1A8FA

Human serum transferrin, recombinant n-terminal lobe
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
Knots found
sequence length
329
structure length
329
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two high-resolution crystal structures of the recombinant N-lobe of human transferrin reveal a structural change implicated in iron release.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Iron transport
molecule keywords SERUM TRANSFERRIN
total genus 107
structure length 329
sequence length 329
other databases KnotProt 2.0: K
ec nomenclature
pdb deposition date 1998-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1a8fA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1a8fA02
3TDJA 3BFUA 3HV1A 4ELRA 1D9VA 4KYSA 3VVDA 1MPCA 2QL3A 3I6VA 5JEIA 4EXKA 2V84A 3HSTA 1UIUA 1NNKA 3A3CA 3MVYA 3TPAA 2GHAA 1MQDA 3T9XB 1B5HA 3LUYA 5F1QA 3S9MC 1J1NA 3KN8A 2PT1A 3G3JA 5TPAA 1N3WA 2D5WA 2I58A 4YICA 1GVCA 1B3HA 2NUVA 4KR5A 3IB2A 2VOZA 2XX7A 4BDNA 4JBZA 3C32A 3FUZA 1LCTA 3H3GA 3W15C 1O64A 5I59A 1SI1A 3IB0A 4F31B 1DTGA 4JSOA 1YCJA 3L6HA 4UACA 1GGGA 3IL1B 3I5OA 3G3GA 2PT2A 4X1DA 3U72A 4EF1A 1Y20A 3KN7A 4KYEA 3VLWA 1PB8A 1P1UA 2DWAA 3QK6A 4LONB 4NF8A 5ITPA 2Y7PA 3KFMA 4K3FA 2RF1A 4F2OA 1MH4A 2V3TA 4X9TA 4ZEFA 4TLMB 3T96B 1IXGA 4OMBA 3IOTA 3H7MA 1L5TA 4DDDA 3CSGA 3FIRA 3PMWA 4IO2A 3A09A 1BLFA 4OFJA 1IXIA 2V3UA 4H8JA 4R2BA 1B7UA 2O69A 3OEMA 3Q27A 1PBPA 1XS5A 4KPTA 4OHNA 5H8NB 3MBPA 4ZEIA 3CG3A 1SW5A 3O29A 2F6GA 5AA2A 4O3CA 2P2AA 3KJ7A 3MP8A 3OSRA 3TCHA 4YMBA 3E4RA 1MM7A 1Y3PA 2V93A 2VHAA 4F22A 1ZKBA 4YAHX 2X7PA 5H8QB 3G3IA 1SDXA 3LBSA 1POY1 5B7DA 1B9JA 1TWYA 4LVQA 3U1OA 4P0IA 4YKPA 4QFPA 1MY1A 3K6XA 4ESWA 5I59B 3FASA 4NF6B 3U92A 3UN6A 5KCJB 4QF9A 4OFLA 1SW1A 2PYYA 1B46A 2G93A 4LATA 2UYEA 4WXJA 2HZKA 1MY4A 2ZYKA 5DVJA 5HM4B 4H5FA 3RT8A 3ZS6A 3B6TA 1O7TA 1JQFA 3K0VA 3MJNA 3ECRA 3OEKA 3OOAA 1A8EA 2Q89A 1B5JA 2PX1A 4AB6A 3TYHA 2ZMBA 1Y4TA 1Y1MA 1SVXB 1QUJA 2AIXA 2GRVA 1QKBA 3CVGA 4RK9A 5K2XA 1LCFA 1MXXA 2GHBA 4C1TA 3MW0A 1I6QA 2Z8DA 2QSXA 1VFDA 2DXYA 2RKMA 2HXWA 3C33A 3OO9A 5EYFA 1FCKA 1EU8A 2B3FA 2DOJA 1B52A 2P1SA 2D3IA 3VLUA 1Z7NE 2DWHA 4JDFA 2B65A 4G68C 1JVXA 3RNNA 3EHSA 4AQ4A 1IEJA 4ISUA 2QS3A 3DELB 4O3AA 2XD3A 1HSLA 5I2KA 1N04A 1Q35A 2IA4A 2O7IA 4OZ9A 4EDPA 1UTBB 1UTHA 3IR1A 1Y4CA 3PUVE 4NEDA 3VE1B 1LFGA 2F97A 3MC2A 3MPKA 1M5CA 2PVUA 4NF4A 2UVIA 3HPIA 5AA2D 5AE4A 2QMXA 2FA7A 4G77A 2O1LA 3O97A 1BP5A 3MP6A 5I58B 4JB7A 1LAXA 4N13A 1YAEA 5HBCA 3RLFE 4G68A 4F1VA 2YPNA 2VP1A 4OERA 2ZYOA 2Y7RA 3K1PA 4DE8A 1YTVA 2R9JA 1ANFA 1CB6A 1MY3A 3B7DA 3FATA 2VD3A 5I2KB 3CFXA 2OZZA 2O7UA 3PMVA 1SYHA 3T9HB 3ZKLA 1SD3A 4GLIA 4ELOA 4PE5B 3LSXA 3IB1A 2Y7WA 3DP4A 4ZS9A 3PPQA 2HQ0A 4JXIA 1B05A 4KD5A 1QKAA 2I49A 2QMWA 3HO7A 5H8FA 1I6AA 1BIYA 1MXUA 2O84X 4N07A 1B7ZA 1B6HA 4QRZA 5I57A 3KSJA 3PPOA 1D4NA 2RCBA 4XIGQ 1LBBA 1N3XA 2ABHA 3KGCA 3SEYA 1P1QA 3DM0A 4ELQA 4F2QA 4YB6A 1NH8A 4PFYA 4YKJA 2RC9A 2YLNA 2RINA 3HN0A 3K6UA 4QFLA 5AA3A 1FTLA 3VFJA 1MQHA 4JWXA 5H8QA 4KYDA 5H8NA 1UQWA 1N0TA 4FIMA 1PB7A 4H65A 4RPOA 3Q28A 5TPAB 1EZOA 3TCFA 5CBRA 1OVTA 3QIMA 4MLVA 4ELPA 2QPQA 2NXOA 2F7AA 2XX8A 2XXUA 3S9NC 1A99A 3V89B 2I0CA 3CR9A 1FTMA 4LP2B 3K01A 3MAMA 4NE4A 4YZZA 1ATGA 3TTNA 5IAIA 3ILUB 4MBPA 2O51A 4GD5A 3VXCA 1NNFA 2ZNSA 4IO6A 1WVJA 1PBQA 4DXCA 3QYTA 4NF6A 4NF8B 4WEDA 3RT6B 5CMMA 3H03A 3SKPA 3RY3A 3TAJA 1OQHA 4XKPA 5DTBA 4YB7A 3O66A 4XKRA 4DCXA 3L6GA 4OENA 2ONSA 4LZ7A 1SQYA 1A55A 2RC7A 3Q25A 3FJMA 1TFAA 1H44A 5FTHA 5ISUA 5L9SA 2OK2A 3C34A 5DVIA 4YB5A 5AA1A 5CC2A 5HPQA 3DLNA 2DS9A 4PETA 3FVOA 4WKMA 1B0HA 1XOCA 3JV9A 4OVJA 4X1BA 3T93B 1US5A 3D4GA 1A54A 2XXVA 2XXPA 3PUWE 1BKAA 2XXHA 3CSBA 1P1OA 1LGBC 2AL5A 3M3FA 1F9BA 1MXYA 4NMYA 3MVWA 3PV0E 1IZ1A 4BDLA 3PPPA 2DE3A 3V83A 3R26A 2Z8EA 4JWOA 1LB8A 1ZBMA 4QSCA 3V5AA 2WKYA 1P1NA 1LSTA 5B70A 3G3HA 3TQLA 3IAZA 4DIGA 1UTBA 1UTHB 2F34A 4OYVA 4XKNA 4GFRA 3U8QA 4F3BA 1NMUA 2F7BA 4DCYA 1M5DA 1AL3A 4R75A 3ILTB 4THIA 1URGA 1YPNA 3TFLA 2ZYNA 3PMXA 1FQFA 3GLBA 3IX1A 4RNSA 1NH7A 3UGWA 3S9LC 1H45A 3FXRA 3IK6B 1VR5A 3IO4A 1ELJA 3GBAA 1FQDA 5F7VA 2RC8A 3MQ9A 5FHNA 4QHQA 2F5XA 2R6GE 3TTLA 2ZYMA 3OO6A 1II5A 4FEDA 4WEPA 5ITOA 1P1WA 2ZNTA 5DEXA 1NNTA 4R74A 1R1NA 4GL0A 3PPNA 2Y7KA 3E3KA 1JW4A 4QSEA 1LAGE 1OVBA 2UVJA 4FE8A 5AA4A 5I2NA 1H43A 3RUMA 4F3SA 1LBCA 1FQBA 1Y9UA 1FQAA 1XT8A 4FATA 4M1VA 1MQJA 4IO7A 3KJTA 1SW4A 1DPEA 2A5SA 2Q2CA 4OESA 1FQEA 3VVEA 2LAOA 4F1UA 3K1NA 1EZPA 1IXHA 5DEXB 1XC1A 1D9YA 1FTJA 1XHYA 1B4HA 2I3VA 3GZGA 4G8HA 4U1ZA 1XVXA 4IO5A 3T66A 3CI8A 3U94A 2DWIA 1QJMA 1B58A 1ZLQA 4RPNA 1Y3QA 3U93A 2DVCA 3N6TA 1B7HA 3FV2A 5TP9B 1JEUA 2PMSA 4ZEDA 3QSLA 3SDFA 2I4CA 1MXWA 1NKXA 2M8CA 1I6BA 1MQGA 2F8DA 2I0BA 4N6PA 3K4UA 1H3DA 2RCAA 1OQGA 3PU5A 2NWJA 5JTYA 3O2AA 4U21A 4BDQA 4F3GA 2QJEA 1USYE 2DE4A 3IORA 4R72A 3OD7A 3OO7A 3RTFB 3V8XB 3S4UA 4DZ1A 5A5XA 1KWHA 5KDTB 2PBWA 3E13X 1MH3A 4ZE8A 4E0WA 5H8FB 3OENA 2ZXTA 4DLDA 5TP9A 3ZSFA 2UVHA 3ONMA 3A3UA 3O6GA 3KEIA 4MFIA 2GFEA 2NVUB 1GV8A 3W9VA 3IOWA 4ZZAA 4R6YA 4G4PA 1US4A 2F78A 3MZ9A 2IEEA 1T0KA 3TKDA 2DE2A 4ZEKA 1URDA 3DP6A 2GH9A 2CZLA 1B0LA 3TODA 3KSXA 3Q26A 5KDTA 4MH5A 1S9TA 4QSDA 3SERA 3VVFA 2XXQA 4H67A 5DT6A 1LAHE 3MZBA 1Y1ZA 4GL8A 4IY6A 4POWA 3TQWA 2F6PA 4ZDMA 5I56B 1IUDA 3MZ1A 3QAXA 1WDNA 4BLAA 1MRPA 3FV1A 1I69A 2VGQA 2ONRA 1IXCA 4XTCQ 1SW2A 4GXAA 4KI0E 4H5GA 2Y7IA 3THIA 3CG1A 4R9GA 2DXRA 2XHDA 4OXVA 3SEXA 1M5FA 1IITA 4U4SA 5ICTA 2O68A 2FYIA 4HTGA 2I6EA 3EN3A 4OEUA 5K2YA 3B6WA 4EUOA 2O1MA 1QULA 4Z0IA 3Q29A 4IB2A 1LB9A 5CMCA 2E0SA 2Q8JA 4TLLB 1N7WA 3T22A 3EF7A 4E0XA 2UYFA 4QFNA 3TUSA 1IIWA 1GR2A 4HCYA 3PD9A 4LQ2A 2QRYA 2H9BA 3HHFA 4U23A 1S7YA 3MVXA 1FTOA 1UIVA 3KOSA 4C0RA 3IOUA 4JWYA 1PEBA 1JEVA 4O3BA 3G3KA 3PUXE 4DXUA 4ZECA 2YJPA 4U22A 1B3GA 4BDRA 3FD3A 3M3LA 4PFTA 4EF2A 4F3PA 1AOVA 1HSEA 4OQOA 2ZNUA 1PDAA 1MXVA 4OTEA 1VSOA 3I3VA 4KCDA 3VLVA 1PB9A 3VV5A 3IO6A 1EH3A 1FQCA 2QS2A 3H06B 3PD8A 3N5LA 4R9FA 4XXUA 3SEVA 2HCAA 3QXMA 1MS7A 3O9PA 4POXA 2B3BA 5CRYA 5TU0A 3RPWA 4MLQA 3C35A 3H6UA 2Q2AA 3S9EA 4FAJA 1OLAA 3KN3A 1RYOA 1MM6A 1O63A 1WODA 3LSLA 4ECFA 1N76A 4U1OA 5DVFA 4Q8RA 1QVSA 1QW0A 3CFLA 1N84A 3R7XA 3UIFA 1RYXA 3RGYA 3GBBA 4F18A 1B51A 2F7CA 3QUJA 2XX9A 3K00A 5A5XB 4F1YA 2REJA 3BKIB 2OJTA 5FTIA 3QUFA 4KFQA 3VXBA 4L17A 2Y84A 3AXFA 3FXUA 1BTJA 1MPBA 1RKMA 2V25A 3OXNA 4JSDA 3OMBA 2XXYA 4GVOA 4P0GA 5L8DA 4F19A 2BJJX 2I48A 2R71A 3USDA 3M3KA 2I3WA 2NOOA 3JZJA 3BFTA 4ONYA 4HCWA 4I9DA 4IO3A 1QUKA 4H1XA 4ZE9A 1LAFE 1TFDA 2Q9TA 1DTZA 3K02A 5LOMA 2REGA 5I84A 4EQBA 3CRBA 3FJGA 4NF5B 4H0WA 2F36A 4LZ5A 4EQ7A 4IY5A 5FHOA 4BDOA 2VD2A 1MQIA 4U4XA 1IQ7A 3K2DA 3FVGA 4GOTA 4FORA 1MDP1 3F11A 3IJXB 1USYH 4LUBA 2X26A 4PFWA 2OBGA 4RJZA 3TZAA 3N6UA 3TCGA 5CM6A 4ESXA 1ZMGA 5I56A 4G8MA 4YKIA 1A40A 2A5TA 4GF8A 3ODBA 3GXAA 3H6VA 3VDFA 2OWSA 4EXLA 5L9OA 3SEUA 2HAUA 4IGTA 3ZKKA 3MVZA 3EHTA 4R6KA 4RK2A 4BDMA 4TOZA 1R9LA 2XXRA 1POTA 4M4GA 1A7LA 5KZTA 1AIVA 3T9UA 1NFTA 3CIJA 1AMFA 1JVYA 3H4ZA 1DMBA 2E1SA 1DOTA 1NNPA 3K6WA 3M8UA 3W9WA 4HW8A 3C36A 2FNCA 2UXAA 1CE2A 3BBRA 4FECA 1H76A 2H25A 4GRKA 4KCCA 4G8NA 1B4ZA 1DPPA 3H6WA 2DVZA 3PUYE 2A5TB 2V3QA 1LFIA 2HZLA 3K1MA 3TMGA 3O6IA 2DSFA 2D21A 2O6AA 5M2VA 4NF4B 5EHSA 4ZZEA 2Z8FA 1FTKA 5I58A 3C31A 3UP9A 4GQOA 1A8FA 2XXXA 4Q5TA 4RXLA 3TTRA 3UA8A 1DSNA 1OMPA 1B1HA 2ONKE 4G68B 3T9VA 5H8SA 1JW5A 2XXIA 5CI5A 1HSJA 2Z23A 3TTMA 1PC3A 1OIBA 1B5IA 3IJOB 4NTLA 2DQVA 4YU0A 3WAEA 1M5BA 1OLCA 2XXTA 3EQ1A 5H8HB 1VE4A 2G29A 3LSFB 1TT1A 1ZTYA 4QFKA 3IOVA 4DXBA 5L9MA 3G7WA 2Z22A 4H6DA 4FEBA 4OETA 4P11A 4U2RA 4PFUA 4H8IA 4PP0A 5ELVA 1MY0A 3RQTA 3OELA 4FJPA 4ZEBA 5AA2B 2CMOA 1MG1A 3FXQA 5CMKA 5I57B 1B32A 2ALUA 2HAVA 3RN8A 1NL5A 2XD2A 4GWOA 3EHUA 1EZ9A 1MXZA 2DYXA 4RY1A 3WAFA 4Z7EA 4LQ5A 2AYSA 1M5EA 5H8HA 3FGSA 3N26A 3UORA 4UA8A 3KZGA 3E9XA 5AA4B 4OWDA 5I2NB 2W7YA 4I1DA 2AL4A 1VFEA 3HHGA 4HS7A 1B3LA 1Q1KA 3RTWB 3FVKA 4MF3A 1JW1A 3TELA 5KCJA 2F35A 1SYIA 1JETA 5BWJA 3K6VA 4R73A 4X48A 3DP8A 3LSWA 5IKBA 3MPLA 1GTKA 3O6HA 4YMAA 2UVGA 5JK4A 1B3EA 2DP8A 1LFHA 3HCQA 2QS1A 2OCUA 2Q88A 3SETA 1URSA 4TQUQ 4C1UA 1ZJLA 2HEUA 3PUZE 4KHZE 3TEPA 1Y3NA 3CFZA 3FJ7A 2X7QA 4EQ9A 5BUUA 1SBPA 3C9HA 3R6UA 1Z7ME 1ZIUA 1MDQA 3KG2A 4GXSB 4G2ZA 3SEWA 4NWCA 4I8CA 3SESA 5J1DA 4RYAA 4ND9A 1D3KA 2OWTA 3H6TA 5JTYB 1JNFA 2ESNA 4KQPA 3TTKA 3D4CA 2OLBA 3S2VA 1MY2A 4NWDA 1B40A 1N7XA 3O28A 1XVYA 2DWJA 3MWBA 2I4BA 3B6QA 2H98A 1LLSA 2H4IA 1AH5A 3JYRA 2H5YA 2H99A 5CMBA 5FHMA 1S50A 1B3FA 3C4MA 2KLFA 3MUQA 3FVNA 1R6ZA 3N94A 3PGFA 4GIZA 4QFOA 4F39A 3OO8A 3EPEA 4LZ8A 4R2FA 1SI0A 2HFBA 5DYHA 3FZVA 3OSQA 3PPRA 3LC8A 4LA9A 4PQJA 3KOTA 4I62A 4RA1A 4OFOA 1P99A 2THIA 5EHMA 5CBSA 4AB5A 1R9QA 1B2HA 4IO4A 3MP1A 1MPDA 1TXFA 1B1XA 1ZU0A 3KBRA 4F29A 1QUIA 4IGRA 4NF5A 5ICQA 3UK4A 1FW0A 3LR1A 2P0SA 4OEVA 4YKKA 4Q0CA 4Q30B 3G3FA 4R6HA 2QS4A 2ANJA 4XKQA 2XXWA 3P7IA
