1A95A

Xprtase from e. coli complexed with mg:cprpp and guanine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
148
structure length
145
Chain Sequence
EKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLARELGIRHVDTVCISSYNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of free and complexed forms of Escherichia coli xanthine-guanine phosphoribosyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphoribosyltransferase
molecule keywords XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
total genus 41
structure length 145
sequence length 148
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.22: Xanthine phosphoribosyltransferase.
pdb deposition date 1998-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1a95A00
1DQPA 1ZN7A 3GEPA 1ECBA 1A3CA 4M0UA 4RQAA 1WD5A 1A96A 2VFAA 2JI4A 1MZVA 1XZ8A 1NULA 4P3KA 3O7MA 2DY0A 1Y0BA 4Z1OA 1QB7A 1VCHA 5ESXA 4OHCA 5E38A 1UPFA 5K51A 4RQBA 4RAOA 1HGXA 2C4KA 5BSKA 1QCDA 2HCRA 2JBHA 2PRZA 1GPH1 1A95A 1QK5A 1TC2A 1ECCA 1HMPA 1U9YA 4WMLA 5EUCA 1JLRA 1G9TA 1IBSA 4QYIA 3DMPA 4X44A 2E55A 1DBRA 3LRTA 4P84A 5JSQA 2P1ZA 1V9SA 1BD4A 3OHPA 1A4XA 1A98A 4P80A 1LH0A 4RACA 4ZFNA 4LZNA 1XTTA 3HVUA 1QK4A 3OZFA 1DQNA 1I5EA 3OZGA 2EHJA 5JV5A 2JKZA 4P86A 4KN6A 1PZMA 4RHXA 4QYIB 3GGCA 1XZNA 2PS1A 3M3HA 2YZKA 5ESWA 1XTUA 4M0PA 4RHUA 5HIAA 1G2QA 4WN3A 1ECJA 1G9SA 3ACBA 4PAWA 1DKRA 2JKYA 3KB8A 4RADA 2PRYA 1BZYA 1JLSA 3GGJA 1O57A 5HKLA 1BD3A 1OREA 3LPNA 1I0IA 2FXVA 1UPUA 4IJQA 1R3UA 3N2LA 4RV4A 5BRNA 5KAPA 1I13A 4LZAA 3ACDA 1D6NA 4QRIA 4PFQA 2AEEA 4MB6A 3DAHA 4JITA 3ACCA 1QB8A 1AO0A 5BQOA 3G6WA 1U9ZA 1I0LA 1L1RA 1P17A 1STOA 4P83A 4S2UA 4RABA 4TWBA 4LYGA 1NONA 1P18A 4RAQA 1G2PA 1P19A 5IPFA 1QCCA 1CJBA 2XBUA 2H06A 4JLSA 2H08A 1ZN8A 3MJDA 4RHYA 1L1QA 1DKUA 5IAOA 2H07A 1YFZA 5KAMA 4M0KA 3NAGA 4LYYA 3S5JA 1Z7GA 4RHTA 4RANA 3MBIA 1P4AA 1I14A 4LZOA 4P81A 1TC1A 3H83A 4FYMA 2WNSA 1UFRA 4X45A 1XTVA 1FSGA 1QK3A 4F8EA 2IGBA 5BQPA 1OPRA 1A97A 1VDMA 1O5OA 1W30A 2GEBA 4P82A 1OROA 1VSTA 1ECGA 1J7JA 1GRVA 3DEZA 3QW4B 1ECFA 1ZN9A 3EFHA
chains in the Genus database with same CATH superfamily
4BFCA 3MWYW 1PJZA 1YGPA 2BHSA 3KVOA 1OX4A 2IIPA 4U6QA 5C7IO 4NYMR 1CZNA 1RRKA 1OSNA 1TT5B 2OSBA 3R0JA 4GEGA 3V8NA 1DT3A 1Y7IA 5CXQA 2ANCA 1YB5A 2BEKA 2R2GA 5IC4A 1TJ4A 4CW7A 4GECA 2RH4A 2KLBA 2B5WA 2PE5A 2C1EA 2QNRA 4QDKA 5ALKA 1W47A 1BN6A 1H85A 521PA 1MNQA 3SLKA 1X1TA 4KAXA 3GZTB 5GMOA 3AKZA 2JIOA 1JEOA 1IATA 4BUZA 5ADWA 1CQWA 5KPJA 2OZKA 3MYRA 3ENZA 1DTWA 2V7EA 4F12A 4WKGA 3T7SA 4C9BA 1ZQ9A 2Y6VA 3F6RA 5CW1A 3D1JA 4V0ME 1N5KA 1BOFA 3Q3CA 1ZD5A 4K6HA 4TTSA 1X9GA 4R1QA 3T54A 1NM5C 1QIKA 1T4CA 2IHTA 2YJNA 3FR7A 4IILA 2CV2A 4N5LA 3F8SA 1HNNA 4S1TA 5JUWA 1U2SA 5I8PA 1IBRA 3OECA 1CTQA 3G1TA 4MYRA 2BFAA 1MT0A 2DYKA 4IQFA 3WJ7A 4JVOA 1FSPA 1K0UA 1MV8A 3I9KA 1KZ6A 3OZEA 2OGWA 3BERA 4LV5B 4TSFD 4A92A 1PT6A 1Y5MA 3SSAA 3SR3A 4D8VA 2O50A 3H5OA 2EEPA 3C74A 3CJRA 3FG9A 3JQFA 4WK0B 2CMFA 1Z56C 2B8JA 3PKIA 1KDYA 3U13A 3WNBA 1IN1A 1VKOA 3SY8A 2NUPB 3OWHA 2QX7A 5E1DA 3BD6A 4LSZA 5KJ1A 1EVZA 2GJ8A 2BMAA 2R1TA 1VLLA 4IDGA 1CQJA 1OH8A 4J0CA 5ICEA 1IZ9A 4A1FA 5K3EA 1OIVA 2BOVA 3ZHTA 4IOMA 