1A88A

Chloroperoxidase l
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
275
structure length
275
Chain Sequence
GTVTTSDGTNIFYKDWGPRDGLPVVFHHGWPLSADDWDNQMLFFLSHGYRVIAHDRRGHGRSDQPSTGHDMDTYAADVAALTEALDLRGAVHIGHSTGGGEVARYVARAEPGRVAKAVLVSAVPPVMVKSDTNPDGLPLEVFDEFRAALAANRAQFYIDVPSGPFYGFNREGATVSQGLIDHWWLQGMMGAANAHYECIAAFSETDFTDDLKRIDVPVLVAHGTDDQVVPYADAAPKSAELLANATLKSYEGLPHGMLSTHPEVLNPDLLAFVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHLOROPEROXIDASE L
publication title Structural investigation of the cofactor-free chloroperoxidases.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Haloperoxidase
total genus 105
structure length 275
sequence length 275
chains with identical sequence B, C
ec nomenclature ec 1.11.1.10: Chloride peroxidase.
pdb deposition date 1998-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1a88A00
1CUDA 3IUQA 4GHWA 6YASA 4HTAA 2FX5A 4NMWA 4ZV9A 5ALFA 4U2CA 2GZRA 5DJ5A 4DNPA 2XI4A 2Z5GA 4C4ZA 5JARA 5DLPA 4PSCA 5AOBA 2LIPA 4BZZA 3WL6A 3RM3A 4EY4A 3WWOA 2DQZA 3RKSA 1AUOA 5KREA 2JGLA 5AM4A 3WLAA 2GBGA 4IH9A 4BTLA 3OURA 2XMRA 2NW6A 2RAUA 3SK0A 4BP8A 5IVDA 5T4EA 5ALIA 3I1IA 3G0DA 3WWDA 1RWQA 1XZAA 1ODTC 5EIAA 2Z3WA 1KEZA 4G8BA 3F9CA 4W63A 4KR0A 1Z68A 3H2GA 4MEBA 3VJLA 3EQ7A 2G5TA 4H7IA 4HAIA 4WDRA 4N8EA 5CH3A 3WIBA 3G9UA 4FFWA 5F4ZA 4JNCA 2HADA 4X71A 1VE7A 1UK7A 1GPKA 3KDAA 4FNMA 5IH7A 1YB6A 1GZ7A 3P2MA 1F0PA 3H2IA 3DYVA 4BCDA 1IMJA 1QIMA 5ALPA 4N8SA 3FNBA 4KE9A 1I6WA 2XUJA 1XZDA 3A70A 1UOPA 5H3HA 1VJ5A 5EIEA 4Q1VA 3VDXA 2VAXA 1FFAA 2J4FA 5K3AA 1O6GA 3BJMA 2WG1A 4WY5A 5ALLA 2W6CX 1WB6A 4QWMA 5DTIA 1XZKA 1GPNA 2ZJFA 3L1HA 1QLWA 4B7ZA 3LLCA 4BE4A 1TIBA 4DMKA 3FYUC 4P93A 1QJ4A 4QDXA 3RK4A 4B80A 5CH5A 1HQDA 4QEKA 1HL7A 3A2MA 4WCVA 3HLKA 4C89A 3STYA 2C0QA 4Y2TA 4UBKA 4AB1A 1IVYA 4M0FA 5DNWA 4FNGA 4DMCA 1J06A 5K3EA 2XDWA 4FBMA 3WWCA 3BE8A 4X97A 2H7XA 3QZUA 1RYYA 3G7NA 2WIGA 2HU5A 3C43A 4KE8A 2XMSA 5ALWA 1T4MA 2WIJA 1JFRA 2W22A 4UBOA 2YASA 4TPKA 1EVQA 4Y2UA 5BWBA 2JGEA 5C8XA 4W1QA 1IUNA 3GA7A 4ZV7A 4X91A 2ZJ7A 5SYNA 4AXBA 3LS2A 4YX9A 1DINA 1WHSA 4O08A 2DSNA 2VATA 4D9JA 3UUEA 1JKMA 1QIDA 5CW2A 2YXPX 1UZAA 4FMPA 5HZGA 3D5EA 4IHAA 1NU8A 1K63A 2Y6VA 2DHCA 1HBJA 4FLEA 3CN9A 5ALGA 4J0DA 4H7DA 5JAHA 4YASA 2EDCA 4X94A 4EY8A 5LP1A 2XUAA 2VEOA 1Q0ZA 2ZSHA 3IBTA 1FFCA 3ZWQA 3ZLVA 5EGNA 2ZSIA 1GPLA 2FJPA 5ESRA 4EB0A 3DKRA 4G1FA 1XZHA 4OSEA 4WY8A 3WKDA 1XZMA 2XUQA 2I03A 3KOOA 3QVMA 2V97A 4OB7A 1E8DA 5ALTA 1J2EA 3OPMA 3U1TA 3WIOA 3HACA 5KBYA 1QO9A 1CUXA 5T4HA 3I6YA 1XRNA 3WWPA 3WK5A 1UKCA 3WKEA 2QM0A 3WI7A 3WK7A 3W06A 3C45A 1XRLA 1UK6A 5AICA 2VJBA 2WU4A 4K6GA 5JAUA 4BP9A 1QFSA 2HA6A 4Y2RA 4UBLA 2EDAA 2RHTA 4QDOA 4LXIA 3IIIA 2HA3A 3EIOA 4KE6A 5AKZA 1YCDA 2OQIA 2OXEA 5JD6A 1SC9A 1TKRA 2O7RA 2ACEA 1TCCA 4J0HA 3WJ1A 1XLUA 1CRLA 4BC1A 1CUYA 1ODSA 3ESDA 2C7BA 4FOLA 1QONA 3EQ9A 4J0GA 4X85A 3B3QA 5ALNA 4FWBA 3MGAA 4KAJA 2HU7A 4MYSA 2AXEA 2JF0A 3IUJA 3C5VA 3DEAA 4B82A 4C6HA 3AJAA 3BIXA 4G5XA 4GLBA 3C8DA 4F5ZA 1YB7A 2QUBA 3W9BA 1ODCA 2HA5A 3FWHA 5FRDA 5JZ9A 2CEKA 1EDDA 1OCEA 4EUSA 2AJLI 1ORVA 5CT8A 3KWFA 1EA5A 3D7RA 2HA7A 3DL7A 1SCKA 1YA8A 1GKLA 2VTVA 3ANSA 4QLAA 5HQ3B 4A5SA 3BDVA 3I2KA 4PW0A 4G4JA 2WUFA 3CN7A 1HPLA 2BUAA 3ZPXA 3F97A 5LKRA 3Q0TA 1H23A 1MT3A 3DQZA 2QJWA 5AIBA 4KRXA 2Q0XA 2PKYX 1ACLA 2C5GA 5ALZA 4K6KA 2RIPA 2OGSA 1UWCA 3A2NA 2WJ4A 4Q82A 5JAPA 2HIHA 5AI4A 1GQSA 2HFJA 4H7KA 1HLGA 4Q05A 3R3ZA 1MN6A 1IUOA 4GWLA 3STVA 1XZJA 4EBBA 3DLTA 5E4TA 3FAKA 5DYTA 5C8VA 3G0BA 5JIBA 2XUDA 5HQ3A 2PPLA 3O4JA 2G63A 4W1RA 4UHHA 3DS8A 2GBCA 1NX9A 5FUMA 4MQMA 4DLNA 2P8SA 1R88A 4KRYA 4NVRA 2PUJA 2CKMA 3C87A 2B4KA 3O9MA 1MAHA 2QRUA 3M83A 5FXMA 4GXNA 2WILA 1C7IA 3TRDA 2R11A 3IVMA 2RONA 3VJMA 4UFPA 1DWQA 3QMMA 4HRXA 5FDFA 1FFBA 4QA9A 3H1AA 4CCWA 3ZV7A 4B84A 3C5WP 3WL7A 4MQLA 1EX9A 5C8ZA 3FLAA 5I8PA 3PUIA 4MYDA 4CI9A 3G02A 3G0CA 5AI9A 1YSCA 4BB0A 1XQVA 1CFJA 2PSEA 2HA4A 3D0KA 3ZLTA 2DCMA 5CH8A 4OU4A 4U2FA 3EQ8A 1ZD2P 3QMVA 4NS4A 4ARBA 1XROA 1UK8A 2PL5A 5DYWA 2DQYA 4C4YA 1CUUA 4ZXFA 1EDBA 5ALKA 4UBMA 1F8UA 1O6FA 3BXPA 2QS9A 4GEGA 3DCNA 3BL8A 1VA5A 4RGYA 1BE0A 1C7JA 2GYVA 2C4HA 2XMZA 1CUEA 1TCBA 3I6ZA 1CQZA 2IX9A 5C7YA 2H7YA 1EXWA 4QDZA 4CG3A 3TEJA 4KE7A 1PV1A 1LPBB 4FLMA 4H18A 4QDUA 1WPRA 4LKOA 1CUSA 1MTZA 5EHQA 1KU6A 3HJUA 3WYDA 1XZFA 3A2LA 5DYYA 2GYUA 4X95A 2QT9A 3NWOA 2QUAA 2FUKA 1CUWA 1XQXA 3WKCA 4W1SA 1GQRA 4F0JA 1C4XA 4H7FA 3ESCA 4ZREA 5LZ7A 1TAHA 4Y2JA 3KD2A 4BVJA 1M33A 1D07A 5DNUA 5CMLA 1AURA 1VE6A 3STWA 2WTNA 4UHEA 4N5IX 3UMJA 3H17A 4LHEA 2CUTA 5J3JA 4HZGA 1N5RA 3LCRA 4W9RA 2WLSA 1CUFA 1MU0A 5HCUA 1IUPA 5HF6A 5ALHA 3QPDA 5K3CA 1CUGA 3HZOA 4B85A 4E11A 2VSQA 4EHBA 5HK9A 1E8MA 1L7QA 1R1DA 3K2IA 4DIUA 3STXA 2C0PA 2WJ3A 5CBKA 5ALEA 4QZVA 2WG2A 3DDUA 5AK5A 1G5FA 2RI6A 4GDMA 4RNCA 1XFDA 2QKYA 1DX6A 1DT5A 3FVTA 5HFNA 4G9GA 3OOSA 2B61A 3RLIA 1XLWA 4RE6A 3RARA 3VVLA 1X2EA 4J7AA 4B9AA 2XUPA 3PF8A 1ZD4A 4LIPD 5AKKA 3H2KA 5AK6A 4EY6A 2VQ6A 1B6GA 1OILA 1S8OA 4QWWA 4UUQA 3HSSA 1R3DA 2QTBA 4XWGA 3O4GA 4H77A 1HDEA 2ONCA 4XVCA 1A88A 3DYIA 2I78A 4HVTA 1ZGCA 2O2IA 1LGYA 1XRMA 3FLBA 4KACA 