chains in the Genus database with same CATH superfamily
1D9VA 3I6VA 4EXKA 3MVYA 1FBPA 2GHAA 2Q8MA 3T9XB 3LUYA 4YICA 3E78A 2HHMA 3C32A 3FUZA 1LCTA 3H3GA 3W15C 5I59A 3IB0A 4JSOA 3MYUA 4I3EA 1GGGA 3CHGA 1NUXA 4PF8A 3G3GA 2PT2A 4X1DA 4EF1A 4KYEA 3VLWA 1PB8A 5ITPA 4MEVA 4K3FA 4P1LA 4OVSA 4OMBA 3CSGA 2QVRA 1BLFA 4R2BA 1B7UA 4P47A 5H8NB 1XS5A 2F6GA 4O3CA 2P2AA 3E4RA 1MM7A 2V93A 2VHAA 1SDXA 5B7DA 3U1OA 3NOHA 4ESWA 3FASA 3U92A 5KCJB 1SW1A 2PYYA 1B46A 2G93A 5DVJA 5HM4B 4H5FA 3ZS6A 3MJNA 1FPJA 1NV2A 1Y4TA 4C1TA 2Z8DA 1VFDA 1EU8A 1FCKA 2B3FA 3VLUA 1Z7NE 4XF5A 4ISUA 3DELB 4EDPA 1UTBB 3IR1A 3VE1B 1Y4CA 5AE4A 3MPKA 3O97A 5HBCA 2Y7RA 1ANFA 3FATA 3CFXA 3T9HB 1SYHA 4MNCA 2Y7WA 1QKAA 5H8FA 2O84X 1B6HA 4QRZA 3PPOA 1D4NA 2RCBA 2ABHA 4F2QA 5EQAA 4YB6A 1NH8A 4YKJA 1MQHA 4JWXA 4MAGA 5H8QA 1PB7A 3Q28A 5CBRA 1OVTA 4ELPA 2QPQA 2F7AA 2XA5A 2I0CA 1FTMA 4LP2B 4NE4A 5IAIA 1ATGA 3RPLA 4GD5A 4P3LA 4WEDA 3RY3A 3TAJA 4DCXA 5ISUA 2OK2A 5DVIA 4PETA 2L5VA 5ET8A 3ROJA 3PUWE 3SZPA 1F9BA 2Z8EA 4PE3A 1LB8A 4QSCA 3V5AA 1P1NA 4N91A 3IAZA 1LBZA 4GFRA 4PFIA 4XKNA 1NMUA 1M5DA 3TFLA 3PMXA 4RNSA 2OX3A 3S9LC 1VR5A 1FQDA 3MQ9A 5FHNA 2R6GE 1II5A 4WEPA 1P1WA 2ZNTA 5DEXA 1R1NA 4AS4A 1OVBA 3RUMA 1FQBA 2Q2CA 4G8HA 2I3VA 1B4HA 1FPFA 1XVXA 4RPNA 1B7HA 1JEUA 2PMSA 4PAKA 2I4CA 1I6BA 2F8DA 3PU5A 2RCAA 1OQGA 4U21A 4BDQA 4F3GA 2QJEA 4R72A 3OD7A 3V8XB 1RDYA 5KDTB 2PBWA 1MH3A 3OENA 2ZXTA 2R8TA 4DLDA 3ZSFA 2NVUB 1BK4A 1US4A 2IEEA 1URDA 1B0LA 1NV0A 1EYIA 1LAHE 3TQWA 1IUDA 1MRPA 3FV1A 1I69A 2ONRA 3THIA 4H5GA 2Y7IA 3CG1A 2DXRA 4OXVA 4MX6A 4OVRA 1K9ZA 4TLLB 1GR2A 4HCYA 3PD9A 2H9BA 3KC0A 4P8BA 1PEBA 3PUXE 3IFAA 4U22A 3M3LA 4F3PA 3N5LA 2HCAA 3QXMA 5CRYA 4MLQA 4HXVA 4U1OA 4Q8RA 1QVSA 3CFLA 3UIFA 4F18A 3GBBA 3BKIB 2OJTA 1BTJA 1MPBA 1RKMA 4JSDA 3OMBA 4GVOA 2I48A 3USDA 3JZJA 2CEYA 3FJGA 4LZ5A 2F36A 4EQ7A 4IY5A 4BDOA 3RPLB 2X26A 4RJZA 4ESXA 4G8MA 4YKIA 4GF8A 4FBPA 4P9KA 4N8YA 2HAUA 4NAPA 1R9LA 2XXRA 3CIJA 1AMFA 1JVYA 5JEIA 1DMBA 2E1SA 3K6WA 1NNPA 3M8UA 5A5XB 4KR5A 3BBRA 4G8NA 1B4ZA 2DVZA 1G0IA 3PUYE 2DSFA 4NF4B 4GQOA 1A8FA 4Q5TA 1OMPA 5H8SA 2XXIA 1HSJA 4NTLA 4YU0A 2DQVA 1AWBA 1VE4A 2G29A 5L9MA 5IM2A 4PFUA 4PP0A 3OELA 1MG1A 5CMKA 5I57B 1B32A 4NN3A 1NL5A 1EZ9A 4LQ5A 4MNIA 4OWDA 2W7YA 1B3LA 3RTWB 5KCJA 1KA1A 1SYIA 4R73A 1GTKA 1B3EA 5EYHA 2Q88A 3KBZA 3SETA 2HEUA 3PUZE 2B4MA 3CFZA 1Z7ME 4GXSB 3KG2A 1D9QA 4RYAA 4H46A 4DI3D 1JNFA 3D1RA 4P1EA 2DWJA 3MWBA 1LLSA 2H5YA 2H99A 5FHMA 2KLFA 4GIZA 3PGFA 1R6ZA 4F39A 3KOTA 4OFOA 1Q9DA 1B2HA 4NHBA 5IGAA 1ZU0A 5ICQA 4IGRA 4NF5A 3LR1A 4OEVA 4YKKA 4R6HA 1IMEA 2XXWA 2HPGA 4GWXA 3HV1A 3T0JA 1MPCA 4PAIA 4PGNA 3HSTA 4MNPA 3A3CA 1B5HA 3S9MC 5F1QA 2XX7A 4BDNA 1O64A 1SI1A 4F31B 1YCJA 3L6HA 3I5OA 3U72A 4NGUA 3QK6A 1NV5A 4F2OA 1MH4A 4ZEFA 3IOTA 1L5TA 3FIRA 3PMWA 3A09A 5H8QB 1PBPA 4O94A 5AA2A 5I7IA 4HE2A 3G3IA 2WEFA 1TWYA 5IZ1A 4YKPA 4QFPA 4WXJA 4QXDA 3RT8A 1FPEA 1JQFA 1A8EA 2Q89A 1FPLA 1NUZA 3TYHA 2ZMBA 1QKBA 5K2XA 1LCFA 1MXXA 3MW0A 2RKMA 5LDZA 2DOJA 1B52A 3FXBA 2D3IA 2DWHA 4JDFA 4G68C 1NI9A 3RNNA 2QS3A 1G0HA 2XD3A 4NEDA 2F97A 4NF4A 4JB7A 1LAXA 4F1VA 2VP1A 2FIEA 3B7DA 1CB6A 5I2KB 2VD3A 2KR0A 3DP4A 4ZS9A 1FBFA 5I57A 1B7ZA 5IZZA 1LBBA 3SEYA 1P1QA 1NV3A 2RC9A 3K6UA 4QFLA 3VFJA 4KYDA 4H65A 4JVDA 3V89B 4MHFA 4OVQA 2XWKA 4MBPA 2O51A 2ZNSA 4IO6A 4NF8B 4NF6A 5CMMA 4XKPA 5DTBA 3O66A 4XKRA 3L6GA 4OENA 4N6DA 2ONSA 4LZ7A 2RC7A 3Q25A 3FJMA 1TFAA 5FTHA 3C34A 5CC2A 1B0HA 1XOCA 4OVJA 5I58B 3PTYA 1A54A 2XXPA 4FORA 1BKAA 1INPA 2KQZA 2DDKA 2DE3A 3V83A 3R26A 4JWOA 1VDWA 2VT5A 4UABA 2WYKA 3G3HA 3TQLA 4PF6A 3U8QA 4F3BA 1DBZA 1AL3A 4THIA 1URGA 1NH7A 3FXRA 2P3NA 3IFCA 3IO4A 1ELJA 5ET7A 3OO6A 4R74A 2Y7KA 3E3KA 4QSEA 5AA4A 4FE8A 1H43A 1LBCA 1FQAA 4IO7A 3KJTA 1SW4A 1NV1A 1DPEA 2LAOA 2MKZA 1EZPA 1IXHA 1XC1A 1XHYA 3U94A 1Y3QA 3FV2A 4ZEDA 3QSLA 3SDFA 1FRPA 1NKXA 1MQGA 1USYE 2DE4A 3RTFB 4DZ1A 5A5XA 1KWHA 4ZE8A 4E0WA 5TP9A 2UVHA 3ONMA 4MFIA 3W9VA 3MSTA 4ZZAA 3MZ9A 1T0KA 3E79A 2GH9A 4MH5A 1K9YA 1S9TA 4QSDA 4MIJA 5DT6A 4H67A 4GL8A 3QAXA 2VGQA 1SW2A 4KI0E 4GBVA 2XHDA 3SEXA 1IITA 2O68A 4EUOA 4OEUA 5CMCA 4E0XA 3EF7A 2UYFA 2QRYA 1FTOA 3IOUA 4O7IA 4ZECA 4DXUA 4BDRA 4PFTA 1AOVA 4OQOA 2QVUA 1MXVA 4PDHA 1VSOA 3I3VA 3VV5A 1FQCA 3H06B 3PD8A 3SEVA 1MS7A 3C35A 2Q2AA 3KN3A 1O63A 1WODA 3LSLA 1FBDA 3R7XA 1RYXA 1B51A 5ESYA 4NG7A 3K00A 1RDXA 5FTIA 4L17A 5L8DA 2NOOA 4ONYA 4HCWA 4I9DA 4IO3A 4AS5A 4ZE9A 3K02A 2REGA 3CRBA 4NF5B 1KZ8A 4GOTA 4KXPA 4LUBA 2FBPA 3N6UA 3ODBA 4BDMA 1POTA 1A7LA 1AIVA 1DOTA 4GRKA 1DPPA 2QVVA 2A5TB 2V3QA 3TMGA 3TTRA 3UA8A 1DSNA 4N15A 2ONKE 1FBCA 4GX6A 3IJOB 1NV6A 1TT1A 3KC1A 3G7WA 4H6DA 4FEBA 4OETA 4ZEBA 5AA2B 2ALUA 3WAFA 4Z7EA 2AYSA 1M5EA 4N8GA 5H8HA 1FSAA 3FGSA 1FBHA 5AA4B 3E9XA 2QFLA 2AL4A 3HHGA 1JW1A 3K6VA 5I3SA 4X48A 3DP8A 5IKBA 1EZOA 3MPLA 3O6HA 1LBVA 2QS1A 3TEPA 1MDQA 5J1DA 4NWCA 3SESA 1D3KA 2OWTA 1SPIA 3S2VA 1MY2A 1XVYA 3B6QA 2H98A 1AH5A 3JYRA 2HXRA 3C4MA 3FVNA 4LN5A 3EPEA 5DYHA 3FZVA 3PPRA 3LC8A 4H45A 4RA1A 1P99A 5CBSA 1R9QA 1TXFA 1B1XA 3KBRA 4F29A 4Q0CA 3QMFA 3BFUA 4KYSA 4OA4A 2V84A 3TPAA 3G3JA 2D5WA 2I58A 3IB2A 2VOZA 4JBZA 4UACA 3IL1B 1Y20A 1P1UA 4NF8A 3KFMA 4GWYA 4X9TA 3T96B 4TLMB 4OFJA 1IXIA 2V3UA 1RDZA 3OEMA 2O69A 3Q27A 4OHNA 3MBPA 3CG3A 3O29A 3MP8A 3OSRA 3TCHA 1ZKBA 4YAHX 2X7PA 1DCUA 3LBSA 1POY1 4LVQA 5EQ9A 1MY1A 4X8RA 3K6XA 4NF6B 4QF9A 1MY4A 3B6TA 3ECRA 1B5JA 2PX1A 4AB6A 2AIXA 5I58A 2GRVA 2GHBA 2QSXA 3C33A 2DXYA 3OO9A 4PAFA 5EYFA 2P1SA 4PBHA 2B65A 2Y5LA 5I5PA 1JVXA 3EHSA 4AQ4A 1IEJA 4O3AA 1HSLA 1N04A 1Q35A 2PFZA 2O7IA 3GYYA 1LFGA 2PVUA 2UVIA 2QMXA 2FA7A 4G77A 2O1LA 3RLFE 1YAEA 2YPNA 1FPDA 4OERA 2ZYOA 2XXKA 1YTVA 3PMVA 4GLIA 3LSXA 4PFBA 3PPQA 4JXIA 4KD5A 2CZKA 2QMWA 3HO7A 1MXUA 4N07A 4XIGQ 4IR8A 4ELQA 3KGCA 3BIGA 2YLNA 2RINA 5AA3A 4FIMA 5TPAB 4MMPA 3TCFA 4X04A 2XX8A 3CR9A 3MAMA 3TTNA 1LBYA 3VXCA 1NNFA 4XFEA 5DW8A 1WVJA 1PBQA 3QYTA 3RT6B 3SKPA 4YB7A 1DK4A 1IMFA 1H44A 4NQ8A 5AA1A 3DLNA 3FVOA 3JV9A 4X1BA 3T93B 3D4GA 2XXHA 4DI4B 3M3FA 1LGBC 2AL5A 1MXYA 2WBDA 4NMYA 3PV0E 1IZ1A 4NX1A 2WKYA 1LSTA 1UTHB 4N6KA 4GX3A 2ZYNA 1FQFA 3GLBA 1LBWA 3IK6B 4PGPA 3GBAA 1YZ0A 4QHQA 4P56A 2F5XA 3TTLA 5ITOA 3T1BA 4GL0A 2UVJA 1Y9UA 2GQ1A 4FATA 1FPBA 4OESA 2Y5KA 3VVEA 4F1UA 3K1NA 5DEXB 4U1ZA 1D9YA 1FTJA 3RYDA 3GZGA 2ZZVA 4IO5A 3CI8A 4AB5A 1QJMA 1B58A 2DVCA 5ET6A 3EKIA 2M8CA 5EQ7A 1IMAA 1H3DA 2NWJA 5JTYA 3O2AA 1KA0A 3OO7A 1JP4A 5T3JA 3A3UA 3O6GA 3KEIA 2GFEA 4JVIA 4R6YA 4G4PA 2F78A 2DE2A 4ZEKA 5J16A 1NUWA 2FIXA 3TODA 3KSXA 5KDTA 3VVFA 3MZBA 4POWA 3MZ1A 1QGXA 4BLAA 4XTCQ 4GXAA 1M5FA 4U4SA 2FYIA 4HTGA 3A29A 2I6EA 3EN3A 5K2YA 2O1MA 1QULA 2Q8JA 3Q29A 4IB2A 3UGWA 2E0SA 1IIWA 4GX4A 1S7YA 1UIVA 4C0RA 4JWYA 3G3KA 4EF2A 2FVZA 1HSEA 4XXUA 2QS2A 4MCOA 4R9FA 4POXA 3O9PA 3RPWA 2B3BA 3H6UA 4G61A 1OLAA 1MM6A 2F7CA 4F1YA 2REJA 3VXBA 2Y84A 3AXFA 3U65A 2V25A 2R71A 2I3WA 3BFTA 4GBWA 1QUKA 3LV0A 5LOMA 4EQBA 4H0WA 5FHOA 2VD2A 1MQIA 1IQ7A 1YXIA 3FVGA 3IJXB 4PFWA 1FBEA 1LEVA 3TCGA 5CM6A 5I56A 4PBQA 3GXAA 5L9OA 3ZKKA 4R6KA 4TOZA 4M4GA 3T9UA 2PCRA 4FECA 1H76A 5EQ8A 1LFIA 2HZLA 3K1MA 3O6IA 5M2VA 2Z8FA 3C31A 3UP9A 2VPOA 2XXXA 1B1HA 4G68B 1JW5A 3TTMA 1PC3A 1OIBA 1B5IA 1OLCA 2XXTA 3EQ1A 2WBBA 1ZTYA 4QFKA 4DXBA 5ELVA 5A5LA 3FXQA 2XWOA 2HAVA 4GWOA 3EHUA 1MXZA 2DYXA 4UA8A 4N81A 5F24A 4HS7A 3FVKA 1YYZA 4YMAA 2XWIA 2DP8A 5LTCA 3HCQA 2OCUA 2CZHA 4PFRA 3FJ7A 2X7QA 1NUYA 3C9HA 3SEWA 5JTYB 2ESNA 3TTKA 2OLBA 4NWDA 1B40A 1NV4A 2H4IA 4PDDA 5FBPA 5CMBA 1S50A 1B3FA 3MUQA 4QFOA 4LZ8A 4R2FA 2HFBA 3OSQA 4PQJA 2F3BA 4I62A 2B4LA 2WX9A 4IO4A 4MJOA 1FW0A 2ANJA 4XKQA 1CNQA 3TDJA 4ELRA 3VVDA 2QL3A 1NV7A 1UIUA 1NNKA 1MQDA 1J1NA 3KN8A 2CZIA 2PT1A 5TPAA 1N3WA 1GVCA 1IMDA 1B3HA 2NUVA 1DTGA 3KN7A 2DWAA 4LONB 2Y7PA 2RF1A 5IZ3B 2V3TA 1IXGA 4GWWA 4DDDA 4PCDA 3H7MA 4IO2A 4PC9A 4H8JA 4KPTA 4ZEIA 1SW5A 3KJ7A 4YMBA 1Y3PA 4F22A 1B9JA 