1A86A

Mmp8 with malonic and aspartic acid based inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
158
Chain Sequence
b'NPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MMP-8
publication title Structure of malonic acid-based inhibitors bound to human neutrophil collagenase. A new binding mode explains apparently anomalous data.
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 46
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 1998-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1a86A00
5CUHA 1YP1A 1OM7A 1IAGA 1G12A 4HMAA 3GBOA 456CA 2PJTA 5I12A 1XUDA 2OXWA 4HX3A 4ILWD 1HTDA 1GE6A 3LIKA 1KAPP 3LE9A 3O2XA 4H49A 3VI1A 3F15A 5BOYA 3DSLA 3EHXA 1L6JA 1PWPA 2OI0A 1QUAA 2OW9A 1R54A 2A8HA 2OVZA 4PKUA 2DW1A 1GKDA 4H2EA 3KMEA 1SLNA 5I3MA 2DDYA 1K7QA 1KUIA 830CA 2E2DA 3KEJA 3LUNA 1MMBA 3I7GA 1G4KA 3HY9A 5D3CA 3TVCA 5L7FA 1ZTQA 4FXQA 1CQRA 3HBUP 2USNA 4R3VA 1R1HA 2JSDA 1UTZA 2W15A 1C8TA 1BIWA 2W13A 1KUFA 1BKCE 3TSKA 2JNPA 1O0TA 3I7IA 1G9KA 4ON1A 3WV2A 1CGEA 1BM6A 1ASTA 1CGFA 3B8ZA 4WKIA 4XM8A 3B92A 4PKRA 2OW1A 1BUDA 1Y8JA 1MNCA 2Z2DA 4PKWA 2QPJA 3KECA 1B8YA 5D2BA 5D1UA 1MMPA 3Q2HA 1ZS0A 1FLSA 1AKLA 1JAPA 5CXAA 4DD8A 5L79A 2OXZA 5BPAA 4DPEA 1BKCI 1A86A 2WOAA 5D1TA 4H76A 2MLRA 4H3XA 3G42A 1G05A 2N8RA 4IUWA 3P24A 1BQOA 2RJPA 1S4BP 4JP4A 3LGPA 1Z3JA 1Q3AA 3Q2GA 2AYKA 2AIGP 1QIBA 1KBCA 4PKVA 1BKCA 2RJQA 5B5PA 2X3AA 5LABA 3DPEA 1OS9A 3V96B 3USNA 1RMZA 3TT4A 2V4BA 3AIGA 3EDHA 1B3DA 1K7GA 2JT6A 4GR0A 3LQ0A 1YOUA 1IAEA 2MLSA 1MMRA 1FBLA 2L0RA 1XFVA 1O0QA 4GWMA 1AYKA 1ATLA 1ROSA 4JQGA 2K9CA 3KRYA 4PKSA 3G5CA 1IABA 2ERQA 1Y0VA 3DL1A 1KUGA 5H8XA 2ERPA 4A3WA 1H71P 4H84A 4L19A 3KMCA 5D1SA 2Y6DA 3EWJA 2X3CA 1JAQA 3ELMA 2KRJA 1HY7A 4I03A 2D1OA 1OO9A 1JH1A 1AF0A 1ZP5A 5CZMA 1IAAA 1GE5A 3N2VA 2HU6A 1QJJA 3LJGA 1XURA 1KUHA 2W14A 1I1IP 1R1JA 1UMTA 2OXUA 1OM8A 3RTTA 3WV1A 1D8FA 4AYKA 2WO9A 4IJOA 3KHIA 2JT5A 4DF9A 4GUYA 3F18A 4PKTA 4H30A 1G49A 1R1IA 966CA 3CKIA 4WF6A 1USNA 1D8MA 3OHOA 1CXVA 4QKZA 1BUVM 4XBHA 4GR3A 1SRPA 1GE7A 1EAKA 4FVLA 1UTTA 4L6TA 3HBVP 4AXQA 4IN9A 1OM6A 1JAOA 3EDIA 1HFSA 3MA2A 1JK3A 3TS4A 1IACA 3DPFA 1I76A 3DWBA 4G9LA 3LIRA 4AIGA 2I47A 1XFUA 5BOTA 3E8RA 3U1RA 3VTGA 1WNIA 2O36A 2OW2A 1BZSA 2Y6CA 3LJTA 1ZVXA 2EROA 1JIWP 3LQBA 1SLMA 3AYKA 1J7NA 1EB6A 2D1NA 2MZHA 2X7MA 1PWQA 4L63A 3N2UA 1DTHA 5I2ZA 2WO8A 4JA1A 1OMJA 4FXYP 1CGLA 4XM6A 4AUOA 1DMTA 2YIGA 3HYGA 2DDFA 3LJZA 3F16A 3F17A 2CKIA 1GO7P 1ND1A 3EDZA 5D7WA 4GR8A 4ZR5A 3EDGA 4XCTA 1SMPA 1MMQA 4EFSA 4GQLA 1BQQM 1FM1A 3K7LA 3DNGA 1D5JA 2OZRA 2XS4A 3LILA 3HDAP 3ZUKA 1YQYA 1JKYA 3EHYA 3BA0A 3SHIA 1XFXA 1HV5A 1XFWA 1SATA 3KWVC 3NX7A 3LMCA 1CAQA 4GF1A 4WKEA 1QIAA 1KUKA 1XFYA 2J0TA 1JJ9A 1R55A 1IADA 2DW2A 3O64A 3HY7A 1GKCA 4J4MA 2W12A 3B2ZA 2W0DA 4CTHA 