5FLKA 5IVKA 5JANA 4BCBA 3H18A 1KU0A 3WKBA 3N2ZB 1VZ2A 2BUBA 4I3FA 1FSSA 4A16A 2FJ0A 4CG2A 1XQWA 3Q8WA 1WB4A 3PICA 4UBIA 4BVKA 2ES4A 1LBTA 3C8HA 1XRRA 1H2YA 1DQYA 3NGMA 4G8DA 4H0CA 3OTQA 1EI9A 1ZJ4A 5HF8A 4HXFB 2CJPA 1HKHA 4ZI5A 1VXRA 2G5PA 2XQFA 2YH2A 5HKBA 3KWJA 3WMRA 4PNZA 5CRIA 3AZPA 4Y7DA 3QPAA 1XZEA 3W05A 1BCRA 4MEAA 4V2IA 3W2TA 2OCLA 4DMHA 5AK3A 1EDEA 4OB6A 4UHBA 1VOTA 2B9VA 4JEIA 4AMZA 3YASA 5YASA 5FPQA 5E2IA 3AINA 4J3JA 3WKAA 3CCCA 4QDTA 3WJ2A 2XB6A 2V96A 3HXKA 2ZJ6A 3N0TA 4E14A 5AKGA 1JJIA 1CUVA 5KWIA 4KEAA 3FVRA 4MJ3A 4BTVA 4GI1A 3AIKA 4ZGBA 3O4HA 3BF8A 4UBJA 4K5QA 3QM1A 1K8QA 5IVIA 2ECFA 3AIOA 4X93A 3R3VA 4ZRDA 2XQGA 1ZI8A 1CVLA 2JGFA 1XRQA 1FJ2A 4KJXA 5CT9A 2VJAA 1BU8A 1H2WA 4H7EA 4Q3OA 4OPMA 1QIEA 5AM5A 4EY7A 1AQLA 2ZYIA 2PBLA 2BGNA 1DT3A 4BATA 3E3AA 2WIDA 4LXGA 2X8BA 1QZ3A 5AKLA 3C6ZA 2WG0A 5JASA 4UHFA 1LZKA 1CUIA 4CFSA 3VKFA 1JU4A 1H2ZA 1F6WA 3D2CA 1JMKC 4UHCA 2H1IA 2AJCA 3F98A 1ZIYA 1XZIA 3STUA 2OGZA 1QIIA 2JEYA 2WU3A 4X3CA 2XLCA 2WIKA 3AUKA 4ZWNA 4PV7A 5T4FA 1JJBA 3AIMA 1F0NA 4PSDA 4A23A 2X5XA 2OLEA 2GBFA 2OCKA 5AIAA 3E4DA 1EH5A 4NZZA 2JGKA 1K6EA 5JYCA 5SYMA 2BFNA 2AJBA 2CZQA 3GZJA 4X00A 1XZLA 2WQZA 1ETHA 2WFZA 3T52A 3F67A 1E5TA 3HYSA 3I2FA 3GBSA 3OM8A 5A71A 1LPNA 5LZ4A 1XZGA 1W75A 5HFAA 2OPHA 3KSRA 2Z8ZA 1MAAA 3PF9A 3K9BA 4GECA 1LPOA 1BROA 4J0KA 5ALDA 5ALYA 3ED1A 1ACJA 5AM2A 5LYYA 2PSFA 2WHRA 1G66A 4DSZA 1P0PA 4WDQA 2JIDA 4BCCA 3I28A 3OC0A 4L9AA 3G0IA 5K3DA 5CXXA 2IIVA 2VAVA 2Y1KA 5LZ2A 1LPSA 1W52X 2WUDA 3V1NA 1LNSA 1TRHA 4BE9A 2J4CA 5AM1A 3IULA 3WK4A 4MWTA 3PI6A 1TK3A 3O9VA 4YPVA 2RHWA 3B5EA 4LXHA 5D3KA 3PFBA 4BDSA 1ISPA 1P0IA 5AKJA 3GFFA 4G8CA 2DFPA 3HABA 3L1IA 3FSGD 5HF5A 1Y7IA 1CUZA 3V1LA 1H22A 5FP0A 5CXUA 1Y37A 3JWEA 1ZGBA 1CUAA 2XMQA 2WIFA 2Y6UA 5DNVA 4CIBA 3BWXA 2PX6A 1JU3A 4X6XA 3QMWA 2H9YA 4H7HA 4UHDA 4Y2PA 1DQZA 3M3DA 5JZBA 1RP1A 4IQ4A 3LP5A 1WM1A 1SFRA 4WFKA 2ACKA 3IA2A 4I19A 1SCIA 2QJRA 5A2GA 1E8NA 4FFVA 2V9ZA 5EHXA 4FHZA 4U2EA 1CUBA 5EI5A 3QBJA 5ALSA 3C6YA 2WHQA 5D3ZA 4WJLA 4PO3X 4BAZA 2XQJA 2Y2VA 1CEXA 3G8YA 4M0EA 1EK2A 5EFZA 5AM0A 2HDWA 1YA4A 3G9ZA 1G42A 3ANTA 2Z3ZA 3V1KA 1XQYA 4UFOA 1WCYA 4J0IA 4Q34A 1J07A 4Y2YA 5AOAA 1R9MA 1ZIXA 1PFQA 2K2QB 1IZ7A 5A62A 4RE5A 4ARAA 2HU8A 3WL8A 3R0VA 1ZOIA 1EHYA 1EINA 1CIJA 3WK9A 1E66A 4Q3KA 1XKLA 4DMFA 1THTA 3PDCA 5K3FB 2WFMA 2CMFA 1BN7A 1X2BA 4DTCA 5FPPA 1MX5A 2YYSA 4BAUA 5AJHA 2HRRA 5EHZA 3WZLA 1XZBA 2PSDA 1MX1A 1NU6A 3BJRA 4OD0A 3I2HA 4K2AA 3R3WA 1EK1A 5AKHA 5I7UA 3E0XA 1BRTA 4C87A 5FOQA 4MXDA 2XE4A 2OAEA 3DKKA 4B6GA 1ZICA 5ALMA 3O0DA 4OYLA 3WZMA 3A6ZA 3VVMA 2GYWA 5JALA 1UFOA 1VKHA 1YS1X 5K3FA 3UUFA 4AZ3A 1USWA 5AOCA 2X76A 5A7GA 2BKLA 1GT6A 1LPAB 5ALRA 1DWPA 3FCYA 1OXMA 2HM7A 5K5EA 1VA4A 1UOQA 1A8SA 2O2GA 4M0MA 4BBZA 1THGA 3R3YA 1WHTA 1FFEA 3FBWA 3W04A 4OB8A 1BN6A 3HC7A 3WK8A 4KYVA 5LZ9A 2PU7A 4EY5A 4QNNA 3O95A 1CUJA 3EBLA 4BRSA 3JYHA 4Y2VA 4AN0A 1IZ8A 3KXPA 3HI4A 4UBNA 4FKBA 1QE3A 5I9IA 3D4LA 4G9EA 4CCYA 1Q83A 1YAHA 2HHAA 4U2GA 1WOMA 4XJVA 1DU4A 4UPDA 2HA2A 4Y2SA 3DL4A 1ZI9A 3D2AA 3FOBA 1CUCA 5E4YA 4JUIA 4OUKX 2WKWA 5FKJA 3IDAA 2J3QA 2XUOA 5CTAA 3NUZA 4CIAA 3V9AA 4C4XA 3O4IA 3G0GA 4B81A 2AJDA 4XIIA 4IH4A 1U2EA 5A7FA 1QIGA 2PM8A 2Y2UA 2CBGA 2D5LA 1JMYA 1MNQA 4F60A 5BV7A 3I2GA 4LYDA 1A8UA 1JT2A 1GXSA 1BS9A 3QYJA 3I6MA 4JH0A 4KAFA 1QGED 3ILSA 2IITA 1R4ZA 4BRZA 1AGYA 3SC2A 5JD4A 4DM7A 3HEAA 4MWSA 2OG1A 2WM2A 3STTA 5JADA 4EA6A 1QTIA 2PSHA 1ZI6A 1LZLA 1UT6A 5AHXA 4X6YA 3R3UA 4AO7A 4AMYA 3WA6A 1FFDA 5BOVA 4WFJA 3AFIA 4X7BA 1ZJ5A 5JATA 3X3HA 4PF1A 3IUMA 2JGIA 2R8BA 4U2BA 3F96A 2QXUA 3GROA 3SX4A 4Y2QA 4X92A 1CR6A 3WA7A 4U2DA 1UOOA 2WHPB 4X6UA 3FYUB 1EVEA 3SWWA 2WSLA 2ZYSA 2I3DA 4FTWA 3TJMA 1JI3A 4IH1A 4AO6A 3CXUA 1W6RA 4DNQA 3R40A 3DOIA 1QO7A 2ROQA 4OU5A 3ZLUA 1E3QA 1Y7HA 1X70A 7YASA 2JEZA 5AI8A 2BGRA 5FV4A 4G4GA 1CV2A 3L1JA 1MNAA 4DGQA 4I4CA 1PJAA 1K4YA 1AKNA 4QLOA 2WTMA 4LYEA 2O2HA 1GKKA 5LIPA 1WB5A 1EB8A 1N5MA 4P08A 4B83A 4P92A 2WFLB 1QFMA 3FCXA 2PSJA 3R3XA 2CB9A 4HXEB 4BYMA 2VA9A 2WHPA 2I3ZA 1DX4A 3FYUA 1YASA 3QITA 1P0QA 1UKBA 4J0CA 4ROTA 2Z8XA 4CG1A 5T4BA 4W1PA 5AI6A 3MUNA 4Y2XA 4B0OA 1A8QA 5CT6A 4S0XA 4HRYA 3IB3A 1J1IA 5ALUA 1XRPA 2PVSA 4OYYA 5DWDA 5E4JA 2XUKA 4G4IA 5A6VA 4PSUA 2VF2A 3D59A 2AJ8A 5AKEA 1ZD3A 4QE3A 2WFLA 2OCGA 2UZ0A 2RGUA 2QXTA 4FBLA 4C01A 3WWEA 3EF3A 5IVHA 4IO0A 1AZWA 5AKIA 1LLFA 5AH0A 1R50A 5KWJA 3WK6A 1LBSA 2BAGA 4BC0A 2QOEA 4BZWA 2DHDA 1Q0RA 1DWOA 4DSAA 5LKAA 2J3DA 1CQWA 2XT0A 4FDMA 3V48A 2VT6A 2XUHA 2XQIA 4KAAA 2QMQA 2XQKA 2JBWA 2EEPA 2OQVA 4XX1A 3U0VA 1Q84A 5D7BA 5AO9A 1W1IA 1W4LA 2WUGA 2GBIA 2XUGA 1QIFA 4TVKA 4UFNA 5BWCA 3PUHA 2E3JA 5LLSA 2VT7A 2XMGA 3OG9A 2XUIA 4E46A 4P9NA 3GUUA 3DNMA 5A7HA 4C88A 1P0MA 3AILA 1WPXA 5JZSA 2HRQA 1BEEA 5CT4A 1U65A 2VJDA 3WYNA 3C70A 3WQHA 4AO8A 1A7UA 1QIJA 2VJCA 3BDIA 3DOHA 4Q3LA 5HKAA 3H2HA 5ISMA 1H2XA 2ORYA 3HRHA 1VXOA 1VLQA 1MJ5A 1XZCA 2BUCA 5AM3A 5HK8A 3T4UA 5EIHA 1TQHA 1DTEA 1U8EA 2C5FA 4GBGA 1ORWA 1QIHA 2O7VA 4BDTA 3K6KA 1QOZA 2HFKA 4HS9A 2PU5A 4J03A 2XLBA 4E15A 2D0DA 4ITVA 1AMNA 1CUHA 3D3NA 4DYHA 2ZYRA 2WJ6A 1GGVA 1B41A 3DJYA 3G9TA 2HA0A 