1A8AA

Rat annexin v complexed with glycerophosphoserine
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
318
structure length
318
Chain Sequence
ALRGTVTDFSGFDGRADAEVLRKAMKGLGTDEDSILNLLTARSNAQRQQIAEEFKTLFGRDLVNDMKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELRAIKQAYEEEYGSNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEKFITILGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLENLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVIVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGGEDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANNEXIN V
publication title Ca(2+)-bridging mechanism and phospholipid head group recognition in the membrane-binding protein annexin V.
pubmed doi rcsb
molecule tags Phospholipid analog
total genus 130
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00191 Annexin Annexin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1a8aA02
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1a8aA04
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1a8aA01
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1a8aA03
2H0LA 1AEIA 1HAKA 2IE7A 2HYUA 2RANA 4MDUA 1A8AA 1ALAA 1HVEA 1N42A 4X9PA 1N41A 1MCXA 1HM6A 2HYWA 1YCNA 2HYVA 1AOWA 2II2A 2Q4CA 1AVRA 4HREA 1AVCA 1AIIA 1YJ0A 1DM5A 1BCWA 1G5NA 1I4AA 2XO2A 1DK5A 1BC1A 1N44A 1W3WA 2H0KA 1AXNA 2ZHIA 1BCYA 2XO3A 1N00A 1HVGA 4EVHA 4EVFA 2ZOCA 1ANNA 1SAVA 1BC0A 1XJLA 1YIIA 2H0MA 2IICA 1BO9A 3BRXA 4MDVA 1AVHA 1M9IA 1HVFA 1ANXA 1HVDA 1W7BA 1W45A 1ANWA 2IE6A 1A8BA 2ZHJA 1BCZA 1BC3A
chains in the Genus database with same CATH superfamily
1BC9A 2R09A 4D7RA 1N42A 1HM6A 1YCNA 1AVRA 1AIIA 1R8ME 1BCWA 1I4AA 4KMUX 1BC1A 4JXHA 2ZHIA 4EVHA 1SAVA 2IICA 1XJLA 2H0MA 4D7QA 1M9IA 3USYA 4FHRB 1A8BA 1LKVX 1AEIA 3HJLA 4JWLA 1C1KA 1N41A 1MCXA 2K6XA 4EVFA 4FQ0C 4HREA 1AVCA 2VXGA 4A4PA 1DK5A 3AO0A 4C0AA 3USWA 4L5MA 1QC7A 1YIIA 4C7PA 1YGMA 3ABSA 3BRXA 1AVHA 1HVFA 1ANXA 1W7BA 2IE6A 1W45A 1ANWA 3AJCA 4Q2SA 4Z21A 1BC3A 4MDUA 1A8AA 1HVEA 3TW5A 4OIYA 1YJ0A 1DM5A 1G5NA 2XO2A 2QEZA 1UPTB 2H0KA 1R4AE 3ANYA 3LTLA 1N00A 1HVGA 1ANNA 3L8NA 1XSZA 1HVDA 1S9DE 3SOHB 1R8SE 1BCZA 1R8QE 2H0LA 2HSNA 2IE7A 2HYUA 2RANA 1ALAA 3ABOA 4X9PA 2II2A 1KU1A 2HYWA 2HYVA 2Q4CA 1AOWA 4JMIA 1PBVA 4KN4X 3ABQA 4JK1X 1N44A 1W3WA 1AXNA 1BCYA 1XT0B 2XO3A 3SWVA 1Q8DA 2ZOCA 1BC0A 1BO9A 4JMOA 4KN7X 2OY9A 4MDVA 2R0DA 1RE0B 3ABRA 2ZHJA 1HAKA
chains in the Genus database with same CATH topology