5I4OA 2SRTA 2X3BA 1BSWA 3WV3A 2JIHA 3L0TA 1SU3A 1ZXVA 2O3EA 2FV5A 1GXDA 1GO8P 4I35A 4JIJA 1JANA 3HB2P 5I43A 2OW0A 1JIZA 1XFZA 1D7XA 1UMSA 1Y93A 1RM8A 3KEKA 3RTSA 3LEAA 4PKQA 2YB9A 2DW0A 1C7KA 1EUBA 3F19A 3LKAA 3L0VA 2OY4A 1HFCA 1PWWA 1ZXCA 2OVXA 3LUMA 4GWNA 5JMYA 3OHLA 2TCLA 4FU4A 4H82A 2POJA 1XUCA 3LK8A 2FV9A 4WK7A 1PWUA 2E3XA 4Q1LA 2CLTA 4JPAA 4G0DA 3K7NA 3ZXHA 4DV8A 2J83A 1I73A 1QICA 2MZIA 2K2GA 2XS3A 1K7IA 1HOVA 1C3IA 1CK7A 2MZEA 1CIZA 3HDBA 1UEAA 1OS2A 3ZVSA 4H1QA 4WZVA 1YCMA 4A7BA 3UVCA 3F1AA 1A85A 1QJIA 5B5OA 5I0LA 3P1VA 3AYUA 1PWVA 4XM7A 2OY2A
chains in the Genus database with same CATH superfamily
5CUHA 1YP1A 1OM7A 1IAGA 1G12A 4HMAA 3GBOA 456CA 2PJTA 5I12A 1XUDA 2OXWA 4HX3A 4ILWD 1HTDA 3DTKA 1GE6A 3LIKA 1KAPP 3LE9A 3O2XA 4H49A 3VI1A 3F15A 5BOYA 3DSLA 3EHXA 1L6JA 1PWPA 2OI0A 1QUAA 2OW9A 1R54A 2A8HA 2OVZA 4PKUA 2DW1A 1GKDA 4H2EA 3KMEA 1SLNA 5I3MA 2DDYA 1K7QA 1KUIA 830CA 2E2DA 3KEJA 3LUNA 1MMBA 3I7GA 1G4KA 3HY9A 5D3CA 3TVCA 5L7FA 1ZTQA 4FXQA 1CQRA 3HBUP 2USNA 4R3VA 1R1HA 2JSDA 1UTZA 2W15A 1C8TA 1BIWA 2W13A 1KUFA 1BKCE 3TSKA 4L7AA 2JNPA 1O0TA 3I7IA 1G9KA 4ON1A 3WV2A 1CGEA 1BM6A 1ASTA 1CGFA 3B8ZA 4WKIA 4XM8A 3B92A 4PKRA 2OW1A 1BUDA 1Y8JA 1MNCA 2Z2DA 4PKWA 2QPJA 3KECA 1B8YA 5D2BA 5D1UA 1MMPA 3Q2HA 1ZS0A 1FLSA 1AKLA 1JAPA 5CXAA 4DD8A 5L79A 2OXZA 5BPAA 4DPEA 1BKCI 1A86A 2WOAA 5D1TA 4H76A 2MLRA 4H3XA 3G42A 1G05A 2N8RA 4IUWA 3P24A 1BQOA 2RJPA 1S4BP 4JP4A 3LGPA 1Z3JA 1Q3AA 3Q2GA 2AYKA 2AIGP 1QIBA 1KBCA 4PKVA 1BKCA 2RJQA 5B5PA 2X3AA 5LABA 3DPEA 1OS9A 3V96B 3USNA 1RMZA 3TT4A 2V4BA 3AIGA 3EDHA 1B3DA 1K7GA 2JT6A 4GR0A 3LQ0A 1YOUA 1IAEA 2MLSA 1MMRA 1FBLA 2L0RA 1XFVA 1O0QA 4GWMA 1AYKA 1ATLA 1ROSA 4JQGA 2K9CA 3KRYA 4PKSA 3G5CA 1IABA 2ERQA 1Y0VA 3DL1A 1KUGA 5H8XA 2ERPA 4A3WA 1H71P 4H84A 4L19A 3KMCA 5D1SA 2Y6DA 3EWJA 2X3CA 1JAQA 3ELMA 2KRJA 1HY7A 4I03A 2D1OA 1OO9A 1JH1A 1AF0A 1ZP5A 5CZMA 1IAAA 1GE5A 3N2VA 2HU6A 1QJJA 3LJGA 1XURA 1KUHA 2W14A 1I1IP 1R1JA 1UMTA 2OXUA 1OM8A 3RTTA 3WV1A 1D8FA 4AYKA 2YUFA 2WO9A 4IJOA 3KHIA 2JT5A 4DF9A 4GUYA 3F18A 4PKTA 4H30A 1G49A 1R1IA 966CA 3CKIA 4WF6A 1USNA 1D8MA 3OHOA 1CXVA 4QKZA 1BUVM 4XBHA 4GR3A 1SRPA 1GE7A 3DTIA 1EAKA 4FVLA 1UTTA 4L6TA 3HBVP 4AXQA 4IN9A 1OM6A 1JAOA 3EDIA 1HFSA 3MA2A 1JK3A 3TS4A 1IACA 3DPFA 1I76A 3DWBA 4G9LA 3LIRA 4AIGA 2I47A 1XFUA 5BOTA 3E8RA 3U1RA 3VTGA 1WNIA 1TVIA 2O36A 2OW2A 1BZSA 2Y6CA 3LJTA 1ZVXA 2EROA 3DTEA 1JIWP 3LQBA 1OZ9A 3AYKA 1SLMA 1J7NA 1EB6A 2D1NA 2MZHA 2X7MA 1PWQA 4L63A 3N2UA 1DTHA 5I2ZA 2WO8A 4JA1A 1OMJA 4FXYP 1CGLA 4XM6A 4AUOA 1DMTA 2YIGA 3HYGA 2DDFA 3LJZA 3F16A 3F17A 2CKIA 1GO7P 1ND1A 3EDZA 5D7WA 4GR8A 4ZR5A 3EDGA 4XCTA 1SMPA 1MMQA 4EFSA 4GQLA 1BQQM 1FM1A 3K7LA 3DNGA 1D5JA 2OZRA 2XS4A 3LILA 3HDAP 3ZUKA 1YQYA 1JKYA 3EHYA 3BA0A 3SHIA 1XFXA 1HV5A 1XFWA 1SATA 