5EPEA 3FSEA 3R8FA 3MNFA 5GP1A 1BZYA 2HRRA 2F8SA 1X19A 4HN9A 3SLGA 3MQFA 4JJIA 5FUBA 3HKBB 1E20A 5CYPA 4JUAA 4CBVA 3DE2X 1TQ2A 4EI2A 2CC2A 3QEMB 5GPBA 3GROA 3E2IA 5CM8B 2G63A 4DQDA 4NLLA 5HGXA 2R5WA 5AJVB 3GV0A 3BE8A 4GVLA 4FIDA 1B6RA 1C0IA 3LC7O 1Q2XA 1NX6A 1M1YB 2B78A 5ECGC 1U2GC 2YR0A 4F84A 2JDID 4M1YA 4QDTA 4X60A 4BQQA 4DRZA 1XTRA 3KCNA 4GPAA 3REGA 5HZGA 3QEJA 3MINB 5L7TA 1RWWA 4YALA 3KVYA 3UMSA 1HOTA 2Z1DA 4MS1A 4E07A 2SNIE 2DKNA 2AJTA 4JLBA 1FQJA 1G6KA 4A2QA 3EXFA 2KPOA 3IC5A 4JJ4A 4JI0B 1XRLA 2CFRA 3IJEB 4LXIA 1NP3A 2Q9UA 1YKFA 1XVTA 3NDPA 4KN8A 1DJQA 3WBKA 4BJ6A 1CG6A 2VF5X 2QP4A 3EIQA 3JQAD 3R3HA 4DW8A 4KLZA 1R4NA 4LX8A 4RS4A 2RHMA 1QK3A 4K1LA 2PR7A 2RHTA 1H22A 4IV5A 3ZHBA 3FFWA 4BNWA 2PS0A 3LHKA 5AQ1A 2DUJA 5FI0B 3F6EX 4IUYA 2V7BA 2RAVA 4M83A 1RYZA 4KFCA 5EQDA 2VDMB 4GM4A 2JLCA 1I32A 1SOMA 2FK8A 2WABA 2Q5JA 1IK6A 4EPRA 1FLNA 121PA 2AFHB 4ZMRA 3CLVA 1WCV1 4X54A 4IFEA 2J30A 2PRKA 1FQKA 2E37A 1JI0A 1YVEI 2R4QA 3HKCA 2F3TA 2G1UA 4G4SO 1ZGAA 5ANRB 5KYUA 1SKQA 1M2NA 3I4CA 2WLTA 2X4DA 1D1TA 2PRSA 2YX1A 3H17A 1ZRSA 3PWZA 3IPRA 2Q4RA 3B5EA 3LPLA 2UZ1A 1W2WB 3EODA 4ZGWA 4TZTA 1GLGA 5B3JC 4FCWA 4XWAA 1KC3A 5K8CA 2IXBA 2VNHA 4FFPA 5GGYA 2ZUEA 2XDQA 3ODGA 1ZY2A 3DAFA 3QU9A 1GTVA 1ISIA 3H05A 5FBHA 1PJCA 3QWIA 3ZZ1A 5KOHB 5FNVA 4WJZA 4UMVA 1XDUA 3CLRD 5DHAA 4EG8A 1OAOA 1U4OA 1GAJA 1E62A 1VE7A 2CXNA 2WR8A 4J90A 4JP3A 1C14A 2ETVA 2CLMB 4Q9LA 5TNXA 4F72A 1BVRA 1UKVY 4QQKA 3CX3A 4MCIA 1A1SA 2PGLA 2XDWA 4BMDA 2WIFA 3NVDA 1JIKA 2DH6A 4OL9A 1QYWA 2JLUA 1FW8A 3SS7X 4K9OA 2CLHB 2Y0PA 1T9GS 1I30A 3BA6A 4ES6A 2ACVA 2ZR7A 3SZRA 1L1FA 4INOA 2JD2A 3QVUA 2W6OA 4NQRA 5CVDA 4AX8A 1P62B 1TUBA 2W6ID 4NZMA 2W00A 1EQUA 2J0UA 5FTKA 3TTYA 1E58A 3I1FA 2O8CA 3ZZUA 1BWQA 4BN0A 1MJ5A 4H6WA 4PGFA 3BH6A 4WZBE 1DKQA 3GA5A 3GP3A 2EATA 1XA0A 5CX1B 1AVTA 4LHZA 1V7PC 3L0CA 3HRKA 4HQOA 2D6FA 4ROSA 1RI5A 2WICA 2YHSA 4MV8A 1JLSA 3OHMA 5E7MA 5BV0A 2A58A 1QO0D 5LQKA 4HEA1 4MX8A 4LYDA 4OXIA 4U6SA 5CNMA 5LQNA 3DF9A 3UXMA 4A8JA 2ZBDA 2C88A 3FW1A 4O4IF 2HIMA 4B35A 2UXBB 4OGFA 1E1CB 3NDJA 2Q0HA 1K8ZB 3WWYA 2VJAA 1OXVA 1Z5VA 4QOIA 2Z2KA 1Q0UA 4KWEA 2CLSA 4EJSC 5ED4A 4HX9A 5GJCA 2IHYA 1TZMA 3HA3A 2DFDA 2YASA 5F7ZA 3PC4A 3IAM1 3DV0A 3QXXA 4S1WA 1A9PA 3I2FA 4YIHA 1Z33A 4Q01A 4M1OA 3VYUB 1QC5B 5J9FA 2FLWA 2FFJA 2UZAA 1NSTA 1NXWA 4CYMA 2FW0A 2Y66A 4J9VA 5IUJC 5AK0A 3U5ZB 2EZ4A 1EVEA 1WMSA 2AMVA 2ZZMA 2Q3MA 4WXYB 3WYNA 4B3MB 2AN9A 1ZC4A 3FTQA 5LJIA 3SF8A 5EHNA 4MP6A 4CF4A 2D0OB 5EIOA 3HLKA 1SCQA 2COUA 2QROA 1CZLA 3V32A 4F6LA 2C3YA 3QVXA 3PGMA 2JIMA 3NM6B 1PV4A 2WNSA 4GO1A 3DAYA 3T6KA 5DYNA 2WYUA 3G5TA 1K88A 2G0AA 3SDZA 4MLZA 1L5SA 1U6IA 4GOLD 3FROA 2VF4X 3ZK9A 2AK2A 2GH1A 4OB6A 3SZGA 4UXIA 3NUZA 3OCXA 2GFQA 5CPFA 2J87A 4BVHA 1FP4A 1B16A 3LSYA 2IP4A 1XD9A 5AJZA 3BJZA 3JVIA 1H1TA 4UFOA 4BRZA 4R0MA 1DLIA 1WSWA 3O91A 4JL5A 4D4GA 3SQLA 4XIIA 3EFHA 5D6NA 4DC1A 2LKDA 1X70A 1ZN7A 3H7AA 4XQ9A 3GEPA 3KD3A 3GBSA 2HDWA 5E4YA 3ZPXA 5LKAA 1C8LA 5FD8A 3AQ4A 5J1TB 4X7BA 2GEVA 2ZBQA 3NC4A 4BP9A 1RZVA 1UOPA 1PT8A 4C7MA 3WGNA 4B6QA 2IA5A 4RK5A 3DCYA 4OBWA 1K5PA 5JJLA 1JEQB 4LHXA 3V4SA 1Z39A 5BR8B 3Q40A 3C5WP 4OHXA 2BD0A 3MD0A 4XUGB 3UM9A 3ZY2A 1ISRA 