5AI0A 4F21A 3MVEA 2C58A 2XMDA 3R41A 5LZ5A 1QTRA 5HF9A 1L7AA 3DD5A 2DR0A 2ZVDA 3FLEA 5AI5A 3TGLA 1N1MA 3I2JA 1R9NA 3S2ZA 1BEZA 2OCIA 5C81A 3IURA 1BCSA 5ALJA 1AX9A 4J0JA 1UXOA 1AC5A 3ZI7A 4L72A 4TGLA 2DHEA 3F8SA 4AX4A 1T2NA 4B9EA 1VZ3A 3ESAA 1TCAA 5ALVA 3H04A 3BF7A 3LIIA 3AZOA 4L0CA 5LZ8A 3H19A 4HXGA 2ZYHA 2QR5A 1EB9A 2OAGA 4DNOA 5JAOA 4X90A 1CPYA 4B0PA 4K6HA 4N8DA 3VISA 1SCQA 5EHNA 4AZ0A 3PFCA 2B20A 4PQEA 2V98A 3QH4A 2GZSA 2HL6A 2JGJA 2WUEA 3H0CA 3WL5A 1QIKA 2BCEA 2XMCA 3W9UA 3H2JA 2XUFA 5AP9A 3PE6A 1XLVA 1MPXA 3JW8A 1L7RA 1U4NA 1LPPA 3M82A 3QPCA 1XKTA 3ICWA 3BIWA 2OGTA 1JJFA 3E1GA 5ALXA 4Y9SA 3FSGA 4OCZA 5ALQA 3G9XA 3MUOA 1W76A 3VXKA 3S8YA 4FLFA 4WFIA 3C6BA 5JD5A 1ZD5A 3C6XA 3ICVA 1UK9A 4H7JA 4DNFA 4L3WA 4GW3A 3NOXA 5K3BA 5D6OA 1CLEA 1MO2A 3IUNA 3CCBA 4AN1A 5AK4A 1YAJA 3FYTA 4BAGA 2QVBA 5AKYA 5IKXA 4INZA 5CURA 4H35A 2BJHA 1G4HA 3D2BA 3VJKA 4BVLA 2JGMA 1UKAA 2G4LA 5DTJA 4EZIA 1K5PA 3AZQA 4CCYB 3I2IA 5AKXA 4AQDA 3H1BA 2QZPA 3LIPA 1YR2A 3M81A 4Z49A 4JYMA 5ALOA 3V1MA 1YS2X 2PUHA 3B12A 3ESBA 1SOMA 1MX9A 2H7CA 4JYPA 2XMBA 1N8SA 1E89A 4N5HX 4ETWA 4YK7A 1LPMA 4RPCA 3GELA 5CT5A 3I1YA
chains in the Genus database with same CATH superfamily
3IUQA 4OH7A 2FKAA 1TGVA 2FX5A 2GUWA 3ET4A 2FSSA 4HEHA 5CVDA 5HBGA 2OFFA 4B4KA 2JFNA 4KKXB 4ZTZB 3ANXA 2P9QA 3L0OA 3WWZA 4DXAA 1OKKA 3UO8B 4GOND 3X2FA 1XAIA 1PJSA 3CVOA 4JQYA 2BE9A 4KBFA 4MUMA 1MAUA 4DNPA 2WDPA 3EGVA 5TS3A 4MLDA 4JB0A 4M98A 3FCAA 4PSCA 2F64A 3IKMB 4HTFB 2X4DA 3SOZA 1BGWA 1Y8QA 5J63A 2ZDGA 1UBLS 2BMDA 3NHJA 1CBUA 4EF6A 2Z08A 1LDGA 1MAWA 1K68A 1A5BB 5A2QA 2MSWA 5HGXA 1M67A 1ESDA 4RD1A 4ETMA 1FBTA 2HQOA 4OO3A 3VR4A 5A4FS 2WWXA 3PEVA 1MOPA 1HO3A 2P11A 1Z2DA 3VR4H 3GRFA 4OJYA 4DV3B 5AMXA 4IH9A 1A5TA 3BK1A 3CUUA 3R0ZA 3IR5A 3WLFA 3TG8A 1QHIA 3HO1A 2YUTA 3E5NA 3ONVA 5L3RA 2EZ9A 3OJXA 3PE4A 3TDMA 4ZN6A 4EMBA 1W5SA 2DPHA 2GXSA 1VPEA 5T4EA 3GLGE 4YAIA 2C92A 4K03A 3COYA 4F5YA 1J2JA 5F76A 2EF0A 4QUIA 5L7WA 1AQIA 2ISQA 1PFKA 3KE9A 3VPAA 2VRNA 3W5AA 3OEYA 2Y67A 4OQEA 1YBFA 1K9VF 3UM9A 4OXRA 5KTYA 4NCHA 1JU9A 2C9CA 4HZUA 4JT4A 4UM5A 4LZAA 2NAPA 1F8YA 1FLAA 3TAXA 3P4UA 1MVOA 3QPBA 5J5AA 3RRXA 3PA6A 1UBFA 4L5AA 4WKGA 5BUZA 5BMOA 2C3MA 1V4BA 3A4VA 2JIZD 1AG9A 1Z68A 3H2GA 2P2DA 3BOSA 3ZQ4A 1RPZA 4H7IA 3QX3A 1FFYA 1IZ9A 3WIBA 3G9UA 4PXYA 2GEJA 3QHQA 4L2IA 1LKZA 4G37A 3BTVA 1NY6A 2CVHA 2HADA 3A9VA 2XKJE 1ULTA 1C1XB 2H7VA 4JT9A 4YJDA 1EESA 4HH4A 3LP6A 1C9KA 3GLFE 1VE7A 1DL5A 3TM4A 2R6CA 4IQ8A 5HNKA 4JSRA 1GPKA 2LBPA 4YS6A 4CQMD 4CT4B 4FMDB 4OGLA 4FNMA 4FYJA 1ILEA 1CDDA 1KNQA 1WOYA 2DLDA 2IP1A 3TMKA 2JAOA 4N0DA 4BV3A 4DS3A 4QBKA 1N75A 3P2MA 3PWZA 1F0PA 1R00A 3BCHA 3EGEA 3QUSA 4JBWA 3DYVA 4P80A 4RNDB 4BCDA 5JPIA 2DXIA 2BELA 1QF7A 3E82A 4D3SA 3X1XA 5TJHA 4BLOA 4D97A 1PV2A 5MGBA 4HFMA 3TVTA 2YZNA 1RFGE 2ZRBA 3A70A 3TGWA 4PSVA 1ZXBA 2AG5A 3R0QA 4C4SA 3E22A 3K30A 1AD2A 2L82A 2YVAA 4OKSA 5LXTF 4E5UA 3WAJA 3ZCXA 1IE3A 3DDZX 1X8KA 5HCNA 1YBMA 2BKVA 2I6GA 1FP1D 2VAXA 4EYEA 5CG1A 1Q19A 5K3AA 2P9FA 3LKVA 4FFPA 3M7IA 4YJ3F 2WEKA 1KI7A 2O5EA 3TOXA 2E4WA 2W6CX 3LY7A 5ALLA 4EUNA 1E1LA 4QU9A 4HAVA 3Q8LA 1E9SA 4MQ4A 1XZKA 4RGQA 2CNOA 3IVXA 1BZYA 3L6OO 3LY9A 2BEWA 1CYDA 2QTRA 1L1RA 2Z2YA 2CD9A 1XALA 3E7DA 3HU3A 3QFFA 4MWGA 2Z6VA 3KFLA 4R31A 3ZW9A 4RTLA 1K6JA 1RI5A 3R3JA 1S9DA 3FYUC 4JJZA 4PINA 4F6LA 2ZAGA 4O25A 3S81A 3CEAA 1ECJA 4UNNA 4P93A 4CM9D 1YCHA 1QJ4A 1R64A 1UEXC 1WXGA 4HGNA 1NNUA 1AUPA 1FXWF 4OP1A 5CH5A 2FUCA 1OASA 3NYRA 2VK8A 4PEVA 4HLNA 4QEKA 3UMGA 4HPWA 1SXQA 3A2MA 3NT4A 3TRKA 4XDYA 3MMNA 1N5KA 1XE3A 3IMEA 1OWNA 3HLKA 1PJZA 2YWXA 3QTLA 3S3TA 3PEUA 1XDGA 4RJLA 1R6AA 4UBKA 2JAPA 3LAWA 2JFZA 2PLAA 2X7HA 1C3XA 1LDEA 2Q6LA 5DNWA 1R2QA 2EC5A 4FNGA 5H83A 4AURA 3EAQA 4FDAA 3R4VA 4D57A 2C88A 4E13A 1TEXA 2XDWA 1C2YA 1UBMS 2FSVC 3D8TA 3F6SA 4MRMA 5B37A 1HTBA 4DA7A 1U2TA 2XD4A 2JASA 3ZIUA 5DHFA 5T8KC 5GONA 3OQOA 1JWLA 1NKTA 3A36A 1DRJA 4YCDA 4ZVTA 2AEEA 2XXAB 2WE8A 1PK7A 3JQDA 4DA4A 2NAFA 5F2KA 1XT6A 3R6DA 2QYHA 4XCXA 1E2QA 5GIPE 1RI1A 3P5SA 3FZNA 1GFIA 2WIGA 3KLMX 2XZTA 1GU0A 1KSGA 8MHTA 3S2IA 3FCUB 4NENB 4I1SA 3E1SA 5F7OA 3PA8A 1NXQA 1R0LA 2W11A 4JP1A 2HU5A 4QTUB 4R54A 5DISB 4ZYLA 5A04A 3C43A 3VTKA 1VBKA 3ZHVA 4ZZIA 1II0A 5DXFA 3FNQA 4IDHA 4CUJA 3UKJA 2IHBA 4D7AA 4D9EA 2P1RA 1ESMA 2H3EA 3GVXA 2WIJA 1XAJA 3AEKA 3H42B 3VYVA 2HF9A 2EFYA 1V4VA 2CXHA 2W22A 4Y7CA 3WGNA 1ZBDA 4HNSA 4BX9A 4BWGA 5IF3A 3L1UA 2JS7A 2P8JA 5FQOA 3U7HB 2NTEA 1Y9ZA 5CYGA 2R85A 2FHPA 2VFAA 5BWBA 1XJ0A 2M6LA 1PJ8A 4W1QA 2ZRDA 5F12A 4US1R 5JXGA 1P18A 1WZIA 2UXCB 2QDKA 4Y6SA 4EDFA 4OIMA 1IM8A 2IXEA 4X91A 3NO4A 2I33A 1GPH1 2JJQA 4XWYA 2W2QA 4UPEA 2C9OA 5SYNA 4KOEC 1ZCBA 5AQEA 4CEHA 4V3CA 4OLBA 4WXEA 3LS2A 1NJSA 3EVTA 1WF3A 1G6HA 2VWPA 1WHSA 1CERA 2DPYA 2VATA 4CQLA 2EKLA 4YPFA 2HXYA 4GRAA 1N2JA 2JEOA 2ZIAA 2NSJA 3EGCA 3I12A 3OFND 3RC9A 4C06A 4WGGA 4EG8A 1JKMA 1JEYA 4EFNA 4GGMX 4K7JA 3NT5A 4FMPA 1CSEE 1RRGA 2X19A 4KGDA 4M46A 4RKRA 1W87A 3FPCA 5HW0A 3D5EA 2JGRA 2QTGA 4IHAA 4N65A 4RK0A 4Y98A 2QN8A 1L5LA 2WP0A 5B58C 3MWFA 4QQFA 5ITWA 3EGXA 3I0NA 4FLEA 2NM0A 2YWBA 1C1YA 1NRXA 1YFZA 3KWMA 2WAAA 1LLDA 3IP7A 