3KWVC 3NX7A 3LMCA 1CAQA 4GF1A 4WKEA 1QIAA 1KUKA 1XFYA 2J0TA 1JJ9A 1R55A 1IADA 2DW2A 3O64A 3HY7A 1GKCA 4J4MA 2W12A 3B2ZA 2W0DA 4CTHA 5I4OA 2SRTA 2X3BA 1BSWA 1XM5A 3WV3A 2JIHA 3L0TA 1SU3A 1ZXVA 2O3EA 2FV5A 1GXDA 1GO8P 4I35A 4JIJA 1JANA 3HB2P 5I43A 2OW0A 1JIZA 1XFZA 1D7XA 1UMSA 1Y93A 1RM8A 3KEKA 3RTSA 3LEAA 4PKQA 2YB9A 2DW0A 1C7KA 1EUBA 3F19A 3LKAA 3L0VA 2OY4A 1XAXA 1HFCA 1PWWA 1ZXCA 2OVXA 3LUMA 4GWNA 5JMYA 3OHLA 2TCLA 4FU4A 4H82A 2POJA 1XUCA 3LK8A 2FV9A 4WK7A 1PWUA 2E3XA 4Q1LA 2CLTA 4JPAA 4G0DA 3K7NA 3ZXHA 4DV8A 2J83A 1I73A 1QICA 2MZIA 2K2GA 2XS3A 1K7IA 1HOVA 1C3IA 1CK7A 2MZEA 1CIZA 3HDBA 1UEAA 1OS2A 3ZVSA 4H1QA 4WZVA 1YCMA 4A7BA 3UVCA 3F1AA 1A85A 1QJIA 5B5OA 5I0LA 3P1VA 3AYUA 1PWVA 4XM7A 2OY2A
chains in the Genus database with same CATH topology
5CUHA 1YP1A 1OM7A 1IAGA 1G12A 4HMAA 3GBOA 456CA 2PJTA 5I12A 1XUDA 2OXWA 4HX3A 4ILWD 1HTDA 3DTKA 1GE6A 3LIKA 1KAPP 3LE9A 3O2XA 4H49A 3VI1A 3F15A 5BOYA 3DSLA 3EHXA 1L6JA 1PWPA 2OI0A 1QUAA 2OW9A 1R54A 2A8HA 2OVZA 4PKUA 2DW1A 1GKDA 4H2EA 3KMEA 1SLNA 5I3MA 2DDYA 1K7QA 1KUIA 830CA 2E2DA 3KEJA 3LUNA 1MMBA 3I7GA 1G4KA 3HY9A 5D3CA 3TVCA 5L7FA 1ZTQA 4FXQA 1CQRA 3HBUP 2USNA 4R3VA 1R1HA 2JSDA 1UTZA 2W15A 1C8TA 1BIWA 2W13A 1KUFA 1BKCE 3TSKA 4L7AA 2JNPA 1O0TA 3I7IA 1G9KA 4ON1A 3WV2A 1CGEA 1BM6A 1ASTA 1CGFA 3B8ZA 4WKIA 4XM8A 3B92A 4PKRA 2OW1A 1BUDA 1Y8JA 1MNCA 2Z2DA 4PKWA 2QPJA 3KECA 1B8YA 5D2BA 5D1UA 1MMPA 3Q2HA 1ZS0A 1FLSA 1AKLA 1JAPA 5CXAA 4DD8A 5L79A 2OXZA 5BPAA 4DPEA 1BKCI 1A86A 2WOAA 5D1TA 4H76A 2MLRA 4H3XA 3G42A 1G05A 2N8RA 4IUWA 3P24A 1BQOA 2RJPA 1S4BP 4JP4A 3LGPA 1Z3JA 1Q3AA 3Q2GA 2AYKA 2AIGP 1QIBA 1KBCA 4PKVA 1BKCA 2RJQA 5B5PA 2X3AA 5LABA 3DPEA 1OS9A 3V96B 3USNA 1RMZA 3TT4A 2V4BA 3AIGA 3EDHA 1B3DA 1K7GA 2JT6A 4GR0A 3LQ0A 1YOUA 1IAEA 2MLSA 1MMRA 1FBLA 2L0RA 1XFVA 1O0QA 4GWMA 1AYKA 1ATLA 1ROSA 4JQGA 2K9CA 3KRYA 4PKSA 3G5CA 1IABA 2ERQA 1Y0VA 3DL1A 1KUGA 5H8XA 2ERPA 4A3WA 1H71P 4H84A 4L19A 3KMCA 5D1SA 2Y6DA 3EWJA 2X3CA 1JAQA 3ELMA 2KRJA 1HY7A 4I03A 2D1OA 1OO9A 1JH1A 1AF0A 1ZP5A 5CZMA 1IAAA 1GE5A 3N2VA 2HU6A 1QJJA 3LJGA 1XURA 1KUHA 2W14A 1I1IP 1R1JA 1UMTA 2OXUA 1OM8A 3RTTA 3WV1A 1D8FA 4AYKA 2YUFA 2WO9A 4IJOA 3KHIA 2JT5A 4DF9A 4GUYA 3F18A 4PKTA 4H30A 1G49A 1R1IA 966CA 3CKIA 4WF6A 1USNA 1D8MA 3OHOA 1CXVA 4QKZA 1BUVM 4XBHA 4GR3A 1SRPA 1GE7A 3DTIA 1EAKA 4FVLA 1UTTA 4L6TA 3HBVP 4AXQA 4IN9A 1OM6A 1JAOA 3EDIA 1HFSA 3MA2A 1JK3A 3TS4A 1IACA 3DPFA 1I76A 3DWBA 4G9LA 3LIRA 4AIGA 2I47A 1XFUA 5BOTA 3E8RA 3U1RA 3VTGA 1WNIA 2O36A 2OW2A 1BZSA 2Y6CA 3LJTA 1ZVXA 2EROA 3DTEA 1JIWP 3LQBA 1SLMA 3AYKA 1J7NA 1EB6A 2D1NA 2MZHA 2X7MA 1PWQA 4L63A 3N2UA 1DTHA 5I2ZA 2WO8A 4JA1A 1OMJA 4FXYP 1CGLA 4XM6A 4AUOA 1DMTA 2YIGA 3HYGA 2DDFA 3LJZA 3F16A 3F17A 2CKIA 1GO7P 1ND1A 3EDZA 5D7WA 4GR8A 4ZR5A 3EDGA 4XCTA 1SMPA 