1A8SA

Chloroperoxidase f/propionate complex
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
273
structure length
273
Chain Sequence
TTFTTRDGTQIYYKDWGSGQPIVFSHGWPLNADSWESQMIFLAAQGYRVIAHDRRGHGRSSQPWSGNDMDTYADDLAQLIEHLDLRDAVLFGFSTGGGEVARYIGRHGTARVAKAGLISAVPPLMLKTEANPGGLPMEVFDGIRQASLADRSQLYKDLASGPFFGFNQPGAKSSAGMVDWFWLQGMAAGHKNAYDCIKAFSETDFTEDLKKIDVPTLVVHGDADQVVPIEASGIASAALVKGSTLKIYSGAPHGLTDTHKDQLNADLLAFIKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural investigation of the cofactor-free chloroperoxidases.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Haloperoxidase
molecule keywords CHLOROPEROXIDASE F
total genus 106
structure length 273
sequence length 273
ec nomenclature ec 1.11.1.10: Chloride peroxidase.
pdb deposition date 1998-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1a8sA00
2C0QA 4U2BA 1LZLA 3A2MA 3KWFA 1ACLA 1U8EA 4GHWA 2WFZA 4B82A 4MWTA 7YASA 1WPRA 4BBZA 2OQVA 5ALZA 1XRMA 3EQ9A 3HC7A 1OXMA 4EBBA 4HRYA 2XUKA 5AKGA 3PE6A 5AI8A 2O7RA 4EB0A 3O9VA 2FJPA 3E1GA 2RONA 5BWCA 4MXDA 1ZIYA 5AM1A 5F4ZA 1F0NA 1B41A 1A7UA 1JU4A 4HXGA 1XKLA 1XLUA 1YSCA 2B9VA 5I7UA 1MN6A 3VVLA 1MU0A 3OG9A 2OCKA 3E4DA 3G8YA 2EDAA 2RGUA 2ONCA 3ICVA 3HYSA 4N5IX 2C5FA 5ALHA 2HU5A 4OD0A 1X70A 4FLEA 1CIJA 5ALTA 4AO7A 3HRHA 1UKAA 1GGVA 1CUJA 2PSFA 2CBGA 2WUDA 1ORVA 3JYHA 1CUYA 5SYNA 3C70A 3W9BA 1QTIA 1LBSA 4WY5A 4TPKA 2PUHA 2CEKA 2XUQA 2CJPA 4H7FA 3EBLA 5AI6A 1WOMA 4HS9A 4P93A 3YASA 3T52A 1ZJ4A 3HI4A 1XRRA 1TCBA 4UHBA 2J3DA 2VF2A 5AKJA 2XLBA 3BDIA 1QIDA 2J3QA 4GDMA 4H35A 3H17A 5AIBA 2VAVA 4IO0A 4QEKA 1SCKA 1UFOA 5CH5A 2RHWA 5CURA 2QUAA 1UT6A 3R40A 4H7DA 4G8BA 3PUIA 4PNZA 4WDQA 2VT6A 5AH0A 3RK4A 4WFKA 1QIEA 4RE6A 2O2IA 3DD5A 3UMJA 3I6ZA 1XRNA 1ETHA 1CVLA 4KE9A 2ZYSA 4P92A 4C89A 1WCYA 4Y2JA 4C4ZA 3D7RA 2B20A 4MYDA 3CN7A 4BP8A 3NWOA 1CR6A 4H7JA 3E0XA 2ACKA 4UHCA 5CTAA 1LPAB 1LPPA 2QM0A 5ALMA 1RP1A 4M0EA 3L1IA 2HADA 3I2KA 2HA0A 1XLVA 1QO9A 3D2BA 4H18A 1YASA 4F60A 4BRZA 2DFPA 3WYNA 2X76A 2WHPA 3CN9A 3QM1A 2VTVA 4LHEA 1BU8A 2WIJA 4Q34A 2ORYA 1ZGCA 3DCNA 2G5TA 1B6GA 2PL5A 1JMYA 5CT5A 4JNCA 1HPLA 1UXOA 2GYWA 3AJAA 2AJ8A 4FDMA 4KAFA 1K63A 5DYYA 2AXEA 4K6KA 5AK3A 4IH1A 3WL5A 4BTVA 2DHDA 3RKSA 1CUHA 3WL8A 1XZHA 4W1QA 5CT9A 4E46A 1H2ZA 1QO7A 3K6KA 3STUA 3ICWA 4WFJA 1XZJA 2QXUA 2WUFA 5HK9A 2WU3A 4B0OA 4B9EA 1XZIA 4DIUA 5ALNA 2Y2VA 5AKHA 4CCWA 1R9NA 2VSQA 3KWJA 5HZGA 5JAPA 2XMDA 4G9EA 3T4UA 1CUGA 1Y7IA 2BAGA 2HA2A 4OPMA 3AIMA 1UKCA 4WJLA 3H1BA 1J07A 5ALEA 2LIPA 2PVSA 1QGED 1EVQA 1H22A 1KU0A 3C43A 3M3DA 2PU5A 3DNMA 4UBIA 4B7ZA 1LPOA 5JADA 4Q3KA 5C8XA 2YASA 4PO3X 5AOCA 4LXGA 4P9NA 5AM3A 2I78A 4NS4A 5LZ2A 1DINA 1R4ZA 2JGMA 2G5PA 2WHRA 4IQ4A 5LLSA 5T4FA 3QPAA 3KXPA 4P08A 3I2IA 4LIPD 2QT9A 1FFDA 4TGLA 3RLIA 3F9CA 3VXKA 4BDSA 3WK7A 3X3HA 3D5EA 5LP1A 1IUNA 1W1IA 3HZOA 3FLEA 3STWA 1XZMA 3G9UA 5LZ5A 4QDOA 3WIBA 4OU4A 1G66A 2BFNA 2WFLA 4GXNA 3AUKA 1L7QA 4LXHA 4UUQA 2CB9A 3WA7A 5JAOA 1BROA 5JANA 5HFAA 2WIGA 3N2ZB 1MNAA 3IB3A 1VZ2A 4PV7A 3A2LA 4L0CA 1CUIA 1RWQA 4UPDA 1SFRA 1ACJA 4BATA 3IA2A 3EIOA 1MX5A 3HEAA 1HQDA 5I8PA 4G4GA 1AMNA 4X3CA 3C5VA 3WKAA 2B4KA 4AMYA 3QVMA 4DNFA 2OCGA 4KACA 2WSLA 3QYJA 4EY4A 4BCDA 2WIFA 4O08A 2XUOA 4J3JA 2WG1A 3DOHA 3O4JA 4BRSA 5CT4A 1BE0A 2JEZA 4Q3LA 2XMRA 3WK6A 4OB8A 3W9UA 5JZBA 1UOOA 3OC0A 4Y2XA 5AM4A 2JGLA 3D2CA 3BIXA 2AJDA 2VATA 2AJCA 5FRDA 4B85A 1XZEA 1QFMA 3BXPA 3G0DA 5K3CA 4ZGBA 3G0GA 1Q83A 1JJFA 1THTA 5ALFA 3B5EA 5ALRA 5BV7A 3F96A 4FWBA 2WJ6A 4UBOA 1BCRA 4YPVA 4UFPA 3C87A 2XUFA 4G8DA 5YASA 4CG1A 4X00A 1JJBA 2XQKA 1R3DA 5AKZA 4ZV9A 3RM3A 4NMWA 1Z68A 3N0TA 4OU5A 2V98A 1S8OA 3PF9A 3G0BA 4GWLA 5ALIA 1I6WA 4WDRA 3ED1A 3R3XA 2JIDA 3GA7A 3ZV7A 3WA6A 4G1FA 4OSEA 2BJHA 3L1JA 2G63A 2YXPX 4HXEB 3MVEA 4CG2A 1SC9A 1ODTC 3U0VA 4HRXA 3WKCA 1E8DA 4I3FA 5D3ZA 1L7RA 5DNWA 2HDWA 4DM7A 3GROA 4J0KA 3QH4A 2E3JA 5C81A 1P0QA 5AM2A 3WWPA 5FLKA 2CMFA 2H7XA 4KAAA 5HCUA 2GYUA 2DHCA 4M0MA 5EI5A 3IIIA 3WK8A 4I4CA 5FOQA 2FJ0A 3K9BA 2GBGA 2CZQA 4U2GA 2QTBA 1ZICA 2JBWA 4B9AA 3W06A 3WIOA 3C6YA 1LPSA 5AK5A 1LLFA 2JF0A 4BP9A 1LZKA 1VZ3A 5A7FA 1PJAA 1XZFA 5A7HA 4UBJA 1YA4A 4BZZA 1ZOIA 2XUDA 5E2IA 1YR2A 3ANSA 1EK1A 3WJ2A 4J7AA 1MPXA 4F0JA 1XZBA 2Y6UA 4KAJA 1EK2A 1F6WA 3Q0TA 5D7BA 5D6OA 5JD4A 4DMKA 3AZPA 4X91A 3BWXA 4BYMA 2FUKA 4B83A 3GZJA 4PF1A 4YK7A 3JWEA 4ZV7A 4MQMA 4MJ3A 2OGTA 5ISMA 2H1IA 3BL8A 4ZREA 5KWIA 2K2QB 1OILA 4PSCA 1BRTA 3WWDA 2XLCA 5K3BA 1DWOA 1CUZA 3DKKA 1XZCA 4NZZA 4Q1VA 3PUHA 4JYPA 3VJKA 1G42A 3ESCA 1IUOA 3R3ZA 1LGYA 1EINA 1QIGA 1XZLA 4N8SA 3AZOA 2EDCA 3U1TA 3ZLVA 5JYCA 4U2EA 1WHSA 2VJDA 1BS9A 2XMQA 4HZGA 2QXTA 1GZ7A 5CXXA 1R9MA 1QONA 5IH7A 4UHHA 3H19A 5EHZA 3DYIA 2GZSA 1NU6A 2HFJA 2ECFA 3WI7A 2GYVA 2WHPB 3TGLA 1LNSA 3I2HA 3QITA 3V1LA 1N5MA 3KOOA 2GBFA 2GZRA 1EDDA 3FLBA 1CUCA 4GBGA 2OAGA 1CUWA 4B80A 3H0CA 4AXBA 1CUUA 2VQ6A 3WL6A 3GBSA 5AKKA 4EUSA 5IVIA 1TK3A 1VOTA 4FTWA 4RPCA 4BZWA 1VLQA 1H23A 1JI3A 1N8SA 3VISA 3R3VA 3WKDA 2FX5A 3TRDA 4DYHA 2XMGA 2CKMA 3Q8WA 3L1HA 2DHEA 2C4HA 3G9XA 3ESAA 2V96A 3VJMA 4KE7A 5HF9A 3W04A 5DNUA 1MJ5A 3IVMA 2QVBA 4WFIA 1QTRA 2OLEA 5JAHA 4MEBA 1QJ4A 