5JAHA 1E92A 3HYTA 3V42A 1TMOA 1JAZA 1WWKA 3KU1A 4FSDA 5E6SA 3PC6A 5IYZB 3AVVA 1NSYA 3MJRA 3QXSA 3OFVA 5CFNA 3RVLA 1DFHA 2PPVA 1UPAA 2X6TA 4O4IA 5AK0A 1YNOA 1IJEA 2HUPA 1XOIA 2PS0A 3O6VA 3WBKA 1IXYA 2R0QC 1WG8A 4I6GA 4XQGA 5JC8A 1ULZA 4YDSA 3ZWQA 4F4UA 1RBYA 5KTKA 2V4UA 4YJKA 3NTVA 1GPJA 2P30A 2H54A 1GRNA 4EB0A 1G21A 2E49A 2NVOA 1U0TA 3SMVA 3WB2A 3NAZA 4JUAA 4L08A 3ZHCA 5IX8A 4DV5B 3LT1A 1GVNB 2MSCB 1DXQA 1EQAA 2FQ1A 4V0OA 1AHHA 1UBEA 4WQMA 2HF8A 4WZBB 3W1EA 4B2IA 5BQFA 3LOQA 2H4ZA 5EQJB 4BBPA 4EGFA 1GPWB 2XW6A 2XUQA 1DAKA 3B6ZA 3CLUC 2W00A 3GAMA 3PXXA 4FX5A 3QVMA 4Q3EA 5ALTA 1U3GA 1Z5WA 4NFSA 2X4GA 4MW6A 1ZUD1 3KQYA 2Y1CA 4PWYA 2RH8A 1Q21A 3DMFA 4PC3A 2HMSA 3BA1A 4PLPA 4K3UA 4G2NA 5JXIA 3BIOA 9LDTA 1E1CA 2K2WA 4U02A 4ZFNA 2ZLBA 3WIOA 2Q99A 1DBPA 5T4HA 4KNYA 2PLRA 4GPZA 1YCFA 5IDYA 3FA2A 5F2EA 3JQAA 1P1BA 2BOVA 1R5OA 2XE7A 5JH7F 3JR3A 4OLAA 3FWYA 3I6YA 1E9CA 3FPKA 1UBOS 4RDCA 4ZEVA 5A06A 1T5DX 4HAUA 3WWPA 4DJTA 2IEYA 4DQLA 1KDZA 5B30A 3WKEA 3VI4B 5K2OA 2BIFA 4W5TA 4RFLA 3ENZA 4HGQA 2RGCA 4BQQA 4WN9A 5A02A 2BBTA 4PYIA 4KR9A 3B1ZA 3R9XB 1M2HA 4ZOLB 2W48A 3NVDA 5AICA 3GP5A 2QV7A 4JUFA 2FWMX 4MAMA 1KRXA 1NSFA 2WU4A 2PL1A 2QMEA 4JHLA 4MV1A 4P35A 4PRKA 3GQBB 5FULA 1XCLA 1WXWA 1NUTA 5IKPA 3QHPA 1QP0A 1QFSA 1WKCA 3R7WA 3V4LA 4MUJA 1X1CA 4Y2RA 3GHHA 2IYEA 4C6TA 4UZSA 1OTXA 1U2DC 3FDXA 1DUSA 1PFYA 3I92A 2FCRA 3U4CA 2H4FA 1DUIA 3REQB 5LU9A 1PJCA 5AKZA 3QTTA 2X5OA 4KE6A 4OK3A 4IFBA 1SC9A 3PGKA 4ZCSA 2FPUA 3GUVA 1AXEA 1TCCA 2OBNA 2AFIB 3BMXA 3DEJA 4MSUA 1CUYA 2BFCA 5K8IA 3JQFC 4GL2A 3ITDA 5KWSA 3EK2A 1ZK1A 2YVUA 4OH1A 4JLUA 4XCVA 4EKYA 5I9LA 3BK7A 3GT0A 4XGIA 4AYTA 2J3EA 1QONA 3EQ9A 5LMNB 3ADPA 3MT9A 5BNWA 2IIQA 2PQ0A 3E5HA 1UXJA 1SU6A 3FPEA 2D7JA 4X85A 3OA0A 3B3QA 5ALNA 2JHCA 4ZAGA 3RW9A 5K3OA 4NATA 2DSTA 3HDTA 2X0KA 5BYKA 3MGAA 4LDZA 4ZARA 2X8LA 3GZ4A 2GCEA 4KAJA 5DZSA 5LUBA 3U44A 3AGQA 3C8MA 2IXDA 3AONB 2QD1A 3N7AA 3R5JA 4X1YB 5E6UA 4AJNA 1Z5OA 2GRAA 4D8WA 4DJJA 2OCAA 1IM5A 1T8UA 3EEYA 4LQDA 1WSAA 1FRNA 2PS1A 3UMBA 2CFRA 4C6HA 1K27A 4L50A 4MA4A 5DV9A 1TL7C 1NUQA 1ONOA 1T3HA 1UADA 2FPXA 2XF8A 2QEQA 3NIBA 2P2ZA 3GA5A 1GPAA 4JLWA 4DLVA 4YUZA 1E98A 3W6OA 3OZRA 3V1TC 2QUBA 4TXMA 1TVMA 3EWIA 4MTCA 4XA8A 3E3OA 5GM2A 2X14A 4U63A 1FLNA 1HFWA 3TX6A 4DM3A 5EQTA 2J9FA 4XAQA 3IP9A 5HIAA 2C2MA 3AY3A 4TYMA 3VVCA 4ENVA 1PDWA 2IKSA 4KFRA 2P6NA 2XVAA 3L0ZA 1R4NB 2HPZA 1OXXK 4WPGA 4L5YA 2DMRA 4UXIA 2PIDA 4MUEA 1SCBA 2GKGA 5D5HA 1YA8A 5JH7A 1MIOB 3AL2A 3CZAA 3P32A 3ELWA 3OKPA 1QHNA 2BGTA 3EXG2 3O2JA 4JNKA 4CDNA 1U2ZA 4MGKR 3HY3A 3C3MA 1Q3KA 1PRYA 3PUKA 3JAMA 1SVLA 1QRAA 4NAUA 4PW0A 4G4JA 3CN7A 2AI3A 1W85B 3GVCA 5CA1F 1W36D 2BUAA 1W8IA 1PS8A 2VQ3A 1CU1A 1ZCZA 2X0FA 4TM7A 1KKUA 3LBIA 1YIAA 2J33A 2FF5A 2JBAB 5L53A 2OSBA 5LQJA 1MT3A 3DQZA 2QJWA 1M2GA 1XL1A 4J4BA 5FCDA 4DCMA 4E2WA 2PO7A 2NVUB 2AH5A 2HY7A 4R4JA 4LN1A 3PJDA 2N42A 3LDUA 5ALZA 2OD9A 5LQAA 3FJYA 1KFEB 1VFNA 4C3OB 4R8VA 3CLTD 3AXSA 3A2NA 3RS2A 4FOSA 3LXRA 5A0FA 2G9UA 5JAPA 4ZODA 3T7IA 2B0CA 2HIHA 1F60A 4HRVA 4IDQA 3I05A 4LHYA 4XZ3A 5AI4A 5FOTA 3ZBTA 3OPYB 2HFJA 1A77A 3OX4A 2RGRA 1J8MF 3NGXA 4PGHA 3ELBA 5IFLA 1IOLA 2A4MA 2RG7A 2AE1A 1NHGA 4C3UA 1HLGA 1Y48E 4NE2A 3OE7D 3ENNA 4HQKA 1X1AA 4J0FA 4OBBA 1NSTA 4I1RA 4DQDA 3SXJA 5JROA 3FHTA 3OOYA 2IE8A 3U37A 1ZGAA 1N2ZA 1ZN2A 2EKQA 1IUOA 4G5GA 1S3IA 2O3RA 3KUUA 1N1GA 1RSZA 4GWLA 4WNCA 5E3IA 4REOA 2EJVA 1OWMA 2V0GA 2Y1FA 2VBCA 3KYDA 2NT3A 2WK1A 3DLTA 4F56A 3D1JA 3L6CA 3R6GA 3P9XA 3KCQA 1H9BA 3FAKA 4RAOA 3U4QB 3G0BA 2OE2A 4HDKA 5J4KA 4QXMA 3W6UA 4E88A 3KALA 2GI4A 4QO7A 2XUDA 1ZIPA 5HQ3A 5DGTA 3QW2A 4KBYA 4O1IA 4YP6A 4CQJA 1FVFA 4NBLA 4QHSA 1HEUA 2D5AA 4QIHA 5M3BA 3DS8A 1RAEA 5BN3A 2GBCA 4DFDA 3KQQA 5FUMA 2JL1A 2OVFA 3N2KA 3AV0B 4INOA 3BWDD 5FF9A 5KX5F 1KO7A 3IDOA 2O48X 4F2GA 1ANKA 3MT0A 4LY9A 3LPCA 3LQFA 2PR7A 4U7GA 1HFEL 1KDPA 1MAHA 1Q95A 4I9FA 5FXMA 4DMGA 1SOVA 2GZAA 4HLUA 1KJ9A 4G84A 2R11A 1SKYE 3IVMA 2HLPA 4G56A 1K08A 3PGMA 3QMMA 1FYDA 1KBQA 1NW3A 2VJKA 4JXJA 4YCBA 3OTIA 1FFBA 2WZQA 4B6QA 3N8KA 3KELA 1M34A 1S6YA 4GX1A 1TTHA 1TUGA 1JJ7A 3FTCA 4N6OA 2WD7B 1EFKA 2O0HA 1SVNA 2ZSEA 3CFYA 3H1AA 4PONA 3P97A 3RNLA 3LF1A 3C5WP 4TT3A 4UUAA 4PX9A 3E8MA 4PR3A 5EYPB 1JVSA 1TLFA 4GE0A 4HP8A 5C8ZA 1XXLA 3HPRA 3FLAA 1TZ2A 4GYKA 1GR1A 4LXQA 3CE9A 1JHVA 4X60A 4KR7A 4B3BA 2AFVA 5C8YB 3ADBA 4TS3A 5IABA 1A98A 1OH5A 1VPDA 4MYDA 4GKAA 3T12A 3M5CA 4DABA 4K6OA 2E0IA 3C4JA 4CI9A 5K09A 2FN8A 1NVXQ 4CM8B 1D8TA 1XN4A 1M8FA 3KZVA 3PK0A 1YBHA 4XD7A 3FY4A 4TTJA 2IBTA 1RYEA 1QGUA 2GJSA 3P2OA 1H93A 4UPVA 5ERXA 1H2AS 2CB0A 3THYB 3SZLA 4JWKA 2YJGA 5K45A 4GO1A 4MYCA 3ZU3A 5K8JB 3WB0A 2CUZA 2QMZA 2ZSAA 1P9OA 1CY1A 4XUGB 2RFLA 1QP4A 3M6FA 1KIMA 4GPEA 4UEWA 2ILVA 1KRWA 4IRUB 1JQDA 3PNVA 3LUGA 1NBEA 3ACDA 1WUIS 2PJZA 5AD1A 1NBMA 1Z6QA 1BYIA 3QG1A 1X77A 2JGAA 2JI7A 4Q15A 3E53A 1E7SA 1RJWA 3KOXA 4O5OA 1XTBA 1O58A 4JI4B 4KZKA 4UCWA 1ZMRA 3E3NA 2WJGA 1OUMA 4CKBB 4NS4A 3ESZA 5JECA 3AHDA 2DFVA 3BWCA 3KKZA 1L1EA 1N3BA 1PNQA 3DVRX 3WXBA 1NR1A 4DZZA 5CFPA 5DYWA 1WMDA 2DQYA 3FRJA 3C1UA 3HCFA 4NK5A 3EC1A 3VBEA 1DAFA 1CUUA 1MV5A 4RL4A 5AUOB 5HHTA 