1MMQA 4EFSA 4GQLA 1BQQM 1FM1A 3K7LA 3DNGA 1D5JA 2OZRA 2XS4A 3LILA 3HDAP 3ZUKA 1YQYA 1JKYA 3EHYA 3BA0A 3SHIA 1XFXA 1HV5A 1XFWA 1SATA 3KWVC 3NX7A 3LMCA 1CAQA 4GF1A 4WKEA 1QIAA 1KUKA 1XFYA 2J0TA 1JJ9A 1R55A 1IADA 2DW2A 3O64A 3HY7A 1GKCA 4J4MA 2W12A 3B2ZA 2W0DA 4CTHA 5I4OA 2SRTA 2X3BA 1BSWA 3WV3A 2JIHA 3L0TA 1SU3A 1ZXVA 2O3EA 2FV5A 1GXDA 1GO8P 4I35A 4JIJA 1JANA 3HB2P 5I43A 2OW0A 1JIZA 1XFZA 1D7XA 1UMSA 1Y93A 1RM8A 3KEKA 3RTSA 3LEAA 4PKQA 2YB9A 2DW0A 1C7KA 1EUBA 3F19A 3LKAA 3L0VA 2OY4A 1HFCA 1PWWA 1ZXCA 2OVXA 3LUMA 4GWNA 5JMYA 3OHLA 2TCLA 4FU4A 4H82A 2POJA 1XUCA 3LK8A 2FV9A 4WK7A 1PWUA 2E3XA 4Q1LA 2CLTA 4JPAA 4G0DA 3K7NA 3ZXHA 4DV8A 2J83A 1I73A 1QICA 2MZIA 2K2GA 2XS3A 1K7IA 1HOVA 1C3IA 1CK7A 2MZEA 1CIZA 3HDBA 1UEAA 1OS2A 3ZVSA 4H1QA 4WZVA 1YCMA 4A7BA 3UVCA 3F1AA 1A85A 1QJIA 5B5OA 5I0LA 3P1VA 3AYUA 1PWVA 4XM7A 2OY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CUH A;  1YP1 A;  1OM7 A;  1IAG A;  1G12 A;  4HMA A;  3GBO A;  456C A;  2PJT A;  5I12 A;  1XUD A;  2OXW A;  4HX3 A;  4ILW D;  1HTD A;  1GE6 A;  3LIK A;  1KAP P;  3LE9 A;  3O2X A;  4H49 A;  3VI1 A;  3F15 A;  5BOY A;  3DSL A;  3EHX A;  1L6J A;  1PWP A;  2OI0 A;  1QUA A;  2OW9 A;  1R54 A;  2A8H A;  2OVZ A;  4PKU A;  2DW1 A;  1GKD A;  4H2E A;  3KME A;  1SLN A;  5I3M A;  2DDY A;  1K7Q A;  1KUI A;  830C A;  2E2D A;  3KEJ A;  3LUN A;  1MMB A;  3I7G A;  1G4K A;  3HY9 A;  5D3C A;  3TVC A;  5L7F A;  1ZTQ A;  4FXQ A;  1CQR A;  3HBU P;  2USN A;  4R3V A;  1R1H A;  2JSD A;  1UTZ A;  2W15 A;  1C8T A;  1BIW A;  2W13 A;  1KUF A;  1BKC E;  3TSK A;  2JNP A;  1O0T A;  3I7I A;  1G9K A;  4ON1 A;  3WV2 A;  1CGE A;  1BM6 A;  1AST A;  1CGF A;  3B8Z A;  4WKI A;  4XM8 A;  3B92 A;  4PKR A;  2OW1 A;  1BUD A;  1Y8J A;  1MNC A;  2Z2D A;  4PKW A;  2QPJ A;  3KEC A;  1B8Y A;  5D2B A;  5D1U A;  1MMP A;  3Q2H A;  1ZS0 A;  1FLS A;  1AKL A;  1JAP A;  5CXA A;  4DD8 A;  5L79 A;  2OXZ A;  5BPA A;  4DPE A;  1BKC I;  1A86 A;  2WOA A;  5D1T A;  4H76 A;  2MLR A;  4H3X A;  3G42 A;  1G05 A;  2N8R A;  4IUW A;  3P24 A;  1BQO A;  2RJP A;  1S4B P;  4JP4 A;  3LGP A;  1Z3J A;  1Q3A A;  3Q2G A;  2AYK A;  2AIG P;  1QIB A;  1KBC A;  4PKV A;  1BKC A;  2RJQ A;  5B5P A;  2X3A A;  5LAB A;  3DPE A;  1OS9 A;  3V96 B;  3USN A;  1RMZ A;  3TT4 A;  2V4B A;  3AIG A;  3EDH A;  1B3D A;  1K7G A;  2JT6 A;  4GR0 A;  3LQ0 A;  1YOU A;  1IAE A;  2MLS A;  1MMR A;  1FBL A;  2L0R A;  1XFV A;  1O0Q A;  4GWM A;  1AYK A;  1ATL A;  1ROS A;  4JQG A;  2K9C A;  3KRY A;  4PKS A;  3G5C A;  1IAB A;  2ERQ A;  1Y0V A;  3DL1 A;  1KUG A;  5H8X A;  2ERP A;  4A3W A;  1H71 P;  4H84 A;  4L19 A;  3KMC A;  5D1S A;  2Y6D A;  3EWJ A;  2X3C A;  1JAQ A;  3ELM A;  2KRJ A;  1HY7 A;  4I03 A;  2D1O A;  1OO9 A;  1JH1 A;  1AF0 A;  1ZP5 A;  5CZM A;  1IAA A;  