4DLXA 1RQNA 4NHEA 4KYTA 5KYTA 1EHIA 3HJFA 5C8ZA 4RQBA 1ZHHA 4NCAA 5T4FA 1DBWA 2ZKIA 4XRGA 2YXBA 3L0PA 5AW2A 1M67A 2VTBB 4DB4A 2O52A 3O4HA 1KZHA 1ST3A 1YMQA 2J45A 5CVUA 1NM5A 1ZOLA 1C9EA 4K05A 2JLAA 4M7OA 4WKOA 1YR6A 4YAOA 3I61A 1XP8A 4X6LA 2B7LA 1UBKS 4I08A 2Z8ZA 4N82A 2PZJA 1B8PA 4CU5A 1U0LA 4ZI7B 4C07A 1LXCA 1OLUA 4HYEA 2QN7A 1IDOA 3ETJA 3U37A 2QT0A 1DBIA 3DOUA 3TMAA 4KDCA 1ND6A 4CIDA 2R6FA 4WQMA 1M72A 5ESDA 2IPAB 5JNLA 2H4JA 3PFHA 1LX7A 5DN9A 3U9LA 4EZIA 1T3SA 5ILGA 2B37A 1OPXA 4D4MA 2UZ1B 3EVTA 5DXAA 4ER0A 5JNSA 5HA5A 1YS9A 4C0JA 4JI4B 4EJ6A 1MAHA 2VXYA 2XKJE 2IYSA 5H9VA 4D81A 5JASA 2X8BA 2BFCA 1T26A 5HS6A 2FMXA 1O5IA 1T4MA 3CZ5A 1XTJA 2IEDA 4R8MA 1EG2A 1MB0A 2CB0A 3ZZMA 4LGYA 5C3UA 1NNLA 1VLHA 1W0KD 2RAPA 2W2TA 1GPKA 2VVTA 4LXGA 4MR7B 5JJBA 5KQLA 2Q3CA 4HQFA 3T61A 3ACCA 4UEJA 1ZI9A 4I1SA 2W2KB 3H6KA 3AF2A 1QZZA 1OVGA 2DHQA 3AILA 2PYZA 4R2KA 5DHSA 4YDQA 4ZK2A 4ERNA 3FKQA 3LLCA 1E3EA 1HLFA 2VZ0A 3ZD7A 1VM6A 4AZTA 5BURA 3AMVA 3PSHA 1HE4A 1GY8A 1DBQA 3DDUA 3GH1A 4YRSA 4YUYA 2WC1A 5COBA 2YNMD 4MQBA 3W5VA 1DXHA 4NBNA 3UGJA 5DM4A 1FZTA 1DAFA 3U9SA 4EATA 3N0WA 3C85A 3P9SA 1FP6A 3RUIA 3JAKA 1PFWA 1AGYA 1IN4A 2VNKA 4F4JA 4D25A 5DBIA 1RC8A 2W48A 5IG2A 3RSGA 2CK3D 2ZUCA 4E2FA 4W5QA 2XNKA 3GLVA 2WJIA 3EXHB 3F3KA 3ND8A 5IBRA 3P2YA 4E4TA 1E3WA 1LNSA 5I7RA 3Q9NA 1M9NA 4MW9A 2RHWA 4KX5A 2H3EA 1NT4A 3GMIA 4ETNA 5F98A 3AXTA 2FP4A 3AIMA 3AOGA 2X5NA 3HSYA 4I1VA 4IWXA 5FT9A 4BX2A 1M34E 2R8OA 3IHLA 3QLUA 3ZS9A 4BN4A 2OHGA 1Y33E 2BGMA 2BM0A 2JARA 2RHLA 5JT1A 1CX9B 1JJIA 4H60A 1LVHA 3LDGA 2EFHB 4QFMA 3UUWA 4TZ6A 4AMVA 4J0EA 4RUKA 3E23A 4N49A 4URUR 5AK4A 2QLTA 1R0KA 1N5RA 1WTCA 1PV1A 2PWZA 1WF3A 3KHKA 4IYRA 3K8ZA 4MEAA 4B2LA 3FLAA 3PLNA 3SS9X 1DIHA 4N7BA 4OA8A 1RJGA 1V7ZA 1LBHA 2WHEA 1FYVA 4D44A 1QPGA 2JI4A 5CB6A 3D6VA 3ML1A 5IU6A 3FFXA 5DNYB 1JXMA 3H5IA 1KAQA 4FE7A 2GN8A 1VCHA 5IVIA 1G5QA 3W5AA 4X1IB 3O4FA 1SU8A 4EKIA 5B58C 2EKQA 4IIFA 1KEEB 2ECOA 1ZUD1 1IHPA 4TWRA 3BHJA 5JAZA 1B0PA 4O2BF 3GIWA 5IK2A 4PLCA 1GV1A 2GN4A 1G55A 1XDZA 2JFYA 2YVUA 1L4FA 3MN1A 4L57A 1U9YA 4JQCA 1VB3A 4X7RA 5BYBA 2DMRA 3THSA 5DNDA 2ZUFA 1N2CE 3C87A 3RS4A 1ZCAA 2BT4A 4GX2A 4A16A 3H4MA 4WNAA 3CVWA 1FYDA 2PWYA 3H1AA 3GPLA 3VPFA 1KSHA 3DP9A 3I01A 5D01A 5EKTA 4DC9A 1KJQA 4I14A 3ONFA 1MXFA 4BV2A 3EMDA 2CJPA 5ITWA 1I6KA 3PPYA 5CEFA 3T52A 3UJ3X 1HDXA 4P08A 3WO0A 2WM8A 4U8HA 4U7DA 2ZM5A 3FH0A 3PWTA 3WLHA 5CA1A 2FUCA 3DKIA 4C1NA 4RDXA 1WCXA 5K09A 1U2RA 4LCEA 3GPDG 1JZQA 2PS1A 4X71A 4BBJA 4ZI7F 1VB5A 5A0TA 1M8JA 4LZZA 1SAYA 4I50F 4NNJA 3RRZA 1EA7A 3T95A 5JXGA 2C5HA 2VUUA 4KTTE 4YFYA 4FWIB 1JJBA 1SCDA 4LY6A 2PX8A 5AXBA 1MFPA 2A3RA 3KQYA 3OEHD 2OCKA 4QQNA 3QPUA 3HB0A 2WMOB 3U3ZA 1LQTA 4H7JA 2ONKA 2X2OA 3VNRA 1M74A 1YR9A 1OVMA 4PHHA 1PHPA 1QONA 1FSZA 1UADA 2PU5A 4TM8A 4UC0A 2HYDA 4S1NA 1XLVA 4FUTA 3KEMA 2Y2VA 3ZNNA 3F5QA 1XEWX 3GRZA 5DPMA 3W2TA 3PGVA 5KMGB 1UT6A 2WUVA 4KIWA 1O9GA 2VJKA 3JSAA 2VAMA 4GX1A 3K70D 1CJBA 2AEMA 4BVBA 4Q7JB 5KTKA 2VQDA 3AF1A 4Q39A 5E9JA 3LFHA 4BUCA 3EUFA 3GU3A 2JLVA 3QKIA 1E0AA 1JU4A 2J9ZB 3DE3X 1P2TA 2DECA 2IH2A 1TCAA 2NG1A 5JRDS 2NTVA 5E95A 3TLJA 3WB0A 5EHZA 2NQ8A 3G02A 3LS2A 1XEXA 2JLSA 3K0AB 5FEUA 