4NTZA 1U8CB 5ALKA 4ZT4A 4UBMA 1GGFA 1TADA 4RQBA 1O6FA 2Q2WA 3S1AA 4A6PA 2EGHA 3DCNA 3BL8A 3GZNA 4H1UA 2GUGA 2QR3A 3E9DA 4QDKA 4R8LA 1N2CE 4V2UA 4F2DA 2IHYA 2XZDA 1QYIA 5FOVA 5ARBA 3EPJA 4V3BA 3ZZNA 2GYVA 2NSLA 3VV3A 3DW3X 2QQGA 3GRKA 4J94A 4X3PA 5IAEA 1Q20A 4MIKA 5EUCA 2CVFA 3IESA 1CQZA 3TDNA 2KJQA 3EUWA 5C7YA 1K5DA 1US8B 2QX6A 4XSVA 5DSZA 4IPTA 4R81A 1GDDA 3AM5A 1EXWA 3OBBA 2IHTA 4X20A 1G6OA 3NIWA 4IIEA 1X7XB 2JFFA 3U9TA 1L5OA 4J07A 2Y4OA 3AB7A 4HD8A 4QYIB 4J1SA 1BC5A 3NHUA 3GGCA 1XZFA 4TXLA 2AW5A 2V03A 3QJYA 3JY6A 3GJ3A 1WPGA 2YMQA 4GR5A 3SFVA 1CY4A 2IV3A 3ZD6A 1XYYA 2FUKA 2IVFA 5FHRA 5BSFA 1Q22A 3KQNA 1DJQA 2OBXA 4YJFA 3WR5A 3MGBA 3ND5A 3TLCA 3Q88A 1YI1A 3I30X 3T7RA 3WKCA 4EGCB 2FUEA 1GQRA 3DLBA 1TK9A 3WKAA 4MLZA 3ZV3A 5D8DA 1LF5A 3GRAA 2GCGA 5DFAA 3JVUA 1TAQA 4H7FA 4YALA 4MCHA 3H1TA 4RANA 2H6EA 4KX5A 2G36A 2VZ0A 3JALB 5LZ7A 1UJNA 5E7JA 1U2GA 1JILA 5EZ5A 2X0EA 1M33A 1QS0A 3W1WA 3ZE1B 2PKQO 3GPBA 3I45A 4MUBA 3R6LA 1CJMA 3Q2KA 3DCYA 2ZTMA 5E3HA 1K06A 2G25A 1MB3A 4PVCA 3ROEA 5JS6A 5JBIA 3BKWA 3EPPA 3LE8A 2BCGY 4LQ4A 4B43A 3PUJA 1HWYA 2P6UA 4GU5A 5SZJA 3T0FA 5KVCA 3MTDA 2O5CA 1PNOA 3O8RA 3RRNA 3KYJB 4N12A 3IXQA 1TCVA 4JX8A 4D4MA 1X14A 4JU9A 4LHEA 3I62A 3EYAA 3O9ZA 1BXRA 2JFWA 3OCXA 2OY0A 1KYYA 4I4IA 4DJFC 4Q1CA 1Q7CA 3FMGA 4BQEA 1I4DD 3IPRA 3LCRA 3UAWA 4B4WA 1MU0A 1PKEA 1BVHA 3ED5A 5IXYA 4P7FA 3IT0A 2NSDA 4MR7B 1IUPA 1NV8A 2HHLA 5HF6A 4G0UA 4I55F 3GW8A 5ALHA 1OFUX 1JALA 1KYIA 1P1IA 1RPJA 1DGQA 3HZOA 5BN4A 1SCJA 2ZKLA 3I9MA 3OZXA 4N6NA 2RKWA 1WABA 1E8MA 1V35A 4HLDA 2GHQA 4KQ9A 5F9FA 5B1DA 3AFHA 3QHAA 2C0PA 2CDCA 2RBGA 3LOUA 3W0LB 1Y9AA 1KMQA 2IOFA 3DNFA 1HA3A 4NDAA 5ALEA 4J2TA 4E5PA 1SPXA 1H2HA 3IQGX 4GRIA 5FYQA 1EJ6A 4IO1A 5AK5A 2R5FA 4IDDA 4RORA 3VPXA 2H2DA 5TF4A 4GDMA 1RJEA 1UM8A 4NAVA 5KHOC 4D0SA 2ZK7A 2Q3MA 1XFDA 1T8PA 4Q02A 2JFVA 1MT0A 4P22A 1WLYA 3S4YA 1I3KA 1PQPA 4O2LA 4MGHA 3RUPA 3ET5A 2MINA 2B61A 1KRHA 1VLHA 2AMYA 1II8A 1PUIA 4FFLA 4IICA 4B6JA 4D8UA 3ZK8A 5K0CA 1YU6A 1T5BA 2AR0A 4HAWA 3HJRA 4ZQIA 3WGTA 3MC1A 1FTNA 4J7AA 1M2FA 1T5OA 1LSJA 2R751 3RSSA 2QTTA 2XUPA 5EESA 4ZYWA 1MZPA 3LDHA 4HY3A 3T4PA 3GN1A 3ZZ0A 3ZD9A 2X2FA 1EK0A 1R8SA 1C7EA 4G09A 4RZXA 4D0NA 2JPDA 1AGNA 5L45A 5IM4A 3H2KA 2ADFA 3UV6A 1GAXA 3N3BC 3L7JA 3U6BA 1NN3A 3FWKA 4UVIA 4BNKA 4RAQA 2GEBA 1QCYA 2ZP1A 3X2EA 1S8OA 2N1BA 3O93A 4HH0A 2FN9A 1P73A 2ETXA 3SDSA 5GONB 1UOEA 2CNNA 2YBDA 4TMXA 3V00A 1RKVA 3ZJ5A 3VV2A 2XSZD 1ENZA 3AKCA 5J4LA 2N75A 4RK5A 1A88A 1H8HD 3DYIA 4WK2B 3T7CA 4AW9A 4MVJP 3C1OA 4AKIA 4YP5A 3T3DA 4XRRA 1BXZA 2O2IA 4JLMA 3WQBA 1NJ1A 1ZRMA 5ARDA 3WLOA 3Q3VA 1FZTA 3DLCA 5CEJA 5IVKA 2GTIA 5JANA 1SZCA 3WJAA 2AQ8A 4UUBA 3LT2A 1PQ4A 4F6RA 4JJ4A 2AS0A 3N2ZB 2BUBA 3DZBA 1USUA 4KJZA 1FSSA 4A16A 4G1EB 2WHEA 1RZRD 3LTEA 3FKJA 3LK6A 4CG2A 1XQWA 4XGNA 2QIOA 2FR8A 3TNYA 1LW6E 4PCLA 1IJFA 3DZIA 3NPAA 1AM4D 3FVVA 2FP4A 4BQFA 3PICA 4EUKA 1YQTA 5BN1A 5I6DA 4BVKA 1K8XB 2JFPA 4FM9A 2C2GA 5C51B 4NCAA 1EVZA 3JZIA 1Z22A 4Z9YA 5DHAA 5LOVF 3AEXA 1RRVA 4PYMA 4BHTA 3A11A 3IFSA 3LG2A 3NHWA 3UG6A 5KU1A 1C5KA 1R6DA 3LD9A 1AXRA 4FZVA 1GL9B 3L93A 3FWNA 2BI4A 2WTEA 3GMSA 4BX2A 2V6BA 1KZ7B 2HH9A 1NT2A 3OTQA 1WPQA 1OBVA 2P62A 4YJGA 1D0IA 4KHZA 3SAJA 4Q01A 1PEKE 5HUJA 5JVDF 4CEHB 3TNLA 1BS1A 1KYZA 1HKHA 3KWLA 3AFNA 4GOMD 4RM3A 1MA3A 1VJCA 2COKA 4B8ZA 1G2IA 4L6CA 2WA1A 3ECAA 2CLOB 2EP5A 2G5PA 4LTNA 5I7HA 2GTHA 3MNFA 5CIYA 1P19A 2VLIA 4OMFG 3RHTA 3WQSB 1PFGA 3COZA 1EVLA 5CD9A 5HKBA 2WYUA 5AVJA 3QE9Y 1JEYB 2XNJA 1SIUA 1XXHA 4X0EA 2MYPA 4IV0A 4DANA 3OWOA 4FYIA 3KWJA 1MC8A 2HT6A 3W6ZA 5AVOA 1JAYA 4MUIA 5B3JA 3JASA 3PV0A 3H8JA 1X7WB 3IP1A 3E15A 4R6XA 3ASZA 2JIZA 2DG2A 4IDPA 1OT3A 3ESYA 3QPAA 4HVCA 4YMVA 1XZEA 4OHBA 1K9SA 1MEJA 3W05A 3U61B 4BX3A 2QRNA 3TOZA 1ECCA 4MEAA 4FSXA 4L74A 4V2IA 4OI1A 2Z5LA 5E6SB 1LI5A 3V34A 1FVHA 2C2WA 3GDGA 4XFKA 1PWEA 3KZCA 3F9RA 1KMHB 1WDWB 1HTWA 2ISCA 5FHQA 4UHBA 3ZJVA 4MIYA 4O4IB 3RJZA 3G3EA 3OJWA 4CQMA 1U0GA 2Z09A 1G8MA 4LOHA 1VPTA 2HHCA 3JQ8A 4RC9A 5BVHA 3OZFA 3ZCQA 3RFVA 4ED9A 4V0KA 1RXYA 4CW7A 1MRNA 1OR8A 5DWVA 1GT91 4NXNB 3RU2A 4GXTA 5DI9A 4K0KB 4DF3A 2CSXA 3BSFA 1DX9A 4M8KA 5EN4A 3C5HA 4QDTA 5GWXA 3T5BA 2XB6A 4ARZB 1XQ6A 3B1XA 3QVUA 1CZOA 4JXKA 4Q21A 4MVYA 4NI5A 2PUDA 3HXKA 3N7UA 1QB7A 3DA8A 2O8CA 3U40A 2E18A 1XTPA 3B2QA 4E09A 1E1CB 1QF6A 5FTNA 3HI6A 4R1TA 1JPVA 2PRZA 1YJ5A 2YHIA 3P0FA 4MRNA 4PO1A 1PDOA 1UDAA 4V0MA 4Y9RA 2AOWA 2Q5IA 1HL3A 3CONA 1QF9A 4MS3A 1IN5A 4HVLA 4FKMA 1Z6XA 2C83A 2ZREA 5JXWA 1GTRA 2CLSA 2V65A 3JQAB 1DXYA 5IARA 2WZDA 3A6GA 3FTQA 3PITA 3OPQA 4FBGA 4PIMA 4RPHA 4W9NA 3ZC3A 1UF9A 5HKLA 3AIKA 1GCOA 2GPTA 2WC1A 4WAUA 1L4LA 5DOZA 4TX1A 2GXQA 4C7XA 1PJ3A 5DLQC 4K5QA 4LZPA 3BRWD 2FSFA 3OKAA 1C9MA 2ECFA 4ZK6A 4X93A 3UAXA 1V0JA 2QZ9A 4YRCA 5D1NA 3R3VA 3SBOA 3BORA 5BRJA 5JI3E 5G4LA 2XQGA 2JGFA 4U8GA 1U1DA 3QBDA 1FJ2A 1TX4B 5CT9A 1RTKA 2N3ZA 3W9SA 3EEQA 5ARCA 4WXHA 1PLJA 1D9ZA 2V5UA 2YIMA 3CX6A 4XEUA 1GDTA 2ZRKA 4F9EA 4UDYX 3R1IA 2H4XA 4P7GA 4L75A 1F2UB 1FVXA 1T6XA 2QP3A 1WEHA 2NSYA 1MB9A 3D31A 4UVHA 5BVGB 1OTHA 1J97A 1AQLA 4HQRA 1V26A 3BMCA 1WUYA 3R7WB 4PZLA 3L79A 4G97A 1T5LA 