1GE5 A;  3N2V A;  2HU6 A;  1QJJ A;  3LJG A;  1XUR A;  1KUH A;  2W14 A;  1I1I P;  1R1J A;  1UMT A;  2OXU A;  1OM8 A;  3RTT A;  3WV1 A;  1D8F A;  4AYK A;  2WO9 A;  4IJO A;  3KHI A;  2JT5 A;  4DF9 A;  4GUY A;  3F18 A;  4PKT A;  4H30 A;  1G49 A;  1R1I A;  966C A;  3CKI A;  4WF6 A;  1USN A;  1D8M A;  3OHO A;  1CXV A;  4QKZ A;  1BUV M;  4XBH A;  4GR3 A;  1SRP A;  1GE7 A;  1EAK A;  4FVL A;  1UTT A;  4L6T A;  3HBV P;  4AXQ A;  4IN9 A;  1OM6 A;  1JAO A;  3EDI A;  1HFS A;  3MA2 A;  1JK3 A;  3TS4 A;  1IAC A;  3DPF A;  1I76 A;  3DWB A;  4G9L A;  3LIR A;  4AIG A;  2I47 A;  1XFU A;  5BOT A;  3E8R A;  3U1R A;  3VTG A;  1WNI A;  2O36 A;  2OW2 A;  1BZS A;  2Y6C A;  3LJT A;  1ZVX A;  2ERO A;  1JIW P;  3LQB A;  1SLM A;  3AYK A;  1J7N A;  1EB6 A;  2D1N A;  2MZH A;  2X7M A;  1PWQ A;  4L63 A;  3N2U A;  1DTH A;  5I2Z A;  2WO8 A;  4JA1 A;  1OMJ A;  4FXY P;  1CGL A;  4XM6 A;  4AUO A;  1DMT A;  2YIG A;  3HYG A;  2DDF A;  3LJZ A;  3F16 A;  3F17 A;  2CKI A;  1GO7 P;  1ND1 A;  3EDZ A;  5D7W A;  4GR8 A;  4ZR5 A;  3EDG A;  4XCT A;  1SMP A;  1MMQ A;  4EFS A;  4GQL A;  1BQQ M;  1FM1 A;  3K7L A;  3DNG A;  1D5J A;  2OZR A;  2XS4 A;  3LIL A;  3HDA P;  3ZUK A;  1YQY A;  1JKY A;  3EHY A;  3BA0 A;  3SHI A;  1XFX A;  1HV5 A;  1XFW A;  1SAT A;  3KWV C;  3NX7 A;  3LMC A;  1CAQ A;  4GF1 A;  4WKE A;  1QIA A;  1KUK A;  1XFY A;  2J0T A;  1JJ9 A;  1R55 A;  1IAD A;  2DW2 A;  3O64 A;  3HY7 A;  1GKC A;  4J4M A;  2W12 A;  3B2Z A;  2W0D A;  4CTH A;  5I4O A;  2SRT A;  2X3B A;  1BSW A;  3WV3 A;  2JIH A;  3L0T A;  1SU3 A;  1ZXV A;  2O3E A;  2FV5 A;  1GXD A;  1GO8 P;  4I35 A;  4JIJ A;  1JAN A;  3HB2 P;  5I43 A;  2OW0 A;  1JIZ A;  1XFZ A;  1D7X A;  1UMS A;  1Y93 A;  1RM8 A;  3KEK A;  3RTS A;  3LEA A;  4PKQ A;  2YB9 A;  2DW0 A;  1C7K A;  1EUB A;  3F19 A;  3LKA A;  3L0V A;  2OY4 A;  1HFC A;  1PWW A;  1ZXC A;  2OVX A;  3LUM A;  4GWN A;  5JMY A;  3OHL A;  2TCL A;  4FU4 A;  4H82 A;  2POJ A;  1XUC A;  3LK8 A;  2FV9 A;  4WK7 A;  1PWU A;  2E3X A;  4Q1L A;  2CLT A;  4JPA A;  4G0D A;  3K7N A;  3ZXH A;  4DV8 A;  2J83 A;  1I73 A;  1QIC A;  2MZI A;  2K2G A;  2XS3 A;  1K7I A;  1HOV A;  1C3I A;  1CK7 A;  2MZE A;  1CIZ A;  3HDB A;  1UEA A;  1OS2 A;  3ZVS A;  4H1Q A;  4WZV A;  1YCM A;  4A7B A;  3UVC A;  3F1A A;  1A85 A;  1QJI A;  5B5O A;  5I0L A;  3P1V A;  3AYU A;  1PWV A;  4XM7 A;  2OY2 A; 
#chains in the Genus database with same CATH topology