4O7MA 4P0IA 3UN6A 4OFLA 4LATA 2UYEA 2HZKA 2ZYKA 4OVPA 1O7TA 2FHYA 3K0VA 3OOAA 3OEKA 1Y1MA 1SVXB 1QUJA 3CVGA 4RK9A 1I6QA 2HXWA 5I2KA 1EYKA 2IA4A 4OZ9A 1UTHA 3PUVE 2WYPA 3MC2A 1M5CA 5AA2D 3HPIA 1BP5A 3MP6A 4N13A 5EYGA 4G68A 2ZZWA 3K1PA 4DE8A 2R9JA 5I59B 1MY3A 2OZZA 2O7UA 4O8MA 3ZKLA 1SD3A 4ELOA 4PE5B 2XWVA 3IB1A 2HQ0A 1B05A 2I49A 1I6AA 1BIYA 3KSJA 1N3XA 4HE0A 3DM0A 3HFUA 4PFYA 3HN0A 1FTLA 5H8NA 1UQWA 1N0TA 4RPOA 3QIMA 4MLVA 2NXOA 2XXUA 3S9NC 1FTAA 1A99A 4PTKA 3FBPA 3K01A 3ISPA 4YZZA 3ILUB 4DXCA 2F3DA 3H03A 1OQHA 1SQYA 1A55A 4YB5A 5HPQA 2DS9A 4N17A 5ET5A 4WKMA 4DCYA 2V4CA 4GWUA 1US5A 2XXVA 3BIHA 1FPIA 3CSBA 1P1OA 4BDLA 3MVWA 3PPPA 2VPNA 1ZBMA 1FPKA 5B70A 2PFYA 4DIGA 1UTBA 2F34A 4HE1A 4OYVA 2F7BA 4R75A 3ILTB 3B8BA 1YPNA 1FJ6A 3IX1A 1H45A 5F7VA 4OVTA 2RC8A 2CEXA 2ZYMA 4FEDA 1NNTA 3PPNA 1JW4A 1LAGE 5I2NA 1XT8A 4M1VA 1MQJA 4OANA 1IMCA 2A5SA 1FQEA 3T66A 2DWIA 3U93A 1ZLQA 1XI6A 3N6TA 5TP9B 5BUUA 1MXWA 1FJ9A 2I0BA 4N6PA 3K4UA 1IMBA 3IORA 3S4UA 3E13X 5H8FB 1GV8A 3IOWA 4I40A 3TKDA 2P3VA 3DP6A 2CZLA 3Q26A 2BJIA 3SERA 2XXQA 5I56B 1Y1ZA 4IY6A 2F6PA 4ZDMA 1WDNA 1IXCA 1LBXA 4R9GA 5ICTA 2OWZA 3B6WA 4Z0IA 4F3SA 1LB9A 3T22A 1N7WA 4N4UA 4QFNA 3TUSA 4LQ2A 3HHFA 4U23A 4GWZA 3MVXA 3KOSA 1JEVA 4O3BA 2YJPA 1B3GA 3FD3A 2ZNUA 1PDAA 4OTEA 3VLVA 4KCDA 1PB9A 3IO6A 1EH3A 5TU0A 5L9SA 3S9EA 4FAJA 1RYOA 4ECFA 1N76A 5DVFA 1QW0A 1N84A 3RGYA 3QUJA 2XX9A 3QUFA 4KFQA 3FXUA 4P0GA 3OXNA 2XXYA 4F19A 2BJJX 3M3KA 4NF0A 4H1XA 1LAFE 1TFDA 2Q9TA 1DTZA 5I84A 4U4XA 3K2DA 1MDP1 3F11A 1USYH 3TZAA 2OBGA 1FPGA 1ZMGA 1A40A 2A5TA 3H6VA 3VDFA 2OWSA 4EXLA 3SEUA 4IGTA 3MVZA 3EHTA 4RK2A 5KZTA 4GWSA 1NFTA 3H4ZA 3W9WA 4HW8A 2Q74A 4XEQA 3C36A 2FNCA 2UXAA 1CE2A 4KCCA 3TELA 2H25A 3H6WA 2D21A 2O6AA 5EHSA 4ZZEA 1FTKA 4RXLA 2ZZXA 3T9VA 5CI5A 2Z23A 3WAEA 1M5BA 5H8HB 3LSFB 3IOVA 2Z22A 4P11A 4U2RA 4H8IA 1MY0A 3RQTA 4FJPA 1FBGA 2CMOA 3RN8A 2XD2A 4RY1A 3N26A 3UORA 3KZGA 5I2NB 4I1DA 1VFEA 2JJKA 1Q1KA 4MF3A 2F35A 5BWJA 1JETA 3LSWA 5IZ3A 5JK4A 1LFHA 2UVGA 3B50A 1URSA 4TQUQ 4C1UA 1ZJLA 4KHZE 1Y3NA 1SBPA 3R6UA 1ZIUA 4EQ9A 4G2ZA 4I8CA 4ND9A 4QBAA 3H6TA 4KQPA 3D4CA 3LUZA 1N7XA 3O28A 2I4BA 3N94A 1EYJA 3OO8A 1SI0A 4LA9A 4JVCA 4I3YA 2THIA 5EHMA 3MP1A 1MPDA 1QUIA 3UK4A 2P0SA 4Q30B 3G3FA 2QS4A 3P7IA
chains in the Genus database with same CATH topology
3TDJA 3BFUA 3HV1A 4ELRA 1D9VA 4KYSA 3VVDA 1MPCA 2QL3A 3I6VA 5JEIA 4EXKA 2V84A 3HSTA 1UIUA 1NNKA 3A3CA 3MVYA 3TPAA 2GHAA 1MQDA 3T9XB 1B5HA 3LUYA 5F1QA 3S9MC 1J1NA 3KN8A 2PT1A 3G3JA 5TPAA 1N3WA 2D5WA 2I58A 4YICA 1GVCA 1B3HA 2NUVA 4KR5A 3IB2A 2VOZA 2XX7A 4BDNA 4JBZA 3C32A 3FUZA 1LCTA 3H3GA 3W15C 1O64A 5I59A 1SI1A 3IB0A 4F31B 1DTGA 4JSOA 1YCJA 3L6HA 4UACA 1GGGA 3IL1B 3I5OA 3G3GA 2PT2A 4X1DA 3U72A 4EF1A 1Y20A 3KN7A 4KYEA 3VLWA 1PB8A 1P1UA 2DWAA 3QK6A 4LONB 4NF8A 5ITPA 2Y7PA 3KFMA 4K3FA 2RF1A 4F2OA 1MH4A 2V3TA 4X9TA 4ZEFA 4TLMB 3T96B 1IXGA 4OMBA 3IOTA 3H7MA 1L5TA 4DDDA 3CSGA 3FIRA 3PMWA 4IO2A 3A09A 1BLFA 4OFJA 1IXIA 2V3UA 4H8JA 4R2BA 1B7UA 2O69A 3OEMA 3Q27A 1PBPA 1XS5A 4KPTA 4OHNA 5H8NB 3MBPA 4ZEIA 3CG3A 1SW5A 3O29A 2F6GA 5AA2A 4O3CA 2P2AA 3KJ7A 3MP8A 3OSRA 3TCHA 4YMBA 3E4RA 1MM7A 1Y3PA 2V93A 2VHAA 4F22A 1ZKBA 4YAHX 2X7PA 5H8QB 3G3IA 1SDXA 3LBSA 1POY1 5B7DA 1B9JA 1TWYA 4LVQA 3U1OA 4P0IA 4YKPA 4QFPA 1MY1A 3K6XA 4ESWA 5I59B 3FASA 4NF6B 3U92A 3UN6A 5KCJB 4QF9A 4OFLA 1SW1A 2PYYA 1B46A 2G93A 4LATA 2UYEA 4WXJA 2HZKA 1MY4A 2ZYKA 5DVJA 5HM4B 4H5FA 3RT8A 3ZS6A 3B6TA 1O7TA 1JQFA 3K0VA 3MJNA 3ECRA 3OEKA 3OOAA 1A8EA 2Q89A 1B5JA 2PX1A 4AB6A 3TYHA 2ZMBA 1Y4TA 1Y1MA 1SVXB 1QUJA 2AIXA 2GRVA 1QKBA 3CVGA 4RK9A 5K2XA 1LCFA 1MXXA 2GHBA 4C1TA 3MW0A 1I6QA 2Z8DA 2QSXA 1VFDA 2DXYA 2RKMA 2HXWA 3C33A 3OO9A 5EYFA 1FCKA 1EU8A 2B3FA 2DOJA 1B52A 2P1SA 2D3IA 3VLUA 1Z7NE 2DWHA 4JDFA 2B65A 4G68C 1JVXA 3RNNA 3EHSA 4AQ4A 1IEJA 4ISUA 2QS3A 3DELB 4O3AA 2XD3A 1HSLA 5I2KA 1N04A 1Q35A 2IA4A 2O7IA 4OZ9A 4EDPA 1UTBB 1UTHA 3IR1A 1Y4CA 3PUVE 4NEDA 3VE1B 1LFGA 2F97A 3MC2A 3MPKA 1M5CA 2PVUA 4NF4A 2UVIA 3HPIA 5AA2D 5AE4A 2QMXA 2FA7A 4G77A 2O1LA 3O97A 1BP5A 3MP6A 5I58B 4JB7A 1LAXA 4N13A 1YAEA 5HBCA 3RLFE 4G68A 4F1VA 2YPNA 2VP1A 4OERA 2ZYOA 2Y7RA 3K1PA 4DE8A 1YTVA 2R9JA 1ANFA 1CB6A 1MY3A 3B7DA 3FATA 2VD3A 5I2KB 3CFXA 2OZZA 2O7UA 3PMVA 1SYHA 3T9HB 3ZKLA 1SD3A 4GLIA 4ELOA 4PE5B 3LSXA 3IB1A 2Y7WA 3DP4A 4ZS9A 3PPQA 2HQ0A 4JXIA 1B05A 4KD5A 1QKAA 2I49A 2QMWA 3HO7A 5H8FA 1I6AA 1BIYA 1MXUA 2O84X 4N07A 1B7ZA 1B6HA 4QRZA 5I57A 3KSJA 3PPOA 1D4NA 2RCBA 4XIGQ 1LBBA 1N3XA 2ABHA 3KGCA 3SEYA 1P1QA 3DM0A 4ELQA 4F2QA 4YB6A 1NH8A 4PFYA 4YKJA 2RC9A 2YLNA 2RINA 3HN0A 3K6UA 4QFLA 5AA3A 1FTLA 3VFJA 1MQHA 4JWXA 5H8QA 4KYDA 5H8NA 1UQWA 1N0TA 4FIMA 1PB7A 4H65A 4RPOA 3Q28A 5TPAB 1EZOA 3TCFA 5CBRA 1OVTA 3QIMA 4MLVA 4ELPA 2QPQA 2NXOA 2F7AA 2XX8A 2XXUA 3S9NC 1A99A 3V89B 2I0CA 3CR9A 1FTMA 4LP2B 3K01A 3MAMA 4NE4A 4YZZA 1ATGA 3TTNA 5IAIA 3ILUB 4MBPA 2O51A 4GD5A 3VXCA 1NNFA 2ZNSA 4IO6A 1WVJA 1PBQA 4DXCA 3QYTA 4NF6A 4NF8B 4WEDA 3RT6B 5CMMA 3H03A 3SKPA 3RY3A 3TAJA 1OQHA 4XKPA 5DTBA 4YB7A 3O66A 4XKRA 4DCXA 3L6GA 4OENA 2ONSA 4LZ7A 1SQYA 1A55A 2RC7A 3Q25A 3FJMA 1TFAA 1H44A 5FTHA 5ISUA 5L9SA 2OK2A 3C34A 5DVIA 4YB5A 5AA1A 5CC2A 5HPQA 3DLNA 2DS9A 4PETA 3FVOA 4WKMA 1B0HA 1XOCA 3JV9A 4OVJA 4X1BA 3T93B 1US5A 3D4GA 1A54A 2XXVA 2XXPA 3PUWE 1BKAA 2XXHA 3CSBA 1P1OA 1LGBC 2AL5A 3M3FA 1F9BA 1MXYA 4NMYA 3MVWA 3PV0E 1IZ1A 4BDLA 3PPPA 2DE3A 3V83A 3R26A 2Z8EA 4JWOA 1LB8A 1ZBMA 4QSCA 3V5AA 2WKYA 1P1NA 1LSTA 5B70A 3G3HA 3TQLA 3IAZA 4DIGA 1UTBA 1UTHB 2F34A 4OYVA 4XKNA 4GFRA 3U8QA 4F3BA 1NMUA 2F7BA 4DCYA 1M5DA 1AL3A 4R75A 3ILTB 4THIA 1URGA 1YPNA 3TFLA 2ZYNA 3PMXA 1FQFA 3GLBA 3IX1A 4RNSA 1NH7A 3UGWA 3S9LC 1H45A 3FXRA 3IK6B 1VR5A 3IO4A 1ELJA 3GBAA 1FQDA 5F7VA 2RC8A 3MQ9A 5FHNA 4QHQA 2F5XA 2R6GE 3TTLA 2ZYMA 3OO6A 1II5A 4FEDA 4WEPA 5ITOA 1P1WA 2ZNTA 5DEXA 1NNTA 4R74A 1R1NA 4GL0A 3PPNA 2Y7KA 3E3KA 1JW4A 4QSEA 1LAGE 1OVBA 2UVJA 4FE8A 5AA4A 5I2NA 1H43A 3RUMA 4F3SA 1LBCA 1FQBA 1Y9UA 1FQAA 1XT8A 4FATA 4M1VA 1MQJA 4IO7A 3KJTA 1SW4A 1DPEA 2A5SA 2Q2CA 4OESA 1FQEA 3VVEA 2LAOA 4F1UA 3K1NA 1EZPA 1IXHA 5DEXB 1XC1A 1D9YA 1FTJA 1XHYA 1B4HA 2I3VA 3GZGA 4G8HA 4U1ZA 1XVXA 4IO5A 3T66A 3CI8A 3U94A 2DWIA 1QJMA 1B58A 1ZLQA 4RPNA 1Y3QA 3U93A 2DVCA 3N6TA 1B7HA 3FV2A 5TP9B 1JEUA 2PMSA 4ZEDA 3QSLA 3SDFA 2I4CA 1MXWA 1NKXA 2M8CA 1I6BA 1MQGA 2F8DA 2I0BA 4N6PA 3K4UA 1H3DA 2RCAA 1OQGA 3PU5A 2NWJA 5JTYA 3O2AA 4U21A 4BDQA 4F3GA 2QJEA 1USYE 2DE4A 3IORA 4R72A 3OD7A 3OO7A 3RTFB 3V8XB 3S4UA 4DZ1A 5A5XA 1KWHA 5KDTB 2PBWA 3E13X 1MH3A 4ZE8A 4E0WA 5H8FB 3OENA 2ZXTA 4DLDA 5TP9A 3ZSFA 2UVHA 3ONMA 3A3UA 3O6GA 3KEIA 4MFIA 2GFEA 2NVUB 1GV8A 3W9VA 3IOWA 4ZZAA 4R6YA 4G4PA 1US4A 2F78A 3MZ9A 2IEEA 1T0KA 3TKDA 2DE2A 4ZEKA 1URDA 3DP6A 2GH9A 2CZLA 1B0LA 3TODA 3KSXA 3Q26A 5KDTA 4MH5A 1S9TA 4QSDA 3SERA 3VVFA 2XXQA 4H67A 5DT6A 1LAHE 3MZBA 1Y1ZA 4GL8A 4IY6A 4POWA 3TQWA 2F6PA 4ZDMA 5I56B 1IUDA 3MZ1A 3QAXA 1WDNA 4BLAA 1MRPA 3FV1A 1I69A 2VGQA 2ONRA 1IXCA 4XTCQ 1SW2A 4GXAA 4KI0E 4H5GA 2Y7IA 3THIA 3CG1A 4R9GA 2DXRA 2XHDA 4OXVA 3SEXA 1M5FA 1IITA 4U4SA 5ICTA 2O68A 2FYIA 4HTGA 2I6EA 3EN3A 4OEUA 5K2YA 3B6WA 4EUOA 2O1MA 1QULA 4Z0IA 3Q29A 4IB2A 1LB9A 5CMCA 2E0SA 2Q8JA 4TLLB 1N7WA 3T22A 3EF7A 4E0XA 2UYFA 4QFNA 3TUSA 1IIWA 1GR2A 4HCYA 3PD9A 4LQ2A 2QRYA 2H9BA 3HHFA 4U23A 1S7YA 3MVXA 1FTOA 1UIVA 3KOSA 4C0RA 3IOUA 4JWYA 1PEBA 1JEVA 4O3BA 3G3KA 3PUXE 4DXUA 4ZECA 2YJPA 4U22A 1B3GA 4BDRA 3FD3A 3M3LA 4PFTA 4EF2A 4F3PA 1AOVA 1HSEA 4OQOA 2ZNUA 1PDAA 1MXVA 4OTEA 1VSOA 3I3VA 4KCDA 3VLVA 1PB9A 3VV5A 3IO6A 1EH3A 1FQCA 2QS2A 3H06B 3PD8A 3N5LA 4R9FA 4XXUA 3SEVA 2HCAA 3QXMA 1MS7A 3O9PA 4POXA 2B3BA 5CRYA 5TU0A 3RPWA 4MLQA 3C35A 3H6UA 2Q2AA 3S9EA 4FAJA 1OLAA 3KN3A 1RYOA 1MM6A 1O63A 1WODA 3LSLA 4ECFA 1N76A 4U1OA 5DVFA 4Q8RA 1QVSA 1QW0A 3CFLA 1N84A 3R7XA 3UIFA 1RYXA 3RGYA 3GBBA 4F18A 1B51A 2F7CA 3QUJA 2XX9A 3K00A 5A5XB 4F1YA 2REJA 3BKIB 2OJTA 5FTIA 3QUFA 4KFQA 3VXBA 4L17A 2Y84A 3AXFA 3FXUA 1BTJA 1MPBA 1RKMA 2V25A 3OXNA 4JSDA 3OMBA 2XXYA 4GVOA 4P0GA 5L8DA 4F19A 2BJJX 2I48A 2R71A 3USDA 3M3KA 2I3WA 2NOOA 3JZJA 3BFTA 4ONYA 4HCWA 4I9DA 4IO3A 1QUKA 4H1XA 4ZE9A 1LAFE 1TFDA 2Q9TA 1DTZA 3K02A 5LOMA 2REGA 5I84A 4EQBA 3CRBA 3FJGA 4NF5B 4H0WA 2F36A 4LZ5A 4EQ7A 4IY5A 5FHOA 4BDOA 2VD2A 1MQIA 4U4XA 1IQ7A 3K2DA 3FVGA 4GOTA 4FORA 1MDP1 3F11A 3IJXB 1USYH 4LUBA 2X26A 4PFWA 2OBGA 4RJZA 3TZAA 3N6UA 3TCGA 5CM6A 4ESXA 