3NAQA 4UNSA 3QE2A 4AJEA 4BATA 1CRZA 3SXPA 2QX7A 3DXYA 1H1LB 1ZK4A 3IUSA 1N3LA 2PV0A 4PAMA 5C4GB 1SEPA 3KJGA 1OPRA 3Q10A 4GF5A 4E70A 1P3DA 4UULA 3C6ZA 1IOWA 1PSZA 4UHFA 1R6VA 1RPAA 1VKOA 5CA0F 2YC2C 4I9HA 2QVXX 2ZIFA 3OZDA 5HDBB 2XRFA 4G81A 3WGVA 1EX7A 1NBOA 3NDBB 1O7JA 2H5JA 2TSYB 4E07A 1JZQA 1EGAA 1O6ZA 3D2CA 3L82B 3T3NA 1Z45A 3N2GB 4UVDA 2BFEA 4RF5A 2A9KA 1N57A 3DPSA 3MD9A 3F98A 3O92A 1XZIA 4ZDWA 3ND9A 1W29A 5LBTA 3D8SA 1HKUA 1NVUQ 3OOWA 1OMOA 2JEYA 1X38A 3GC6A 2QQFA 4NZ9A 4P38A 4URWR 2B3TA 2I34A 4UZEA 1FP7A 2RHBA 4WNAA 4AKTA 2O8EA 5ANRB 2EJTA 1W1UA 3WS7A 1U63A 2WIKA 3EPRA 1I51A 4NZNA 1ZK3A 4PV7A 1LV7A 4XD2A 5T4FA 1AO3A 3ZWMA 3U44B 3L8CA 2OCXA 3QKUA 5E6UB 3AIMA 1Y81A 1SWWA 2NU6B 4JOSA 5ELXA 4KSYA 2GBPA 3RKUA 4AJOA 4HLCA 5SYAA 2ZIXA 2GD1O 1FNSA 2Q6TA 2GBFA 4Q39A 5EPOA 1YRHA 5KJCA 1QHGA 2YW9A 2C31A 3B82A 3E4DA 1AH2A 3EQ6A 3CC8A 5J2TF 3PUWA 4NZZA 4CMKA 4BMXA 3N0XA 3NFRA 3ZZMA 3ZUGA 5FOUA 2VXBA 1XLTA 3ZWKA 4B31A 3GHYA 4R69A 2ZDQA 4TRMA 2YS6A 5LDHA 4MJ7A 3TZKA 1TI7A 1VM6A 2AEMA 2AJBA 4PZPA 1SCUB 3TW8A 4MCIA 2G7MC 4TN1A 2CFCA 3KS9A 5JW6A 4QYTA 3CQ9A 4AP6A 4O2AF 2P7HA 1ZUHA 3KB2A 3LUDA 3RIYA 4KKVA 3OFNA 1PJ4A 3T5TA 2XNSA 2RMKA 2O3SA 4UNIA 4CMIB 1L5FA 3L7OA 3D6NB 4HWOA 4WEQA 4YCSA 1GD1O 1FYXA 3AJRA 3T5DA 2QROA 1XZGA 5HFAA 4WESB 5JV5A 1QE0A 2WKPA 2C5EA 2VAWA 2C95A 1GVHA 3G2LA 3HLTA 2Q41A 2GF9A 2HQBA 3PF9A 3QUAA 3PCRB 3M6VA 4LOKA 3T9CA 1NLMA 3KSBC 1XD8A 2JLRA 2QX4A 5EMHA 4B2PA 3L7MA 3KNZA 1SO8A 2QTVA 3MHPA 1KHTA 4GSKA 1U9YA 4J0KA 4XYLA 5KTNA 4ZZ3A 1UJ4A 5ALYA 1E1NA 2DUJA 3ED1A 3U3ZA 3K05A 3KPVA 2NYUA 3HU5A 4BNMA 1B15A 1YVEI 4LY6A 4TT8A 1MRZA 3N8HA 5AXCA 1JH9A 1KZ9A 3LXMA 3O4VA 1RYHA 4WDQA 5EY5B 3SS8A 1GSAA 1ZMOA 1SELA 2REXB 4GWGA 4M0PA 2GF0A 1NVEA 5DYNA 2H06A 2FFQA 4GMKA 3NOQA 1OHHD 1V5EA 1ULSA 1ZM4A 4UZFA 1N7HA 1XTSA 2GM3A 3QNWA 4R1LA 4JC8A 5DEOA 2QV0A 4WCFC 5JFGA 2ZBDA 1P80A 5F23A 4LW8A 2JK0A 4TMTA 1Y80A 4LVOA 4LRXA 4URZR 4BE7B 3FIJA 4HSGA 4C78A 3FPHA 5IJ0A 1F1JA 2L42A 3HJCA 1LQUA 3P26A 4JL6A 4OA8A 1JRLA 1DKOA 3R7NA 2E55A 2SBTA 2J5KA 3EOBI 4KVZA 1TRHA 4HDRA 4WW0A 2CCKA 4INAA 2IZ6A 1DBIA 1N7GA 5AM1A 4FFBB 4LG1A 3IULA 4EMTA 1XTIA 4PLTA 2VQFB 4PYKA 4FNOA 4GM1A 4R0VA 3OHMA 5KYTA 4GZ3A 4RVGA 1LS1A 5CLJA 2ZRAA 3INNA 4IGEA 5C5IA 3O9VA 1DBWA 5CBPA 3BMNB 4CDRA 1R0CA 3PEEA 4LXHA 5KJEA 1X1BA 5SY4A 3GDHA 2O3QA 2UDPA 2DKOA 4BNYA 4PC6A 4BDSA 1ISPA 2J7PD 4GOXA 3TFQA 1NMEA 1JTVA 1OA1A 5DRYA 3GFFA 1PTJC 2DP4E 4BEWA 3HABA 3OSZA 3T5PA 3WQQA 3ZWWA 1LWNA 2RKOA 4B87A 5EJ9A 1CUZA 2JIOA 4D5GA 4ZP1A 3OMLA 4LHVA 5FP0A 1W49A 3WBJA 5CXUA 4CKWA 1OOEA 1Z4NA 1OU0A 1QDEA 3FMOB 4UTNA 5CM8B 2CC2A 1SG6A 1M0SA 2C5BA 3HGMA 1FCJA 3L1VA 2Y71A 3M4ZA 4IWNA 1Y8AA 4MVJF 3NR2A 2MT9A 2YFQA 2C7QA 4JI0B 5FI1B 1DTWA 2JVJA 2PUCA 1N3YA 1XVUA 3FDZA 4IF4A 4FK8A 4IY1A 2H9YA 1NL3A 4S1TA 3ULKA 2ZJ0A 4DWOA 3UJNA 1J8VA 2RJ3A 2ZRHA 2YWFA 3JVDA 1EBBA 1RBQA 1RVV1 3M3DA 1GCAA 5JZBA 3PPYA 1QUEA 4GP7A 3LP5A 1AK2A 3IDZA 4TTIA 1P1JA 4AULA 4TTTS 2UUOA 2BKEA 3ELYA 1SFRA 3GNSA 2ZI4A 3HXLA 3IA2A 2GA9A 4ZEXA 1BFDA 2WJYA 1QGUB 2GB4A 1SCIA 3LRTA 3P2KA 4YYEA 1RLMA 1RVDA 4JP2A 1TD9A 1H6DA 2IEAA 2BLNA 1NQTA 3FPFA 4LRWA 2ZIZA 3ILVA 4BGEA 2OOSA 5MFZA 4FGUA 4ND8B 5KYXB 4WFQA 4L8FA 3VYSB 3UXMA 3ITKA 3QXHA 3NTUA 4DLPA 3WLQA 1PG0A 1UP6A 2Q3EA 1Q77A 1YFKA 4G5HA 5BR7A 1WQ4A 1YB1A 1HE8B 4P32A 4WJLA 3SJCA 1Y4SA 3VZDA 1JA0A 4GLLA 5CLGA 3IJEB 1TF7A 3VR2D 3IKLA 5GJWC 4BAZA 3SMQA 3LT5A 5BWOA 1R0YA 4EABA 2DB3A 5F77A 1AMOA 2B4RO 1D1QA 2R6GA 3SM3A 1ZL2A 1HNWB 7MDHA 5AM0A 3A9RA 1SBIA 1H2BA 3MJSA 3SYMA 3V1KA 1G42A 3S1AB 4L8VA 4E33A 1VCOA 2DWOA 3I72A 4IOJA 2BSXA 1NOJA 1Y3HA 3RADC 4BUJA 1E58A 3GL9A 5A3SA 1DCFA 3L8ZA 4D8VA 1V9LA 2XBMA 2DYKA 2GD2A 3LYHA 4JMLA 2X23A 2B6HA 1WW2A 1KVQA 3ITNA 5FLXA 2BKAA 2WJPA 3B1KA 5LA6A 5AOAA 4MUFA 2IPOA 1R9MA 4BGIA 3LLUA 2FMXA 3UMSA 1ZIXA 1PFQA 1B7GO 1XUOA 3P0EA 5DX8A 4EL0A 4K3VA 4BU1A 2XXJA 3OU2A 1IZ7A 2BHTA 5A62A 4WK0B 2Z0MA 1NXOA 1PFWA 4GE3A 3HJBA 4W99A 1O6CA 1DJLA 1XG5A 1IHYA 2HU8A 3EWSA 2E4AA 1JI0A 4LX8A 4CTOA 2HJGA 2H9AA 3AF2A 3AXTA 4QGHA 3M2PA 1CT9A 1W94A 1K4MA 5UKDA 3WK9A 3ME5A 2PUTA 1E66A 2CXSA 2IYWA 4G0NA 4KQJA 3ZHSA 3B48A 2EAUA 4Y1GA 3ORYA 1ESEA 1THTA 4LDRA 3TX2A 4DMFA 3CV3A 3D7LA 1OFTA 1TVKA 3GMTA 3H2BA 1E1MA 3QV2A 4RH0A 3UJ8A 1BX1A 4F45A 1OYYA 1CC1S 3JAKA 3SF8A 3IPCA 5EWMB 3C15C 2CWDA 3EXEA 1R37A 1MGPA 2GGSA 4LWQA 1BN7A 2BGKA 3REFA 3WGOA 4C43A 4KG7A 4EGJA 1OD6A 1L8XA 5HM6A 4Q4HB 4G1CA 1ZAYA 2ZJ4A 4Y9UA 3D8BA 1KYQA 3IH5A 1JDJA 2VJNA 1DDIA 3DBLA 4RLFA 4UOQA 2QSYA 4BAUA 1FUIA 4EPRA 5LDDC 2CV1A 2PSDA 1QWSA 4O59O 4GGOA 2C4NA 2IYTA 2QLFA 4IHJA 4M8LA 5CLLA 5DMHA 3BB1A 1VL5A 2FSUA 4OD0A 1DAOA 1RLUA 4M0KA 3R3WA 4QJBA 1L5GB 1B26A 1EK1A 3L4JA 2WB2A 4RVHA 3TBHA 1WSWA 3G85A 4C0SA 4DY6A 2QY9A 4EAAA 5ELLA 2RAFA 1N6PA 2BI8A 2RBEA 2FVXA 3P19A 9LDBA 2WZCA 1E7WA 1AQUA 3R9WA 4DSTA 3Q9LA 4C87A 3T5GA 2XXBA 4GLJA 1Z2OX 4XLLA 1IBRA 1YXMA 2OK8A 2GD0A 3DGFC 2BMFA 4GLOA 2I6UA 4K26A 4MVJM 4NYJQ 2XE4A 3B3GA 1M5TA 3PJGA 3WGMA 5GY7A 3I4FA 1EFVA 2JFBA 1WTAA 1HG0A 4DLRA 3N53A 4KLAA 2A86A 3ANMA 1XJWA 2J9YB 4H17A 3O0DA 4W8GA 4OYLA 4YP7A 3I5YA 2I91A 2P40A 