 5CUH A;  1YP1 A;  1OM7 A;  1IAG A;  1G12 A;  4HMA A;  3GBO A;  456C A;  2PJT A;  5I12 A;  1XUD A;  2OXW A;  4HX3 A;  4ILW D;  1HTD A;  3DTK A;  1GE6 A;  3LIK A;  1KAP P;  3LE9 A;  3O2X A;  4H49 A;  3VI1 A;  3F15 A;  5BOY A;  3DSL A;  3EHX A;  1L6J A;  1PWP A;  2OI0 A;  1QUA A;  2OW9 A;  1R54 A;  2A8H A;  2OVZ A;  4PKU A;  2DW1 A;  1GKD A;  4H2E A;  3KME A;  1SLN A;  5I3M A;  2DDY A;  1K7Q A;  1KUI A;  830C A;  2E2D A;  3KEJ A;  3LUN A;  1MMB A;  3I7G A;  1G4K A;  3HY9 A;  5D3C A;  3TVC A;  5L7F A;  1ZTQ A;  4FXQ A;  1CQR A;  3HBU P;  2USN A;  4R3V A;  1R1H A;  2JSD A;  1UTZ A;  2W15 A;  1C8T A;  1BIW A;  2W13 A;  1KUF A;  1BKC E;  3TSK A;  4L7A A;  2JNP A;  1O0T A;  3I7I A;  1G9K A;  4ON1 A;  3WV2 A;  1CGE A;  1BM6 A;  1AST A;  1CGF A;  3B8Z A;  4WKI A;  4XM8 A;  3B92 A;  4PKR A;  2OW1 A;  1BUD A;  1Y8J A;  1MNC A;  2Z2D A;  4PKW A;  2QPJ A;  3KEC A;  1B8Y A;  5D2B A;  5D1U A;  1MMP A;  3Q2H A;  1ZS0 A;  1FLS A;  1AKL A;  1JAP A;  5CXA A;  4DD8 A;  5L79 A;  2OXZ A;  5BPA A;  4DPE A;  1BKC I;  1A86 A;  2WOA A;  5D1T A;  4H76 A;  2MLR A;  4H3X A;  3G42 A;  1G05 A;  2N8R A;  4IUW A;  3P24 A;  1BQO A;  2RJP A;  1S4B P;  4JP4 A;  3LGP A;  1Z3J A;  1Q3A A;  3Q2G A;  2AYK A;  2AIG P;  1QIB A;  1KBC A;  4PKV A;  1BKC A;  2RJQ A;  5B5P A;  2X3A A;  5LAB A;  3DPE A;  1OS9 A;  3V96 B;  3USN A;  1RMZ A;  3TT4 A;  2V4B A;  3AIG A;  3EDH A;  1B3D A;  1K7G A;  2JT6 A;  4GR0 A;  3LQ0 A;  1YOU A;  1IAE A;  2MLS A;  1MMR A;  1FBL A;  2L0R A;  1XFV A;  1O0Q A;  4GWM A;  1AYK A;  1ATL A;  1ROS A;  4JQG A;  2K9C A;  3KRY A;  4PKS A;  3G5C A;  1IAB A;  2ERQ A;  1Y0V A;  3DL1 A;  1KUG A;  5H8X A;  2ERP A;  4A3W A;  1H71 P;  4H84 A;  4L19 A;  3KMC A;  5D1S A;  2Y6D A;  3EWJ A;  2X3C A;  1JAQ A;  3ELM A;  2KRJ A;  1HY7 A;  4I03 A;  2D1O A;  1OO9 A;  1JH1 A;  1AF0 A;  1ZP5 A;  5CZM A;  1IAA A;  1GE5 A;  3N2V A;  2HU6 A;  1QJJ A;  3LJG A;  1XUR A;  1KUH A;  2W14 A;  1I1I P;  1R1J A;  1UMT A;  2OXU A;  1OM8 A;  3RTT A;  3WV1 A;  1D8F A;  4AYK A;  2YUF A;  2WO9 A;  4IJO A;  3KHI A;  2JT5 A;  4DF9 A;  4GUY A;  3F18 A;  4PKT A;  4H30 A;  1G49 A;  1R1I A;  966C A;  3CKI A;  4WF6 A;  1USN A;  1D8M A;  3OHO A;  1CXV A;  4QKZ A;  1BUV M;  4XBH A;  4GR3 A;  1SRP A;  1GE7 A;  3DTI A;  1EAK A;  4FVL A;  1UTT A;  4L6T A;  3HBV P;  4AXQ A;  4IN9 A;  1OM6 A;  1JAO A;  3EDI A;  1HFS A;  3MA2 A;  1JK3 A;  3TS4 A;  1IAC A;  3DPF A;  1I76 A;  3DWB A;  4G9L A;  3LIR A;  4AIG A;  2I47 A;  1XFU A;  5BOT A;  3E8R A;  3U1R A;  3VTG A;  1WNI A;  1TVI A;  2O36 A;  2OW2 A;  1BZS A;  2Y6C A;  3LJT A;  1ZVX A;  2ERO A;  3DTE A;  1JIW P;  3LQB A;  1OZ9 A;  3AYK A;  1SLM A;  1J7N A;  1EB6 A;  2D1N A;  2MZH A;  2X7M A;  1PWQ A;  4L63 A;  3N2U A;  1DTH A;  5I2Z A;  2WO8 A;  4JA1 A;  1OMJ A;  4FXY P;  1CGL A;  4XM6 A;  4AUO A;  1DMT A;  2YIG A;  3HYG A;  2DDF A;  3LJZ A;  3F16 A;  3F17 A;  2CKI A;  1GO7 P;  1ND1 A;  3EDZ A;  5D7W A;  4GR8 A;  4ZR5 A;  3EDG A;  4XCT A;  1SMP A;  1MMQ A;  4EFS A;  4GQL A;  1BQQ M;  1FM1 A;  3K7L A;  3DNG A;  1D5J A;  2OZR A;  2XS4 A;  3LIL A;  3HDA P;  3ZUK A;  1YQY A;  1JKY