2H0LA 1AEIA 1HAKA 2IE7A 2HYUA 2RANA 4MDUA 1A8AA 1ALAA 1HVEA 1N42A 4X9PA 1N41A 1MCXA 1HM6A 2HYWA 1YCNA 2HYVA 1AOWA 2II2A 2Q4CA 1AVRA 4HREA 1AVCA 1AIIA 1YJ0A 1DM5A 1BCWA 1G5NA 1I4AA 2XO2A 1DK5A 1BC1A 1N44A 1W3WA 2H0KA 1AXNA 2ZHIA 1BCYA 2XO3A 1N00A 1HVGA 4EVHA 4EVFA 2ZOCA 1ANNA 1SAVA 1BC0A 1XJLA 1YIIA 2H0MA 2IICA 1BO9A 3BRXA 4MDVA 1AVHA 1M9IA 1HVFA 1ANXA 1HVDA 1W7BA 1W45A 1ANWA 2IE6A 1A8BA 2ZHJA 1BCZA 1BC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H0L A;  1AEI A;  1HAK A;  2IE7 A;  2HYU A;  2RAN A;  4MDU A;  1A8A A;  1ALA A;  1HVE A;  1N42 A;  4X9P A;  1N41 A;  1MCX A;  1HM6 A;  2HYW A;  1YCN A;  2HYV A;  1AOW A;  2II2 A;  2Q4C A;  1AVR A;  4HRE A;  1AVC A;  1AII A;  1YJ0 A;  1DM5 A;  1BCW A;  1G5N A;  1I4A A;  2XO2 A;  1DK5 A;  1BC1 A;  1N44 A;  1W3W A;  2H0K A;  1AXN A;  2ZHI A;  1BCY A;  2XO3 A;  1N00 A;  1HVG A;  4EVH A;  4EVF A;  2ZOC A;  1ANN A;  1SAV A;  1BC0 A;  1XJL A;  1YII A;  2H0M A;  2IIC A;  1BO9 A;  3BRX A;  4MDV A;  1AVH A;  1M9I A;  1HVF A;  1ANX A;  1HVD A;  1W7B A;  1W45 A;  1ANW A;  2IE6 A;  1A8B A;  2ZHJ A;  1BCZ A;  1BC3 A; 
#chains in the Genus database with same CATH topology
 1BC9 A;  2R09 A;  4D7R A;  1N42 A;  1HM6 A;  1YCN A;  1AVR A;  1AII A;  1R8M E;  1BCW A;  1I4A A;  4KMU X;  1BC1 A;  4JXH A;  2ZHI A;  4EVH A;  1SAV A;  2IIC A;  1XJL A;  2H0M A;  4D7Q A;  1M9I A;  3USY A;  4FHR B;  1A8B A;  1LKV X;  1AEI A;  3HJL A;  4JWL A;  1C1K A;  1N41 A;  1MCX A;  2K6X A;  4EVF A;  4FQ0 C;  4HRE A;  1AVC A;  2VXG A;  4A4P A;  1DK5 A;  3AO0 A;  4C0A A;  3USW A;  4L5M A;  1QC7 A;  1YII A;  4C7P A;  1YGM A;  3ABS A;  3BRX A;  1AVH A;  1HVF A;  1ANX A;  1W7B A;  2IE6 A;  1W45 A;  1ANW A;  3AJC A;  4Q2S A;  4Z21 A;  1BC3 A;  4MDU A;  1A8A A;  1HVE A;  3TW5 A;  4OIY A;  1YJ0 A;  1DM5 A;  1G5N A;  2XO2 A;  2QEZ A;  1UPT B;  2H0K A;  1R4A E;  3ANY A;  3LTL A;  1N00 A;  1HVG A;  1ANN A;  3L8N A;  1XSZ A;  1HVD A;  1S9D E;  3SOH B;  1R8S E;  1BCZ A;  1R8Q E;  2H0L A;  2HSN A;  2IE7 A;  2HYU A;  2RAN A;  1ALA A;  3ABO A;  4X9P A;  2II2 A;  1KU1 A;  2HYW A;  2HYV A;  2Q4C A;  1AOW A;  4JMI A;  1PBV A;  4KN4 X;  3ABQ A;  4JK1 X;  1N44 A;  1W3W A;  1AXN A;  1BCY A;  1XT0 B;  2XO3 A;  3SWV A;  1Q8D A;  2ZOC A;  1BC0 A;  1BO9 A;  4JMO A;  4KN7 X;  2OY9 A;  4MDV A;  2R0D A;  1RE0 B;  3ABR A;  2ZHJ A;  1HAK A; 
#chains in the Genus database with same CATH homology
 2H0L A;  1AEI A;  1HAK A;  2IE7 A;  2HYU A;  2RAN A;  4MDU A;  1A8A A;  1ALA A;  1HVE A;  1N42 A;  4X9P A;  1N41 A;  1MCX A;  1HM6 A;  2HYW A;  1YCN A;  2HYV A;  1AOW A;  2II2 A;  2Q4C A;  1AVR A;  4HRE A;  1AVC A;  1AII A;  1YJ0 A;  1DM5 A;  1BCW A;  1G5N A;  1I4A A;  2XO2 A;  1DK5 A;  1BC1 A;  1N44 A;  1W3W A;  2H0K A;  1AXN A;  2ZHI A;  1BCY A;  2XO3 A;  1N00 A;  1HVG A;  4EVH A;  4EVF A;  2ZOC A;  1ANN A;  1SAV A;  1BC0 A;  1XJL A;  1YII A;  2H0M A;  2IIC A;  1BO9 A;  3BRX A;  4MDV A;  1AVH A;  1M9I A;  1HVF A;  1ANX A;  1HVD A;  1W7B A;  1W45 A;  1ANW A;  2IE6 A;  1A8B A;  2ZHJ A;  1BCZ A;  1BC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...