1ORWA 5FKJA 4BVJA 1EDEA 3FSGD 3GELA 2H7CA 2JGJA 3D2AA 5AI5A 5ALXA 5JIBA 5ALSA 1WB6A 3LIIA 1XZAA 2I03A 3PICA 3KDAA 5HKBA 2H7YA 3E3AA 3MUOA 1TCCA 1CUBA 4FBLA 1YB7A 4J0DA 4U2CA 4U2FA 5FXMA 1E3QA 4XVCA 4OCZA 1VE7A 5DNVA 4QZVA 2O7VA 3PDCA 2QMQA 5CMLA 2Y1KA 3BE8A 3QPDA 4LYDA 3DOIA 2CUTA 4G5XA 2WJ3A 5ALWA 3IUQA 4FNMA 4Y2UA 3K2IA 3V48A 2QS9A 1CUVA 4AMZA 4OUKX 5K3AA 2WFLB 4X97A 3HXKA 5K3FA 4LYEA 2W22A 3DS8A 4DSAA 3BJRA 1DX6A 3PF8A 3QZUA 5A7GA 3A6ZA 2VT7A 1VKHA 1GKLA 2BKLA 3OOSA 1BN6A 1IVYA 2PSDA 2QOEA 2WG0A 1GPKA 3DEAA 1XZGA 3KSRA 4C4YA 1AURA 4FMPA 4C87A 3WK9A 1FSSA 5FUMA 3R3YA 1HDEA 3DDUA 5J3JA 4BC1A 3LS2A 5E4TA 4ZRDA 1J06A 4W1PA 3DYVA 5JZ9A 3WK5A 2HFKA 4DNOA 1SOMA 1XRPA 2WQZA 2J4CA 5ALLA 3PI6A 1TCAA 2HA3A 4DMFA 3AILA 2HL6A 2PUJA 4L72A 5EHQA 5EHNA 3V1NA 3IDAA 4EY8A 4ARBA 1ZI6A 2VJAA 3D59A 4NVRA 4Y2QA 3QMWA 2ZYIA 1BEZA 3NUZA 3I2GA 1EH5A 2HU8A 2JGEA 5CT8A 2XQJA 2OGZA 1A8SA 3O4IA 5FP0A 3FYUB 3BJMA 1TKRA 3FVTA 3NOXA 3GFFA 3CXUA 3H2KA 4BDTA 3FYTA 3R0VA 2XMCA 1YA8A 1UK9A 5A6VA 5CXUA 3PFBA 2I3DA 3O4HA 4HVTA 2D5LA 4W63A 2QZPA 2GBCA 4EZIA 4Z49A 1CEXA 1E8MA 3IUJA 1C4XA 2WFMA 2QJRA 4DLNA 4KRYA 2P8SA 3QBJA 4X6YA 4GI1A 5AKYA 3UUEA 5CH8A 4H7KA 1P0PA 2VA9A 5EIEA 5A62A 1N1MA 3I6YA 4RE5A 4BAUA 4TVKA 2Z8XA 2XMSA 1JFRA 1ZI8A 2ACEA 3WZLA 1EHYA 2PBLA 3OURA 2WIDA 1XZKA 2G4LA 3BIWA 3SX4A 1YB6A 2DQYA 3G0CA 5EHXA 5AK6A 5LZ9A 4QE3A 1H2WA 2ROQA 3FBWA 3IURA 1Q84A 2PSEA 4Q82A 1JKMA 2XB6A 1KEZA 2DR0A 1CV2A 1L7AA 4JH0A 1LPNA 5AK4A 1P0IA 3G9ZA 2XI4A 5DTIA 5EFZA 3MUNA 4H0CA 1JU3A 4FLFA 4UHEA 4YX9A 3IBTA 3G0IA 3ZPXA 3A2NA 3F98A 3I2JA 5AI9A 2WILA 2JGKA 5AI4A 1YS2X 3WKEA 1JJIA 1D07A 1IMJA 2VEOA 3V1KA 4PSDA 2HM7A 1XKTA 4N5HX 1F8UA 2PPLA 1QFSA 1K5PA 4QDZA 5H3HA 1XQWA 2OCLA 1EI9A 4G4JA 4H7IA 1AUOA 1W4LA 4QLAA 4X95A 1AX9A 2ZJ6A 4GLBA 3AIOA 1DWQA 1A88A 1W75A 4BTLA 4QLOA 1YCDA 4J0HA 2Z3ZA 5IVKA 3HABA 4AO8A 5IKXA 1FFAA 2WHQA 4BCBA 2XUGA 4GEGA 2C58A 1ZGBA 3WLAA 1ZI9A 3H18A 1UZAA 4FOLA 4OYLA 4PQEA 4PW0A 3VDXA 4UBNA 5CH3A 5IVHA 1HBJA 2ZJFA 1BEEA 1ZIXA 3IUNA 4CCYA 2C5GA 4RGYA 4FLMA 5LKAA 2WTMA 3STVA 1UOQA 3FAKA 4W9RA 5HF5A 4QWMA 4INZA 5HF8A 4V2IA 5I9IA 2BUAA 4E14A 1XFDA 3LIPA 2WM2A 1QIMA 2BUBA 4CG3A 2V9ZA 3ZWQA 3WWOA 3MGAA 3LCRA 1ODCA 4ROTA 4YASA 5CBKA 3QMVA 2AJLI 3AFIA 1H2XA 3ZLTA 2V97A 2Z3WA 3G9TA 3FWHA 4ZWNA 4Y2SA 3C5WP 3I1YA 4FFWA 4ZI5A 4KE6A 2WLSA 1YAHA 5LKRA 5ALVA 3EQ7A 1LPMA 5JASA 5AJHA 1CLEA 1GT6A 4AX4A 1WPXA 1VXOA 3FNBA 3UUFA 1UKBA 1UK8A 3R3WA 1EX9A 1C7IA 1MO2A 3KD2A 5AHXA 4LXIA 2I3ZA 1U4NA 3JW8A 1JMKC 3FSGA 4ZXFA 1CQWA 3O0DA 3WMRA 1EB9A 2R11A 3C6ZA 1R88A 1ISPA 4QWWA 1KU6A 4W1RA 2HRRA 2JEYA 2RIPA 5ALYA 1G4HA 3FLAA 3C8HA 4IHAA 1CUEA 3RARA 4AB1A 4K2AA 4XWGA 3WWEA 4B84A 2HA6A 2HA5A 4Y7DA 1G5FA 2BGRA 1O6GA 1HKHA 1HL7A 1UK7A 3F8SA 5E4YA 5LZ7A 1W76A 4C4XA 4CI9A 2OQIA 1YAJA 4E15A 1XZDA 3W2TA 5HF6A 4X6UA 5DWDA 2YH2A 4Y2TA 3S2ZA 3I28A 4L9AA 1LPBB 1PV1A 4H7EA 3O95A 4KJXA 5ESRA 5AKXA 1A8UA 5HK8A 5FPQA 1CUFA 4DGQA 2WUGA 4GW3A 4FBMA 1CUSA 4Y9SA 1VXRA 5FV4A 4K5QA 2Q0XA 2HU7A 4F21A 5KWJA 5ALPA 2HIHA 5DTJA 3WWCA 3SK0A 4S0XA 1X2EA 5ALQA 3I1IA 4BE4A 2ZSIA 2IIVA 4FKBA 1AGYA 2JGIA 3QMMA 4DNQA 4DMHA 1LBTA 4N8DA 4AN0A 2ZYRA 1A8QA 1QIJA 5IVDA 2WIKA 1ZJ5A 5D3KA 1U65A 1GPNA 2XMBA 4FFVA 3WYDA 4J0GA 1PFQA 3R3UA 3VKFA 2X5XA 5AOBA 3V1MA 1SCQA 2DCMA 4UHFA 1CRLA 5ALKA 1QIIA 4Q05A 5DYWA 2JGFA 4G4IA 5BWBA 2XQGA 3FYUC 1J1IA 1VA4A 2HA4A 2D0DA 3STYA 5AIAA 4KYVA 3BDVA 3ESBA 2BGNA 4Y2RA 5C7YA 3B12A 3WL7A 3C6BA 3CCCA 4A5SA 2B61A 1AZWA 4N8EA 4XX1A 2OXEA 5K3EA 4QA9A 1OCEA 3H2JA 3DQZA 5FPPA 1JT2A 4HXFB 4W1SA 4B0PA 2NW6A 3LLCA 4E11A 3EQ8A 4UHDA 1FJ2A 1XLWA 4QNNA 2DQZA 4J03A 3HSSA 1NX9A 3EF3A 1W52X 6YASA 4OB6A 5ALJA 4X71A 1EDBA 4AZ0A 1CUAA 2AJBA 4CIAA 4X92A 4HTAA 1XRLA 1MX9A 3R41A 5HFNA 2IX9A 1ZD2P 2ZSHA 5HQ3A 1UK6A 2BUCA 1GKKA 2PKYX 2QKYA 1DQYA 4UBLA 4BVLA 5C8VA 2PX6A 4K6HA 1SCIA 1J2EA 4UBMA 1YS1X 4B81A 2Z5GA 1BCSA 1MTZA 4JEIA 2ES4A 5DJ5A 5AM0A 2PSHA 2C0PA 3P2MA 4AZ3A 1Y7HA 5T4EA 1CUDA 1WB4A 3CCBA 1FFEA 1R1DA 4C6HA 2PU7A 1MAHA 2IITA 3H04A 2H9YA 3A70A 4XIIA 1VA5A 1TQHA 3H2HA 5K3FB 3DL7A 1WB5A 4G8CA 2O2GA 4EY7A 3DJYA 2Y6VA 3DLTA 4X90A 3IULA 3H1AA 4WY8A 1MT3A 3C6XA 1TIBA 1Y37A 3WQHA 5JD5A 1CPYA 4UFOA 4ARAA 4CIBA 2O2HA 4X85A 4F5ZA 1DT3A 1DT5A 4QDTA 5AI0A 5CT6A 3AIKA 1O6FA 2OG1A 5ALOA 3AZQA 4X94A 2XQIA 1BN7A 1ODSA 2DSNA 2XUJA 5JAUA 2RI6A 1EA5A 4I19A 4FNGA 3FCYA 4BCCA 1RYYA 3D4LA 3H2GA 5AKLA 5ALDA 1Q0ZA 2WKWA 4H7HA 2RHTA 4XJVA 4IH9A 1CQZA 4CCYB 4DSZA 4OB7A 4C01A 2WJ4A 1IUPA 3W05A 3WJ1A 1M33A 2BCEA 4AN1A 2X8BA 4ITVA 3TJMA 1AC5A 3F67A 4M0FA 3VJLA 4KEAA 1CFJA 1W6RA 2PSJA 3ZLUA 1T4MA 2YYSA 3VVMA 3ILSA 1DWPA 1QIKA 3C8DA 5HKAA 3H2IA 3HLKA 4OYYA 1UWCA 1GXSA 1QE3A 2QRUA 1CUXA 1X2BA 4LKOA 4B6GA 4MWSA 5ALGA 2HRQA 3OM8A 2QUBA 4QDXA 2ZVDA 2WUEA 1VE6A 4IH4A 3HACA 1DQZA 4U2DA 5CW2A 3I6MA 5DYTA 3O9MA 4MQLA 3STTA 1K8QA 5EGNA 1Q0RA 1HLGA 3SWWA 4JYMA 4BAZA 5KREA 5DLPA 4DTCA 3LP5A 3M83A 5JALA 5AICA 5KBYA 2XT0A 4X6XA 5T4HA 2QJWA 3M82A 2Z8ZA 5AP9A 4H77A 3BF8A 2Y2UA 3OPMA 5LZ8A 5LIPA 1P0MA 5K5EA 4BE9A 1IZ7A 1XRQA 5JATA 3PFCA 3M81A 5LYYA 5EIHA 2OCIA 1FFCA 5CRIA 4Y2VA 1E5TA 1WM1A 