A;  3EHY A;  3BA0 A;  3SHI A;  1XFX A;  1HV5 A;  1XFW A;  1SAT A;  3KWV C;  3NX7 A;  3LMC A;  1CAQ A;  4GF1 A;  4WKE A;  1QIA A;  1KUK A;  1XFY A;  2J0T A;  1JJ9 A;  1R55 A;  1IAD A;  2DW2 A;  3O64 A;  3HY7 A;  1GKC A;  4J4M A;  2W12 A;  3B2Z A;  2W0D A;  4CTH A;  5I4O A;  2SRT A;  2X3B A;  1BSW A;  1XM5 A;  3WV3 A;  2JIH A;  3L0T A;  1SU3 A;  1ZXV A;  2O3E A;  2FV5 A;  1GXD A;  1GO8 P;  4I35 A;  4JIJ A;  1JAN A;  3HB2 P;  5I43 A;  2OW0 A;  1JIZ A;  1XFZ A;  1D7X A;  1UMS A;  1Y93 A;  1RM8 A;  3KEK A;  3RTS A;  3LEA A;  4PKQ A;  2YB9 A;  2DW0 A;  1C7K A;  1EUB A;  3F19 A;  3LKA A;  3L0V A;  2OY4 A;  1XAX A;  1HFC A;  1PWW A;  1ZXC A;  2OVX A;  3LUM A;  4GWN A;  5JMY A;  3OHL A;  2TCL A;  4FU4 A;  4H82 A;  2POJ A;  1XUC A;  3LK8 A;  2FV9 A;  4WK7 A;  1PWU A;  2E3X A;  4Q1L A;  2CLT A;  4JPA A;  4G0D A;  3K7N A;  3ZXH A;  4DV8 A;  2J83 A;  1I73 A;  1QIC A;  2MZI A;  2K2G A;  2XS3 A;  1K7I A;  1HOV A;  1C3I A;  1CK7 A;  2MZE A;  1CIZ A;  3HDB A;  1UEA A;  1OS2 A;  3ZVS A;  4H1Q A;  4WZV A;  1YCM A;  4A7B A;  3UVC A;  3F1A A;  1A85 A;  1QJI A;  5B5O A;  5I0L A;  3P1V A;  3AYU A;  1PWV A;  4XM7 A;  2OY2 A; 
#chains in the Genus database with same CATH homology
 5CUH A;  1YP1 A;  1OM7 A;  1IAG A;  1G12 A;  4HMA A;  3GBO A;  456C A;  2PJT A;  5I12 A;  1XUD A;  2OXW A;  4HX3 A;  4ILW D;  1HTD A;  3DTK A;  1GE6 A;  3LIK A;  1KAP P;  3LE9 A;  3O2X A;  4H49 A;  3VI1 A;  3F15 A;  5BOY A;  3DSL A;  3EHX A;  1L6J A;  1PWP A;  2OI0 A;  1QUA A;  2OW9 A;  1R54 A;  2A8H A;  2OVZ A;  4PKU A;  2DW1 A;  1GKD A;  4H2E A;  3KME A;  1SLN A;  5I3M A;  2DDY A;  1K7Q A;  1KUI A;  830C A;  2E2D A;  3KEJ A;  3LUN A;  1MMB A;  3I7G A;  1G4K A;  3HY9 A;  5D3C A;  3TVC A;  5L7F A;  1ZTQ A;  4FXQ A;  1CQR A;  3HBU P;  2USN A;  4R3V A;  1R1H A;  2JSD A;  1UTZ A;  2W15 A;  1C8T A;  1BIW A;  2W13 A;  1KUF A;  1BKC E;  3TSK A;  4L7A A;  2JNP A;  1O0T A;  3I7I A;  1G9K A;  4ON1 A;  3WV2 A;  1CGE A;  1BM6 A;  1AST A;  1CGF A;  3B8Z A;  4WKI A;  4XM8 A;  3B92 A;  4PKR A;  2OW1 A;  1BUD A;  1Y8J A;  1MNC A;  2Z2D A;  4PKW A;  2QPJ A;  3KEC A;  1B8Y A;  5D2B A;  5D1U A;  1MMP A;  3Q2H A;  1ZS0 A;  1FLS A;  1AKL A;  1JAP A;  5CXA A;  4DD8 A;  5L79 A;  2OXZ A;  5BPA A;  4DPE A;  1BKC I;  1A86 A;  2WOA A;  5D1T A;  4H76 A;  2MLR A;  4H3X A;  3G42 A;  1G05 A;  2N8R A;  4IUW A;  3P24 A;  1BQO A;  2RJP A;  1S4B P;  4JP4 A;  3LGP A;  1Z3J A;  1Q3A A;  3Q2G A;  2AYK A;  2AIG P;  1QIB A;  1KBC A;  4PKV A;  1BKC A;  2RJQ A;  5B5P A;  2X3A A;  5LAB A;  3DPE A;  1OS9 A;  3V96 B;  3USN A;  1RMZ A;  3TT4 A;  2V4B A;  3AIG A;  3EDH A;  1B3D A;  1K7G A;  2JT6 A;  4GR0 A;  3LQ0 A;  1YOU A;  1IAE A;  2MLS A;  1MMR A;  1FBL A;  2L0R A;  1XFV A;  1O0Q A;  4GWM A;  1AYK