5JU6A 1C0EA 3QE4A 3JYPA 3RTDA 1I94B 5EZQA 4KG7A 2WYVA 5K0NA 5EXPA 4OA5A 1O95D 4MINA 1ODLA 4D02A 1ORTA 1UPCA 3LCVB 3PTAA 2QRGA 3SXPA 1L5HA 1HYQA 2X76A 5FUYA 1XD2B 2OO3A 1DBPA 3WAGA 4NH0A 4LYAA 1KOFA 1TCVA 3RCBA 3F7NA 4C3VA 4ATNA 1X1RA 2HADA 1B26A 2ZUUA 1SA0A 3FF1A 3QEOA 1Q91A 2EDCA 2FOIA 2NU6A 2VRWA 1M6YA 4X93A 3TD9A 3GT3A 4CM9D 4HTAA 4K0KB 1M75A 1DWUA 3JD1A 2J4FA 4MO2A 3SEZA 1P6UA 2F6RA 2B2CA 3W7AA 4DVJA 4DYHA 2IP1A 4FBLA 4QOJA 4YPFA 4EIWA 3C0KA 1EUQA 2P9QA 3VH3A 5AQEA 5M3BA 4Y6GB 4JCCA 1VMEA 1JSXA 1OB5A 5DLPA 4PLWA 3L1KA 4F9EA 1JSCA 2F8MA 5M34A 5HGJA 1GPJA 1O97D 2CZCA 2L42A 3A7DA 1Q1NA 4EECA 4I4TF 1X77A 1X8LA 3AP3A 2OSVA 5ECDA 4EY8A 1K6EA 1PUIA 1ZUHA 2H59A 2PFGA 3O8QB 3PXXA 4P0PB 4I9FA 3ZGZA 2PLAA 4FDUA 4UU0A 2DUWA 4CJXA 4HI0E 2YWBA 3ESDA 3GCZA 4LGMA 3SBXA 2VI5A 1ITZA 1CULC 1NFQA 2PX6A 3ETEA 5CB4F 3HNOA 2WM3A 1QFXA 3TQIA 3KPYA 5ALHA 1G20A 2HMWA 1NVTA 2WU4A 2V7WA 2FMIA 3U7RA 4EELA 4QBTA 4DA0A 2ZIEA 1MQ9A 2BE7A 1TI7A 1Q3TA 3JR7A 2R751 3WWZA 1OT3A 1JJVA 3G7SA 4YK7A 4A26A 2HA3A 2KE5A 1I3CA 1TADA 3QLEA 1K92A 1DWOA 2LWIA 4TSKA 3QE2A 2IW3A 2GFHA 1PJLA 2GK6A 3L77A 4BVEA 4C3ZA 4MI6A 1WW8A 1Z5GA 2ODNA 1DC3A 2RCYA 4FGLA 3AQIA 2IDZA 1Y7TA 4O4JF 3U7QB 1ORRA 3IQGX 5HQ3A 1NN3A 2JPDA 2BGNA 2ZGVA 1B8VA 4PAMA 1MT3A 2OFWA 2XVMA 2YBDA 4RZUA 2EFEB 3W6ZA 3JWIA 5BMOA 5HJ5A 3SF8B 1U0HC 2BGJA 1DRVA 3PXUA 4ZVRA 3EX7C 2ZVJA 3AUJB 5EPUA 2ZRLA 1VJRA 2YZ7A 1WU7A 3IYLW 4HGZA 2AHOA 3LX8A 3SS8A 1DC7A 4FUQA 2RKOA 5JCOC 2QU8A 5FL7D 1VP9A 5JSZA 4DV2B 3SYNA 4PVDA 2E1PA 4FZVA 3AESA 5FTWA 5JD5A 1MAAA 3N8KA 1WPGA 1AUQA 5JAUA 1XK6A 2OILA 4EFKA 1RVDA 3WWEA 1L4EA 3K92A 3VGPA 4B3XA 4KLRA 3G5UA 1NRXA 4AXBA 3EFBA 1NI3A 4HTFA 4OD0A 2P77A 5E3HA 4M9ZA 5BNFA 2FSHA 1CQIB 3DFZA 4J1TA 5BRJA 4ZQBA 4FGSA 4WFKA 1IBKB 1A2OA 3ITKA 5G1PA 4F5EA 4I9GA 1HSZA 3K2EA 3RF7A 3C1OA 1WG8A 3ITEA 3I6ZA 4JVNA 4G0NA 1W48A 4L75A 3F1LA 5ALDA 4M86A 2H07A 3C6ZA 2AT1A 2QN2A 1NMZA 3X1DA 1W25A 3CZ4A 3KZKA 1I14A 4FQ8A 2YZNA 2D4HA 1N2XA 2Y99A 4P81A 2WKQA 5HVNA 3UT6A 2ZSKA 3FTFA 3JYOA 2RJOA 3RS8A 3BRQA 2IPXA 2JH3A 4J0GA 1LPPA 3L7JA 2ZI9A 3NDRA 2WM9B 3HL4A 1QHGA 1A8QA 1NOJA 1QGUB 1JQAA 2V54A 3C24A 2Z4SA 3S2GA 1PGOA 3AHCA 2QG9A 3U7IA 4MWBA 3QLTA 1OTYA 3SMVA 4RE6A 1JEEA 1I33A 3ELBA 2J6HA 3G8AA 3SX0A 4AN1A 5LLDA 3MJ4A 2BN4A 4PCUA 1RRFA 1QR2A 3BWDD 4ER6A 3ROTA 5K0TA 2I91A 1Z17A 2H8GA 2V7QA 1MX3A 1D1SA 1C4WA 2E2WA 1PKXA 5E7QA 3C6KA 5TC4A 1DBVO 3EB9A 3NBMA 4PGAA 4MI1A 5E8RA 1QG2A 3JSXA 1B00A 1KETA 1XL0A 3ASYA 1CDEA 4TMVA 4IIHA 2Z2XA 1CY4A 2ZIXA 4Y8VA 4OVKA 5ETJA 5LP6A 3H2JA 4Q1AA 1KR2A 2P0YA 2PKEA 1QDUA 4XJTA 5NLLA 3N05A 5FR1A 5H0IA 4NKRA 4TQUS 3SU8A 4TXLA 4HQLA 2C2GA 2Y76A 3CX6A 421PA 5JDCA 4PNZA 5KDOA 5KNBH 2GXSA 2G25A 1Q17A 3AB7A 1FFSA 4MJ7A 4GPEA 3VFDA 5J59A 3OZRA 5I6DA 1D2CA 2V0GA 2XE8A 5I4BA 3G7NA 1NXXA 3PA8A 3U81A 1GQ2A 3TVYA 3RVDA 1T8RA 5DTQA 1OC2A 3ITNA 1U0TA 3QVGB 5KBYA 1R5NA 4WFIA 3RUPA 4BMXA 5EE9A 5IJWA 1K63A 2CL7X 1QGOA 3QENA 5TQ2B 2WYOA 3A4MA 3BF8A 1OTXA 4A8HA 3MRSA 1NC1A 5FXMA 1GNLA 3LCCA 1I10A 1LH0A 1QMGA 4FD3A 2XEDA 1Q6ZA 4H4DA 4Q9IA 1XAGA 2A1TR 4KFTA 4DNPA 3AHJA 5J2UA 2WIJA 1MA3A 1G41A 1ZK3A 1UINA 2Z5FA 4Q1BA 3TW8A 4EMBA 2G08A 5LC1A 1OFTA 