5AKIA 1F0PA 3WK4A 4J0CA 2ZYHA 5FDFA 4PSUA 4GECA 4JUIA 1E89A 4X93A 2XE4A 5AOAA 2HHAA 3O4GA 1K6EA 3FVRA 5A2GA 2EEPA 4QDUA 1DX4A 3C45A 1MAAA 1EXWA 1E66A 2VJCA 4AQDA 2WG2A 4HAIA 1TAHA 2J4FA 4DMCA 1GPLA 2OGSA 1IZ8A 2XMZA 2VAXA 3FOBA 4UBKA 3WZMA 3IUMA 4A23A 4Q3OA 4EY6A 2VJBA 4G9GA 4CFSA 3D0KA 1EVEA 3DL4A 1MX1A 3HJUA 2UZ0A 4FHZA 4X7BA 1VJ5A 4RNCA 4WCVA 2OPHA 4BB0A 1AKNA 5AKEA 1H2YA 2C7BA 4K6GA 3ESDA 3S8YA 3I2FA 1NU8A 4DNPA 1XQXA 1QZ3A 2XDWA 3FCXA 1XQVA 4Y2YA 4BAGA 5ALUA 1TRHA 3TEJA 1DU4A 2W6CX 1EB8A 2WTNA 5C8ZA 1QIHA 1DTEA 3B3QA 4EY5A 5JARA 1WHTA 1MNQA 4EHBA 2XUIA 3QPCA 1R50A 3ANTA 2QR5A 5A71A 5AM5A 1AQLA 4KE8A 5K3DA 3G7NA 1C7JA 5SYMA 1GQSA 1QLWA 1GQRA 5E4JA 3G02A 4UFNA 5HQ3B 2RAUA 5EIAA 5BOVA 1K4YA 2WU4A 4EA6A 3F97A 2HA7A 5AO9A 1THGA 5LZ4A 1N5RA 5T4BA 3AINA 4KRXA 1USWA 2R8BA 2GBIA 4BC0A 3OTQA 3GUUA 4KR0A 3D3NA 1UOPA 4J0JA 3SC2A 3NGMA 1XQYA 1QIFA 2PM8A 5JZSA 3BF7A 1E8NA 4D9JA 4L3WA 1U2EA 2ZJ7A 2XUPA 1ZD4A 4C88A 4MEAA 5JD6A 4Y2PA 4BVKA 4MYSA 2XUHA 1ZD5A 1XROA 2XUAA 1ZD3A 4AO6A 1FFBA 3ZI7A 3V9AA 1T2NA 4J0IA 3WKBA 1QOZA 3DKRA 3STXA 3FYUA 4A16A 2OAEA 4ETWA 2XQFA
chains in the Genus database with same CATH superfamily
3PQCA 3D6JA 2QVZX 2IHTA 1LLUA 4NOMA 4J6FA 3DF7A 4AMVA 5CU7A 1S2GA 2AZDA 1Z26A 5ITWA 3T7RA 3KZNA 1QH8B 1U8EA 3IKTA 1A76A 3L8ZA 5ICGA 1IB6A 2PEZA 4GHWA 4LRUA 4PSVA 3U61B 1DP4A 1GTJ1 2WFZA 3GIDA 3HVKA 3PQ7A 2FW1A 5GOTA 3UUWA 4MWTA 1KK2A 4HUTA 1UEIA 4JI4B 3SQXA 2OQVA 1YRYE 1ZVMA 1QPBA 3K4HA 1VHTA 2F3QA 3EQ9A 1PL7A 1VJDA 4BGVA 1KAGA 2J3JA 4MUHA 1OXMA 3LOQA 4KQHA 4HLDA 4UE3S 4NL4H 2EBWA 5AKGA 1LFAA 1IB0A 3PE6A 4LSMA 4C6TA 4YAUA 1R5BA 4JSTA 1ZCAA 1FRNA 2HPAA 4PYKA 4EB0A 2HLDD 4N4AA 3SBDA 3V80A 3DV0A 1DOAA 2WTXA 2RONA 5D3MB 5KDLA 5BT9A 1E61A 1IN7A 4PC6A 4AW9A 5A5EA 5JPCA 5KNDH 2B8EA 3OMXA 5AM1A 1KYZA 4OMUA 5ES3A 5LD2C 1B8NA 3RRFA 4E6EA 1IK6A 1A7UA 1H1LA 4DDKA 1ZH4A 4G1MB 2GMWA 2RHHA 3FTEA 1YSCA 2G77B 3RRNA 2VXCA 1YGYA 2AX4A 2YINC 5D7NA 1RYFA 3E53A 2Q5OA 3H16A 4RVFA 4GE3A 3R6WA 4DS3A 3QV1A 1LDMA 1TJPB 3OG9A 1KQGA 1LLQA 2ZIGA 4YJ3F 5FUYA 3HFRA 3JD0A 3F4LA 4JD5A 1VBFA 2OHFA 2XW6A 4TROA 4E03A 3R7WA 2F9LA 1MQ9A 1QG0A 1Y8RA 2GAFA 1N2JA 3H9JA 3HCEA 5H02A 3Q8MA 3M4YA 2XYVA 2Z95A 1YJBA 4FVTA 5E6SB 4CM9A 1E4EA 2FWPA 1M1YA 3CMCO 1KO7A 1VKZA 2HU5A 3WJAA 3AQIA 1X70A 4OXNA 2I4MA 4FLEA 1BCSB 4C1NA 5KDDA 2AE2A 4CW7A 2W6ZA 3N53A 2B5WA 1VHJA 3HRHA 1FC0A 1UKAA 2E5WA 2PSFA 4TLMB 5CIQA 4ZYZA 1RYNA 5D5PA 4FS8A 4MVWA 3AERA 4PRLA 3EXIA 1GCOA 2IWRA 9MHTA 1IN5A 1CUYA 3HM2A 4DRXA 2VPTA 3TG2A 3OETA 3W9BA 2EP5A 2I66A 3Q88A 3HNOA 5F4BA 3VOAA 4F9GA 3J81A 3EXG1 4RULA 1JQAA 3WB9A 1TO2E 3OE4A 4G1BA 4EMBA 1E58A 2AGVA 2YV3A 4LRXA 4D25A 3U0BA 3M6LA 1BVHA 3W7AA 3OPYA 5CJPA 3KZCA 4NF2A 4XYLA 2A9JA 2DFTA 2YIMA 4FB4A 1T6NA 1U7TA 3NBFA 4L8VA 3DHWC 3NTLA 3THOA 4NBKA 1ZJ4A 4E13A 3ZVNA 4UHBA 3WRXA 4IO1A 1O77A 5BSRA 4YR9A 4WRRA 2FQYA 2EQ5A 3ILYA 2D74A 1CDDA 1NLUA 1KRWA 4JDUA 5DLDA 1DNPA 2TS1A 1QIDA 3N7AA 2J3QA 4JEUA 2G3YA 1WVIA 3K0CC 1J4AA 4QM6A 3H17A 1UT5A 2RH8A 3L8EA 4RWZA 4B3JA 5AIBA 821PA 1YR9A 4QEKA 1M2KA 1UFOA 3CR3C 2PGIA 2WWHA 3L6CA 4RF4A 5JQGA 3H5NA 1NR5A 1P4JA 1TU3A 1CZHA 1OKKA 1Z88A 3DKIA 4ZARA 2BHTA 2X7JA 3ZWAA 4E5UA 5C9ZA 3BRCA 1XB2A 2GNAA 3FKSD 1D2CA 1GU0A 5EWJA 4QPZA 3OLYA 1U7XA 1BWRA 1UFKA 1T9BA 4ZKDA 2NVUB 2BE9A 4DBLC 4CV3A 3SC6A 1L7PA 2HH9A 3W1VA 2EOAA 1RBQA 2NYRA 1PS8A 1UDWA 4E7OA 5CB4B 1LSSA 5EMHA 3ZZUA 5KYGA 4PNZA 4CEJB 3OQBA 3O90A 1GG2A 2OVBA 4MRRA 2VT6A 5CX4A 2O0HA 3TX6A 3RK4A 2MR6A 3PS9A 3P4UA 5JAIA 5A0VA 2FEPA 4GWGA 3ZU3A 1SXJC 1T3HA 7GPBA 2O2IA 1IVNA 3DD5A 3LCUA 2NADA 3D54D 2FSFA 1XRNA 5CCXA 3AM3A 1L5MA 1XMQB 1P33A 1RJ9B 1BDHA 4ZYYA 1CVLA 4IF4A 4JVSB 4AMBA 1BW9B 1S2LA 2ZUUA 3OIYA 3KPVA 1GFZA 1MQ8B 3GR6A 3CVJA 4C89A 2GM4A 3WO1A 1WCYA 1GZ5A 3C7DB 4Y2JA 2WY2D 4C4ZA 2G25A 2B20A 2X58A 3IL2A 3D9QX 4PHHA 4DZTA 4MYDA 3P9CA 3JQAD 2GFIA 1QK3A 2I6SA 3NWOA 4P7GA 5JLJA 1TXGA 1CR6A 2J33A 2VPZA 1TW3A 4H7JA 3E0XA 2ACKA 2G9QA 2Y76A 5CTAA 5F7ZA 3HU3A 5JD3A 5L6LB 2JAQA 5LXTB 3IKVA 2XXAB 1CJCA 4AYTA 3MT0A 1AKWA 4I4IA 2DTEA 5ALMA 1RP1A 1LQTA 3L1IA 3CLTC 2QE6A 4YMSA 5F78A 5HZMA 4XFJA 2PWZA 1QO9A 2I3AA 2GN4A 3I01A 4IX1A 2VPPA 3ZIDA 1YASA 2R6DA 4QXOA 2DFPA 2EFCB 3Q4GA 5BR4A 4C3UA 2H1VA 1YE3A 4YP6A 2X76A 5BUQA 5K1ZA 1FYFA 1C8KA 1GQ2A 1VECA 4R0NA 1ZJJA 4US0R 3ZBUA 3KETA 3C14C 4PZYA 4AWXA 2XTMA 1G3RA 5F1YA 1JR2A 2O3QA 1XVLA 4AKEA 4ENTA 1DRVA 1NMXA 1GWNA 2BBWA 2CD7A 3JQQA 3DOOA 4PSAA 2FSVC 3RD5A 4EJMA 1E77A 2FN9A 5IAEA 3CTMA 3OFVA 1XPOA 2XCIA 4WX2B 2YCBA 4MRVA 1MXFA 4GMKA 4JNCA 4R8RA 4MPRA 4F97A 3HCBA 4BB9A 2AJ8A 3AC0A 5KC8A 2R48A 4IZHA 2C7OA 2DECA 5H5JA 2VTKA 4MW0A 4DRYA 4JBIA 4LF5B 3RIHA 1V2GA 1K63A 4KIUA 1TUBB 3B3GA 2Q41A 1IK4A 3PEUA 3Q7QA 5DYYA 1E3SA 3DFIA 5ILGA 2AFIA 4FDUA 4C3ZA 5KKCA 1Z28A 4CKBA 2IUSA 1VFPA 3GWGA 4BGIA 1DKMA 1BFKA 3G2OA 3G13A 3ODGA 3OX3A 5GOZA 3WJ7A 4CM5A 3QPVA 1AA6A 1Q19A 4IH1A 4O59O 1PKEA 4DQDA 1AGRA 2K6GA 2DT8A 2WHYA 4LDZA 4US1R 3R9IA 3SXUB 2HNBA 4U7GA 4RK7A 3THXA 3UJ9A 1KZYC 1CB0A 1D7OA 3Q11A 2C9ZA 2W4MA 4TV9A 4XYMA 5CT9A 5KPJA 5A4IS 1V8FA 2Y66A 4NYJR 1H2ZA 4G67A 3L41A 1QO7A 1JKIA 1W46A 