1ZMGA 5I56A 4G8MA 4YKIA 1A40A 2A5TA 4GF8A 3ODBA 3GXAA 3H6VA 3VDFA 2OWSA 4EXLA 5L9OA 3SEUA 2HAUA 4IGTA 3ZKKA 3MVZA 3EHTA 4R6KA 4RK2A 4BDMA 4TOZA 1R9LA 2XXRA 1POTA 4M4GA 1A7LA 5KZTA 1AIVA 3T9UA 1NFTA 3CIJA 1AMFA 1JVYA 3H4ZA 1DMBA 2E1SA 1DOTA 1NNPA 3K6WA 3M8UA 3W9WA 4HW8A 3C36A 2FNCA 2UXAA 1CE2A 3BBRA 4FECA 1H76A 2H25A 4GRKA 4KCCA 4G8NA 1B4ZA 1DPPA 3H6WA 2DVZA 3PUYE 2A5TB 2V3QA 1LFIA 2HZLA 3K1MA 3TMGA 3O6IA 2DSFA 2D21A 2O6AA 5M2VA 4NF4B 5EHSA 4ZZEA 2Z8FA 1FTKA 5I58A 3C31A 3UP9A 4GQOA 1A8FA 2XXXA 4Q5TA 4RXLA 3TTRA 3UA8A 1DSNA 1OMPA 1B1HA 2ONKE 4G68B 3T9VA 5H8SA 1JW5A 2XXIA 5CI5A 1HSJA 2Z23A 3TTMA 1PC3A 1OIBA 1B5IA 3IJOB 4NTLA 2DQVA 4YU0A 3WAEA 1M5BA 1OLCA 2XXTA 3EQ1A 5H8HB 1VE4A 2G29A 3LSFB 1TT1A 1ZTYA 4QFKA 3IOVA 4DXBA 5L9MA 3G7WA 2Z22A 4H6DA 4FEBA 4OETA 4P11A 4U2RA 4PFUA 4H8IA 4PP0A 5ELVA 1MY0A 3RQTA 3OELA 4FJPA 4ZEBA 5AA2B 2CMOA 1MG1A 3FXQA 5CMKA 5I57B 1B32A 2ALUA 2HAVA 3RN8A 1NL5A 2XD2A 4GWOA 3EHUA 1EZ9A 1MXZA 2DYXA 4RY1A 3WAFA 4Z7EA 4LQ5A 2AYSA 1M5EA 5H8HA 3FGSA 3N26A 3UORA 4UA8A 3KZGA 3E9XA 5AA4B 4OWDA 5I2NB 2W7YA 4I1DA 2AL4A 1VFEA 3HHGA 4HS7A 1B3LA 1Q1KA 3RTWB 3FVKA 4MF3A 1JW1A 3TELA 5KCJA 2F35A 1SYIA 1JETA 5BWJA 3K6VA 4R73A 4X48A 3DP8A 3LSWA 5IKBA 3MPLA 1GTKA 3O6HA 4YMAA 2UVGA 5JK4A 1B3EA 2DP8A 1LFHA 3HCQA 2QS1A 2OCUA 2Q88A 3SETA 1URSA 4TQUQ 4C1UA 1ZJLA 2HEUA 3PUZE 4KHZE 3TEPA 1Y3NA 3CFZA 3FJ7A 2X7QA 4EQ9A 5BUUA 1SBPA 3C9HA 3R6UA 1Z7ME 1ZIUA 1MDQA 3KG2A 4GXSB 4G2ZA 3SEWA 4NWCA 4I8CA 3SESA 5J1DA 4RYAA 4ND9A 1D3KA 2OWTA 3H6TA 5JTYB 1JNFA 2ESNA 4KQPA 3TTKA 3D4CA 2OLBA 3S2VA 1MY2A 4NWDA 1B40A 1N7XA 3O28A 1XVYA 2DWJA 3MWBA 2I4BA 3B6QA 2H98A 1LLSA 2H4IA 1AH5A 3JYRA 2H5YA 2H99A 5CMBA 5FHMA 1S50A 1B3FA 3C4MA 2KLFA 3MUQA 3FVNA 1R6ZA 3N94A 3PGFA 4GIZA 4QFOA 4F39A 3OO8A 3EPEA 4LZ8A 4R2FA 1SI0A 2HFBA 5DYHA 3FZVA 3OSQA 3PPRA 3LC8A 4LA9A 4PQJA 3KOTA 4I62A 4RA1A 4OFOA 1P99A 2THIA 5EHMA 5CBSA 4AB5A 1R9QA 1B2HA 4IO4A 3MP1A 1MPDA 1TXFA 1B1XA 1ZU0A 3KBRA 4F29A 1QUIA 4IGRA 4NF5A 5ICQA 3UK4A 1FW0A 3LR1A 2P0SA 4OEVA 4YKKA 4Q0CA 4Q30B 3G3FA 4R6HA 2QS4A 2ANJA 4XKQA 2XXWA 3P7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TDJ A;  3BFU A;  3HV1 A;  4ELR A;  1D9V A;  4KYS A;  3VVD A;  1MPC A;  2QL3 A;  3I6V A;  5JEI A;  4EXK A;  2V84 A;  3HST A;  1UIU A;  1NNK A;  3A3C A;  3MVY A;  3TPA A;  2GHA A;  1MQD A;  3T9X B;  1B5H A;  3LUY A;  5F1Q A;  3S9M C;  1J1N A;  3KN8 A;  2PT1 A;  3G3J A;  5TPA A;  1N3W A;  2D5W A;  2I58 A;  4YIC A;  1GVC A;  1B3H A;  2NUV A;  4KR5 A;  3IB2 A;  2VOZ A;  2XX7 A;  4BDN A;  4JBZ A;  3C32 A;  3FUZ A;  1LCT A;  3H3G A;  3W15 C;  1O64 A;  5I59 A;  1SI1 A;  3IB0 A;  4F31 B;  1DTG A;  4JSO A;  1YCJ A;  3L6H A;  4UAC A;  1GGG A;  3IL1 B;  3I5O A;  3G3G A;  2PT2 A;  4X1D A;  3U72 A;  4EF1 A;  1Y20 A;  3KN7 A;  4KYE A;  3VLW A;  1PB8 A;  1P1U A;  2DWA A;  3QK6 A;  4LON B;  4NF8 A;  5ITP A;  2Y7P A;  3KFM A;  4K3F A;  2RF1 A;  4F2O A;  1MH4 A;  2V3T A;  4X9T A;  4ZEF A;  4TLM B;  3T96 B;  1IXG A;  4OMB A;  3IOT A;  3H7M A;  1L5T A;  4DDD A;  3CSG A;  3FIR A;  3PMW A;  4IO2 A;  3A09 A;  1BLF A;  4OFJ A;  1IXI A;  2V3U A;  4H8J A;  4R2B A;  1B7U A;  2O69 A;  3OEM A;  3Q27 A;  1PBP A;  1XS5 A;  4KPT A;  4OHN A;  5H8N B;  3MBP A;  4ZEI A;  3CG3 A;  1SW5 A;  3O29 A;  2F6G A;  5AA2 A;  4O3C A;  2P2A A;  3KJ7 A;  3MP8 A;  3OSR A;  3TCH A;  4YMB A;  3E4R A;  1MM7 A;  1Y3P A;  2V93 A;  2VHA A;  4F22 A;  1ZKB A;  4YAH X;  2X7P A;  5H8Q B;  3G3I A;  1SDX A;  3LBS A;  1POY 1;  5B7D A;  1B9J A;  1TWY A;  4LVQ A;  3U1O A;  4P0I A;  4YKP A;  4QFP A;  1MY1 A;  3K6X A;  4ESW A;  5I59 B;  3FAS A;  4NF6 B;  3U92 A;  3UN6 A;  5KCJ B;  4QF9 A;  4OFL A;  1SW1 A;  2PYY A;  1B46 A;  2G93 A;  4LAT A;  2UYE A;  4WXJ A;  2HZK A;  1MY4 A;  2ZYK A;  5DVJ A;  5HM4 B;  4H5F A;  3RT8 A;  3ZS6 A;  3B6T A;  1O7T A;  1JQF A;  3K0V A;  3MJN A;  3ECR A;  3OEK A;  3OOA A;  1A8E A;  2Q89 A;  1B5J A;  2PX1 A;  4AB6 A;  3TYH A;  2ZMB A;  1Y4T A;  1Y1M A;  1SVX B;  1QUJ A;  2AIX A;  2GRV A;  1QKB A;  3CVG A;  4RK9 A;  5K2X A;  1LCF A;  1MXX A;  2GHB A;  4C1T A;  3MW0 A;  1I6Q A;  2Z8D A;  2QSX A;  1VFD A;  2DXY A;  2RKM A;  2HXW A;  3C33 A;  3OO9 A;  5EYF A;  1FCK A;  1EU8 A;  2B3F A;  2DOJ A;  1B52 A;  2P1S A;  2D3I A;  3VLU A;  1Z7N E;  2DWH A;  4JDF A;  2B65 A;  4G68 C;  1JVX A;  3RNN A;  3EHS A;  4AQ4 A;  1IEJ A;  4ISU A;  2QS3 A;  3DEL B;  4O3A A;  2XD3 A;  1HSL A;  5I2K A;  1N04 A;  1Q35 A;  2IA4 A;  2O7I A;  4OZ9 A;  4EDP A;  1UTB B;  1UTH A;  3IR1 A;  1Y4C A;  3PUV E;  4NED A;  3VE1 B;  1LFG A;  2F97 A;  3MC2 A;  3MPK A;  1M5C A;  2PVU A;  4NF4 A;  2UVI A;  3HPI A;  5AA2 D;  5AE4 A;  2QMX A;  2FA7 A;  4G77 A;  2O1L A;  3O97 A;  1BP5 A;  3MP6 A;  5I58 B;  4JB7 A;  1LAX A;  4N13 A;  1YAE A;  5HBC A;  3RLF E;  4G68 A;  4F1V A;  2YPN A;  2VP1 A;  4OER A;  2ZYO A;  2Y7R A;  3K1P A;  4DE8 A;  1YTV A;  2R9J A;  1ANF A;  1CB6 A;  1MY3 A;  3B7D A;  3FAT A;  2VD3 A;  5I2K B;  3CFX A;  2OZZ A;  2O7U A;  3PMV A;  1SYH A;  3T9H B;  3ZKL A;  1SD3 A;  4GLI A;  4ELO A;  4PE5 B;  3LSX A;  3IB1 A;  2Y7W A;  3DP4 A;  4ZS9 A;  3PPQ A;  2HQ0 A;  4JXI A;  1B05 A;  4KD5 A;  1QKA A;  2I49 A;  2QMW A;  3HO7 A;  5H8F A;  1I6A A;  1BIY A;  1MXU A;  2O84 X;  4N07 A;  1B7Z A;  1B6H A;  4QRZ A;  5I57 A;  3KSJ A;  3PPO A;  1D4N A;  2RCB A;  4XIG Q;  1LBB A;  1N3X A;  2ABH A;  3KGC A;  3SEY A;  1P1Q A;  3DM0 A;  4ELQ A;  4F2Q A;  4YB6 A;  1NH8 A;  4PFY A;  4YKJ A;  2RC9 A;  2YLN A;  2RIN A;  3HN0 A;  3K6U A;  4QFL A;  5AA3 A;  1FTL A;  3VFJ A;  1MQH A;  4JWX A;  5H8Q A;  4KYD A;  5H8N A;  1UQW A;  1N0T A;  4FIM A;  1PB7 A;  4H65 A;  4RPO A;  3Q28 A;  5TPA B;  1EZO A;  3TCF A;  5CBR A;  1OVT A;  3QIM A;  4MLV A;  4ELP A;  2QPQ A;  2NXO A;  2F7A A;  2XX8 A;  2XXU A;  3S9N C;  1A99 A;  3V89 B;  2I0C A;  3CR9 A;  1FTM A;  4LP2 B;  3K01 A;  3MAM A;  4NE4 A;  4YZZ A;  1ATG A;  3TTN A;  5IAI A;  3ILU B;  4MBP A;  2O51 A;  4GD5 A;  3VXC A;  1NNF A;  2ZNS A;  4IO6 A;  1WVJ A;  1PBQ A;  4DXC A;  3QYT A;  4NF6 A;  4NF8 B;  4WED A;  3RT6 B;  5CMM A;  3H03 A;  3SKP A;  3RY3 A;  3TAJ A;  1OQH A;  4XKP A;  5DTB A;  4YB7 A;  3O66 A;  4XKR A;  4DCX A;  3L6G A;  4OEN A;  2ONS A;  4LZ7 A;  1SQY A;  1A55 A;  2RC7 A;  3Q25 A;  3FJM A;  1TFA A;  1H44 A;  5FTH A;  5ISU A;  5L9S A;  2OK2 A;  3C34 A;  5DVI A;  4YB5 A;  5AA1 A;  5CC2 A;  5HPQ A;  3DLN A;  2DS9 A;  4PET A;  3FVO A;  4WKM A;  1B0H A;  1XOC A;  3JV9 A;  4OVJ A;  4X1B A;  3T93 B;  1US5 A;  3D4G A;  1A54 A;  2XXV A;  2XXP A;  3PUW E;  1BKA A;  2XXH A;  3CSB A;  1P1O A;  1LGB C;  2AL5 A;  3M3F A;  1F9B A;  1MXY A;  4NMY A;  3MVW A;  3PV0 E;  1IZ1 A;  4BDL A;  3PPP A;  2DE3 A;  3V83 A;  3R26 A;  2Z8E A;  4JWO A;  1LB8 A;  1ZBM A;  4QSC A;  3V5A A;  2WKY A;  1P1N A;  1LST A;  5B70 A;  3G3H A;  3TQL A;  3IAZ A;  4DIG A;  1UTB A;  1UTH B;  2F34 A;  4OYV A;  4XKN A;  4GFR A;  3U8Q A;  4F3B A;  1NMU A;  2F7B A;  4DCY A;  1M5D A;  1AL3 A;  4R75 A;  3ILT B;  4THI A;  1URG A;  1YPN A;  3TFL A;  2ZYN A;  3PMX A;  1FQF A;  3GLB A;  3IX1 A;  4RNS A;  1NH7 A;  3UGW A;  3S9L C;  1H45 A;  3FXR A;  3IK6 B;  1VR5 A;  3IO4 A;  1ELJ A;  3GBA A;  1FQD A;  5F7V A;  2RC8 A;  3MQ9 A;  5FHN A;  4QHQ A;  2F5X A;  2R6G E;  3TTL A;  2ZYM A;  3OO6 A;  1II5 A;  4FED A;  4WEP A;  5ITO A;  1P1W A;  2ZNT A;  5DEX A;  1NNT A;  4R74 A;  1R1N A;  4GL0 A;  3PPN A;  2Y7K A;  3E3K A;  1JW4 A;  4QSE A;  1LAG E;  1OVB A;  2UVJ A;  4FE8 A;  5AA4 A;  5I2N A;  1H43 A;  3RUM A;  4F3S A;  1LBC A;  1FQB A;  1Y9U A;  1FQA A;  1XT8 A;  4FAT A;  4M1V A;  1MQJ A;  4IO7 A;  3KJT A;  1SW4 A;  1DPE A;  2A5S A;  2Q2C A;  4OES A;  1FQE A;  3VVE A;  2LAO A;  4F1U A;  3K1N A;  1EZP A;  1IXH A;  5DEX B;  1XC1 A;  1D9Y A;  1FTJ A;  1XHY A;  1B4H A;  2I3V A;  3GZG A;  4G8H A;  4U1Z A;  1XVX A;  4IO5 A;  3T66 A;  3CI8 A;  3U94 A;  2DWI A;  1QJM A;  1B58 A;  1ZLQ A;  4RPN A;  1Y3Q A;  3U93 A;  2DVC A;  3N6T A;  1B7H A;  3FV2 A;  5TP9 B;  1JEU A;  2PMS A;  4ZED A;  3QSL A;  3SDF A;  2I4C A;  1MXW A;  1NKX A;  2M8C A;  1I6B A;  1MQG A;  2F8D A;  2I0B A;  4N6P A;  3K4U A;  1H3D A;  2RCA A;  1OQG A;  3PU5 A;  2NWJ A;  5JTY A;  3O2A A;  4U21 A;  4BDQ A;  4F3G A;  2QJE A;  1USY E;  2DE4 A;  3IOR A;  4R72 A;  3OD7 A;  3OO7 A;  3RTF B;  3V8X B;  3S4U A;  