1UM9B 1KI8A 2ES4A 2JAOA 1FNSA 2MINB 4J2HA 5CM2Z 2RHOA 5M7EA 3J81k 2DUUA 1MGPA 3O8QA 4Q0MA 4JC4A 1X7WA 4MQ4A 5IAKA 3RHSA 2VPIA 4KNVA 1V16A 2PRYA 4K9MA 5B3LA 1CKEA 1PNRA 1LJ8A 2TRSB 1BE1A 2VUTA 2BKVA 2X15A 3B1ZA 3GD5A 4IXMA 1FU4A 3ZH9B 3S81A 2JIQA 3EF1A 4JUFA 2FXVA 1NQUA 4MJLA 2HU8A 4QEDA 4TLLB 3S2SA 4IAOA 3PXEA 2QMZA 3S6JA 1F38A 4FEYA 2F3UA 4NESA 3OA0A 3QY9A 1SQ6A 2CL0X 2EW2A 3HEBA 1GTJ1 3G9ZA 3GQBB 1R64A 3JYLA 2GJ4A 1GFSA 1LVGA 4WESB 5BPHA 3FVVA 3IT1A 4CXMA 1IUKA 3SNHA 3HJHA 5I7EA 1Q50A 2PUTA 3P9CA 5FL7A 3PJEA 1JFRA 1N6HA 1UWLA 2FR8C 3QVSA 4BFTA 5EFOA 1A04A 3WI7A 5B4TA 5MN4A 3PDWA 4UOEA 1IXSB 3OWXA 4BO1A 4M99A 1I6WA 3T99A 1AKTA 1VL8A 1XE3A 2BFDA 2C4WA 3CTMA 4HAXA 4D9NA 4AQDA 4DSUA 5BW4A 4CRWB 3MBIA 5F7XA 2DCMA 3A6GA 4HTFB 1MXHA 1XRMA 2CVFA 1U2QA 3M6VA 1KK2A 1V5WA 4EW3A 2JJQA 2Z2JA 5A3SA 5B7QA 2WAOA 4OK6A 2MCFA 3T9DA 3V1NA 3ZD8A 1TFUA 1GU7A 5B2EA 3HBAA 5L53A 4R7TA 3FX2A 4ZD6A 8OHMA 1GTL1 4ZO8A 4HNRA 3AR6A 2UUAB 1YQGA 4MKGA 3P97A 2VATA 1ETHA 4P38A 3LWBA 2DWUA 1EVYA 2O1SA 3MB8A 1SZPA 2IY7A 2VQFB 3GLGB 1SCUA 3PTZA 4FZ3A 3TOXA 1QHHB 2GCOA 1KVUA 2QG4A 4HG2A 3CN9A 4NS1A 4WY8A 3T9EA 2R4UA 3T7EA 4QXQA 1V8BA 3N2YA 1ZSVA 1Z83A 2IYZA 4QUAA 1JX6A 1N92A 1F2VA 4YP5A 2BFBB 3RNOA 3T9BA 4UE6A 3ICPA 3LT5A 3WL3A 1F1BA 1WJGA 4QU0A 3T1HB 3EDOA 3EXG1 4Q3OA 4UPDA 4YAKA 4X6YA 2XCSB 3V2UA 4KSCA 4V0LA 2H4FA 5FBVB 3ZHSA 1CEEA 2CJFA 3NBKA 4EB3A 2WILA 3DLCA 5IMBA 5DWQA 3PXBA 4B7XA 1DO8A 4EBFA 4ND2A 2Y0CA 6REQA 1N4DA 3JQCA 1EP1B 4ZYUA 3MGGA 2H11A 4NMXB 5K6AC 2CYCA 2A9QA 3TDKA 4D3FA 5CYGA 2Z6AA 1V41E 3CURA 3EIFA 3ABSB 5DO9A 3PRKE 3HDYA 1NE7A 1UZUA 2OESA 2R44A 5EJMA 3V2HA 2AYXA 1KPGA 1TT7A 2OE2A 2R6JA 3FWZA 2JKVA 4EVIA 1T5SA 3Q8WA 1IXRC 2WF8A 2ODPA 1URPA 3VR6D 1COZA 5FIUA 4JR2A 1Q5PA 3D2AA 4LDRA 1LDNA 3NG1A 2NADA 4RE5A 4AKSA 1G3UA 3BDAA 4B3HA 1KEPA 4G0VA 1DX6A 2Q2WA 1QH1A 4GQIA 4IS2A 1W0KA 1L6RA 4K9NA 4RVSA 2WTBA 2XZLA 5IYZA 3PHIA 3K0FA 1XLWA 3WGQA 2XRFA 4E1AA 3TDNA 4OHZA 4BEVA 2YY7A 4YN3A 5IAGA 4U02A 2BH2A 4EKGA 4YJ2A 4JL6A 4OKNA 2P9BA 2OQIA 4ESEA 5A3QA 2UYCA 3CVXA 1ZIDA 1HORA 3SKYA 1WV0A 4E6EA 4L0QA 3BXPA 4NMMA 1R6TA 1Y8RA 2OLKA 4M8NE 1J5XA 1O9HA 2BFOA 2REXB 2XHZA 3QRWA 4R83A 2ODEA 1M1UA 4PFSA 5GOZA 5J2UB 3DNMA 2YIDA 2BV3A 3FFBA 4EEKA 1NTOA 2Q7XA 1E89A 3DV2A 3LC1O 2HPHA 2P27A 3W3ZB 2J7PD 4OB7A 1CP3A 1FUUA 2JHFA 2IZ6A 5JYBA 1WR8A 1JHAA 1NP7A 3H11B 2PZEA 3HGQA 3LPAA 1JW9B 1KYVA 4DLAA 1CEXA 2VWHA 2QVXX 3QI7A 4PNEA 3ROKA 1XR3A 1P72A 2INGX 1GD1O 4A0SA 1C3VA 2H54A 4DQVA 1F2DA 2FNAA 1HBJA 1IZYA 4NBUA 2MYUA 5FQNA 2P9EA 2Q6TA 4X97A 4BNJA 1FFHA 4PPYA 1R6DA 4TL8A 4ZREA 3WBFA 1I7PA 4M6WB 1RLJA 4JUCA 3RK4A 1H2ZA 3MK31 4NYJQ 2P2YA 4OHUA 4RANA 4WESA 1T1JA 5JS2A 1I24A 3WL5A 3WK6A 4C08A 3ZWYA 2PSFA 1K3UB 4MYDA 4C88A 1X87A 2Y67A 3CX4A 1KRXA 1F0YA 2I2CA 2ZWIA 1ZCJA 2VG8A 5DSZA 1FMLA 2PT5A 3EIHA 2Z0MA 1YR3A 4E5VA 2JGMA 3B1FA 1E2EA 1T9ZA 3GFQA 1T1EA 5BQPA 3WFIA 5C37A 1O94C 4XX1A 1HQYE 1W30A 1XOIA 2IYRA 1UC9A 3O5AA 3MT9A 4Y1EA 2I1QA 2EU8A 2WEKA 3OJCA 4FZ5A 4OSEA 1FVXA 3O8OA 1XU7A 3SEQA 3OO0A 5EKSA 3RS0A 2RSLA 1Z0JA 4EB6B 1P0CA 2J7PA 4C21A 4ZT6A 3EGOA 1KO1A 5HKOA 4GUDA 2XMZA 1SQ5A 3BRWA 4TS3A 1RWOA 4DEVA 1O0BA 1SC6A 1V48A 