4HO1X 5AJZA 4OHZA 3KVRA 3TTSA 1MCZA 4Z99A 2PFKA 3BZUA 5TQ0B 5TLSA 2XB8A 2D6FA 4OQNA 5SZKB 3UENA 1TMGE 3GAZA 4WFJA 1ESCA 2WUFA 4GBED 4Y2HA 2YFHA 5HK9A 4QYSA 1VE3A 4G1EB 1W2GA 4R1NA 3LF2A 3QNMA 1E4VA 3F6SA 3NATA 4DMRA 1XZIA 4EYQA 4EW2A 4XA8A 3IPLA 3ZGYA 5ALNA 2B7LA 1NLFA 2OO5A 1X1SA 4RK1A 5CFLA 3NHFA 4UJ5A 1L5RA 3HXOA 3C6QA 1XA3A 3N74A 4HKTA 4JBHA 5DO9A 2I1VB 4RGBA 2QZSA 4LHXA 1LNQA 2B1RA 4RFSA 2DBZA 2C2GA 3DEFA 2PH3A 1LNZA 3IX7A 1H4TA 3QXCA 3U7QA 1W29A 2EWWA 3EGDB 2HA2A 2O50A 3O2JA 4KO8A 4OPMA 4YEDA 4FPXA 4IHJB 1J07A 3LXMA 1JE1A 3AI1A 3E5MA 3NC4A 4FK8A 3D1LA 1E2NA 3N1UA 3BTOA 3A9TA 3E58A 3V2UA 2HEGA 3B8EA 4DJJA 1JJVA 1I2MA 1NC3A 1H22A 3ZYZA 2BMDA 3COSA 1GCAA 1I01A 2MSDB 3BFPA 3DM9B 3DUFA 2AFIB 3R23A 2V0CA 3UYKA 1WMBA 3KJHA 3M3DA 3V8NA 1RXCA 4KQIA 1Y3FE 3KQLA 2PKEA 3DNMA 3D6UA 4G23A 3CGGA 4EO9A 3PXBA 1AQNA 5K4AA 3VHXA 1NF9A 1WPQA 2OT3B 2YYAA 3EA0A 4LI3X 2IXGA 3I9V1 4TTJA 3HO1A 4Q3KA 4QREA 2JCBA 5BSHA 5C8XA 5K0FA 1PV4A 5IARA 3KXKA 4XWYA 3ABRB 2Z30A 4P9NA 1Y1LA 4GRIA 1DRKA 4B4OA 5JCXA 1OH6A 2I8CA 1KI8A 1BGXT 1WHTB 1M1YE 1Q3TA 1ENYA 4V0RA 2JC3A 2AFHB 2OCAA 2XHZA 2ZIXB 4HMOA 4YXWD 5AVYA 4PU0A 2D4AA 3U44B 5AHRA 3MPOA 1CLUA 4W5TA 1UQTA 4CKYA 5IEBA 3AESA 4F4HA 2DKNA 4KX5A 4LIPD 4LRYA 3DZJA 4PZCA 2QT9A 2QD5A 3DE3X 3BXHA 2QQFA 3I5XA 3FTFA 3GEDA 4G81A 5DWVA 3T94A 4F1KA 4BNXA 1T0IA 1ZOPA 4LYGA 1QF7A 1K2VN 2BP7A 4OSPA 4F85A 4YMUA 4BFUA 3M5CA 1R2QA 3ZKWA 1DSSG 1W88A 3IP6A 2I9PA 3T9DA 3CGWA 4EHNA 1M2NA 1Z45A 2C2ZA 3D5EA 3O8QB 4LDJA 1CQPA 4PXYA 4Q1AA 5LP1A 1N4DA 5KSOA 1IUNA 3LI2A 1GV0A 4XDYA 5B58C 1AJEA 1EUDA 1JAHA 2O5RA 2RKBA 2UDPA 3ZNPA 5G4LA 1WOYA 4CHTA 3RU7A 4ND2A 3FLEA 3VDMA 1XZMA 4F04A 2VFAA 3NBXX 2OCBA 1FNDA 3KTFA 3NIGB 2ZYAA 3ORRA 4EHIA 4H1TA 2AW5A 2I7DA 2IIBA 4YLGA 4KIJA 3T7TA 1O0BA 1YA6A 4QDJA 4BLOA 4QUEA 4BHTA 2E4ZA 1E2UA 3B1XA 4PGHA 4KFCA 3HDHA 2QPTA 4XEHA 3URKA 4ZO4A 1PW7A 3M6XA 3UHPA 4RVUA 1E2LA 5EINA 1Y63A 4XH9B 1A95A 3MYRA 4Z4QA 1BROA 4IIHA 3UHFA 4KV7A 2GR9A 1YQ9A 3FBGA 2BKUA 1Z4MA 4PQYA 4QGGA 5FH9A 3OH8A 3RS3A 2ECPA 3RVBA 4CM7A 3U80A 2JA1A 2WIBA 1Z0JA 1W7AA 4MVJE 2EERA 1FQJA 3FGNA 4YRFA 4AZTA 1CUIA 1NKTA 1SFRA 4GD3Q 5K8TA 1ACJA 3DLCA 4QU9A 1I51A 3DDZX 3IA2A 1PWZA 3G5MA 3NEJA 4PC7A 1XTQA 1MX5A 2HB6A 1Y8QB 3HEAA 2ZJAA 3HDVA 3MCWA 4H0NA 4W8OA 2H57A 4D9BA 1YKGA 1EU1A 1MB0A 1NM5A 1P4AA 3KPJA 4IIJB 4OHCA 4P4SA 5B4VA 2XD4A 1AMNA 1YS9A 3VOTA 1M1NA 2W7TA 3BM5A 1LLCA 3DMTC 1JLLA 3TLCA 1HNZB 1E3WB 4AMYA 1SGWA 2Z6VA 4PG4A 3H0EA 5FIUA 4DNFA 2OCGA 4JGBA 4E4TA 3JS5A 2PH7A 5U4XA 3T12A 1MMFB 3M4JA 3QYJA 3LAWA 2VG8A 2PUAA 1F20A 4M76B 4N3CA 2W2LA 2GKGA 3T34A 4B4KA 3R4VA 4O08A 2L18A 1UKEA 1ORRA 3IAS1 5F1KA 3ISVA 2C8JA 4PXAA 4XWKA 2IDMA 5ENZA 2ID8A 2P1RA 1NKSA 2WG1A 3ZK8A 4HVLA 2GOYA 2A30A 4NNJA 1VIDA 3EQ2A 2NTVA 3WP1B 4BRSA 2XGMA 2JEZA 2ZKLA 4L76A 4Q3LA 4KYIB 4RQAA 4RETA 1WKCA 5TR9A 3HNPA 1XALA 4DZRA 4U5XA 4EY3A 4C7KA 3IDZA 4WIAA 1M7BA 2FEMA 2J45A 4P7JA 1UOOA 1DO2A 1GZVA 1XLTA 1ZJZA 4Y2XA 4ZJZA 5JZBA 3VKVA 1KRXA 1Q1EA 4UDNA 2VZ0A 3CLRD 3IOBA 3FMPB 4PZPA 2XXBA 4JI8B 1CFZA 3D7MA 2J9RA 3S1AB 1DMRA 1KZ4A 3HBMA 1ECJA 1IAVA 1QLHA 3G2KA 5K01A 3AV3A 2E37A 4U7WA 3OMWA 1RRCA 4G5OA 4QO8A 1JHYA 3A7DA 2D7CA 3VPAA 1XZEA 5FA6A 2CCJA 2W6JD 2JAPA 1E4EB 4HNQA 3ZQ4A 3WFJA 3G0DA 3AU9A 1AF7A 4G4SO 2HHJA 5JS8A 4RPGA 3L7DA 1UR5A 3FTDA 2IK8A 2VHUA 4ZGBA 2EXXA 4DWJA 4YPFA 1KZ7B 2Q0HA 1K7CA 4IOMA 1KRHA 3WYFA 1T9ZA 4MQ5A 4RTSA 5J4VA 2NTEA 2WSYB 3BMNB 3UA3A 1FUUA 2JHCA 1CB7A 1VHDA 1DIGA 4J0EA 1BCRA 2GTHA 4ZTZB 2ZCVA 1D1PA 3MXOA 4GNKA 2A0FA 5BVHA 1U11A 4OO3A 5CG2A 4GM0A 3WMXA 4JOCA 5FA8A 4X00A 5CLHA 1GPUA 2GPNA 1C80A 2IU6A 4ZGGA 2V6BA 1FMLA 1MP0A 3TSAA 2GXSA 1DQPA 1XTVA 2N46A 1DZIA 3MSCA 4NMWA 4YYEA 3N0TA 4R1OA 2I1WA 3LYLA 1FU4A 3OLCX 3WWZA 5CA0A 5LYJB 4L78A 4GYWA 2UXDB 4Z3DA 4MHOA 2ZJBA 1BS2A 1E9VA 1LD3A 2FPSA 2XOEA 3T9CA 4RENA 3PF9A 4A8JA 1XAJA 2RI1A 2CJWB 4CTJA 1SO8A 3R8FA 3KB1A 4GWLA 5ALIA 1KC1A 4WDRA 2ZUWA 2FE4A 1CJVC 1X1EA 3R3XA 1RU3A 3QEKA 4YNBA 4PLVA 2HMTA 3GA7A 4GOLD 2WD7B 4RV9A 3UVEA 3WA6A 4I4TF 1RYDA 3D3JA 1NVXQ 3AHJA 3G85A 4I8DA 4KYTA 4AKTA 1H66A 5CYFA 1JLLB 4DPKA 1OPRA 3HA2A 3SKXA 1X39A 4N3BA 4YCMA 4BQRA 1Q1GA 4O0MA 4CG0A 4EJSC 1ZESA 2YXDA 3H5TA 5C51B 1SC9A 1IJEA 4MIOA 3I30X 3X1JA 1U0LA 3DZIA 4FZ3A 1E8DA 2F9MA 2CBXA 4LY6A 3ZE8A 1PGNA 3TB6A 3F74A 4KQFA 2W6PA 2C4UA 5DNWA 3R5SA 3TLBA 4DM7A 2ZJ4A 3GROA 3CURA 3ZCVA 3MAAC 5HA5A 3GLGB 1E1QD 3O94A 1IIBA 2AE1A 4U7PB 1ML3A 1J9GA 3L0SA 4JUBA 1JIXA 2WSSD 5AM2A 1LV7A 3ZX4A 2Q62A 4R9VA 5FLKA 2H7XA 4QBIA 1P7PA 2EKZA 1Y9JA 3EPPA 1QCDA 1UEJA 1ADYA 3V4SA 4QJ3A 3H7IA 4M0MA 5EI5A 2ADMA 4CLEA 3SZUA 3WK8A 4O3MA 2FPGB 3CHYA 1WXIA 4DIDA 2BFDB 3K9BA 1PR9A 1N77A 2GX6A 2FW9A 1N0IA 4Z0NA 5A05A 4IY1A 3RREA 1F9AA 1ZEJA 1M3SA 3CRW1 4MI1A 4YAEA 1V3QE 4GFDA 2PS1A 3ZS8A 1LLFA 1FLAA 2CVZA 2G6TA 3ENZA 4MKXA 1Y3BE 4X1IA 5LQCA 1EBFA 2O4UX 4A0QA 5K0LA 1N3IA 5TGZA 1LZKA 2GZ3A 2P9CA 3TQFA 4CCAA 3T3EA 1PJAA 3M6WA 2V7WA 1UMBB 2ST1A 4CM8A 4UBJA 2ECQA 2X5OA 1BKYA 3N2GB 4F38A 2PA0A 5T8KA 4KUGA 4FYHA 2I4TA 2Q2NA 4J3NA 5B5SA 1CKEA 4Y1GA 4R7GA 3A3NA 3FDXA 1ZGAA 2AB0A 3GEBA 4MVJA 1PJZA 3B6JA 4N49A 