2NMVA 1TM5E 1O4WA 1Y8CA 1GYQA 1Q15A 4J9VA 2QRMA 3QX9A 1NA5A 2XAAA 4QELA 1G64A 5AVYA 4NFHA 1Z0KA 1QAQA 2GO1A 4GZ6A 4ND3A 4UDNA 3SJBA 1K97A 3PWSA 2DPLA 5K3FA 3PC2A 2UVPB 3KETA 1KAEA 2IUFA 4M7WA 1TM1E 3UUFA 4AZ3A 3KE8A 1Q3HA 1R5BA 4FR2A 4B1FA 1L3IA 1U3DA 3AUYA 3T9DA 4RPJA 4F4JA 1ZZGA 1AQ6A 1RAFA 4A0RA 4KWIA 3M1LA 5CDSA 3DGEC 4M60A 4YAUA 2ZZKA 3GT7A 4OMCA 1KXJA 3ZEAA 4PC1A 1SB9A 5ALRA 1TYDE 1J7KA 3QLVA 1OXMA 1Y1SA 3EXIA 4PHCA 4CKEA 3LUAA 4NABA 4YUWA 3MF4A 4M0MA 1UBGA 2C2ZA 4HDSA 5C34B 3DP7A 4L8LA 5FR1A 2RK3A 3BD6A 4Z9AA 2O59A 1THGA 2OL4A 4MW1A 1W2WB 2OC9A 1J1ZA 1U7TA 2NU7A 3LUCA 2GR9A 1Z8HA 1YUBA 1ML3A 4BLVA 4QPPA 1YT5A 1DQRA 1YUMA 3KL2A 5LWQA 4YHHB 4RF2A 5TY0A 1BQ4A 4NZYA 1W8DA 4R1PA 3F4BA 4MV9A 3K70C 3URMA 3WBFA 5FBWB 4TLEA 1EFPB 4IQGA 3NNDA 3O21A 3IEVA 4BFVA 4QNNA 5ULLA 3CRRA 1A7JA 1Q1BA 1P4HA 4TZTA 1VSQA 2ZI3A 2MMGA 3L4SO 3EBLA 1G55A 4OQMA 3KZ1E 1GKUB 1MC4A 4BRSA 5I7FA 3RIEA 5A6SA 4M76B 4PGAA 4Y2VA 2FXVA 4OHVA 4CXMA 1IZ8A 3C97A 1OFUA 4IX9A 4KQWA 5FNVA 5BQOA 4IL5A 5DM0A 2FW0A 4OLJA 3BH6A 2PX3A 3CT4A 4UE6A 3WRVA 2W2MA 2P4SA 4CCYA 3H7IA 1YQ9A 3ZW8A 1QVZA 2R6HA 4EZBA 2PUAA 1KO8A 4L0DA 1E2FA 4Q7LA 2VSYA 4TS1A 2JI6A 1WOMA 3DMTA 5KNCH 4DR4B 3A3KA 4AWXA 1PQWA 2HMUA 3HBFA 4PNEA 2W37A 1Q2XA 2OA0A 3WL3A 4YDHB 3U4GA 2HA2A 2JLBA 1E9EA 4I1YA 1OI7A 5G4KB 4NYIR 4O3FA 4P8RA 3RVRA 2HU2A 3RS5A 5KKAA 5JO0A 1SBHA 2OGWA 2FYTA 1Z7WA 5K4AA 4TLBA 1H69A 2ON6A 1WR8A 2XUZA 1VYTA 5IT4A 3NP9A 1CUCA 1V8DA 3TYXA 2HPHA 4MX8A 3C8ZA 2AK3A 5KC9A 3TO5A 13PKA 1E79D 1RM3A 2HAEA 2O0KA 5CCDA 3UJPA 2KB0A 4OUKX 3RUCA 4F2WA 4IKOA 3IDAA 3TJRA 1DJOA 2WU8A 1OH7A 2ADOA 2J6BA 1JKJA 4MGYR 4YIHA 1FP4A 1MGOA 1V1JA 4CM3A 2ET6A 3A1FA 4CIAA 4YAKA 1ZPDA 3FYSA 1GGJA 2YHBA 3ZHUA 2YV4A 4QSHA 1T4CB 3OC6A 1NPTO 1Z56C 5I8WA 2EV9A 5AVKA 2O3TA 4IH4A 4XIIA 5TPZD 2XYHA 3HN2A 4P3KA 3D4IA 1QIGA 5F3RA 5LD2B 2O8NA 2C99A 4J2OA 1QGOA 4RZ2A 3BREA 4P33A 3V4ZA 4MW4A 4N54A 3RC7A 3PIDA 3PLNA 1ES9A 1YDGA 4TTRA 4R68A 3GLGA 1H2FA 4AROA 3BHJA 4XTRA 2Y2UA 4L4YA 2C8LA 5EXPA 2HK7A 4H3KB 1T5SA 2D5LA 3O8OA 1JMYA 1KMMA 2QVGA 4LV6A 1FEZA 2AN1A 1G20B 2C84A 4KC0A 3WLPA 1AZTA 4KO8A 1XXHB 5BV7A 5DBEX 3S28A 4X9XA 2KS6A 3H5AA 2BF7A 1XFAA 4LYDA 3JASB 4PHTA 3S29A 5JQGF 1LD3A 2C2OA 3REGA 1TM2A 5J58A 2C57A 1GXSA 1C9JA 1RLOA 4F86A 4H6VA 3CVXA 1KKLA 2PZEA 3I6MA 1M2KA 3H5IA 2BDTA 2XX3A 1QGED 3D8RA 1P2SA 4KAFA 1E9BA 1NQXA 4KNVA 2BR4A 1DJNA 1AGYA 1M2EA 2P9JA 4MUXA 3SC2A 1P2BA 4PGGA 3R75A 1A71A 4FZ5A 3PD0A 2ADMA 2H3HA 3GUHA 3HEAA 2IZ1A 2OQ2A 3STTA 4BFTA 2ZU0C 2DH5A 2R5NA 1KOLA 3VUEA 2PRKA 4ZI2A 4CQMB 1ZI6A 2F59A 1LZLA 2L19A 3EXAA 3FD8A 2IWHA 4HCJA 1RKQA 2I6QA 3G8DA 5COQA 1E2DA 1EM8A 3GFVA 2IYZA 2PTHA 4X6YA 3UWOA 4X62B 2BYTA 3R3UA 3JVIA 4AO7A 5HPYB 3RBAA 2D0PB 2G4CA 2P9HA 1WZUA 4EP1A 1U3FA 3QLUA 2JHPA 1PV4A 4V0SA 2PQ2A 4RZIA 1VMAA 1ZJ5A 2R44A 3JVEA 4TQGA 1W5EA 3X3HA 4EENA 1ONBA 4W9NC 5M5BA 5J59A 1NVWQ 4JELA 5BQPA 4I1VA 4OQZA 4D3YA 4D8TA 2GZHA 1GV1A 2EHJA 4XIYA 4G1VA 4MJXA 1P9NA 1CR6A 3S70A 4HNAB 2A14A 4U2DA 4YMIA 2EZTA 2RG1A 3WA7A 2CYAA 2H2IA 5HCIA 2ZTHA 2WLTA 3GG2A 1QQTA 2WTXA 1EVEA 3WFIA 2YZMA 3Q0IA 4ZZ0A 2W6NA 3O8QA 3SWWA 1NPYA 1KXZA 5CW1A 2WSLA 2ZYSA 3FGNA 4FXPA 2P91A 2RCYA 3L46A 3OQJA 3PIRA 4FTWA 4KZPA 3E18A 5EKUA 1DCMA 4HN9A 4GD3Q 3TJMA 1GTL1 2NPOA 2PA3A 4LSMA 2FWAA 1NQVA 1K86A 3A3NA 3QY9A 4QQNA 3ABIA 2ZR9A 1E9DA 3DBHB 2ODQA 2OO5A 4CIYA 1CQIA 1OV6A 1NQ5A 3R40A 3BTUA 1FF9A 1WUJS 4QULA 2WUWE 4A8PA 2WWYA 2X9GA 1X70A 3I9FA 5AI8A 2X1VA 5HR5A 2NXEA 2WU0A 3DVQX 1WXHA 2B69A 3DMGA 4FD2A 3RVKA 3VM6A 3EF1A 2JLSA 3T9AA 2RHDA 2PXCA 3AUFA 4K9LA 4I4CA 4Q3CA 4DGQA 2PJRA 1MDFA 5B6JA 2J59A 2OHHA 3GU3A 3NBUA 1VC2A 5DN9A 4D0LB 3MTGA 2WD8A 4N9WA 3RANA 1J4AA 3V6MA 1EFLA 1RYBA 4LF7B 4NMMA 1ZY2A 1WB5A 4AUEA 2X86A 3DR5A 3BMCB 3L8YA 4JVNA 3USZA 3CLHA 1JFFA 3BRSA 5FV7A 1E3IA 1L8LA 3PQFA 4J4HA 4HXYA 4CV0A 2FU5C 2X2PA 4G0VA 2ZSFA 4L5BA 2AVNA 2DM6A 2M1XA 3K5HA 1O94D 1UFVA 1XK6A 4A6XA 2NNWB 3LTNC 1SUCA 3VHRA 4C3VA 2K7FA 2ZUWA 3T1YB 4MKGA 1SHKA 1HUQA 3T3OA 3U7JA 2RIRA 3D1VA 3IELA 1SM4A 4ZC8A 1H8HA 3WMXA 1OGIA 3ZTTA 4BO6A 4OXYA 4AFNA 4FYKA 4ZQGA 1YV9A 1M0EA 2UVQA 4IHQA 2ZUFA 4EA8A 3U19A 5IM4F 2I2BA 3N75A 4MA0A 5BPFA 2CFSA 4G0PA 4HQ6A 4Z9XA 1GUDA 4Z86A 4YRFA 2BEUB 5F1KA 2ZUCA 1LK7A 2D7DA 1HK7A 1A8QA 3FW1A 1J7JA 2K4MA 1ONNA 1KVRA 2BBWA 4GOJA 5CT6A 1PT7A 4WGFA 2ZWIA 3DF7A 4LY0A 4BNWA 4IXNA 4JJ6A 1AN9A 1CS0A 4N5LA 2RE8A 1TOAA 2C3UA 4B73A 1DE0A 1L5NA 4X8OA 3ZBQA 1PX0A 5F2OA 2HBQA 3UJAA 3AHJA 1Z4KA 4GP6A 2GPWA 2YWRA 2B4TO 1UC4B 5IAGA 1FVOA 4PCVA 2QPOA 2QPTA 1Z13A 3CNEA 3PL5A 2GTPA 1WJGA 1L6RA 2FGJA 2VF2A 3D59A 4XSGA 2J5XA 1ZD3A 1WUKS 2W58A 4QE3A 3X0DA 5CXQA 1E5VA 3K0CC 3WAGA 3ENWA 1OB2A 1HDRA 2OCGA 1XP5A 2CHVA 1SRQA 1T2AA 3A6JA 3Q3GE 1Q1EA 3IT3A 4P58A 4C01A 2V7BA 1YL5A 3QJ5A 4QUGA 2VCEA 1CR2A 1E94E 3UWMA 3K7EA 5IVHA 1W19A 2XY4A 4PHHA 2XH8A 1OXKB 1TF5A 2WR8A 4MYHA 4N5NA 4HPJB 3ZGZA 3H3JA 2D2XA 1DDOA 1LLFA 1UFQA 5AH0A 3A1UA 4CFYA 4CIVA 2FWJA 1CETA 3KAJA 1B8NA 5KKCA 1DKLA 3ECCA 1OBFO 3GGJA 4HNHA 1R50A 4LYAA 3TE7A 4DAEA 2FFJA 2DECA 5KSPA 4Q4JA 4EPWA 3FPBA 4AY2A 5JLAA 4BZWA 1QAMA 1GL7A 1E5QA 3NM4A 3PNMA 