1YC2A 3ROQA 3IUBA 2R11A 1DADA 3C4QA 3FR8A 1QB7A 2BKXA 4YHHB 1QQAA 1M2VB 4YP1A 2RG1A 3UMMA 1JHDA 1QTIA 3SJBA 3HSKA 4L15A 1VI6A 4ODIA 3O74A 2CL6X 3VZPA 2ZAGA 3EK2A 3LY9A 2JRCA 1SG0A 4H7FA 16PKA 2CFIA 3ZZTA 2X0IA 4DLWA 4R9VA 4L6IA 4E5NA 1P1CA 2SKDA 3PF8A 4JCOA 4CQJA 3OAAA 2JGLA 2J08A 2HK9A 3CH7A 4LWPA 4GYYA 4OAQA 4NOMA 5K3BA 1T8YA 2HA0A 5KNBD 3AZPA 4L9AA 4UMDA 1JNYA 3VOSA 1GKUB 3QKRA 4YJKA 2P7IA 1KU6A 1K98A 4QHSA 2O4CA 5EWJB 1G21A 4LY9A 3DWIA 2BI8A 4Q3EA 1VIYA 5FHRA 3UCFA 3Q8KA 4NV0A 2OMEA 2I2BA 2BISA 3E8MA 3F78A 4P86A 4MUEA 4WUTA 4OHRA 1RYFA 1L7EA 3TOSA 1PEDA 4MARA 4TWAA 4JP1A 3IIKA 4NH4A 3A1FA 1AT1A 3N39C 4KL8S 5HSGA 3HTXA 2ZBFA 3GOQA 4GSYA 3WKAA 1I2BA 4DLLA 3IAS1 1QH8B 1NURA 2QW1A 4G0YA 2FTKE 4PRKA 1M5RA 3VMMA 2QDKA 3J7TA 4LXQA 1JWBB 1N8NA 3UJCA 3CRRA 3C3MA 2HRCA 3KX2A 2AG5A 1OW3B 4LOIA 4EY5A 1I4LD 1V5GA 4NE2A 3TUZC 3UUGA 4MWOA 1QR6A 1BW9A 3A25A 3OWOA 4LZAA 1NBEA 3L79A 3PEFA 5I7OA 2IEAA 2Z3WA 1KFCB 4OKSA 5AOCA 1E98A 3NTOA 1WW2A 3ZK8A 4EHNA 4ZIRA 2IIBA 5ADHA 5D85A 2ZRQA 2P62A 2PV0A 2Y1EA 4CKCB 1MO5A 2PL5A 3FHJA 4HATA 1RFGE 1QCCA 2CYBA 2JFUA 2OUIA 3AL2A 3EXIB 3HBMA 1T0IA 3LO5A 2I3BA 4Z2YA 5LXTF 5LP6B 1HX7A 1II8B 1NUHA 3DDCA 2ZJYA 3EZ2A 2ZS8A 4XA8A 3O2SB 3RNLA 5E2IA 3TNFA 1C3LA 2C20A 3AHGA 1U8UA 4JKIA 5LZ9A 1ODKA 2B1JA 1W6RA 4FD2A 4F91B 1KEVA 4OQZA 3QXHA 2BPOA 1L7NA 4NEQA 1FFWA 3FPJA 2NPFA 1RWMA 2VF8A 4P4NA 1Z7EA 1N6KA 1UJ6A 4F21A 1K66A 3RGGA 1B3RA 1MX5A 1ZOSA 4LNHA 1XMSA 1GDDA 1XRPA 4KCGA 1TW2A 3BSFA 3D5EA 4IOLA 1UJ2A 3GFOA 4IGEA 4W4TA 2DOKA 1EYZA 5HIKA 4P82A 2XUKA 3MIIA 1WPXA 1XVAA 2WVGA 5C31A 2J3MA 1TM1E 4NAUA 5H1YA 5TT0A 1A8HA 2C07A 4UDYX 1IVSA 2ETXA 5KNDD 1MZPA 1R0WA 4DFDA 2WJYA 2YFHA 4RC9A 2WHQA 3AGPA 5DYYA 1E2BA 1YU6A 3HR8A 1HDYA 4HBGA 3COZA 3PXAA 3AR5A 2C2KA 2IY9A 1W49A 4FHZA 4ZPXA 4HDMB 3FRIA 5LB4A 1TYCA 2DR3A 3MJTA 3DBHA 4C1BA 4P3KA 3ETGA 4CQLA 4N48A 1RWKA 3TCXB 4PSKA 1GA4A 2AW5A 2DJ5A 2ZE8A 3FZEA 3AF5A 4HSEA 1DJLA 4K88A 4UCFA 5CLJA 5NULA 1OGIA 3OIDA 5ALXA 1K86A 4O5OA 2O7SA 4WFJA 3HEMA 1NG1A 3WLEA 3IDFA 4FQ5A 4LDJA 3C8MA 3HS3A 5CP8A 3IO5A 2H2IA 1JMVA 1V6AA 2C2WA 2I4RA 3LW7A 3T3GA 4YT2A 1XV5A 3FBGA 3C5HA 3S40A 1FXWA 2FPIB 3ZWXA 1E7WA 4MCAA 3DBHB 4MS4A 4BZPA 2ZWAA 3B13B 4GS5A 4W9RA 1HETA 2B98A 3O47A 2OCPA 3ZDAA 1FDVA 3S8EA 1GFWA 2BEUA 2LXNA 2L0XA 2F3QA 2ZAIA 4QXMA 4X7PA 3PUJA 2FW1A 5GGXA 2R1ZA 4GUAA 5CIWA 4LZLA 4N9WA 2RK3A 1KO8A 4BLOA 1F7UA 2BFCB 4H77A 4YCMA 4EW2A 5JS1A 3DZIA 3FMPB 4EI7A 1W46A 3A28A 1VIMA 3ZDYB 4CKYA 2HHJA 3DKRA 3HN6A 4FX5A 4DADA 4M1MA 4AUMA 3ODPA 5CK5A 1WWKA 3NYQA 3VPDA 2D1YA 4C01A 1V1MA 4WK4B 3RJ9A 1T1GA 2LUOA 4WN3A 3QI2A 2PO7A 3K35A 5BSUA 1N36B 2DERA 5TIIA 2Y0DA 1EAMA 3HVHA 4M1KA 5A05A 1JA9A 3MTEA 1GUZA 3OQIA 2ZTHA 4IX9A 4NCIA 3O2QB 4D45A 4E12A 4IHKA 721PA 4PU0A 1T9CA 2BTOA 4WVLA 2C92A 4Y6SA 1C0PA 4IIJF 1C7IA 5SYMA 4MYTA 3T8YA 3TW6A 2D13A 2YW2A 3BKXA 5ITZB 2BGGA 3GWZA 4RO0A 1KI6B 4X63A 2FSFA 2FEXA 5BT9A 1JPUA 5T4BA 5FDFA 3TG2A 4DNOA 3ZVMA 2Y71A 3EEYA 1RE1A 1NUQA 4B84A 5HNKA 3NCHA 4XM1A 1G3MA 1B6GA 1Y9EA 2DHRA 3ENVA 4TL7A 2NP7A 1NT2A 5TS3A 3U2QA 4E03A 4KR9A 3EZLA 3JWJA 4KQJA 1ZSNA 2FVYA 2YQ5A 3K5IA 2AZTA 3RSSA 3S5UA 2OXEA 3GJ7A 3OOHA 3PJGA 1D03A 