5DRYA 4Q9IA 1ZOIA 3UOWA 3AUUA 2GHQA 3ZI0A 3C4QA 4S04A 1RYZA 3C4VA 3Q9NA 4UJ3A 1LB1B 3WJ2A 3DBHA 4J7AA 1F3OA 1IMOA 2KLHA 1UPFA 1ZLYA 2REXB 1ZONA 1MJGM 3HDQA 1VP3A 4KAJA 4EG8A 4FEGA 4CM6A 1F6WA 3GD5A 1SU7A 3IKJA 4M9RA 1VJTA 4JENA 1PV2A 5HS4A 4H6PA 1NQ5A 2ZUVA 3ZV4A 2RARA 3AHGA 4MAMA 5K8CA 2AFHA 1A9OA 2ZIXA 4R3NA 4BMSA 4OGKA 2XWSA 3BWXA 3VO9A 2B6NA 4BYMA 5F7JA 4JEHA 8ABPA 1EUYA 3CKKA 4CIXA 4RH0A 1NJ6A 1AZSC 3Q1KA 4KPUB 3URMA 4YXFA 2WDZA 4PX9A 3UANA 1ZIOA 5HBGA 2CLLB 5TQJA 1YI0A 5HEKA 1EFHA 1KPHA 2QB5A 1A97A 1C2YA 4U8GA 3NRJA 1YUNA 5AUQA 1I36A 2A78A 2OSVA 2B4YA 3BL8A 5K2MA 5AHOA 5HHTA 2AKYA 2OK8A 3NBQA 5FOVA 5F64A 2EX1A 2QAGB 2XWPA 3TFQA 3TYXA 4BRUA 4OLBA 3HZZA 1D6MA 2V6JA 3VHLB 4EECA 1TU0A 3EZGA 1I5EA 4I1YA 5H9WA 3NDRA 2CFTA 3LA6A 2QY6A 4XARA 3TTXA 1IWOA 5JEDA 5K3BA 1W5EA 1DWOA 3KOZA 1PJCA 1RP7A 5B37A 4IIVA 3DC2A 3GAMA 2Y71A 4Q1VA 5DM60 5DM70 5A4AA 1RZVA 1Z06A 4OQXA 3M6IA 1L5KA 5JNRA 1GKIA 1A71A 5C1BA 2J0SA 5M29A 3IP5A 3K2QA 4BQSA 3Q6NA 1ICEA 3CO0S 3DDWA 3IPCA 3NNNA 1DAEA 1G42A 1ZJYA 4IBOA 3LUPA 1RLTA 4XD7D 2MJLA 4YB8A 1R8SA 4KWIA 5AW6A 3LLVA 4J4TA 4GKJB 1SC1A 4IGKA 5L3SB 4W9MC 2ZE7A 4MHTA 1NT4A 2X9GA 1IPFA 1EINA 1CETA 1NE7A 1IDOA 1XZLA 5DTMA 4OQMA 4LF8B 1W93A 2ZDGA 2H5LA 2X19A 1PL8A 4JCOA 2TYSB 3AZOA 1XUOA 1U7WA 5AXDA 1MOPA 4DYVA 1W8IA 2GKSA 3QK7A 2DBRA 4IF6A 4QOGA 2PT6A 4NOKA 4UAUA 3RSGA 2ZCUA 3TL6A 5K4HA 3CT4A 4EWLA 2I62A 1KJYA 4ZOAA 4F3TA 5REQB 2IZ5A 1FCJA 4XSHA 2XMQA 4URYR 5D87A 3U3DA 4LCJA 5A0TA 5I7VA 2PR2A 1GUFA 1VIMA 3PXDA 1TCVA 3GRPA 4QOEA 1UDRA 3VPHA 3ENQA 3DH0A 4KRGA 4LV8B 4AKIA 1NVGA 3IHWA 3NHAA 4LHYA 2CXQA 1H9BA 2HEIA 3U40A 5EHZA 1BQEA 1FP1D 1YH3A 1YZGA 4H2DA 2W11A 4MQEA 4BLVA 4YI5A 1ULUA 5DXJA 1PI3A 2ECFA 3BXGA 2IP1A 4NPAA 3VFDA 5AW7A 3WI7A 2BHLA 2GYVA 4OL9A 4B46A 1LEHA 2WKPA 1YBMA 1YI1A 4YJ3B 5K8JB 4CEIA 1KERA 1LNSA 1RFLA 4PYNA 1XDGA 3DMPA 1JG4A 1H8EA 2X3UA 4ERXA 1GYRA 4OK6A 2ZUBA 4TZTA 1X8LA 3DEYX 3GZNB 1JBKA 3KOOA 5FFNA 2YUTA 1S1MA 2GZRA 1ID1A 4RD6A 4MZXA 2IJGX 3AW8A 3DDHA 3TKYA 3FLBA 3SQWA 3NEPX 1HM5A 3EXHC 3RUCA 1Z47A 3DLBA 1D2HA 2AOTB 1LSOA 1V45E 4UTOA 5IANA 4WK0B 1E7YA 3VPXA 3H4MA 3SY8A 3WYGA 2FAXA 3PRYA 4K40A 4MS3B 4AURA 5CB6A 3H0CA 3E84A 5HVNA 3KEGA 2X9VA 3OZCA 1J97A 2QVYX 2ZIVB 1KE2A 2F00A 2VF4X 4GMXA 3UKDA 2YZMA 2ZSDA 2XH8A 2C3PA 3GBSA 5ICCA 2DH6A 2N42A 3QVSA 2LWIA 3R09A 3ZLJA 2P9QA 4BV8A 3OO1A 4B3MB 5IH3A 1K2WA 1K0FA 4G0XA 3TBHA 5IFKA 4GE0A 5HG0A 2EG5A 4BZWA 3EZNA 2NTYC 3IV6A 4R2JA 2G72A 4WLFA 1GPH1 1J2TA 5EKSA 3S44A 1PNTA 3G82C 1EQAA 2BDEA 1A1SA 1D2EA 1NI4A 2VNSA 4GPIB 2BFBA 3WKDA 2CV0A 2HSGA 1S8AA 1PJ2A 2NXJA 1TVMA 1E9BA 2XMGA 4C0LA 4YAWA 3OZFA 3PRJA 1D2MA 4X6LA 3UK1A 2C99A 3LDAA 5CJJA 3T7EA 5AW4A 5L7WA 4WK2B 1LTKA 3M1LA 1S9DA 5LA6B 8MHTA 3O8DA 4ZI2A 4DHWA 1QYXA 3NNSA 4KE7A 4Q93A 4QUAA 4MLZA 3FZYA 3BBLA 2NU8A 4M9UA 1C9YA 5DYNA 1QH0A 2C98A 1OROA 3L0CA 4P36A 1ZKDA 4D0SA 1T8TA 3ZJTA 4AI6A 1HT0A 2QVBA 4XQEA 4TSFA 4PTLA 5KZMB 3IKMB 3DO5A 3GLTA 2NZWA 4KCGA 1PFWA 2R8RA 1KSGA 4DE5A 3OQIA 4Y6OA 1MJHA 4G0ZA 1QJ4A 1HE8B 1E96A 1ORWA 1LX6A 1R8QA 2IL1A 2P2LA 3L05A 4B4DA 1EM8B 4LTMA 4BVJA 4AY5A 2P0EA 4KYUA 3ONVA 5J63A 1E6MA 2H7CA 2W2XA 1LTQA 1ZXBA 2INGX 3D3QA 5HCNA 3DAPA 1K86A 1VJGA 1E99A 2FSIA 1UBJS 4OJNA 5BNZA 3ZNOA 1YJXA 1RKBA 1Z33A 2E5FA 2WHEA 3NHLA 4WPGA 2GK4A 1YQTA 3BRWA 5DSZA 1KBZA 1XDBA 4BWFB 4GM4A 2AEMA 4YACA 4GSLA 1JQLB 1R0YA 1LRLA 3PPXA 5ALSA 1OX4A 1RQNA 5FYQA 2CXNA 3SZGA 1WB6A 4LWQA 3ZN2A 3L7BA 2Q3MA 4IIXA 2DTDA 2HO4A 5TY0A 2LNDA 1GGHA 2QW0X 1XL1A 2EKPA 2XCOA 1P2UA 3AM4A 1ZC3A 4DGSA 621PA 4PG7A 4MYRA 1YVEI 2HREA 3KDAA 2X0JA 3RIXA 2WTBA 2OR3A 4X7MA 4XDGA 1NYRA 4G26A 3H97A 4CQMA 1QGUB 4QLBA 2RC6A 2VDVE 4OQEA 3UJAA 4G37A 3UK2A 1OUMA 2BEUA 5GGXA 3SNKA 4YRIA 7ABPA 3MUOA 4BFCA 4UULA 2ZCJA 1TCCA 1D7AA 1ZP6A 2OORC 2FG5A 2WF9A 1ADBA 4J0DA 1WXWA 4U2FA 1R6BX 1J25A 1SBCA 4UDXX 5FXMA 3OQOA 4Z51A 1S7GA 1V7PC 4OCZA 2BI8A 4EJ0A 4QZVA 2GF0A 4H9GA 3NRBA 2BFFB 4B47A 4P2BA 3QKUA 3ND7A 4GRAA 1C1XB 1DIHA 2YHIA 5HS6A 4QJ5A 5CMLA 4AECA 1BQ3A 2H2HA 3OM1A 4MWCA 3CEHA 4EYEA 5TMBA 1XYYA 1GKYA 2QTMA 1GU7A 1I1NA 1O6BA 3D4IA 3O7MA 4I7EA 3ID6C 4LYDA 2VA8A 1UZUA 5JWHA 4NULA 3RVRA 3HFGA 4D9KA 1OFUX 2WJ3A 4QOIA 4LE2A 5SICE 3PFIA 3K2IA 3QGMA 3ANYB 2CLOB 2GVZC 2OBFA 2YMLA 3V48A 1FJXA 1QRSA 2MMGA 1SD2A 1SR8A 4HN9A 1CUVA 1Q12A 2FSUA 1SZPA 1ZINA 3L0PA 4FGLA 1HDIA 1GAEO 3CV3A 4PPFA 3QWAA 5K3AA 2ON6A 3WR5A 1U8YA 2R44A 4X97A 2PGOA 3AXTA 2VDQB 4NWIA 1XPRA 4QO7A 3TOZA 3BOSA 3VU8A 2F7SA 5C3MA 2WWIA 5K3FA 4UTRA 1Q50A 4Q3CA 4BO4A 4ZFNA 2VNKA 2OOKA 1MR3F 3I04M 1VGQA 3FGPA 4HAOA 3CLSD 5EZYA 1CD5A 2VK4A 4CKEA 3LPMA 2X9NA 4G2NA 3SF0A 1L4BA 3VR6H 1EFLA 3UCEA 3ORFA 5IWCA 2ZRDA 3A6ZA 2VUIB 2VT7A 3R9XB 1O95D 4NI5A 5CBPB 2BWJA 2BKLA 1L8XA 1BN6A 3ZU5A 3GJ6A 1ZL0A 5FQOA 4WXEA 2PSDA 2QOEA 3UMBA 4FILA 1N4AA 2Q99A 4N5LA 1A5BB 4N5NA 4XPIB 4UM9B 5JVDF 3JVUA 1IDN1 5HNKA 4A10A 3NXSA 3P1JA 4G07A 1AURA 3PPIA 5JJ5A 2P6MA 1PR1A 4M4SA 2B82A 4YRMA 1HA3A 1IWPB 2QN1A 3PV0A 4AKGA 2VYND 4V0ME 1MOSA 3DDUA 2O2EA 4TKUA 1E1NA 5ULLA 5B12A 5B55A 5J3JA 3NP9A 1OHHD 2A9RA 5K0NA 3ZKWB 1FS6A 2BZSA 1P2SA 3LS2A 3HO6A 2G1UA 1K5GA 