKHA 4HYRA 3AMLA 4G7FA 3NZRA 3U0HA 4JDYA 4HT3A 4ECLA 1XRTA 5BU9A 1CEOA 4HPJA 1CLKA 3M6YA 1XD0A 3POCA 3WLOA 4B91A 4FAMA 4ZO6A 4GBUA 3PZUA 1OX4A 1A5BA 3FSUA 1YDVA 1XL9A 3CHFA 1BWKA 2HCVA 3GR7A 5FESA 3EA2A 3RAOA 3BV7A 4F2TA 4JQ3A 1O95A 1MUWA 5J8LA 1EC9A 3U2OA 4C6BA 3MVTA 4UTHA 5DCBA 2QR6A 4PB4A 1Q5MA 2XFFA 4JFSA 3FDKA 3WDHA 3HO8A 4PMUA 2QUUA 1FWIC 3PFMA 2WHJA 1EUAA 3ZZ1A 1NFGA 3OG3A 3AFBA 1PDZA 1VRXA 1HVQA 3LENA 1J5SA 5DLCA 3FHAA 3B4YA 4D6HA 2Z00A 3PWAA 1LDCA 2WQPA 4EXBA 1MMFA 4CEXC 4NVTA 5HWNA 1QHZA 4YVPA 1C93A 3ME3A 4L80A 3UYCA 8A3HA 3C52A 1T0OA 2QDHA 2OOFA 1S5VA 5HOSA 1QNOA 2RJGA 1R5YA 2EGZA 3PB0A 3GO2A 1R7OA 4JN6A 4UXDA 4K3ZA 4ASTA 3RN6A 3OO2A 3RMEA 2P76A 3SW6A 3INPA 5C54A 2DT1A 3LK6A 1E6SM 3VNDA 1JNEA 1ICQA 3AMDA 4K1GA 4YL2A 1W1IE 2DUAA 3LCXA 4D6IA 3USZA 2G5WA 2V6AA 3CPRA 4K2SA 1ZTVA 4C90A 3B0YA 4O16A 3UERA 2PODA 1RY0A 3G77A 3E38A 2L5HA 3R43A 1OT2A 3T78A 2A2IA 2YXXA 4BQ3A 4NJGA 3TLQA 5T26A 4GNJA 3QXBA 5KZDA 1LOSA 3GXPA 4X22A 1CGXA 3W82A 4DBEA 2NZLA 2YBVA 3D3AA 4CD5A 4HK5A 3AO0A 2XH4A 1E70M 4IX2A 3BCDA 2VKZG 3TH6A 5FSEC 3WLTA 2QXWA 1A3WA 2W91A 2VFEA 3GIPA 3UVAA 4E6MA 1DJNA 3WMSA 4E8DA 2X2GA 4QSFA 3ZVIA 3LN3A 3CZ8A 2YW4A 1UD6A 4F79A 3H21A 3UW6A 2CKRA 1J96A 1JQVA 1QI4A 4BEQA 3OP2A 4UTFA 3SR7A 2HWGA 2VC9A 4W86A 3FGCA 5CSRA 3VD3A 1I1WA 2YCKX 4R9OA 4IIBA 1K8YA 4B90A 5D02A 4K7VA 2WMKA 1B4EA 5DMYA 5AYYA 2NXHA 4XUYA 3MSDA 4PMNA 1JCYA 4S3DA 3B8DA 2PRMA 3LCFA 1LWIA 4KWUA 3MV01 1EBGA 4AD4A 2E25A 4HA4A 3EDJA 5T9BG 4XBKA 3LBMA 2QUMA 2XM1A 1YYAA 1EJSC 4DUOA 4I9TA 4IISA 2OODA 3RNDA 3WO8A 3TYEA 3OIHA 1DORA 5HJLA 3W81A 5EKYA 3LBOA 1I6NA 4JTQA 2G3NA 3BK0A 3JZUA 1OVDA 3FEQA 4Z2HA 2IQDA 2RGMA 3UR2A 1W1YA 4JTLA 3SCRA 3S2CA 2OQLA 1UR0A 5AZ0A 1NQ6A 5EYWA 3K1GA 4QAWA 1QBAA 1TV5A 1JCNA 1AQFA 4S3GA 1XHGA 4UR9A 1YXYA 3W24A 4LPCA 1XCWA 2HXUA 4HYWA 1JPHA 4JYEA 4U33A 5D2WA 3BMXA 1V8EA 3BGAA 4JQAA 2XIMA 4UFHA 2IUZA 2D69A 2E1WA 1L2QA 1Q6FA 1XYBA 2J8GA 1XICA 1YXDA 2Y61A 5EBAA 3PNZA 4I6KA 1X1ZA 3U7VA 4ZQNA 4E38A 1F74A 2DQWA 4MWAA 1PIGA 1AL8A 4UNLA 1KCLA 2ZBTA 3NXFA 1VENA 3GTXA 1TR9A 2EF9A 3HG4A 3NR0A 1XCXA 3VD4A 1S5WA 1HFBA 2YDAA 2Q3OA 5D9OA 2E6DA 4O4VA 4TV5A 1AH4A 1SFTA 1HQTA 4DYEA 1NFPA 2ZX5A 4O4WA 1OX4B 3QVQA 4MYXA 3THAA 1EDGA 3OBKA 1V6TA 1HKVA 3THDA 3DI1A 3IGUA 1SJDA 3PC0A 4P5UA 4GA8A 4CNSA 4HP5A 1MZHA 3RJYA 4G7EA 2X40A 1KM3A 4NJJA 3W7LA 4E0CA 4AY7A 3L0NA 3WEZA 2FKPA 4S3KA 5GPRA 3C8FA 3T0BA 5RUBA 2VZOA 4LEFA 1UH2A 1AA1B 2YCEA 4Z2IA 1R3SA 2PDGA 3WH9A 1RY8A 5EMUA 1Q7MA 5CJNA 2OVLA 3GUWA 1A3XA 3NL6A 1E4LA 3KM8A 1TQXA