1O08A 4FKMA 4S0XA 4UE2A 3PE4A 5AM1A 4D5EA 3ZWKA 4MH0R 1H3EA 3WRXC 2RGYA 3RRFA 3QPCA 4GZMA 4RETA 3ZBQA 3TNJA 4EI8A 1NDUA 2WU8A 5PNTA 1G0NA 3Q3GE 1NVKA 1RR6A 2VYCA 4O08A 4RMGA 3ESRA 4ZCLA 1HYBA 3OQHA 1K08A 4WCVA 3MTBA 1C80A 3UF0A 3FPEA 5LMUB 3ET4A 3B6EA 2DFKB 1QQ6A 1S96A 2W98A 2GKGA 1DPFA 1XF9A 4AWXA 2EYQA 5LD2C 3E3AA 1CY6A 3ZE7A 5L3SB 4HNHA 3KJIA 2BBTA 1N5LA 1YFLA 4IYJA 5IVDA 3O1JC 4JGIA 5HJEA 4GOOD 1PR5A 1QMPA 5IC6A 1CXZA 3ESYA 3QUSA 4YONB 5CA1F 4K9PA 1E2PA 4J7AA 3TGPA 4ZIRB 9ATCA 4OATA 4N6OA 3QFSA 5EC8A 3ZTTA 2XVAA 4XYEA 3FB4A 5E8JA 4YMVA 1TU4A 2X6TA 1BVYF 2H7YA 2VDNB 1JNXX 1M2WA 2CJWA 3AI2A 2QTHA 2V58A 3C97A 3G0CA 4FFDA 4LKRA 5IZCA 4DCJA 4JI7B 1GYRA 4NYIQ 3H2SA 1ZH8A 3PWKA 1UBJS 4UHKA 4A03A 1YCDA 1KH2A 3WGOA 2K6GA 4FFNA 1SBQA 1QS0B 1M54A 1WUIS 1RZUA 2P9JA 2HA6A 4HS9A 3RSCA 4ZEMA 3UMVA 1SURA 1SXJA 2E6KA 3BZBA 4KI0A 4R2LA 3M6IA 3HY3A 5KQSA 2F17A 4P5DA 3ZHZA 1E1RD 3G9TA 4KIJA 1R5BA 4NG5A 1HNZB 1T0HB 3F9IA 4YRPA 1F06A 3DBVO 4DJJA 2VR1A 2GPWA 3TLZA 4ARAA 5ARCA 1E2DA 2H1RA 4MWDA 3HADA 4G5XA 3GVHA 2DBZA 5D5HA 4TQ9A 2BSAA 4ZVLA 2YYAA 3RHTA 4F9FA 1NI4B 2BBOA 2IBTA 5FA5A 4DA6A 4MKIA 4MVJA 1CCWA 3Q2KA 3EVNA 1YVUA 4H7PA 4LJRA 1RM3A 4M3NA 5CGZA 3L1IA 1YRHA 1OCEA 3D0OA 3DEJA 5CA0A 1NI5A 5KEIA 1CZKA 4CDMA 3NJRA 4INAA 1T9DA 2R8PA 3FGOA 3KQKA 4G4SP 4HH0A 2NVUB 1EAYA 3A6PC 1PTJC 3IURA 1TD9A 2QXUA 3ROFA 1ZJWA 4IDDA 3IB6A 3LGSA 4IS3A 4U6NA 2EZ8A 2W2OA 2AF4C 4Y1FA 2POQX 3VSDA 1GIAA 3Q3JB 4QQRA 1YU9A 1P6QA 4MPDA 3K1AA 3FGNA 1THZA 1CV2A 3D4OA 3FOWA 1R3UA 5IM4A 1W4RA 2UYQA 3ZVRA 5FWXB 3SF0A 1LX6A 5IT5A 1FDWA 1ZQ1A 4DJFC 1J4AA 4IUDS 3AHEA 4YWHA 1PW7A 2J41A 3HA5A 2RHHA 1MGOA 1UKBA 4BMSA 2BKAA 1QIJA 4QYWA 3LA6A 4UEWA 3QPVA 3HM9A 2NACA 3I12A 1UCFA 5IT0A 2B0CA 1ODSA 4L4YA 3TVTA 1U8XX 4FFBB 4FMBB 5FTNA 1Q19A 2H00A 3ZWWA 2QXTA 4I1UA 3OPQA 5G53C 5CHYA 2WD7A 1ZA2A 1IDN1 4EX6A 4Q4CA 4M1QA 1SCIA 3QKSA 5GOTA 1C4OA 1SB9A 2WJHA 5D51S 5G0VA 3NAGA 1ZLXA 1S1MA 4EENA 4RJ2A 1V1MB 4EHBA 1QAQA 1ZYUA 3B6MA 1U9CA 4JQZA 5IJXA 5ULLA 3GPCA 4D97A 1HO3A 3PUIA 5HWSA 4ZEXA 1QXSA 1XJ5A 4ZJPA 3P9PA 4JJEA 3M4NA 1AQYA 4NFYA 1SKUA 2AN1A 2FXIA 1U2GA 4FP9A 4BB0A 2EJUA 4LOJA 5D84A 4J75A 1L4BA 5HUJA 4PG7A 1NZJA 5IDVA 1NBMD 1DSSG 4LJAA 3KZXA 4ZCIA 4GLOA 4LMPA 3OE5A 4UUPA 4G56A 4DHWA 3EQZA 3AOEA 4WX2B 4C4OA 4C4YA 1W7AA 2HF9A 1WHTB 4F2DA 5HR5A 2B4TO 1IIRA 1G20E 2GF2A 3A9CA 1P5ZB 4X8HA 4JXJA 4HDCA 2X8LA 3HXTA 5B3AA 1A88A 4N5HX 3VI3B 1NKSA 2E4XA 1LZLA 2R7AA 4I6JA 4DJAA 1PSDA 3VNBA 4IV8A 1OWLA 2I4NA 4I55A 3QUCA 2ORYA 3LPDA 2P41A 3V4FA 3RSFA 4G0UA 4WEOA 2GYWA 3TOVA 5BQ3A 2P2CA 1XHLA 2VXCA 3QOXA 2QP9X 3QITA 4M1ZA 2ADOA 1VIAA 4UUQA 5E38A 5HDQA 3ROEA 3TSAA 1WEKA 4Y98A 3W4JA 1P31A 4NP6A 1Z4JA 3BC1A 4TTTS 2YQZA 4NCHA 3UFXB 1LPAB 1ZR4A 2YINC 2O2JA 3I6MA 4E6PA 3LIPA 4P2BA 3L6BA 2Q5HA 1Q7TA 3UTDA 2QM8A 4AS2A 5IFLA 1JH8A 1V9CA 2DQKA 4E30A 1B0UA 2OHOA 1Y4AE 5A2QA 2IDKA 1PDWA 3FOAA 3KKQA 3MAGA 3PVSA 4PC1A 3WIUA 4WZZA 3ZUPA 4ZAZA 2W6QA 5IBPA 5CB8A 4M54A 3R3VA 5DXJA 3HVUA 2D8AA 2GZHA 4JSTA 1IY1A 4XZ3A 2FFRA 5H02A 4EF4A 1L3BA 1HTWA 1WCIA 4PICA 2GBCA 3H18A 3O75A 3A36A 3DTYA 5IJAA 1PJ8A 2PLRA 2QEQA 1CPYA 1R9NA 1WS6A 3O2JA 4UZSA 3HDVA 2WJPA 5HRUA 1CR4A 