4JI7B 3HUEA 3QSGA 3TTTA 4BWYA 4MUNA 1OZFA 1M2HA 3PA6A 4LDQA 4QM7A 3MFYA 2Z04A 1KI7A 3DYVA 1ULAA 2I80A 2IXBA 3W4IA 5DNCA 2YQ4A 3JQ8A 4QJ4A 2HFKA 3II6X 4FJ2A 4G5QA 2FWIA 1UBCA 2WQZA 4UM8B 2WWFA 3I5MA 4TS3A 3PI6A 1DG3A 4DLLA 2DY0A 1AE1A 4D9EA 1F14A 5P8WA 4EHAA 2JK1A 1DJNA 5KI6A 2ZR7A 4M8SA 1RXIA 4L72A 1F2UB 3IEKA 2B1IA 2CHFA 3OOEA 4DFDA 4GKBA 2FTKE 1JQBA 2EZUA 1UDAA 2TMDA 1PFVA 2X40A 4WVLA 5HIMA 5C7YA 2JCYA 5J2TF 3SHFA 4Y6LA 1AUXA 1I14A 1PHRA 1V9LA 2QYTA 4W5HA 1T36B 3F6CA 1Z6GA 2XB9A 4YJ2F 4GIBA 1GR0A 4JYZA 2BE7A 4JQSA 1HV8A 1ZI6A 3FI0A 3FNQA 1XRJA 1U1EA 3LUCA 3DQQA 4DWWA 2P6NA 2W2MA 4Y2QA 4KQ2A 5AXBA 3FNEA 3N2YA 2ZYIA 5BSTA 1J21A 4NCBA 5TSDA 1EH5A 3GIWA 4KPFC 3EDMA 3MTDA 1SK8A 4WXPA 5CT8A 3ROFA 1UM9B 3IP3A 1ZL2A 2W43A 1SC6A 3LLSA 4QBTA 3ST7A 4CV0A 2GJSA 2PNFA 3GVHA 3T6KA 1UBRS 4EUFA 3FYUB 1RAFA 2VNIA 2ZI4A 4LXUA 3BJMA 4XAQA 2V9PA 3PHJA 4NQRA 3A4MA 3NVAA 2LP4Y 1OE0A 3FKSA 3Q7RA 3BN3A 3GFFA 5REQA 2O8BB 2G9RA 2HQSA 2NO0A 1EFKA 1T5BA 3IELA 4NCHA 4F4DA 3GUYA 1XMIA 2FMIA 3FYTA 3AUFA 1XMJA 2NUAA 1QH8A 2R66A 5LU8A 3L4SO 4NMHA 3VI4B 1UC9A 3RHZA 3HDGA 1QYWA 2QRVA 3JVVA 2WF6A 3KQVA 4ZCTA 4M60A 2C8LA 2HTEA 3AGPA 3RYHA 3O4HA 5CDSA 2B34A 3EHEA 1FDIA 3WLJA 2RH9B 1LLDA 2FGKA 1SU4A 5DHPA 3SVLA 4LC1A 1ZSVA 1TM3E 1YI8A 2C4KA 3BILA 4AJJA 2BKEA 4D4IA 4BQEA 1TYZA 3S7TA 4ESHA 4V39A 2ZRLA 5CYPA 2DZDA 2QJRA 3W6PA 1PP4A 5BQXA 4BQOA 2ZT6A 3P2EA 4LNUB 3ADOA 4LY9A 1XAGA 4BX2A 4MVJG 1W8DA 4LS3A 3N58A 1OU4A 1ZGGA 2P91A 4GI1A 3G0HA 2O8DA 1YU6A 3HQ4O 1FP2A 2DJ5A 5CAEB 1FJHA 3AM1A 2UAGA 3OT4A 1N1MA 1CULC 2QX6A 3NW9A 3IQWA 1WHSB 3OJEA 4RE5A 4QJIA 1NBIA 4EUKA 2Z8XA 1NVVQ 3EGEA 4LZAA 2XMSA 2G6BA 3PHLA 4FDAA 3BB1A 4S12A 5EJMA 3VX3A 1UMKA 4CLRA 1ZA2A 4HYYA 3QU9A 2ACEA 1PHPA 4ZN6A 3FVVA 4RDXA 4DIOA 3HG7A 4UDYX 2BGWA 1KVUA 3GA5A 3OURA 4MW7A 2F1IA 2N1MA 2X15A 4PAGA 2RGEA 2SCUB 3HP4A 2BRUA 4KKVA 4MV9A 4Y1EA 2WF5A 6CHYA 1AK1A 1JDJA 3ZHQA 1RLMA 3OVMA 2P11A 1L4GA 4XX0A 3DFMA 2DUNA 1FBNA 1YB6A 2DQYA 3MTEA 2VJNA 3G0CA 4I9NA 1E2FA 4LHWA 4TTRA 3DT9A 4WLVA 1BVYF 5AK6A 3C7KA 4DAEA 5LZ9A 1X0XA 3JTEA 3JQEA 4UD2A 3L4KA 3DR3A 2ROQA 2C95A 2GN6A 3TLGB 3OD5A 1MRSA 1FXWA 3E18A 3I4LA 3I32A 3MMXA 3O74A 4U9IS 1U28A 3EDYA 1W4ZA 2X8JB 1VB5A 3JSAA 4AJEA 4D74A 1KEKA 4B7XA 3D1VA 3UBTA 2ZANA 1JKMA 2GK3A 2YJNA 4M99A 1KEZA 2DR0A 3GFSA 5MHTA 4JH0A 1G8MA 2BEKA 2XAUA 1X7ZB 4IVRA 2W4QA 1P0IA 1JIVA 1ZVKA 2ZKIA 1A8PA 1E5QA 2SCUA 2AZ4A 3FGZA 3P96A 5EFZA 1LJLA 1UMBA 3EARA 3TUJC 2IOFA 1J90A 5LDHA 1WP9A 1ZMTA 3PZRA 2GYYA 3RSQA 4L5YA 1RQXA 2KBFA 4YYZA 1C29B 1I2BA 2FN7A 2C0CA 4J43A 3C3MA 3QXXA 2IA5A 1ONNA 3AETB 4TYPA 4ND8A 4GO1A 4F8YA 3ZDCA 2QUIA 1Y5LA 4MKGA 2NP7A 3F98A 3I2JA 2C59A 2HPZA 1YVRA 3NIWA 2PX0A 5AI4A 5L3QB 3NHMA 2OAP1 3JQFC 4R8KA 3WKEA 1JJIA 2D1RA 1D07A 1IMJA 2M1XA 4EJFA 4L73A 4U5QA 1BJRE 2HM7A 3SGLA 2R4TA 3UB2A 1DUVG 3CEJA 1F8UA 2PPLA 3EGCA 3WHPA 4K9MA 1SD1A 1XMOB 1S02A 1JDBB 2W98A 4R6WA 3U81A 3NHYA 4ER0A 5IRCD 1HFJA 4JLWA 4GS5A 2DH5A 4C7MA 3RF6A 2DWQA 1DUSA 2V7UA 1D0SA 1DHRA 3DPSA 2VNHA 3K0FB 2VYVA 1EI9A 2V7QA 4B8WA 1MFPA 4X64B 2XY4A 1XXHE 2B35A 4Y1FA 4JBXA 4X66B 3GLGA 3MEQA 1JHZA 3G2MA 4FIZA 1W4LA 4QLAA 1IH8A 1Z4KA 3IJEB 4INAA 4IR7A 2G76A 5AJXA 3TSYA 4LC9A 4RSRA 2LKCA 4YUWA 2WNSA 3KK0A 3R20A 3AIOA 1M8GA 2ATIA 4FSHA 5FNVB 1GGNA 2VYNA 1X7DA 4DC1A 2GT1A 2IS6A 1WCV1 1KGDA 1PJQA 4MUMA 4ND3A 1EHIA 4W5JA 3BC1A 4YP1A 1GDTA 1C1HA 4NEHB 3THWA 5DX8A 1W75A 1YV9A 4HFNA 2PZ8A 1Y1QA 3DM5A 3SJCA 1KDTA 2BJWA 4JJ6A 4BTLA 5BYAA 1PJTA 4FYVA 2CLKB 4JIMA 2Z3ZA 2ODPA 2QRJA 4AO8A 3EPLA 3D4NA 2WWGA 2IH5A 2XRYA 3VZQA 4LNHA 5IKXA 3U16A 2WHQA 1U6KA 1PJ3A 5HRUA 1Z08A 2JARA 2FW6A 4Q47A 1NI5A 1W0KD 4QNRA 3L8HA 4C22A 3N2GA 1EAMA 2XYPA 1SVLA 4ZAFA 4ER3A 1UM9A 1Z8FA 2C58A 2WABA 4CM3A 5T7BA 1HDZA 1U3CA 4RZUA 3WLAA 3JQ9C 3MJVA 3S4YA 3I92A 1X19A 5HTKA 4HNRA 5IEJA 1HQKA 1PNVA 3SI7A 3GDGA 4OYLA 2CVPA 4Z3OA 3IEIA 1B6RA 1H6DA 3DWFA 4PW0A 4TS9A 3UC5A 2WKQA 3N8HA 4Q1CA 2P8JA 1CW2B 5CH3A 2SICE 2YMMA 5IVHA 3ICPA 1NJ5A 1I10A 4M0KA 1SVSA 1NFRA 4QODA 6AT1A 5DGXA 1FDVA 1DCTA 3ORYA 1DVRA 1K88A 3PQ5A 5NLLA 4A03A 1X7GA 3D2LA 2C7QA 5EESA 4KOEC 3UAZA 3SQOA 3MOSA 3HBNA 1C7EA 1QSGA 2BC9A 2ZS8A 3KQMA 1IM5A 2RAPA 2ZIFA 4RGYA 3HDYA 3K0BA 5DGIA 1H4SA 1P74A 4BNLA 5BSWA 1JFVA 4I5IA 3N7TA 3U7HB 3H1GA 3H8WA 1QOQB 2PQ6A 2EFDB 1PQWA 1XN1A 1V1MA 3L3BA 4RBNA 1QS0A 2D3WA 3BMQB 4FEAA 3QNUA 3A4LA 3D64A 4V2IA 4ZVLA 5I9IA 2D2FA 5G53C 4ACAA 2O59A 2VDMB 4H1HA 5LQKA 1SWWA 5ECDA 1XFDA 2XB4A 2ZRPA 4NQZA 4MA0A 3WLLA 1GN9A 1QIMA 2WM2A 4XLZA 3RDPA 4PG8A 5CFRA 2FP3A 2EIHA 3LLMA 3COVA 1QF9A 2CVFA 5FPSA 1D6JA 4OA5A 3SFTA 3WWOA 3ZWQA 4A7PA 4MI9A 1PK7A 2WM9B 4JJ7A 1ODCA 4QQRA 1T2DA 4DR7B 4YASA 3IMFA 2QLFA 5ECYA 5E0KB 5EKXA 1O6CA 3QMVA 4IZOA 4QEDA 4DPLA 2QVGA 2FLKA 2HBQA 4P7KA 5CD9A 1XXLA 1OLSA 2RGYA 1KI3A 2G82A 1KP2A 4TXMA 1YQXA 2ZAOA 3FOCA 1VPLA 1ZJ6A 2O19A 4V0KA 1IPHA 4NV3A 3VNRA 4Q4AB 3GJXC 1RWXA 2YNMA 1VBMA 2Q9UA 3VR3D 3PT9A 3SN6A 4Y2SA 1Q2XA 2KX7A 3NO4A 3QQPA 3C5WP 1EFVA 2BL4A 2IPXA 2W6JA 2NU6B 4FFWA 4ZI5A 5BWLA 3HRKA 2WLSA 4RYDA 5J5AA 3RT9A 2QLLA 4C6TB 1G4AE 2QP4A 3O8LA 4IL5A 4GPBA 3CSSA 3JAMA 2GEDA 2BCJQ 1FB5A 