5A4AA 2BFFB 4AP9A 4D81A 5C31A 5KJ1A 4YBZA 3PYXA 4JUCA 4DSAA 4PLZA 2J3DA 2XT0A 4WASA 3I4CA 5TVGA 1LEHA 2Y1XA 3DZCA 2VT6A 1W44A 2OCYC 5J43A 4I5FA 4W8OA 2QMQA 1PT5A 4JZKA 5H81A 5HYVA 2IP4A 3NH6A 2I29A 4TV9A 4WBNA 4DB2A 4QGFA 2JBWA 4HWGA 1HSZA 1HDYA 2COEA 2GPSA 4ENRA 3A4TA 5C37A 3ASVA 5BSRA 4L57A 4B34A 4D6YA 2EW1A 4I5DA 4KIUA 4XX1A 4IXWA 4AMBA 5AW7A 4XASA 1HT0A 1OX4B 1NHWA 1QH1A 3E9MA 4NONA 4N4AA 4P83A 3TMAA 3K1AB 3BYZA 3T5AA 2YMMA 2JGNA 3CPJB 3UV7A 3HYNA 5HUHA 2P2NA 1UQRA 1SIWA 2OM6A 5TQ0A 4ZCIA 4K9OA 1K7YA 4C2UA 2YNMC 4HDRB 3ROMA 2EG5A 2BGJA 1TU3A 3ECSA 2DU8A 2J4DA 3PUHA 2POCA 1OFIA 3G59A 4JYZA 2XJ9A 5LLSA 1NNLA 5IS2A 3ZH9B 2YWHA 5DK6A 2UYOA 2EZUA 3M1YA 3TI9A 2H07A 2QRJA 2LW7A 3ONNA 2XUIA 2BE7A 5C1IA 5KOJB 1QLJA 3AEQB 4PYNA 4BOYA 1JWBB 4GNRA 3R7SA 3NFYA 1E0DA 2PCJA 4G0XA 3PC7A 4K6FA 5TGTA 5CBPB 2O8FB 4KPGA 3RVOA 1ZX1A 2BEVA 2W70A 4RY9A 4M7RA 2HSEA 1T36B 3BRWA 2VF7A 4X1KB 4C88A 1M1YE 2ZI7A 4EG3A 3WMFA 4TKLA 1L5RA 3KQTA 1PGQA 2FE1A 3GLHB 3NONA 3GEPA 4LDQA 4MITA 5GGYA 3AILA 1X7GA 4YRPA 3T1TA 2YJNA 3CWZA 3SBXA 4E03A 1E9RA 5I51A 1KQ3A 2QUJA 4C20A 1P7PA 5JWOA 4CKWB 3L0CA 3ID6C 3M9LA 4IM7A 1PWYE 3ANLA 2W6QA 3GJRA 3HUUA 4G0MA 3WYNA 3C70A 421PA 3DHWC 3PXCX 2QVCA 1Z4QA 1TZJA 3CZQA 4DDUA 4BU0A 3RGGA 2VSFA 1JTFA 2IYQA 1DTWB 4U4AA 1VIAA 1NJ8A 1FP6A 1XL0A 4KIWA 1MA0A 3RU9A 4KP7A 3DOHA 1PWHA 5CDFE 4RGVA 4GBMA 4DR1B 3S2GA 1G2QA 3B1VA 1TT7A 2ORYA 2YIJA 3KR1A 3DAGA 2YS7A 4GPBA 5I7OA 2CNLA 1PL0A 1MJ5A 1XZCA 2ZG6A 2A9QA 3CX4A 1RYMA 4FW8A 2XVMA 1FFSA 3PNYA 4KUHA 3RSFA 4PWZA 3WYEA 2PGNA 4DKXA 4W5NA 3RTEA 1LNQA 2Z30A 2ZR7A 4XUEA 5C2JB 3ISJA 3MCVA 4UU8A 1ORWA 1U0FA 2G06A 3AFGA 4ZVKA 1Q0TA 3IJ5A 5LL6P 2AV6A 4HNGA 3E84A 4MZDA 3SJUA 1GZVA 2HUNA 3IHLA 3DOEA 3KL4A 2QAJA 1QOZA 3IP5A 4HS9A 5KNBD 4R98A 1G0OA 2IHUA 3CO5A 2ZWVA 2J3JA 3RJMA 4JJ8A 1E2EA 4QM6A 3MS7A 2PH5A 3WTBA 3BJEA 3W7VA 5CG2A 4AMVA 1WS6A 2D0DA 1E3SA 2FW8A 1R6BX 1TZMA 1ZXLA 1D4OA 3IP6A 4PG7A 2A0WA 2CHUA 1AMNA 3H9BA 1YRQA 4P1ZA 3NHBA 3P27A 3AHHA 2ZYRA 4CE6A 2ZB2A 3KD3A 1X15A 1B41A 3DJYA 1GTG1 4MI1A 5IDXA 5T64A 3ROZA 2VNHA 2IGBA 3GH1A 1Z0IA 4NZOA 1NRWA 5AI0A 3USCS 4RCVA 1QQ6A 2ZTUA 1AY0A 3JPWA 2PDAA 3CNBA 1A9YA 1FUEA 2X6RA 1U1EA 4H7PA 4ONEA 3EXHA 3GAFA 3MVEA 4MI9A 1QRRA 2YL2A 4W5JA 3RRZA 1UFRA 1EGMB 3QEKA 2QQEA 4Q4AA 5ERGB 4HNVA 1YZYA 3RAFC 3RIXA 1ZGHA 1CDEA 4GG1A 3LRXA 2J0VA 4S35A 4PICA 4UXJA 4YJ2A 1QHHB 1I2MA 2QRQA 1QYXA 1JLSA 3C48A 2HF7A 1W36C 2I6FA 1QV9A 3PC8C 1VSTA 3PNSA 1KS2A 4H4CA 1BEZA 2IFTA 2OCIA 4MWZA 5DN6A 1GG8A 4EGSA 5HX7A 3KB8A 4X65B 2H18A 3IURA 2VKQA 3QU5A 5DNAA 1BCSA 4EH1A 3HN7A 3KPWA 3PPVA 4TL7A 5IDWA 2QVLA 1G1MA 2R8YA 3CIFA 5ALJA 3I42A 2YJZA 1E1YA 5JJIA 3L0SA 3MS2A 2P69A 3CEPB 1WDTA 2K6GA 4L72A 3HJGA 3IAS6 4HQ0A 3ZHBA 3F8SA 4RHCA 1B2RA 1QORA 3C1TA 5DVZA 5IFKA 1DWUA 5AVQA 7ADHA 2WWIA 3OT1A 2I7VA 3HDJA 3OO0A 4PRLA 4E5DA 3TECE 2GEUA 2D8MA 3DONA 1R0XA 2GPJA 3VZQA 4M53A 1IXKA 3MT8A 1WV1A 2FFBA 1EVKA 1NW8A 1KGDA 2PN1A 3H04A 3QTBA 4FCVA 4I4TA 1TVKB 4I50A 4RLHA 3AZOA 3O75A 4FD3A 3PU6A 4N7MA 4IIHA 3H19A 1E7RA 3IGFA 1Q0HA 3JAKB 3JQCA 3LYAA 3MTJA 3SF8B 2ZYHA 3MWDA 3VPCA 1EK5A 3OUUA 3RUIA 5FT9A 4B33A 3ZK7A 4YV1A 3PKIA 1T26A 4OTZA 5JAOA 4Y3UA 1UJCA 2H1SA 4FGSA 5F4BA 4EJSA 4EHJA 1LWOA 4X90A 4UD2A 4LYGA 4B0PA 4K6HA 4N8DA 9ATCA 3EVEA 1NVMB 1YJBA 5AVUA 5KVAA 2NXCA 1T35A 3EZFA 3NBFA 4NZPA 3KSAC 2VTKA 1SCQA 1R0KA 4EARA 3KUDA 2QUHA 1M8GA 1DG9A 2B1JA 4EWLA 3T7EA 3O3CA 5E0OA 1S2GA 2VH2A 1Z6PA 1ARZA 3X1DA 4AC9A 1ZUIA 4MW0A 3K6JA 5C1PA 1QYDA 4PQEA 4RA9A 2WICA 3N6VA 4JLPA 1YH3A 2B98A 3ROPA 2ZR0A 3V8VA 4I66A 1EUDB 3C6MA 2HL6A 1VLVA 3MWYW 5EIWA 2EX4A 3KR9A 3EYWA 4BNJA 1EFVB 4EKIA 5BURA 5AP9A 1YB4A 3KJEA 2D7CA 1QTQA 2HIMA 3S1LA 3ETGA 2JA1A 3R8CA 1GNLA 2IUUA 2ENWA 2WV7A 1UPFA 1L7RA 2BMEA 1E6MA 2O2SA 3CSSA 5TPWB 3D6AA 5FV4A 3RC2A 1UXGA 1P5HA 1XJQA 5I47A 1YJAA 3IO5A 2GHIA 4EIWA 4Q9LA 4AF8A 1QMPA 1IVNA 1ZH6A 2J7PA 3QPCA 1RRFA 3R20A 1P45A 4B4OA 3KX2A 3GPLA 5HJ2A 4D4LA 5DNYB 5ALXA 3PJFA 1KOFA 1JHMA 2H48A 4OI2A 1V95A 3SBEA 3PDIA 3MUOA 1ZOOA 1W76A 3BFPA 3VXKA 4BQSA 1P1RA 1GTSA 3G6WA 2IC5A 2NO1A 1ADCA 3BZUA 4JWTA 1LVHA 2HK9A 2KQUA 4RZSA 5FTKA 2W2XA 4IJQA 4R1UA 4BQRA 4FYYA 3Q3IA 4DL9A 3W5JA 3IYLW 3V46A 1A9QA 1G5IA 2AW3A 3FTNA 4ZCLA 4OKIA 4DNFA 2Q2OA 4GW3A 2LUOA 3NOXA 2A84A 2WVJA 4YLYA 3Q5DA 1IIRA 2O2EA 2WMDA 2NU7B 2D1SA 5L3VA 1SVWA 5KC8A 3EDMA 3CCBA 2C2HA 2QW8A 4QNMA 3VNQA 5CAEB 4YWHA 2GZDA 4BNDA 4D9GA 1QRUA 3F5SA 5LP6A 3HSKA 4E6EA 3OZUA 1V5FA 4NP6A 4ODIA 3BXHA 2E1PA 5BSGA 3MG9A 2LTAA 3VYRB 1ISRA 5P21A 2BJHA 3D4OA 1ZD8A 1Q17A 1UBJS 1KOJA 2CLKB 3F4KA 1AHNA 4BVLA 1NJFA 2JGMA 5EINA 2H5IA 1GV0A 4RK6A 4EKEA 3V8PA 5FNVB 5LJIA 1EVIA 4LBVA 3SYLA 5E9AA 3ZWYA 3TL2A 3I2IA 4CCYB 2I2DA 4KN5A 4OHRA 1B73A 3GNQA 2J3MA 1ISGA 3SF0A 1IRIA 1ORRA 4EB6A 5BW5A 2MJLA 1OH8A 4W6ZA 2QZPA 5IZ4A 2LDXA 4NG5A 4PC7A 4ESHA 3TG2A 3VR2A 3LIPA 3M81A 3GJ4A 3LC7O 4LF9B 4JYMA 5GQSA 4RSMA 1RMQA 2CJFA 2IKQA 3ML1A 4AG5A 3MQFA 2DKNA 2RHCA 4EHDA 3CLRD 1IVSA 4HAZA 1ID1A 2FHSA 3ESBA 1RE1A 4G0ZA 3WNZA 5L4NA 4BLPA 5CFRA 2OHFA 4DLTA 1ZONA 2FOXA 5BT8A 1C30A 3VZBA 4FNAA 3H4IA 1XAHA 4QT4A 4MVCA 4U39A 1TK2A