A;  1ATL A;  1ROS A;  4JQG A;  2K9C A;  3KRY A;  4PKS A;  3G5C A;  1IAB A;  2ERQ A;  1Y0V A;  3DL1 A;  1KUG A;  5H8X A;  2ERP A;  4A3W A;  1H71 P;  4H84 A;  4L19 A;  3KMC A;  5D1S A;  2Y6D A;  3EWJ A;  2X3C A;  1JAQ A;  3ELM A;  2KRJ A;  1HY7 A;  4I03 A;  2D1O A;  1OO9 A;  1JH1 A;  1AF0 A;  1ZP5 A;  5CZM A;  1IAA A;  1GE5 A;  3N2V A;  2HU6 A;  1QJJ A;  3LJG A;  1XUR A;  1KUH A;  2W14 A;  1I1I P;  1R1J A;  1UMT A;  2OXU A;  1OM8 A;  3RTT A;  3WV1 A;  1D8F A;  4AYK A;  2YUF A;  2WO9 A;  4IJO A;  3KHI A;  2JT5 A;  4DF9 A;  4GUY A;  3F18 A;  4PKT A;  4H30 A;  1G49 A;  1R1I A;  966C A;  3CKI A;  4WF6 A;  1USN A;  1D8M A;  3OHO A;  1CXV A;  4QKZ A;  1BUV M;  4XBH A;  4GR3 A;  1SRP A;  1GE7 A;  3DTI A;  1EAK A;  4FVL A;  1UTT A;  4L6T A;  3HBV P;  4AXQ A;  4IN9 A;  1OM6 A;  1JAO A;  3EDI A;  1HFS A;  3MA2 A;  1JK3 A;  3TS4 A;  1IAC A;  3DPF A;  1I76 A;  3DWB A;  4G9L A;  3LIR A;  4AIG A;  2I47 A;  1XFU A;  5BOT A;  3E8R A;  3U1R A;  3VTG A;  1WNI A;  2O36 A;  2OW2 A;  1BZS A;  2Y6C A;  3LJT A;  1ZVX A;  2ERO A;  3DTE A;  1JIW P;  3LQB A;  1SLM A;  3AYK A;  1J7N A;  1EB6 A;  2D1N A;  2MZH A;  2X7M A;  1PWQ A;  4L63 A;  3N2U A;  1DTH A;  5I2Z A;  2WO8 A;  4JA1 A;  1OMJ A;  4FXY P;  1CGL A;  4XM6 A;  4AUO A;  1DMT A;  2YIG A;  3HYG A;  2DDF A;  3LJZ A;  3F16 A;  3F17 A;  2CKI A;  1GO7 P;  1ND1 A;  3EDZ A;  5D7W A;  4GR8 A;  4ZR5 A;  3EDG A;  4XCT A;  1SMP A;  1MMQ A;  4EFS A;  4GQL A;  1BQQ M;  1FM1 A;  3K7L A;  3DNG A;  1D5J A;  2OZR A;  2XS4 A;  3LIL A;  3HDA P;  3ZUK A;  1YQY A;  1JKY A;  3EHY A;  3BA0 A;  3SHI A;  1XFX A;  1HV5 A;  1XFW A;  1SAT A;  3KWV C;  3NX7 A;  3LMC A;  1CAQ A;  4GF1 A;  4WKE A;  1QIA A;  1KUK A;  1XFY A;  2J0T A;  1JJ9 A;  1R55 A;  1IAD A;  2DW2 A;  3O64 A;  3HY7 A;  1GKC A;  4J4M A;  2W12 A;  3B2Z A;  2W0D A;  4CTH A;  5I4O A;  2SRT A;  2X3B A;  1BSW A;  3WV3 A;  2JIH A;  3L0T A;  1SU3 A;  1ZXV A;  2O3E A;  2FV5 A;  1GXD A;  1GO8 P;  4I35 A;  4JIJ A;  1JAN A;  3HB2 P;  5I43 A;  2OW0 A;  1JIZ A;  1XFZ A;  1D7X A;  1UMS A;  1Y93 A;  1RM8 A;  3KEK A;  3RTS A;  3LEA A;  4PKQ A;  2YB9 A;  2DW0 A;  1C7K A;  1EUB A;  3F19 A;  3LKA A;  3L0V A;  2OY4 A;  1HFC A;  1PWW A;  1ZXC A;  2OVX A;  3LUM A;  4GWN A;  5JMY A;  3OHL A;  2TCL A;  4FU4 A;  4H82 A;  2POJ A;  1XUC A;  3LK8 A;  2FV9 A;  4WK7 A;  1PWU A;  2E3X A;  4Q1L A;  2CLT A;  4JPA A;  4G0D A;  3K7N A;  3ZXH A;  4DV8 A;  2J83 A;  1I73 A;  1QIC A;  2MZI A;  2K2G A;  2XS3 A;  1K7I A;  1HOV A;  1C3I A;  1CK7 A;  2MZE A;  1CIZ A;  3HDB A;  1UEA A;  1OS2 A;  3ZVS A;  4H1Q A;  4WZV A;  1YCM A;  4A7B A;  3UVC A;  3F1A A;  1A85 A;  1QJI A;  5B5O A;  5I0L A;  3P1V A;  3AYU A;  1PWV A;  4XM7 A;  2OY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...