2WF8A 4DSTA 1GT6A 1NW4A 3HJNA 1NRWA 5C4MA 1JQ3A 1KMHA 1QVZA 3GNLA 4AX4A 5U9CA 3EA5A 3NDPA 4JB0A 2IEIA 3PC4A 1VXOA 4K6CA 4YAFA 4R2HA 1P7CA 1UK8A 2NUPA 3LY5A 4C0QC 3Q2OA 3QBEA 1MUUA 4EFKA 4ITRC 3TNJA 1C7IA 4JR2A 3LO8A 4NDAA 1BCRB 4B2IA 2UUCB 3KYCA 3IBCA 1KQFA 4R8LA 2ZJ2A 3E22A 5LSAA 4HF7A 1N8TA 4HB2A 1JMKC 4QQ8A 5BN4A 4ZICA 1YBAA 3ZJUA 3I0MA 4RFVA 4G86A 5IVPA 3LZDA 4K46A 1J70A 3G8AA 4ZYLA 2VBIA 1JLSA 2ACWA 2O1XA 3ITEA 5KC9A 2JLXA 4ML3A 1HZZC 3O0DA 2CSUA 5A4KA 4CDRA 2QIOA 1GEEA 2VBFA 1GL3A 1EB9A 4P83A 1FTNA 2R11A 3ZDZB 4LOAA 4F5DA 4CGZA 2YL2A 2O2YA 3QX3A 2CL6X 1R88A 4NE2A 2IY7A 2XCRB 4M0CA 3TXAA 4MYHA 4ALMA 1NJFA 4XW2A 2XOXA 4RTNA 2G4VA 2JJ2A 3CLVA 1G2OA 5JUWA 1CERA 3ENWA 2AOWA 1Z2NX 3F5DA 4EJ6A 3HB7A 4INJA 2CHGA 4W1RA 2HRRA 2Q6OA 1HUQA 2RIPA 3OAAD 4AJPA 1Z6QA 4L8LA 4J2HA 3C8HA 3K5WA 3QOXA 2FSSA 4W6QA 4AB1A 1ARZA 4LGCA 4NBTA 2HJGA 1JV2B 1OLOA 2KJQA 3L79A 3NBMA 4WECA 4P7BA 4B84A 4P35A 4C0XA 1T6ZA 3R3JA 4FE7A 3VPSA 1U5AA 1Z2CA 2XVZA 2BGRA 4NK5A 5LWQA 3NOOA 4OOEA 4EHJA 1JKFA 2RMKA 3C4JA 3TX2A 2IXDA 2B98A 4YT2A 3KLBA 1UK7A 1HL7A 2OB2A 3F8SA 1SEVA 3L2OB 2P6PA 4MQEB 3V7FA 2GRJA 2G88A 4MKIA 1K3FA 4YJFB 1OI2A 1UBHS 3N70A 5EUBA 1XZDA 3T7JA 4DSUA 1WQ4A 1TEVA 3OZEA 2F9FA 1J8YF 3M6AA 4BNKA 1O97C 2FNAA 2KW5A 1TJ5A 5AVKA 5JSYA 4JB3A 4EL0A 2F8LA 3I28A 4ZIRB 4YGYA 1CHDA 4WJKB 4OP2A 3ZY5A 1WY5A 2JAWA 1LPBB 3IBSA 4FSXA 4ZCRA 3U26A 4WGFA 2J9XB 3O95A 5ESRA 3B85A 4LXQA 2YZKA 4GI5A 5AKXA 3IEVA 2CK3D 4JCCA 1UADA 5FPQA 1XQ9A 4F2WA 3JQGB 4MMXB 1QG4A 1SBYA 2OTCA 4ENSA 1OGJA 2NSLA 4HN2A 1VI2A 2AYYA 3V4RA 4GW3A 3RAFC 1JWAB 3FB4A 3QVOA 3T7CA 4DB2A 4WEQA 4KN6A 2A9PA 1VXRA 2LE0A 2VHZA 3CPJB 3CUTA 4K5QA 4MA5A 1WMSA 2HU7A 2VJKA 3H9GA 4F21A 1SM4A 1YUMA 1ZQ9A 2HIHA 2WJWA 3I8XA 3SC3A 3ZWCA 5KWJA 4HNTA 3GLHE 3GCDA 4ACBA 3O73A 2YWHA 4TWRA 3R5XA 3BGIA 4HC4A 2QX4A 3I1IA 5IZCC 2GXAA 1ZUHA 1ULTA 2QNRA 4WCDA 2IIVA 2Z1MA 1LK0A 3AKEA 3AP1A 1U8ZA 1AGYA 3N75A 4I50F 3ZU2A 5L3VA 1SU6A 3QMMA 4GX1A 3NH9A 1SCUB 4FSDA 4IIBA 2A1TS 2OV3A 4P82A 2JCXA 2NU7A 5K0TA 3OKCA 5HKKD 1UZNA 4QJBA 2BBTA 4CL3A 4DMHA 1DTWB 2EX4A 2EG9A 1IIRA 1A5SB 2ZRIA 2OMKA 3INNA 3LXRA 2PXCA 1Y6RA 2PBZA 4O4LB 3BMOB 2VEDA 3SYLA 5BN3B 2JS7A 1TECE 1AF4A 3FSRA 3RYIB 1A8QA 1KDRA 5DF1A 4FS3A 2HXYA 4O4IF 3O8QA 2FUNB 3GAFA 1DKQA 5D3KA 2YJGA 4EUNA 3R9XA 1KK1A 1W73A 1AU9A 3SC2B 1UJ4A 2XMBA 2WK1A 4ODIA 1XMXA 2JJQA 1VJRA 3KXIA 3EH2A 4RLQA 2QTLA 5FL7D 2FKNA 2BIFA 1RRVA 4LY0A 2OC9A 3KAKA 2PS9A 5HZKA 2QTNA 4D4HA 1UC4B 3JAWA 1R0LA 3LUDA 1E7WA 1L7XA 3MT9A 4A27A 3PUYA 2X5XA 1MO3A 1I6MA 4LDPA 1TX4B 4GOMD 4YH1A 4URUR 5KTPA 4P0TA 3KG2A 3KJEA 2H2AA 3U44A 4TRNA 1QFYA 4A4DA 4LQLA 4RHFA 2WWYA 1PQYA 1CYDA 4OTZA 1B16A 2IYTA 2DCMA 1OFTA 1KAMA 1KSHA 2Q0SA 1M1XB 1E9RA 1NVVR 5IP5A 5TPWB 5AW9A 3SVTA 3E3OA 2IUTA 1E1LA 3I9NA 2QD2A 4QBKA 5FLEX 4Q05A 3RANA 2ZWVA 3FWKA 1BC5A 4ZK6A 2VYQA 3ISTA 1RQPA 1TFRA 2Y0CA 4Q18A 4EZEA 3SQDA 2ZZKA 3PQ8A 4M87A 1VA4A 2YXEA 4Z9YA 2QMUA 2D0DA 2YR0A 4EQ6B 3BWEA 2RGDA 3HR4A 4CMEA 1C3JA 3IT3A 5JDCA 1Y8CA 2VUTA 3MRVA 4X62B 1F2UA 4FYXA 1J56A 3WL7A 3ZJVA 1NV8A 2Q6TA 3SYNA 4CL8A 1FNBA 3PKZA 2YZ2A 5IXJA 2DRIA 4HP8A 2O3RA 5TGTA 1NF3A 4O29A 2V4MA 4A5SA 3UJPA 3U7QB 4XX1A 1MV5A 2WYOA 5K3EA 4QA9A 4RA6B 4R84A 3J7TA 3DO8A 4XOIA 3ZR4B 3V7UA 5A04A 2JBAB 3H2JA 4YAOA 2IXTA 3SLRA 5GVSA 4W1SA 2B5VA 5H80A 1QYIA 1B00A 3EQ8A 4O4HB 3GXBA 3CZ9A 3VYVA 1JLRA 3H5VA 4IAOA 4GKKB 3RFCA 1Q95A 2WNIA 3PTLA 2DQZA 5AK0A 3X43A 1UC5B 3EEIA 5H3LA 8ADHA 5G3YA 3ZE1B 4ZCMA 5L4LA 1XHLA 2C9MA 3G2QA 1U4OA 3EF3A 5ICFA 4BYGA 1W52X 4Z2YA 3KSBC 5HM8A 2JIRA 2RC5A 5BQFA 1U2ZA 3NJ4A 2R9VA 1A50B 1YCHA 2C4MA 3S1SA 1DC7A 4AZ0A 4GYKA 3A3OA 3WRYC 3O2QB 2AJBA 5BSFA 4KAXA 2IIPA 4G5HA 4X63A 3E1SA 2IXFA 1BHJA 3SMVA 2C4TA 3ANXA 4D1YA 4DA4A 2M6RA 3NC1C 3TCXB 2ECKA 3DOJA 2ECOA 4RNDB 1SUDA 1VYTA 3GJ8A 3H75A 3R41A 4RJIA 4WOCA 1BMDA 1U2GC 4I2NA 3VYTB 4AJOA 3HH8A 2GH1A 3JY6A 3A9VA 3KFXA 2R6R1 2F8SA 1EZZA 2NPOA 5HQ3A 4DDVA 4X65B 3I09A 3JZDA 1OQAA 3MJTA 3VGPA 1GKKA 5EMMA 5LOVB 4XASA 1ICIA 3GEGA 3RS2A 3S40A 1PGOA 1HDOA 3ZWDA 3PNKA 1FX1A 2G83A 2UUOA 4HDCA 4RY9A 1TNDA 2OO7A 3N8NA 3RVJA 4DCNA 3Q5DA 2F67A 3EASA 2DR2A 3DZCA 4BVLA 4PRZA 5C8VA 4TRMA 2PX6A 3NBKA 3KL2A 1KEEB 2Q7XA 4XM0A 1H2RS 5FTJA 3QVGB 5FI5A 5L40A 1PZGA 4NBUA 3RS5A 3GDWA 5AFSA 3U19A 1HNWB 1WDLA 2PGNA 4UBMA 4B81A 3HEBA 4MQFB 1ZM7A 4FHEA 5FOUA 5JSFA 2Z5GA 1YS7A 1XKXA 1G20B 4R8SA 5JJKA 3T1QA 1WXXA 1E2IA 5ES4B 3ASUA 5CFZA 3IVXA 5AM0A 4GPTA 3WFZA 1JEYB 3OFSA 1EVIA 2PSHA 4F9TA 4HGYA 2PPVA 2QK4A 3F49S 3JARB 1C8BA 2C1ZA 4PAWA 1Y7HA 3LVRE 4DR5B 3FPCA 1VRCA 3HKDB 4GZ6A 3VR2A 1K7SN 1WB4A 4F6RB 1FFEA 3NUGA 4L2IB 4R5HA 5DN9A 2A3RA 4O4LA 2PU7A 2IITA 3C97A 3N39C 3L01A 4P98A 5AD1A 2IU0A 1SRQA 2HO5A 1NJ2A 2HWKA 1JSCA 2Y4NA 4XIIA 2BKXA 2Y0EA 3K5IA 1ULSA 1Y48E 2GWHA 1T35A 1SOUA 3CH7A 4XTCS 4RJTA 1EG2A 1U7ZA 5D85A 3KQWA 5BN1A 3E9RA 3SJAA 4F3CA 1UFRA 2GD6A 5GP1A 2OYSA 5CDTA 2MWMA 1U9IA 1Z22A 1EVKA 5F1PA 3R0QA 1OXXK 5JAQA 3UW1A 4YR7A 1CF2O 4Z4IA 1K9SA 1XQ6A 1DRUA 2Y27A 3IULA 2OV2A 2OBLA 1W25A 4YGXB 4AD8A 3MGBA 2JPDA 4RQBA 4WY8A 1MT3A 3C6XA 3EDQA 2IOYA 3P19A 1QZTA 1TIBA 3OQMA 1GVNB 1R5JA 