4DZ1 A;  5A5X A;  1KWH A;  5KDT B;  2PBW A;  3E13 X;  1MH3 A;  4ZE8 A;  4E0W A;  5H8F B;  3OEN A;  2ZXT A;  4DLD A;  5TP9 A;  3ZSF A;  2UVH A;  3ONM A;  3A3U A;  3O6G A;  3KEI A;  4MFI A;  2GFE A;  2NVU B;  1GV8 A;  3W9V A;  3IOW A;  4ZZA A;  4R6Y A;  4G4P A;  1US4 A;  2F78 A;  3MZ9 A;  2IEE A;  1T0K A;  3TKD A;  2DE2 A;  4ZEK A;  1URD A;  3DP6 A;  2GH9 A;  2CZL A;  1B0L A;  3TOD A;  3KSX A;  3Q26 A;  5KDT A;  4MH5 A;  1S9T A;  4QSD A;  3SER A;  3VVF A;  2XXQ A;  4H67 A;  5DT6 A;  1LAH E;  3MZB A;  1Y1Z A;  4GL8 A;  4IY6 A;  4POW A;  3TQW A;  2F6P A;  4ZDM A;  5I56 B;  1IUD A;  3MZ1 A;  3QAX A;  1WDN A;  4BLA A;  1MRP A;  3FV1 A;  1I69 A;  2VGQ A;  2ONR A;  1IXC A;  4XTC Q;  1SW2 A;  4GXA A;  4KI0 E;  4H5G A;  2Y7I A;  3THI A;  3CG1 A;  4R9G A;  2DXR A;  2XHD A;  4OXV A;  3SEX A;  1M5F A;  1IIT A;  4U4S A;  5ICT A;  2O68 A;  2FYI A;  4HTG A;  2I6E A;  3EN3 A;  4OEU A;  5K2Y A;  3B6W A;  4EUO A;  2O1M A;  1QUL A;  4Z0I A;  3Q29 A;  4IB2 A;  1LB9 A;  5CMC A;  2E0S A;  2Q8J A;  4TLL B;  1N7W A;  3T22 A;  3EF7 A;  4E0X A;  2UYF A;  4QFN A;  3TUS A;  1IIW A;  1GR2 A;  4HCY A;  3PD9 A;  4LQ2 A;  2QRY A;  2H9B A;  3HHF A;  4U23 A;  1S7Y A;  3MVX A;  1FTO A;  1UIV A;  3KOS A;  4C0R A;  3IOU A;  4JWY A;  1PEB A;  1JEV A;  4O3B A;  3G3K A;  3PUX E;  4DXU A;  4ZEC A;  2YJP A;  4U22 A;  1B3G A;  4BDR A;  3FD3 A;  3M3L A;  4PFT A;  4EF2 A;  4F3P A;  1AOV A;  1HSE A;  4OQO A;  2ZNU A;  1PDA A;  1MXV A;  4OTE A;  1VSO A;  3I3V A;  4KCD A;  3VLV A;  1PB9 A;  3VV5 A;  3IO6 A;  1EH3 A;  1FQC A;  2QS2 A;  3H06 B;  3PD8 A;  3N5L A;  4R9F A;  4XXU A;  3SEV A;  2HCA A;  3QXM A;  1MS7 A;  3O9P A;  4POX A;  2B3B A;  5CRY A;  5TU0 A;  3RPW A;  4MLQ A;  3C35 A;  3H6U A;  2Q2A A;  3S9E A;  4FAJ A;  1OLA A;  3KN3 A;  1RYO A;  1MM6 A;  1O63 A;  1WOD A;  3LSL A;  4ECF A;  1N76 A;  4U1O A;  5DVF A;  4Q8R A;  1QVS A;  1QW0 A;  3CFL A;  1N84 A;  3R7X A;  3UIF A;  1RYX A;  3RGY A;  3GBB A;  4F18 A;  1B51 A;  2F7C A;  3QUJ A;  2XX9 A;  3K00 A;  5A5X B;  4F1Y A;  2REJ A;  3BKI B;  2OJT A;  5FTI A;  3QUF A;  4KFQ A;  3VXB A;  4L17 A;  2Y84 A;  3AXF A;  3FXU A;  1BTJ A;  1MPB A;  1RKM A;  2V25 A;  3OXN A;  4JSD A;  3OMB A;  2XXY A;  4GVO A;  4P0G A;  5L8D A;  4F19 A;  2BJJ X;  2I48 A;  2R71 A;  3USD A;  3M3K A;  2I3W A;  2NOO A;  3JZJ A;  3BFT A;  4ONY A;  4HCW A;  4I9D A;  4IO3 A;  1QUK A;  4H1X A;  4ZE9 A;  1LAF E;  1TFD A;  2Q9T A;  1DTZ A;  3K02 A;  5LOM A;  2REG A;  5I84 A;  4EQB A;  3CRB A;  3FJG A;  4NF5 B;  4H0W A;  2F36 A;  4LZ5 A;  4EQ7 A;  4IY5 A;  5FHO A;  4BDO A;  2VD2 A;  1MQI A;  4U4X A;  1IQ7 A;  3K2D A;  3FVG A;  4GOT A;  4FOR A;  1MDP 1;  3F11 A;  3IJX B;  1USY H;  4LUB A;  2X26 A;  4PFW A;  2OBG A;  4RJZ A;  3TZA A;  3N6U A;  3TCG A;  5CM6 A;  4ESX A;  1ZMG A;  5I56 A;  4G8M A;  4YKI A;  1A40 A;  2A5T A;  4GF8 A;  3ODB A;  3GXA A;  3H6V A;  3VDF A;  2OWS A;  4EXL A;  5L9O A;  3SEU A;  2HAU A;  4IGT A;  3ZKK A;  3MVZ A;  3EHT A;  4R6K A;  4RK2 A;  4BDM A;  4TOZ A;  1R9L A;  2XXR A;  1POT A;  4M4G A;  1A7L A;  5KZT A;  1AIV A;  3T9U A;  1NFT A;  3CIJ A;  1AMF A;  1JVY A;  3H4Z A;  1DMB A;  2E1S A;  1DOT A;  1NNP A;  3K6W A;  3M8U A;  3W9W A;  4HW8 A;  3C36 A;  2FNC A;  2UXA A;  1CE2 A;  3BBR A;  4FEC A;  1H76 A;  2H25 A;  4GRK A;  4KCC A;  4G8N A;  1B4Z A;  1DPP A;  3H6W A;  2DVZ A;  3PUY E;  2A5T B;  2V3Q A;  1LFI A;  2HZL A;  3K1M A;  3TMG A;  3O6I A;  2DSF A;  2D21 A;  2O6A A;  5M2V A;  4NF4 B;  5EHS A;  4ZZE A;  2Z8F A;  1FTK A;  5I58 A;  3C31 A;  3UP9 A;  4GQO A;  1A8F A;  2XXX A;  4Q5T A;  4RXL A;  3TTR A;  3UA8 A;  1DSN A;  1OMP A;  1B1H A;  2ONK E;  4G68 B;  3T9V A;  5H8S A;  1JW5 A;  2XXI A;  5CI5 A;  1HSJ A;  2Z23 A;  3TTM A;  1PC3 A;  1OIB A;  1B5I A;  3IJO B;  4NTL A;  2DQV A;  4YU0 A;  3WAE A;  1M5B A;  1OLC A;  2XXT A;  3EQ1 A;  5H8H B;  1VE4 A;  2G29 A;  3LSF B;  1TT1 A;  1ZTY A;  4QFK A;  3IOV A;  4DXB A;  5L9M A;  3G7W A;  2Z22 A;  4H6D A;  4FEB A;  4OET A;  4P11 A;  4U2R A;  4PFU A;  4H8I A;  4PP0 A;  5ELV A;  1MY0 A;  3RQT A;  3OEL A;  4FJP A;  4ZEB A;  5AA2 B;  2CMO A;  1MG1 A;  3FXQ A;  5CMK A;  5I57 B;  1B32 A;  2ALU A;  2HAV A;  3RN8 A;  1NL5 A;  2XD2 A;  4GWO A;  3EHU A;  1EZ9 A;  1MXZ A;  2DYX A;  4RY1 A;  3WAF A;  4Z7E A;  4LQ5 A;  2AYS A;  1M5E A;  5H8H A;  3FGS A;  3N26 A;  3UOR A;  4UA8 A;  3KZG A;  3E9X A;  5AA4 B;  4OWD A;  5I2N B;  2W7Y A;  4I1D A;  2AL4 A;  1VFE A;  3HHG A;  4HS7 A;  1B3L A;  1Q1K A;  3RTW B;  3FVK A;  4MF3 A;  1JW1 A;  3TEL A;  5KCJ A;  2F35 A;  1SYI A;  1JET A;  5BWJ A;  3K6V A;  4R73 A;  4X48 A;  3DP8 A;  3LSW A;  5IKB A;  3MPL A;  1GTK A;  3O6H A;  4YMA A;  2UVG A;  5JK4 A;  1B3E A;  2DP8 A;  1LFH A;  3HCQ A;  2QS1 A;  2OCU A;  2Q88 A;  3SET A;  1URS A;  4TQU Q;  4C1U A;  1ZJL A;  2HEU A;  3PUZ E;  4KHZ E;  3TEP A;  1Y3N A;  3CFZ A;  3FJ7 A;  2X7Q A;  4EQ9 A;  5BUU A;  1SBP A;  3C9H A;  3R6U A;  1Z7M E;  1ZIU A;  1MDQ A;  3KG2 A;  4GXS B;  4G2Z A;  3SEW A;  4NWC A;  4I8C A;  3SES A;  5J1D A;  4RYA A;  4ND9 A;  1D3K A;  2OWT A;  3H6T A;  5JTY B;  1JNF A;  2ESN A;  4KQP A;  3TTK A;  3D4C A;  2OLB A;  3S2V A;  1MY2 A;  4NWD A;  1B40 A;  1N7X A;  3O28 A;  1XVY A;  2DWJ A;  3MWB A;  2I4B A;  3B6Q A;  2H98 A;  1LLS A;  2H4I A;  1AH5 A;  3JYR A;  2H5Y A;  2H99 A;  5CMB A;  5FHM A;  1S50 A;  1B3F A;  3C4M A;  2KLF A;  3MUQ A;  3FVN A;  1R6Z A;  3N94 A;  3PGF A;  4GIZ A;  4QFO A;  4F39 A;  3OO8 A;  3EPE A;  4LZ8 A;  4R2F A;  1SI0 A;  2HFB A;  5DYH A;  3FZV A;  3OSQ A;  3PPR A;  3LC8 A;  4LA9 A;  4PQJ A;  3KOT A;  4I62 A;  4RA1 A;  4OFO A;  1P99 A;  2THI A;  5EHM A;  5CBS A;  4AB5 A;  1R9Q A;  1B2H A;  4IO4 A;  3MP1 A;  1MPD A;  1TXF A;  1B1X A;  1ZU0 A;  3KBR A;  4F29 A;  1QUI A;  4IGR A;  4NF5 A;  5ICQ A;  3UK4 A;  1FW0 A;  3LR1 A;  2P0S A;  4OEV A;  4YKK A;  4Q0C A;  4Q30 B;  3G3F A;  4R6H A;  2QS4 A;  2ANJ A;  4XKQ A;  2XXW A;  3P7I A; 
#chains in the Genus database with same CATH topology
 1D9V A;  3I6V A;  4EXK A;  3MVY A;  1FBP A;  2GHA A;  2Q8M A;  3T9X B;  3LUY A;  4YIC A;  3E78 A;  2HHM A;  3C32 A;  3FUZ A;  1LCT A;  3H3G A;  3W15 C;  5I59 A;  3IB0 A;  4JSO A;  3MYU A;  4I3E A;  1GGG A;  3CHG A;  1NUX A;  4PF8 A;  3G3G A;  2PT2 A;  4X1D A;  4EF1 A;  4KYE A;  3VLW A;  1PB8 A;  5ITP A;  4MEV A;  4K3F A;  4P1L A;  4OVS A;  4OMB A;  3CSG A;  2QVR A;  1BLF A;  4R2B A;  1B7U A;  4P47 A;  5H8N B;  1XS5 A;  2F6G A;  4O3C A;  2P2A A;  3E4R A;  1MM7 A;  2V93 A;  2VHA A;  1SDX A;  5B7D A;  3U1O A;  3NOH A;  4ESW A;  3FAS A;  3U92 A;  5KCJ B;  1SW1 A;  2PYY A;  1B46 A;  2G93 A;  5DVJ A;  5HM4 B;  4H5F A;  3ZS6 A;  3MJN A;  1FPJ A;  1NV2 A;  1Y4T A;  4C1T A;  2Z8D A;  1VFD A;  1EU8 A;  1FCK A;  2B3F A;  3VLU A;  1Z7N E;  4XF5 A;  4ISU A;  3DEL B;  4EDP A;  1UTB B;  3IR1 A;  3VE1 B;  1Y4C A;  5AE4 A;  3MPK A;  3O97 A;  5HBC A;  2Y7R A;  1ANF A;  3FAT A;  3CFX A;  3T9H B;  1SYH A;  4MNC A;  2Y7W A;  1QKA A;  5H8F A;  2O84 X;  1B6H A;  4QRZ A;  3PPO A;  1D4N A;  2RCB A;  2ABH A;  4F2Q A;  5EQA A;  4YB6 A;  1NH8 A;  4YKJ A;  1MQH A;  4JWX A;  4MAG A;  5H8Q A;  1PB7 A;  3Q28 A;  5CBR A;  1OVT A;  4ELP A;  2QPQ A;  2F7A A;  2XA5 A;  2I0C A;  1FTM A;  4LP2 B;  4NE4 A;  5IAI A;  1ATG A;  3RPL A;  4GD5 A;  4P3L A;  4WED A;  3RY3 A;  3TAJ A;  4DCX A;  5ISU A;  2OK2 A;  5DVI A;  4PET A;  2L5V A;  5ET8 A;  3ROJ A;  3PUW E;  3SZP A;  1F9B A;  2Z8E A;  4PE3 A;  1LB8 A;  4QSC A;  3V5A A;  1P1N A;  4N91 A;  3IAZ A;  1LBZ A;  4GFR A;  4PFI A;  4XKN A;  1NMU A;  1M5D A;  3TFL A;  3PMX A;  4RNS A;  2OX3 A;  3S9L C;  1VR5 A;  1FQD A;  3MQ9 A;  5FHN A;  2R6G E;  1II5 A;  4WEP A;  1P1W A;  2ZNT A;  5DEX A;  1R1N A;  4AS4 A;  1OVB A;  3RUM A;  1FQB A;  2Q2C A;  4G8H A;  2I3V A;  1B4H A;  1FPF A;  1XVX A;  4RPN A;  1B7H A;  1JEU A;  2PMS A;  4PAK A;  2I4C A;  1I6B A;  2F8D A;  3PU5 A;  2RCA A;  1OQG A;  4U21 A;  4BDQ A;  4F3G A;  2QJE A;  4R72 A;  3OD7 A;  3V8X B;  1RDY A;  5KDT B;  2PBW A;  1MH3 A;  3OEN A;  2ZXT A;  2R8T A;  4DLD A;  3ZSF A;  2NVU B;  1BK4 A;  1US4 A;  2IEE A;  1URD A;  1B0L A;  1NV0 A;  1EYI A;  1LAH E;  3TQW A;  1IUD A;  1MRP A;  3FV1 A;  1I69 A;  2ONR A;  3THI A;  4H5G A;  2Y7I A;  3CG1 A;  2DXR A;  4OXV A;  4MX6 A;  4OVR A;  1K9Z A;  4TLL