1YULA 4L50A 4I1SA 1BOFA 1TKAA 3EC2A 2IEZA 1E3WA 4XSVA 3SHQA 4B6PA 2P30A 3Q3IA 3T1YB 4CIBA 1XNQB 2O2HA 2CLFB 3COZA 2B99A 1DT3A 5EPOA 5BW4A 2NO5A 1DT5A 4BO8A 1PFKA 2Y1XA 4QGSA 1TZKA 2RE8A 1XKQA 1EX6A 1NZJA 1VC2A 3P4XA 5ALOA 5FEMA 2CDBA 1HG0A 2E21A 4TRJA 3VSCA 4NP6A 4S1NA 4X94A 5EC8A 3RIYA 3ZZTA 1EK5A 2H31A 2QTZA 3WIUA 2FHPA 3QV2A 3KSZO 2O8EB 4B73A 1BN7A 5I4CA 1JR4A 4CCSA 4HWOA 3OIGA 4K28A 2NVBA 1K7EB 2EW1A 3H5LA 2VHVA 2FRDA 5KOHB 1IRXA 1EA5A 4EITA 3MFQA 4A8PA 4KLRA 2JD1A 3PB3A 1L7EA 4KIWA 2RGNA 2J9FA 2Y1WA 4ZT2A 3V4LA 1G8GA 2VHJA 1WW3A 1FIUA 8GPBA 4QHYA 2D0IA 5INTA 5HRCA 1QO0A 4M9CA 3QELB 4L57A 1VKJA 3BTVA 3VPFA 4INOA 2P0YA 3RRMA 4OH1A 1T26A 2RHTA 2VZLA 3ORSA 4XJVA 3ZXSA 2XKKA 2RG1A 1FP4B 3M33A 1CQZA 1Z6YA 4ABYA 2BHRA 4W5OA 3FKJA 4CBVA 5F5NA 1JDBC 1CZNA 2RAVA 1DGQA 1DIOB 5F9FA 4ZU1X 4C01A 2XTZA 2WJ4A 2XDYA 3DD1A 1Y5MA 4TV9F 5BMVB 1M33A 5DEIA 2HJSA 2X8BA 1PGPA 4HD8A 3S2YA 3SS8A 3KOUA 5I8WA 1Y1RA 5FOXA 1EUDB 2BR4A 3C3DA 3WGTA 3HKDA 1R6DA 4M0FA 1TEXA 1KVSA 5EJ8A 3K1TA 3HBJA 1UPCA 4FKZA 2ILTA 4RLFA 4GF5A 4FJ0A 2FPPA 3JARA 4MKZA 3S29A 3OTIA 3BWBA 1L5OA 1P39A 5G0SA 1KNXA 3W5JA 5ESWA 3HRIA 3CBGA 4LOIA 4BKOA 3CMMA 1DMSA 1LUAA 2R8OA 3E5RA 3OP1A 3SJBA 3V33A 5KX5A 1O2DA 1GDDA 3UT6A 1QIKA 3EVBA 2WTAA 4MQBA 4PZLA 3WLIA 5EJFA 1NDHA 1V1MB 1OI4A 3IVAA 4ND7A 4OYYA 1N2XA 4RY2A 3RUFA 1M7HA 1NLZA 3EG5A 4PYMA 3KYJB 2UXBB 3TVYA 3UYLA 4YLYA 1G20E 1X2BA 2GERA 3SHTA 4LKOA 3OEHD 4MJ7A 4S3MA 1B3RA 3OI7A 5DX1A 5ALGA 1N75A 5B3KA 1T5DX 2WZDA 2QMYA 1U0RA 3O75A 2IYLD 1JEDA 2WJGA 2XCQA 3N8DA 4JLAA 1NP6A 2Q1WA 2WUEA 3HBLA 1NLYA 3W2HA 4IH4A 4HH1A 4WZBE 1WMFA 1PG5A 3VZBA 2ID9A 5TC4A 2X0RA 1QE0A 4JU9A 5B7NA 1WLSA 1EE9A 1HE5A 3H3FA 4RF3A 1B2LA 1K8QA 3F90A 3ZCXA 3KKQA 3FAZA 2CJWA 2WT9A 5JMTA 3LNTA 3PDUA 1HLGA 4E21A 1W85B 4BL5A 4BMPB 4JYMA 3KVVA 1Y98A 5AUNB 1YJCA 1WETA 4B31A 2P6RA 3OLZA 4GXRA 3DF9A 4Q4AA 1HDYA 3B5JA 3GRVA 5DLPA 3TEFA 3U9SA 3M83A 1GNTA 5IT9A 1DCMA 1EUCA 1GZ4A 5ICSA 1DLIA 5T4HA 4KHPB 3AR5A 3IOEA 3IR7A 1I8TA 4NBRA 2PGLA 2CXHA 2QN7A 1NVBA 4GOXA 3OM0A 4MUXA 1IY8A 3O92A 3NB0A 4LG1A 2IIQA 4XQ0A 3FIUA 5H4HA 2YZGA 3JQDA 1C3XA 1P0MA 1WCXA 4IDEA 2Q28A 4BE9A 1CRPA 1XRQA 2WJJA 2P35A 4CDMA 1EAYA 5BOSA 4RX1A 3UUGA 1OBFO 5JATA 4DIEA 2IELA 4JY7A 4X1OA 2JI7A 1ZPDA 3CLRC 3PFFA 4F3YA 3VYRB 2HK7A 2HXGA 2RDMA 3W5AA 2XBMA 3SBOA 5KVCA 1FFCA 5FAKA 5L3SA 2XD9A 1FYWA 3A6JA 3WBKA 2A67A 3C0KA 2CLSA 3REOA 3HZRA 1LRJA 3RTBA 3KOWA 2PGXA 3JYOA 2AZTA 4X7PA 4MZDA 1KKUA 1E6KA 2IHJA 4YIHA 2FN4A 4J9VA 4JLOA 4AUMA 1VPDA 4UOZA 1CF9A 3E3LA 4H1UA 1GPYA 4LFAB 1WQ1R 2ZWPA 2ZYHA 3U3KA 4DV7B 3I9MA 5K0EA 2O2JA 3NAZA 2H2GA 4ZCQA 1LK7A 4PZAA 1K27A 4D9NA 2YQZA 3W5DA 3EPRA 4X93A 2WR8A 4PFKA 1XJWA 3TR6A 3WMEA 4A8TA 4EJ2A 3EW9A 5AOAA 2QGFA 1EQUA 3D81A 5EUQB 4ZV4A 3DTNA 4IV0A 3O4GA 1UC8A 1EMDA 4IYJA 3HR8A 5C46F 2EEPA 1AB5A 1ADCA 1U80A 3V4VB 5I7RA 1EWQA 1M67A 1YRBA 3LPAA 3OAAA 2J9ZB 2PGAA 1JDVA 3P94A 4O4IB 5JMOA 1PR2A 1JP7A 3VYUB 3DVQX 3K9HA 4ZRMA 3M6MD 2HOQA 1OB5A 4ALLA 2RD2A 1O87A 2WG2A 1EUQA 4UATA 1JLHA 2PMCA 1EZ1A 1T2UA 2DE0X 1OREA 2RGWA 5EE5B 3ZQUA 2LR0A 1PN3A 2VAXA 4EGCB 3KALA 4BFYA 2TMKA 3COWA 1PWXA 1Q20A 1ZITA 1QH1A 1KP3A 1UXKA 3FOBA 4PLPA 4F72A 4PPYA 2YFQA 4OBWA 1F9EA 3WXMA 5AJTA 4EABA 1MX3A 1JH9A 2XR1A 1KY2A 3THWB 2JZCA 1Q0TA 4QPJC 3WZMA 5AW8A 3FUXA 4NE9A 2I4RA 3QBDA 1NASA 1AKYA 2GJ4A 2Z8YM 3AOEC 5EE9A 2D2VA 4QTXA 3KZVA 3DHNA 4EPXA 4OHUA 5KTOA 1M6VA 1Q0QA 1U9CA 2FEKA 5CLLA 3R7SA 3DBRB 5IN4A 5EP2A 2JGDA 3D0KA 5EWMA 2ZTSA 4TLAA 2P69A 4O1HA 3VYWA 3C8UA 3HV2A 2UZ0A 3EIEA 2IE8A 2YYYA 1R0CA 1NF8A 2QR2A 2FW7A 3ADDA 4WCVA 2N75A 3QJ5A 3LY8A 1YB4A 3PCRB 5ECGC 3LK7A 4C2BA 3ZDEA 2RHGB 3T9BA 5JC8A 5LMZA 2O8CB 2C5BA 2Q27A 3ULKA 1J5EB 2OZLA 1UBSB 3BK1A 3AF4A 4PG6A 4TV8B 4XQ9A 1OFGA 2PYZA 1IWBB 2EATA 3QIAA 2CMKA 1JIKA 4FYJA 2JBHA 5EZSA 4A9AA 1W2WB 3E9NA 4PPNA 4XJSA 3DHEA 1PEDA 1WXEA 1NU8A 3P2YA 2HSWA 1YMQA 1JHXA 1V16B 2GEVA 3COYA 1PGQA 1V95A 3CW2A 3EFOB 1RW4A 2KI5A 3JQ9A 3AY6A 2GM5A 4H16A 3UWKA 2FPGA 2X5NA 3C48A 1BFUA 1QZ3A 1TGVA 1XAHA 3MBKA 4EHHA 2GDJA 3RNLA 3ACDA 4TMKA 5I9NA 3P8ZA 1Q57A 2WVJA 2YWFA 4N03A 4R81A 4KZPA 4D96A 5K09A 3HSYA 3ZU4A 4HSGA 3J80A 2C77A 1OI3A 4XB2A 5FOWA 1NXVA 2WIAA 5IUKC 1DU4A 3B70A 3HCFA 1UKVY 2WBLC 3LHSA 4CF6A 4JVOA 5FTWA 1Z7YA 3OY7A 4HCJA 2QLTA 5FI0B 4B6OA 3DMNA 2P9BA 5CIYA 3LDUA 2I7VA 3B3QA 1WJGA 4EY5A 1ADJA 4RHYA 5AJUA 3WLTA 2QAJA 5JARA 1D4AA 4FN5A 5TS3A 5KCZA 1TIKA 4WKOA 4QEZA 4EHBA 2XUIA 1AQ6A 1JDPA 1NG1A 3OZAA 2QDXA 1MG0A 4DJEC 4UTNA 1APBA 3U4QB 1EX7A 1QC5B 5LUAA 3N0VA 1C0PA 1TO1E 3OQVA 1WSAA 3R7BA 4C0KA 2PX5A 3E9MA 2YOGA 5HYVA 5AM5A 4HQ6A 4XX0B 3L06A 4J1NA 4J16C 2C82A 5HCIA 5K3DA 4LX8A 4D8VA 3DV9A 4EHLA 3PD1A 4IP0A 1FMTA 4F4CA 4BLWA 2H9IA 2X0KA 3KXLA 1QLWA 2IHNA 4CKBB 1YU9A 2XSZA 3OEED 3W8FA 5HUQA 5JNUA 3F6RA 1K5HA 1PE0A 2H5IA 1T1EA 2JAHA 4GMHA 2J1LA 4UFNA 3RFVA 5HQ3B 4NAHA 4LMPA 4O33A 4UHKA 4QTTB 1T4DA 2WE8A 2HCJB 2GETA 3L7MA 1HI9A 3OF5A 5IXYA 1TQ8A 2SKEA 3LT0A 1L1QA 2BT4A 2C96A 2C5EA 2EL9A 1EJ6A 2HCBA 2Y1GA 5LQSA 3S5UA 3EOBI 4DMMA 5LZ4A 3BORA 5E9AA 5SYAA 2BGUA 4KRXA 4LJYA 3FHJA 4Q3NA 2BKVA 3NJRA 4TL8A 2GBIA 3U1VA