B;  1GR2 A;  4HCY A;  3PD9 A;  2H9B A;  3KC0 A;  4P8B A;  1PEB A;  3PUX E;  3IFA A;  4U22 A;  3M3L A;  4F3P A;  3N5L A;  2HCA A;  3QXM A;  5CRY A;  4MLQ A;  4HXV A;  4U1O A;  4Q8R A;  1QVS A;  3CFL A;  3UIF A;  4F18 A;  3GBB A;  3BKI B;  2OJT A;  1BTJ A;  1MPB A;  1RKM A;  4JSD A;  3OMB A;  4GVO A;  2I48 A;  3USD A;  3JZJ A;  2CEY A;  3FJG A;  4LZ5 A;  2F36 A;  4EQ7 A;  4IY5 A;  4BDO A;  3RPL B;  2X26 A;  4RJZ A;  4ESX A;  4G8M A;  4YKI A;  4GF8 A;  4FBP A;  4P9K A;  4N8Y A;  2HAU A;  4NAP A;  1R9L A;  2XXR A;  3CIJ A;  1AMF A;  1JVY A;  5JEI A;  1DMB A;  2E1S A;  3K6W A;  1NNP A;  3M8U A;  5A5X B;  4KR5 A;  3BBR A;  4G8N A;  1B4Z A;  2DVZ A;  1G0I A;  3PUY E;  2DSF A;  4NF4 B;  4GQO A;  1A8F A;  4Q5T A;  1OMP A;  5H8S A;  2XXI A;  1HSJ A;  4NTL A;  4YU0 A;  2DQV A;  1AWB A;  1VE4 A;  2G29 A;  5L9M A;  5IM2 A;  4PFU A;  4PP0 A;  3OEL A;  1MG1 A;  5CMK A;  5I57 B;  1B32 A;  4NN3 A;  1NL5 A;  1EZ9 A;  4LQ5 A;  4MNI A;  4OWD A;  2W7Y A;  1B3L A;  3RTW B;  5KCJ A;  1KA1 A;  1SYI A;  4R73 A;  1GTK A;  1B3E A;  5EYH A;  2Q88 A;  3KBZ A;  3SET A;  2HEU A;  3PUZ E;  2B4M A;  3CFZ A;  1Z7M E;  4GXS B;  3KG2 A;  1D9Q A;  4RYA A;  4H46 A;  4DI3 D;  1JNF A;  3D1R A;  4P1E A;  2DWJ A;  3MWB A;  1LLS A;  2H5Y A;  2H99 A;  5FHM A;  2KLF A;  4GIZ A;  3PGF A;  1R6Z A;  4F39 A;  3KOT A;  4OFO A;  1Q9D A;  1B2H A;  4NHB A;  5IGA A;  1ZU0 A;  5ICQ A;  4IGR A;  4NF5 A;  3LR1 A;  4OEV A;  4YKK A;  4R6H A;  1IME A;  2XXW A;  2HPG A;  4GWX A;  3HV1 A;  3T0J A;  1MPC A;  4PAI A;  4PGN A;  3HST A;  4MNP A;  3A3C A;  1B5H A;  3S9M C;  5F1Q A;  2XX7 A;  4BDN A;  1O64 A;  1SI1 A;  4F31 B;  1YCJ A;  3L6H A;  3I5O A;  3U72 A;  4NGU A;  3QK6 A;  1NV5 A;  4F2O A;  1MH4 A;  4ZEF A;  3IOT A;  1L5T A;  3FIR A;  3PMW A;  3A09 A;  5H8Q B;  1PBP A;  4O94 A;  5AA2 A;  5I7I A;  4HE2 A;  3G3I A;  2WEF A;  1TWY A;  5IZ1 A;  4YKP A;  4QFP A;  4WXJ A;  4QXD A;  3RT8 A;  1FPE A;  1JQF A;  1A8E A;  2Q89 A;  1FPL A;  1NUZ A;  3TYH A;  2ZMB A;  1QKB A;  5K2X A;  1LCF A;  1MXX A;  3MW0 A;  2RKM A;  5LDZ A;  2DOJ A;  1B52 A;  3FXB A;  2D3I A;  2DWH A;  4JDF A;  4G68 C;  1NI9 A;  3RNN A;  2QS3 A;  1G0H A;  2XD3 A;  4NED A;  2F97 A;  4NF4 A;  4JB7 A;  1LAX A;  4F1V A;  2VP1 A;  2FIE A;  3B7D A;  1CB6 A;  5I2K B;  2VD3 A;  2KR0 A;  3DP4 A;  4ZS9 A;  1FBF A;  5I57 A;  1B7Z A;  5IZZ A;  1LBB A;  3SEY A;  1P1Q A;  1NV3 A;  2RC9 A;  3K6U A;  4QFL A;  3VFJ A;  4KYD A;  4H65 A;  4JVD A;  3V89 B;  4MHF A;  4OVQ A;  2XWK A;  4MBP A;  2O51 A;  2ZNS A;  4IO6 A;  4NF8 B;  4NF6 A;  5CMM A;  4XKP A;  5DTB A;  3O66 A;  4XKR A;  3L6G A;  4OEN A;  4N6D A;  2ONS A;  4LZ7 A;  2RC7 A;  3Q25 A;  3FJM A;  1TFA A;  5FTH A;  3C34 A;  5CC2 A;  1B0H A;  1XOC A;  4OVJ A;  5I58 B;  3PTY A;  1A54 A;  2XXP A;  4FOR A;  1BKA A;  1INP A;  2KQZ A;  2DDK A;  2DE3 A;  3V83 A;  3R26 A;  4JWO A;  1VDW A;  2VT5 A;  4UAB A;  2WYK A;  3G3H A;  3TQL A;  4PF6 A;  3U8Q A;  4F3B A;  1DBZ A;  1AL3 A;  4THI A;  1URG A;  1NH7 A;  3FXR A;  2P3N A;  3IFC A;  3IO4 A;  1ELJ A;  5ET7 A;  3OO6 A;  4R74 A;  2Y7K A;  3E3K A;  4QSE A;  5AA4 A;  4FE8 A;  1H43 A;  1LBC A;  1FQA A;  4IO7 A;  3KJT A;  1SW4 A;  1NV1 A;  1DPE A;  2LAO A;  2MKZ A;  1EZP A;  1IXH A;  1XC1 A;  1XHY A;  3U94 A;  1Y3Q A;  3FV2 A;  4ZED A;  3QSL A;  3SDF A;  1FRP A;  1NKX A;  1MQG A;  1USY E;  2DE4 A;  3RTF B;  4DZ1 A;  5A5X A;  1KWH A;  4ZE8 A;  4E0W A;  5TP9 A;  2UVH A;  3ONM A;  4MFI A;  3W9V A;  3MST A;  4ZZA A;  3MZ9 A;  1T0K A;  3E79 A;  2GH9 A;  4MH5 A;  1K9Y A;  1S9T A;  4QSD A;  4MIJ A;  5DT6 A;  4H67 A;  4GL8 A;  3QAX A;  2VGQ A;  1SW2 A;  4KI0 E;  4GBV A;  2XHD A;  3SEX A;  1IIT A;  2O68 A;  4EUO A;  4OEU A;  5CMC A;  4E0X A;  3EF7 A;  2UYF A;  2QRY A;  1FTO A;  3IOU A;  4O7I A;  4ZEC A;  4DXU A;  4BDR A;  4PFT A;  1AOV A;  4OQO A;  2QVU A;  1MXV A;  4PDH A;  1VSO A;  3I3V A;  3VV5 A;  1FQC A;  3H06 B;  3PD8 A;  3SEV A;  1MS7 A;  3C35 A;  2Q2A A;  3KN3 A;  1O63 A;  1WOD A;  3LSL A;  1FBD A;  3R7X A;  1RYX A;  1B51 A;  5ESY A;  4NG7 A;  3K00 A;  1RDX A;  5FTI A;  4L17 A;  5L8D A;  2NOO A;  4ONY A;  4HCW A;  4I9D A;  4IO3 A;  4AS5 A;  4ZE9 A;  3K02 A;  2REG A;  3CRB A;  4NF5 B;  1KZ8 A;  4GOT A;  4KXP A;  4LUB A;  2FBP A;  3N6U A;  3ODB A;  4BDM A;  1POT A;  1A7L A;  1AIV A;  1DOT A;  4GRK A;  1DPP A;  2QVV A;  2A5T B;  2V3Q A;  3TMG A;  3TTR A;  3UA8 A;  1DSN A;  4N15 A;  2ONK E;  1FBC A;  4GX6 A;  3IJO B;  1NV6 A;  1TT1 A;  3KC1 A;  3G7W A;  4H6D A;  4FEB A;  4OET A;  4ZEB A;  5AA2 B;  2ALU A;  3WAF A;  4Z7E A;  2AYS A;  1M5E A;  4N8G A;  5H8H A;  1FSA A;  3FGS A;  1FBH A;  5AA4 B;  3E9X A;  2QFL A;  2AL4 A;  3HHG A;  1JW1 A;  3K6V A;  5I3S A;  4X48 A;  3DP8 A;  5IKB A;  1EZO A;  3MPL A;  3O6H A;  1LBV A;  2QS1 A;  3TEP A;  1MDQ A;  5J1D A;  4NWC A;  3SES A;  1D3K A;  2OWT A;  1SPI A;  3S2V A;  1MY2 A;  1XVY A;  3B6Q A;  2H98 A;  1AH5 A;  3JYR A;  2HXR A;  3C4M A;  3FVN A;  4LN5 A;  3EPE A;  5DYH A;  3FZV A;  3PPR A;  3LC8 A;  4H45 A;  4RA1 A;  1P99 A;  5CBS A;  1R9Q A;  1TXF A;  1B1X A;  3KBR A;  4F29 A;  4Q0C A;  3QMF A;  3BFU A;  4KYS A;  4OA4 A;  2V84 A;  3TPA A;  3G3J A;  2D5W A;  2I58 A;  3IB2 A;  2VOZ A;  4JBZ A;  4UAC A;  3IL1 B;  1Y20 A;  1P1U A;  4NF8 A;  3KFM A;  4GWY A;  4X9T A;  3T96 B;  4TLM B;  4OFJ A;  1IXI A;  2V3U A;  1RDZ A;  3OEM A;  2O69 A;  3Q27 A;  4OHN A;  3MBP A;  3CG3 A;  3O29 A;  3MP8 A;  3OSR A;  3TCH A;  1ZKB A;  4YAH X;  2X7P A;  1DCU A;  3LBS A;  1POY 1;  4LVQ A;  5EQ9 A;  1MY1 A;  4X8R A;  3K6X A;  4NF6 B;  4QF9 A;  1MY4 A;  3B6T A;  3ECR A;  1B5J A;  2PX1 A;  4AB6 A;  2AIX A;  5I58 A;  2GRV A;  2GHB A;  2QSX A;  3C33 A;  2DXY A;  3OO9 A;  4PAF A;  5EYF A;  2P1S A;  4PBH A;  2B65 A;  2Y5L A;  5I5P A;  1JVX A;  3EHS A;  4AQ4 A;  1IEJ A;  4O3A A;  1HSL A;  1N04 A;  1Q35 A;  2PFZ A;  2O7I A;  3GYY A;  1LFG A;  2PVU A;  2UVI A;  2QMX A;  2FA7 A;  4G77 A;  2O1L A;  3RLF E;  1YAE A;  2YPN A;  1FPD A;  4OER A;  2ZYO A;  2XXK A;  1YTV A;  3PMV A;  4GLI A;  3LSX A;  4PFB A;  3PPQ A;  4JXI A;  4KD5 A;  2CZK A;  2QMW A;  3HO7 A;  1MXU A;  4N07 A;  4XIG Q;  4IR8 A;  4ELQ A;  3KGC A;  3BIG A;  2YLN A;  2RIN A;  5AA3 A;  4FIM A;  5TPA B;  4MMP A;  3TCF A;  4X04 A;  2XX8 A;  3CR9 A;  3MAM A;  3TTN A;  1LBY A;  3VXC A;  1NNF A;  4XFE A;  5DW8 A;  1WVJ A;  1PBQ A;  3QYT A;  3RT6 B;  3SKP A;  4YB7 A;  1DK4 A;  1IMF A;  1H44 A;  4NQ8 A;  5AA1 A;  3DLN A;  3FVO A;  3JV9 A;  4X1B A;  3T93 B;  3D4G A;  2XXH A;  4DI4 B;  3M3F A;  1LGB C;  2AL5 A;  1MXY A;  2WBD A;  4NMY A;  3PV0 E;  1IZ1 A;  4NX1 A;  2WKY A;  1LST A;  1UTH B;  4N6K A;  4GX3 A;  2ZYN A;  1FQF A;  3GLB A;  1LBW A;  3IK6 B;  4PGP A;  3GBA A;  1YZ0 A;  4QHQ A;  4P56 A;  2F5X A;  3TTL A;  5ITO A;  3T1B A;  4GL0 A;  2UVJ A;  1Y9U A;  2GQ1 A;  4FAT A;  1FPB A;  4OES A;  2Y5K A;  3VVE A;  4F1U A;  3K1N A;  5DEX B;  4U1Z A;  1D9Y A;  1FTJ A;  3RYD A;  3GZG A;  2ZZV A;  4IO5 A;  3CI8 A;  4AB5 A;  1QJM A;  1B58 A;  2DVC A;  5ET6 A;  3EKI A;  2M8C A;  5EQ7 A;  1IMA A;  1H3D A;  2NWJ A;  5JTY A;  3O2A A;  1KA0 A;  3OO7 A;  1JP4 A;  5T3J A;  3A3U A;  3O6G A;  3KEI A;  2GFE A;  4JVI A;  4R6Y A;  4G4P A;  2F78 A;  2DE2 A;  4ZEK A;  5J16 A;  1NUW A;  2FIX A;  3TOD A;  3KSX A;  5KDT A;  3VVF A;  3MZB A;  4POW A;  3MZ1 A;  1QGX A;  4BLA A;  4XTC Q;  4GXA A;  1M5F A;  4U4S A;  2FYI A;  4HTG A;  3A29 A;  2I6E A;  3EN3 A;  5K2Y A;  2O1M A;  1QUL A;  2Q8J A;  3Q29 A;  4IB2 A;  3UGW A;  2E0S A;  1IIW A;  4GX4 A;  1S7Y A;  1UIV A;  4C0R A;  4JWY A;  3G3K A;  4EF2 A;  2FVZ A;  1HSE A;  4XXU A;  2QS2 A;  4MCO A;  4R9F A;  4POX A;  3O9P A;  3RPW A;  2B3B A;  3H6U A;  4G61 A;  1OLA A;  1MM6 A;  2F7C A;  4F1Y A;  2REJ A;  3VXB A;  2Y84 A;  3AXF A;  3U65 A;  2V25 A;  2R71 A;  2I3W A;  3BFT A;  4GBW A;  1QUK A;  3LV0 A;  5LOM A;  4EQB A;  4H0W A;  5FHO A;  2VD2 A;  1MQI A;  1IQ7 A;  1YXI A;  3FVG A;  3IJX B;  4PFW A;  1FBE A;  1LEV A;  3TCG A;  5CM6 A;  5I56 A;  4PBQ A;  3GXA A;  5L9O A;  3ZKK A;  4R6K A;  4TOZ A;  4M4G A;  3T9U A;  2PCR A;  4FEC A;  1H76 A;  5EQ8 A;  1LFI A;  2HZL A;  3K1M A;  3O6I A;  5M2V A;  2Z8F A;  3C31 A;  3UP9 A;  2VPO A;  2XXX A;  1B1H A;  4G68 B;  1JW5 A;  3TTM A;  1PC3 A;  1OIB A;  1B5I A;  1OLC A;  2XXT A;  3EQ1 A;  2WBB A;  1ZTY A;  4QFK A;  4DXB A;  5ELV A;  5A5L A;  3FXQ A;  2XWO A;  2HAV A;  4GWO A;  3EHU A;  1MXZ A;  2DYX A;  4UA8 A;  4N81 A;  5F24 A;  4HS7 A;  3FVK A;  1YYZ A;  4YMA A;  2XWI A;  2DP8 A;  5LTC A;  3HCQ A;  2OCU A;  2CZH A;  4PFR A;  3FJ7 A;  2X7Q A;  1NUY A;  3C9H A;  3SEW A;  5JTY B;  2ESN A;  3TTK A;  2OLB A;  4NWD A;  1B40 A;  1NV4 A;  2H4I A;  4PDD A;  5FBP A;  5CMB A;  1S50 A;  1B3F A;  3MUQ A;  4QFO A;  4LZ8 A;  4R2F A;  2HFB A;  3OSQ A;  4PQJ A;  2F3B A;  4I62 A;  2B4L A;  2WX9 A;  4IO4 A;  4MJO A;  1FW0 A;  2ANJ A;  4XKQ A;  1CNQ A;  3TDJ A;  4ELR A;  3VVD A;  2QL3 A;  1NV7 A;  1UIU A;  1NNK A;  1MQD A;  1J1N A;  3KN8 A;  2CZI A;  2PT1 A;  5TPA A;  1N3W A;  1GVC A;  1IMD A;  1B3H A;  2NUV A;  1DTG A;  3KN7 A;  2DWA A;  4LON B;  2Y7P A;  2RF1 A;  5IZ3 B;  2V3T A;  1IXG A;  4GWW A;  4DDD A;  4PCD A;  3H7M A;  4IO2 A;  4PC9 A;  4H8J A;  4KPT A;  4ZEI A;  1SW5 A;  3KJ7 A;  4YMB A;  1Y3P A;  4F22 A;  1B9J A;  4O7M A;  4P0I A;  3UN6 A;  4OFL A;  4LAT A;  2UYE A;  2HZK A;  2ZYK A;  4OVP A;  1O7T A;  2FHY A;  3K0V A;  3OOA A;  3OEK A;  1Y1M A;  1SVX B;  1QUJ A;  3CVG A;  4RK9 A;  1I6Q A;  2HXW A;  5I2K A;  1EYK A;  2IA4 A;  4OZ9 A;  1UTH A;  3PUV E;  2WYP A;  3MC2 A;  1M5C A;  5AA2 D;  3HPI A;  1BP5 A;  3MP6 A;  4N13 A;  5EYG A;  4G68 A;  2ZZW A;  3K1P A;  4DE8 A;  2R9J A;  5I59 B;  1MY3 A;  2OZZ A;  2O7U A;  4O8M A;  3ZKL A;  1SD3 A;  4ELO A;  4PE5 B;  2XWV A;  3IB1 A;  2HQ0 A;  1B05 A;  2I49 A;  1I6A A;  1BIY A;  3KSJ A;  1N3X A;  4HE0 A;  3DM0 A;  3HFU A;  4PFY A;  3HN0 A;  1FTL A;  5H8N A;  1UQW A;  1N0T A;  4RPO A;  3QIM A;  4MLV A;  2NXO A;  2XXU A;  3S9N C;  1FTA A;  1A99 A;  4PTK A;  3FBP A;  3K01 A;  3ISP A;  4YZZ A;  3ILU B;  4DXC A;  2F3D A;  3H03 A;  1OQH A;  1SQY A;  1A55 A;  4YB5 A;  5HPQ A;  2DS9 A;  4N17 A;  5ET5 A;  4WKM A;  4DCY A;  2V4C A;  4GWU A;  1US5 A;  2XXV A;  3BIH A;  1FPI A;  3CSB A;  1P1O A;  4BDL A;  3MVW A;  3PPP A;  2VPN A;  1ZBM A;  1FPK A;  5B70 A;  2PFY A;  4DIG A;  1UTB A;  2F34 A;  4HE1 A;  4OYV A;  2F7B A;  4R75 A;  3ILT B;  3B8B A;  1YPN A;  1FJ6 A;  3IX1 A;  1H45 A;  5F7V A;  4OVT A;  2RC8 A;  2CEX A;  2ZYM A;  4FED A;  1NNT A;  3PPN A;  1JW4 A;  1LAG E;  5I2N A;  1XT8 A;  4M1V A;  1MQJ A;  4OAN A;  1IMC A;  2A5S A;  1FQE A;  3T66 A;  2DWI A;  3U93 A;  1ZLQ A;  1XI6 A;  3N6T A;  5TP9 B;  5BUU A;  1MXW A;  1FJ9 A;  2I0B A;  4N6P A;  3K4U A;  1IMB A;  3IOR A;  3S4U A;  3E13 X;  5H8F B;  1GV8 A;  3IOW A;  4I40 A;  3TKD A;  2P3V A;  3DP6 A;  2CZL A;  3Q26 A;  2BJI A;  3SER A;  2XXQ A;  5I56 B;  1Y1Z A;  4IY6 A;  2F6P A;  4ZDM A;  1WDN A;  1IXC A;  1LBX A;  4R9G A;  5ICT A;  2OWZ A;  3B6W A;  4Z0I A;  4F3S A;  1LB9 A;  3T22 A;  1N7W A;  4N4U A;  4QFN A;  3TUS A;  4LQ2 A;  3HHF A;  4U23 A;  4GWZ A;  3MVX A;  3KOS A;  1JEV A;  4O3B A;  2YJP A;  1B3G A;  3FD3 A;  2ZNU A;  1PDA A;  4OTE A;  3VLV A;  4KCD A;  1PB9 A;  3IO6 A;  1EH3 A;  5TU0 A;  5L9S A;  3S9E A;  4FAJ A;  1RYO A;  4ECF A;  1N76 A;  5DVF A;  1QW0 A;  1N84 A;  3RGY A;  3QUJ A;  2XX9 A;  3QUF A;  4KFQ A;  3FXU A;  4P0G A;  3OXN A;  2XXY A;  4F19 A;  2BJJ X;  3M3K A;  4NF0 A;  4H1X A;  1LAF E;  1TFD A;  2Q9T A;  1DTZ A;  5I84 A;  4U4X A;  3K2D A;  1MDP 1;  3F11 A;  1USY H;  3TZA A;  2OBG A;  1FPG A;  1ZMG A;  1A40 A;  2A5T A;  3H6V A;  3VDF A;  2OWS A;  4EXL A;  3SEU A;  4IGT A;  3MVZ A;  3EHT A;  4RK2 A;  5KZT A;  4GWS A;  1NFT A;  3H4Z A;  3W9W A;  4HW8 A;  2Q74 A;  4XEQ A;  3C36 A;  2FNC A;  2UXA A;  1CE2 A;  4KCC A;  3TEL A;  2H25 A;  3H6W A;  2D21 A;  2O6A A;  5EHS A;  4ZZE A;  1FTK A;  4RXL A;  2ZZX A;  3T9V A;  5CI5 A;  2Z23 A;  3WAE A;  1M5B A;  5H8H B;  3LSF B;  3IOV A;  2Z22 A;  4P11 A;  4U2R A;  4H8I A;  1MY0 A;  3RQT A;  4FJP A;  1FBG A;  2CMO A;  3RN8 A;  2XD2 A;  4RY1 A;  3N26 A;  3UOR A;  3KZG A;  5I2N B;  4I1D A;  1VFE A;  2JJK A;  1Q1K A;  4MF3 A;  2F35 A;  5BWJ A;  1JET A;  3LSW A;  5IZ3 A;  5JK4 A;  1LFH A;  2UVG A;  3B50 A;  1URS A;  4TQU Q;  4C1U A;  1ZJL A;  4KHZ E;  1Y3N A;  1SBP A;  3R6U A;  1ZIU A;  4EQ9 A;  4G2Z A;  4I8C A;  4ND9 A;  4QBA A;  3H6T A;  4KQP A;  3D4C A;  3LUZ A;  1N7X A;  3O28 A;  2I4B A;  3N94 A;  1EYJ A;  3OO8 A;  1SI0 A;  4LA9 A;  4JVC A;  4I3Y A;  2THI A;  5EHM A;  3MP1 A;  1MPD A;  1QUI A;  3UK4 A;  2P0S A;  4Q30 B;  3G3F A;  2QS4 A;  3P7I A; 
#chains in the Genus database with same CATH homology
 3TDJ A;  3BFU A;  3HV1 A;  4ELR A;  1D9V A;  4KYS A;  3VVD A;  1MPC A;  2QL3 A;  3I6V A;  5JEI A;  4EXK A;  2V84 A;  3HST A;  1UIU A;  1NNK A;  3A3C A;  3MVY A;  3TPA A;  2GHA A;  1MQD A;  3T9X B;  1B5H A;  3LUY A;  5F1Q A;  3S9M C;  1J1N A;  3KN8 A;  2PT1 A;  3G3J A;  5TPA A;  1N3W A;  2D5W A;  2I58 A;  4YIC A;  1GVC A;  1B3H A;  2NUV A;  4KR5 A;  3IB2 A;  2VOZ A;  2XX7 A;  4BDN A;  4JBZ A;  3C32 A;  3FUZ A;  1LCT A;  3H3G A;  3W15 C;  1O64 A;  5I59 A;  1SI1 A;  3IB0 A;  4F31 B;  1DTG A;  4JSO A;  1YCJ A;  3L6H A;  4UAC A;  1GGG A;  3IL1 B;  3I5O A;  3G3G A;  2PT2 A;  4X1D A;  3U72 A;  4EF1 A;  1Y20 A;  3KN7 A;  4KYE A;  3VLW A;  1PB8 A;  1P1U A;  2DWA A;  3QK6 A;  4LON B;  4NF8 A;  5ITP A;  2Y7P A;  3KFM A;  4K3F A;  2RF1 A;  4F2O A;  1MH4 A;  2V3T A;  4X9T A;  4ZEF A;  4TLM B;  3T96 B;  1IXG A;  4OMB A;  3IOT A;  3H7M A;  1L5T A;  4DDD A;  3CSG A;  3FIR A;  3PMW A;  4IO2 A;  3A09 A;  1BLF A;  4OFJ A;  1IXI A;  2V3U A;  4H8J A;  4R2B A;  1B7U A;  2O69 A;  3OEM A;  3Q27 A;  1PBP A;  1XS5 A;  4KPT A;  4OHN A;  5H8N B;  3MBP A;  4ZEI A;  3CG3 A;  1SW5 A;  3O29 A;  2F6G A;  5AA2 A;  4O3C A;  2P2A A;  3KJ7 A;  3MP8 A;  3OSR A;  3TCH A;  4YMB A;  3E4R A;  1MM7 A;  1Y3P A;  2V93 A;  2VHA A;  4F22 A;  1ZKB A;  4YAH X;  2X7P A;  5H8Q B;  3G3I A;  1SDX A;  3LBS A;  1POY 1;  5B7D A;  1B9J A;  1TWY A;  4LVQ A;  3U1O A;  4P0I A;  4YKP A;  4QFP A;  1MY1 A;  3K6X A;  4ESW A;  5I59 B;  3FAS A;  4NF6 B;  3U92 A;  3UN6 A;  5KCJ B;  4QF9 A;  4OFL A;  1SW1 A;  2PYY A;  1B46 A;  2G93 A;  4LAT A;  2UYE A;  4WXJ A;  2HZK A;  1MY4 A;  2ZYK A;  5DVJ A;  5HM4 B;  4H5F A;  3RT8 A;  3ZS6 A;  3B6T A;  1O7T A;  1JQF A;  3K0V A;  3MJN A;  3ECR A;  3OEK A;  3OOA A;  1A8E A;  2Q89 A;  1B5J A;  2PX1 A;  4AB6 A;  3TYH A;  2ZMB A;  1Y4T A;  1Y1M A;  1SVX B;  1QUJ A;  2AIX A;  2GRV A;  1QKB A;  3CVG A;  4RK9 A;  5K2X A;  1LCF A;  1MXX A;  2GHB A;  4C1T A;  3MW0 A;  1I6Q A;  2Z8D A;  2QSX A;  1VFD A;  2DXY A;  2RKM A;  2HXW A;  3C33 A;  3OO9 A;  5EYF A;  1FCK A;  1EU8 A;  2B3F A;  2DOJ A;  1B52 A;  2P1S A;  2D3I A;  3VLU A;  1Z7N E;  2DWH A;  4JDF A;  2B65 A;  4G68 C;  1JVX A;  3RNN A;  3EHS A;  4AQ4 A;  1IEJ A;  4ISU A;  2QS3 A;  3DEL B;  4O3A A;  2XD3 A;  1HSL A;  5I2K A;  1N04 A;  1Q35 A;  2IA4 A;  2O7I A;  4OZ9 A;  4EDP A;  1UTB B;  1UTH A;  3IR1 A;  1Y4C A;  3PUV E;  4NED A;  3VE1 B;  1LFG A;  2F97 A;  3MC2 A;  3MPK A;  1M5C A;  2PVU A;  4NF4 A;  2UVI A;  3HPI A;  5AA2 D;  5AE4 A;  2QMX A;  2FA7 A;  4G77 A;  2O1L A;  3O97 A;  1BP5 A;  3MP6 A;  5I58 B;  4JB7 A;  1LAX A;  4N13 A;  1YAE A;  5HBC A;  3RLF E;  4G68 A;  4F1V A;  2YPN A;  2VP1 A;  4OER A;  2ZYO A;  2Y7R A;  3K1P A;  4DE8 A;  1YTV A;  2R9J A;  1ANF A;  1CB6 A;  1MY3 A;  3B7D A;  3FAT A;  2VD3 A;  5I2K B;  3CFX A;  2OZZ A;  2O7U A;  3PMV A;  1SYH A;  3T9H B;  3ZKL A;  1SD3 A;  4GLI A;  4ELO A;  4PE5 B;  3LSX A;  3IB1 A;  2Y7W A;  3DP4 A;  4ZS9 A;  3PPQ A;  2HQ0 A;  4JXI A;  1B05 A;  4KD5 A;  1QKA A;  2I49 A;  2QMW A;  3HO7 A;  5H8F A;  1I6A A;  1BIY A;  1MXU A;  2O84 X;  4N07 A;  1B7Z A;  1B6H A;  4QRZ A;  5I57 A;  3KSJ A;  3PPO A;  1D4N A;  2RCB A;  4XIG Q;  1LBB A;  1N3X A;  2ABH A;  3KGC A;  3SEY A;  1P1Q A;  3DM0 A;  4ELQ A;  4F2Q A;  4YB6 A;  1NH8 A;  4PFY A;  4YKJ A;  2RC9 A;  2YLN A;  2RIN A;  3HN0 A;  3K6U A;  4QFL A;  5AA3 A;  1FTL A;  3VFJ A;  1MQH A;  4JWX A;  5H8Q A;  4KYD A;  5H8N A;  1UQW A;  1N0T A;  4FIM A;  1PB7 A;  4H65 A;  4RPO A;  3Q28 A;  5TPA B;  1EZO A;  3TCF A;  5CBR A;  1OVT A;  3QIM A;  4MLV A;  4ELP A;  2QPQ A;  2NXO A;  2F7A A;  2XX8 A;  2XXU A;  3S9N C;  1A99 A;  3V89 B;  2I0C A;  3CR9 A;  1FTM A;  4LP2 B;  3K01 A;  3MAM A;  4NE4 A;  4YZZ A;  1ATG A;  3TTN A;  5IAI A;  3ILU B;  4MBP A;  2O51 A;  4GD5 A;  3VXC A;  1NNF A;  2ZNS A;  4IO6 A;  1WVJ A;  1PBQ A;  4DXC A;  3QYT A;  4NF6 A;  4NF8 B;  4WED A;  3RT6 B;  5CMM A;  3H03 A;  3SKP A;  3RY3 A;  3TAJ A;  1OQH A;  4XKP A;  5DTB A;  4YB7 A;  3O66 A;  4XKR A;  4DCX A;  3L6G A;  4OEN A;  2ONS A;  4LZ7 A;  1SQY A;  1A55 A;  2RC7 A;  3Q25 A;  3FJM A;  1TFA A;  1H44 A;  5FTH A;  5ISU A;  5L9S A;  2OK2 A;  3C34 A;  5DVI A;  4YB5 A;  5AA1 A;  5CC2 A;  5HPQ A;  3DLN A;  2DS9 A;  4PET A;  3FVO A;  4WKM A;  1B0H A;  1XOC A;  3JV9 A;  4OVJ A;  4X1B A;  3T93 B;  1US5 A;  3D4G A;  1A54 A;  2XXV A;  2XXP A;  3PUW E;  1BKA A;  2XXH A;  3CSB A;  1P1O A;  1LGB C;  2AL5 A;  3M3F A;  1F9B A;  1MXY A;  4NMY A;  3MVW A;  3PV0 E;  1IZ1 A;  4BDL A;  3PPP A;  2DE3 A;  3V83 A;  3R26 A;  2Z8E A;  4JWO A;  1LB8 A;  1ZBM A;  4QSC A;  3V5A A;  2WKY A;  1P1N A;  1LST A;  5B70 A;  3G3H A;  3TQL A;  3IAZ A;  4DIG A;  1UTB A;  1UTH B;  2F34 A;  4OYV A;  4XKN A;  4GFR A;  3U8Q A;  4F3B A;  1NMU A;  2F7B A;  4DCY A;  1M5D A;  1AL3 A;  4R75 A;  3ILT B;  4THI A;  1URG A;  1YPN A;  3TFL A;  2ZYN A;  3PMX A;  1FQF A;  3GLB A;  3IX1 A;  4RNS A;  1NH7 A;  3UGW A;  3S9L C;  1H45 A;  3FXR A;  3IK6 B;  1VR5 A;  3IO4 A;  1ELJ A;  3GBA A;  1FQD A;  5F7V A;  2RC8 A;  3MQ9 A;  5FHN A;  4QHQ A;  2F5X A;  2R6G E;  3TTL A;  2ZYM A;  3OO6 A;  1II5 A;  4FED A;  4WEP A;  5ITO A;  1P1W A;  2ZNT A;  5DEX A;  1NNT A;  4R74 A;  1R1N A;  4GL0 A;  3PPN A;  2Y7K A;  3E3K A;  1JW4 A;  4QSE A;  1LAG E;  1OVB A;  2UVJ A;  4FE8 A;  5AA4 A;  5I2N A;  1H43 A;  3RUM A;  4F3S A;  1LBC A;  1FQB A;  1Y9U A;  1FQA A;  1XT8 A;  4FAT A;  4M1V A;  1MQJ A;  4IO7 A;  3KJT A;  1SW4 A;  1DPE A;  2A5S A;  2Q2C A;  4OES A;  1FQE A;  3VVE A;  2LAO A;  4F1U A;  3K1N A;  1EZP A;  1IXH A;  5DEX B;  1XC1 A;  1D9Y A;  1FTJ A;  1XHY A;  1B4H A;  2I3V A;  3GZG A;  4G8H A;  4U1Z A;  1XVX A;  4IO5 A;  3T66 A;  3CI8 A;  3U94 A;  2DWI A;  1QJM A;  1B58 A;  1ZLQ A;  4RPN A;  1Y3Q A;  3U93 A;  2DVC A;  3N6T A;  1B7H A;  3FV2 A;  5TP9 B;  1JEU A;  2PMS A;  4ZED A;  3QSL A;  3SDF A;  2I4C A;  1MXW A;  1NKX A;  2M8C A;  1I6B A;  1MQG A;  2F8D A;  2I0B A;  4N6P A;  3K4U A;  1H3D A;  2RCA A;  1OQG A;  3PU5 A;  2NWJ A;  5JTY A;  3O2A A;  4U21 A;  4BDQ A;  4F3G A;  2QJE A;  1USY E;  2DE4 A;  3IOR A;  4R72 A;  3OD7 A;  3OO7 A;  3RTF B;  3V8X B;  3S4U A;  4DZ1 A;  5A5X A;  1KWH A;  5KDT B;  2PBW A;  3E13 X;  1MH3 A;  4ZE8 A;  4E0W A;  5H8F B;  3OEN A;  2ZXT A;  4DLD A;  5TP9 A;  3ZSF A;  2UVH A;  3ONM A;  3A3U A;  3O6G A;  3KEI A;  4MFI A;  2GFE A;  2NVU B;  1GV8 A;  3W9V A;  3IOW A;  4ZZA A;  4R6Y A;  4G4P A;  1US4 A;  2F78 A;  3MZ9 A;  2IEE A;  1T0K A;  3TKD A;  2DE2 A;  4ZEK A;  1URD A;  3DP6 A;  2GH9 A;  2CZL A;  1B0L A;  3TOD A;  3KSX A;  3Q26 A;  5KDT A;  4MH5 A;  1S9T A;  4QSD A;  3SER A;  3VVF A;  2XXQ A;  4H67 A;  5DT6 A;  1LAH E;  3MZB A;  1Y1Z A;  4GL8 A;  4IY6 A;  4POW A;  3TQW A;  2F6P A;  4ZDM A;  5I56 B;  1IUD A;  3MZ1 A;  3QAX A;  1WDN A;  4BLA A;  1MRP A;  3FV1 A;  1I69 A;  2VGQ A;  2ONR A;  1IXC A;  4XTC Q;  1SW2 A;  4GXA A;  4KI0 E;  4H5G A;  2Y7I A;  3THI A;  3CG1 A;  4R9G A;  2DXR A;  2XHD A;  4OXV A;  3SEX A;  1M5F A;  1IIT A;  4U4S A;  5ICT A;  2O68 A;  2FYI A;  4HTG A;  2I6E A;  3EN3 A;  4OEU A;  5K2Y A;  3B6W A;  4EUO A;  2O1M A;  1QUL A;  4Z0I A;  3Q29 A;  4IB2 A;  1LB9 A;  5CMC A;  2E0S A;  2Q8J A;  4TLL B;  1N7W A;  3T22 A;  3EF7 A;  4E0X A;  2UYF A;  4QFN A;  3TUS A;  1IIW A;  1GR2 A;  4HCY A;  3PD9 A;  4LQ2 A;  2QRY A;  2H9B A;  3HHF A;  4U23 A;  1S7Y A;  3MVX A;  1FTO A;  1UIV A;  3KOS A;  4C0R A;  3IOU A;  4JWY A;  1PEB A;  1JEV A;  4O3B A;  3G3K A;  3PUX E;  4DXU A;  4ZEC A;  2YJP A;  4U22 A;  1B3G A;  4BDR A;  3FD3 A;  3M3L A;  4PFT A;  4EF2 A;  4F3P A;  1AOV A;  1HSE A;  4OQO A;  2ZNU A;  1PDA A;  1MXV A;  4OTE A;  1VSO A;  3I3V A;  4KCD A;  3VLV A;  1PB9 A;  3VV5 A;  3IO6 A;  1EH3 A;  1FQC A;  2QS2 A;  3H06 B;  3PD8 A;  3N5L A;  4R9F A;  4XXU A;  3SEV A;  2HCA A;  3QXM A;  1MS7 A;  3O9P A;  4POX A;  2B3B A;  5CRY A;  5TU0 A;  3RPW A;  4MLQ A;  3C35 A;  3H6U A;  2Q2A A;  3S9E A;  4FAJ A;  1OLA A;  3KN3 A;  1RYO A;  1MM6 A;  1O63 A;  1WOD A;  3LSL A;  4ECF A;  1N76 A;  4U1O A;  5DVF A;  4Q8R A;  1QVS A;  1QW0 A;  3CFL A;  1N84 A;  3R7X A;  3UIF A;  1RYX A;  3RGY A;  3GBB A;  4F18 A;  1B51 A;  2F7C A;  3QUJ A;  2XX9 A;  3K00 A;  5A5X B;  4F1Y A;  2REJ A;  3BKI B;  2OJT A;  5FTI A;  3QUF A;  4KFQ A;  3VXB A;  4L17 A;  2Y84 A;  3AXF A;  3FXU A;  1BTJ A;  1MPB A;  1RKM A;  2V25 A;  3OXN A;  4JSD A;  3OMB A;  2XXY A;  4GVO A;  4P0G A;  5L8D A;  4F19 A;  2BJJ X;  2I48 A;  2R71 A;  3USD A;  3M3K A;  2I3W A;  2NOO A;  3JZJ A;  3BFT A;  4ONY A;  4HCW A;  4I9D A;  4IO3 A;  1QUK A;  4H1X A;  4ZE9 A;  1LAF E;  1TFD A;  2Q9T A;  1DTZ A;  3K02 A;  5LOM A;  2REG A;  5I84 A;  4EQB A;  3CRB A;  3FJG A;  4NF5 B;  4H0W A;  2F36 A;  4LZ5 A;  4EQ7 A;  4IY5 A;  5FHO A;  4BDO A;  2VD2 A;  1MQI A;  4U4X A;  1IQ7 A;  3K2D A;  3FVG A;  4GOT A;  4FOR A;  1MDP 1;  3F11 A;  3IJX B;  1USY H;  4LUB A;  2X26 A;  4PFW A;  2OBG A;  4RJZ A;  3TZA A;  3N6U A;  3TCG A;  5CM6 A;  4ESX A;  1ZMG A;  5I56 A;  4G8M A;  4YKI A;  1A40 A;  2A5T A;  4GF8 A;  3ODB A;  3GXA A;  3H6V A;  3VDF A;  2OWS A;  4EXL A;  5L9O A;  3SEU A;  2HAU A;  4IGT A;  3ZKK A;  3MVZ A;  3EHT A;  4R6K A;  4RK2 A;  4BDM A;  4TOZ A;  1R9L A;  2XXR A;  1POT A;  4M4G A;  1A7L A;  5KZT A;  1AIV A;  3T9U A;  1NFT A;  3CIJ A;  1AMF A;  1JVY A;  3H4Z A;  1DMB A;  2E1S A;  1DOT A;  1NNP A;  3K6W A;  3M8U A;  3W9W A;  4HW8 A;  3C36 A;  2FNC A;  2UXA A;  1CE2 A;  3BBR A;  4FEC A;  1H76 A;  2H25 A;  4GRK A;  4KCC A;  4G8N A;  1B4Z A;  1DPP A;  3H6W A;  2DVZ A;  3PUY E;  2A5T B;  2V3Q A;  1LFI A;  2HZL A;  3K1M A;  3TMG A;  3O6I A;  2DSF A;  2D21 A;  2O6A A;  5M2V A;  4NF4 B;  5EHS A;  4ZZE A;  2Z8F A;  1FTK A;  5I58 A;  3C31 A;  3UP9 A;  4GQO A;  1A8F A;  2XXX A;  4Q5T A;  4RXL A;  3TTR A;  3UA8 A;  1DSN A;  1OMP A;  1B1H A;  2ONK E;  4G68 B;  3T9V A;  5H8S A;  1JW5 A;  2XXI A;  5CI5 A;  1HSJ A;  2Z23 A;  3TTM A;  1PC3 A;  1OIB A;  1B5I A;  3IJO B;  4NTL A;  2DQV A;  4YU0 A;  3WAE A;  1M5B A;  1OLC A;  2XXT A;  3EQ1 A;  5H8H B;  1VE4 A;  2G29 A;  3LSF B;  1TT1 A;  1ZTY A;  4QFK A;  3IOV A;  4DXB A;  5L9M A;  3G7W A;  2Z22 A;  4H6D A;  4FEB A;  4OET A;  4P11 A;  4U2R A;  4PFU A;  4H8I A;  4PP0 A;  5ELV A;  1MY0 A;  3RQT A;  3OEL A;  4FJP A;  4ZEB A;  5AA2 B;  2CMO A;  1MG1 A;  3FXQ A;  5CMK A;  5I57 B;  1B32 A;  2ALU A;  2HAV A;  3RN8 A;  1NL5 A;  2XD2 A;  4GWO A;  3EHU A;  1EZ9 A;  1MXZ A;  2DYX A;  4RY1 A;  3WAF A;  4Z7E A;  4LQ5 A;  2AYS A;  1M5E A;  5H8H A;  3FGS A;  3N26 A;  3UOR A;  4UA8 A;  3KZG A;  3E9X A;  5AA4 B;  4OWD A;  5I2N B;  2W7Y A;  4I1D A;  2AL4 A;  1VFE A;  3HHG A;  4HS7 A;  1B3L A;  1Q1K A;  3RTW B;  3FVK A;  4MF3 A;  1JW1 A;  3TEL A;  5KCJ A;  2F35 A;  1SYI A;  1JET A;  5BWJ A;  3K6V A;  4R73 A;  4X48 A;  3DP8 A;  3LSW A;  5IKB A;  3MPL A;  1GTK A;  3O6H A;  4YMA A;  2UVG A;  5JK4 A;  1B3E A;  2DP8 A;  1LFH A;  3HCQ A;  2QS1 A;  2OCU A;  2Q88 A;  3SET A;  1URS A;  4TQU Q;  4C1U A;  1ZJL A;  2HEU A;  3PUZ E;  4KHZ E;  3TEP A;  1Y3N A;  3CFZ A;  3FJ7 A;  2X7Q A;  4EQ9 A;  5BUU A;  1SBP A;  3C9H A;  3R6U A;  1Z7M E;  1ZIU A;  1MDQ A;  3KG2 A;  4GXS B;  4G2Z A;  3SEW A;  4NWC A;  4I8C A;  3SES A;  5J1D A;  4RYA A;  4ND9 A;  1D3K A;  2OWT A;  3H6T A;  5JTY B;  1JNF A;  2ESN A;  4KQP A;  3TTK A;  3D4C A;  2OLB A;  3S2V A;  1MY2 A;  4NWD A;  1B40 A;  1N7X A;  3O28 A;  1XVY A;  2DWJ A;  3MWB A;  2I4B A;  3B6Q A;  2H98 A;  1LLS A;  2H4I A;  1AH5 A;  3JYR A;  2H5Y A;  2H99 A;  5CMB A;  5FHM A;  1S50 A;  1B3F A;  3C4M A;  2KLF A;  3MUQ A;  3FVN A;  1R6Z A;  3N94 A;  3PGF A;  4GIZ A;  4QFO A;  4F39 A;  3OO8 A;  3EPE A;  4LZ8 A;  4R2F A;  1SI0 A;  2HFB A;  5DYH A;  3FZV A;  3OSQ A;  3PPR A;  3LC8 A;  4LA9 A;  4PQJ A;  3KOT A;  4I62 A;  4RA1 A;  4OFO A;  1P99 A;  2THI A;  5EHM A;  5CBS A;  4AB5 A;  1R9Q A;  1B2H A;  4IO4 A;  3MP1 A;  1MPD A;  1TXF A;  1B1X A;  1ZU0 A;  3KBR A;  4F29 A;  1QUI A;  4IGR A;  4NF5 A;  5ICQ A;  3UK4 A;  1FW0 A;  3LR1 A;  2P0S A;  4OEV A;  4YKK A;  4Q0C A;  4Q30 B;  3G3F A;  4R6H A;  2QS4 A;  2ANJ A;  4XKQ A;  2XXW A;  3P7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...