1THMA 4PZZA 4C0QC 4F4UA 5KWIA 1N2EA 3K94A 3BTVA 1WDMA 3F6YA 2JKYA 3BQNB 2W2XA 1JVBA 2JFOA 3IRUA 4GC5A 1E9EA 5FYDA 1TM3E 3OCZA 1YTUA 2IU6A 3KFXA 4A8JC 2FWJA 5JWRA 4R6WA 1E9CA 3BGDA 4WN9A 4YCDA 3VDQA 2EF0A 2IZ5A 4AZ0A 2AVNA 3QXSA 1E2FA 1Z06A 1L7PA 2O48X 3JQAB 3OPNA 4MUFA 4B34A 3T7IA 4C3OB 4E1BA 1S2MA 3GARA 3GNLA 1V11B 1XZPA 5BN4B 3MM4A 3HE3A 3Q5GA 1TK9A 4JUBA 1W5EA 1V3QE 3IMEA 4PZEA 4L8VA 5LVAA 1SJ9A 3AEKA 4I4LA 4O4JB 3PDHA 4R3NA 3YASA 5FTLA 5JPCA 4LRWA 3OTWA 2EKBA 1M2EA 2V7TA 1R18A 2IZ1A 4P2GA 5DGHA 4DA7A 1PL0A 3QG1A 4JQSA 5HF6A 1YDEA 4UOZA 5CB4B 4QVGA 2YN4A 2HUPA 5TVGA 1U3VA 4GLLA 2XGJA 3H5WA 2GBFA 4H0NA 1W88B 1UBHS 2VLBA 3AKYA 2FMFA 4FX2A 5J5CA 4A8TA 1TUIA 1M6VA 2FEMA 2V3WA 3O6VA 3M5CA 1S9HA 1AU9A 1EBFA 3INGA 4JB2A 4F4HA 1L9KA 5CTJA 5IWAB 1G291 1ULZA 2R2AA 3C6BA 3QVLA 5TXGA 2G70A 1G4HA 5IVKA 2OHXA 3RAJA 4Z3OA 3DZJA 2EFCB 1L4KA 1VGRA 2EZUA 3LAWA 2R85A 2GASA 2O8EB 3OQ1A 3LIIA 4O8CA 1PGNA 3GJQA 4NJEA 5KS2A 3KQQA 1EUDA 4I50B 3FNFA 4H15A 4O2AB 4LDAA 3ASVA 5WRFA 3VHQA 4C5AA 5K6TA 1M6VB 1VPLA 3GC6A 2XF8A 4HFRA 4YBRA 5L8VA 2HLDD 3PCTA 3MCVA 5LZ8A 3U0BA 4V0OA 2AC4A 4LVUA 1IFXA 3F5FA 1TVKB 1K4KA 3NHMA 1ECFA 3DOIA 3DOHA 2O3TA 3BB3A 1DQPA 2AOWA 3KZOA 4IG9A 3T1QA 3I9NA 4DM7A 2PUFA 4PGMA 1IQ0A 1RYDA 4OCZA 3GEMA 3PD1A 4O8ZA 4WGFA 3UJ7A 2C0CA 5H68A 1J2JA 4BWFB 4DGQA 1TEZA 2CHVA 1L8QA 2B3TA 1J8VA 1T6YA 2NM0A 1TVKA 2R97A 5KX5F 9LDBA 3RSLA 4JJGA 2A1TS 1WSBA 4NBTA 2HK6A 3ZE2B 1P5FA 4AP6A 4F5WA 1Q0PA 3ZWMA 1P0PA 4AN0A 3U4DA 4D46A 3R44A 5KJFA 4OXRA 5KREA 3GT7A 3PENA 4QXRA 5K0GA 4B3BA 4PAGA 4TVSA 1L5HB 3HRHA 1D9ZA 1U5BB 3BZUA 4S24A 5BN4A 3AR3A 2BJWA 3FIUA 2FYTA 4J0JA 1YE3A 1VCNA 2H7XA 2NSDA 4MRRA 5LBIA 4IJUA 5A9SB 1XPJA 3RM3A 1R3DA 2HSDA 3AM3A 1MO2A 4FNOA 1HDCA 4RU1A 5ILQA 3GJYA 4AJKA 1YONA 4Q03A 1QG0A 3CCFA 3DZ8A 3GD7A 1UK9A 4ZO6A 2Q29A 2C42A 3TSOA 3WZLA 5I9TA 2GARA 4M38A 1KDVA 1PG5A 1C9NA 2AWOA 3KLNA 2D7CA 3NT2A 3WMRA 4C7VA 2HLNA 1Q3HA 3WLAA 1LQ2A 2VIIA 3HJRA 1X39A 2PIDA 1T6ZA 5FI3A 4LNAA 1CJKC 4MR9A 1J9EA 3VU9B 2XKAA 2EJTA 3EQ6A 5A7HA 4ECEA 1POWA 3WJAA 4ARCA 3UW3A 1YIAA 1DDGA 5IKPA 2GERA 4V2UA 2XPCA 1WUHS 1X8JA 3DVAA 4E2WA 1Y9JA 3E3OA 1H8EA 3HDTA 2WG1A 3LNCA 1L7DA 1XC7A 3ET5A 4LTNA 1T6BY 2EHDA 5GVRA 1FVFA 1XQWA 1C3XA 3HB5X 1CQZA 2QY6A 1SBCA 2VDOB 3EZNA 2WTAA 3Q0EA 3K0HA 1QYDA 3BPSA 3KUKA 2P9TA 3U49A 3H4IA 2DSTA 1KBOA 1E3DA 4X20B 2RBEA 4C6TA 4ZHSA 2PUEA 4TTRA 5T4HA 1XZMA 3AXSA 1X0XA 3D6JA 3GRYA 3CR8A 2NU9B 1R4MA 2MT9A 4AJ9A 2CNKA 3HXPA 3NWBA 1C1HA 4A4DA 3BXGA 4BRWA 4J7XA 1WCIB 5DNEA 5IYZF 4PYJA 2AIRA 2A67A 4G8BA 1LDYA 1ICEA 3KVVA 3GP8A 4JJFA 4MVWA 3D6TB 5JZSA 1LCIA 3HJUA 1FB5A 3NIGB 5J2TF 2D1TA 3I0ZA 1A2QA 3O90A 5AVVA 4WXEA 5LNK1 5HEKA 2YFKA 1TMOA 1J49A 3ERCA 2F8LA 2R6HA 2CHGA 1Y5RA 4G81A 4TMWA 2JH8A 3SXJA 5CT8A 1S8AA 1F12A 1SCKA 4OBBA 3B3JA 3SE0A 4E70A 2ZYTX 1ACJA 4Y9RA 3K53A 1PQYA 2BM8A 1CE8A 2G5GX 3GP5A 4PZDA 4X95A 2VP0A 3H1TA 3GLIE 2ZB8A 2H0QA 2HJHA 2OAQ1 2YQ4A 4XR9A 4ZO9A 4P0QB 3K1YA 2WA1A 1CJMA 4NBRA 4B2PA 1IWPB 3D4IA 5K3OA 1D0SA 2QUJA 1MB9A 4R2IA 1RLMA 3OQMA 1EBUA 2Z2YA 1YA8A 2B34A 1J9GA 3NHJA 1V4BA 3TFOA 1L3CA 3FPLA 4OOFA 3T4XA 4GHWA 3IHTA 2VF2A 3B82A 4MS3A 1E6KA 1P0QA 3DO5A 3GJ6A 4JC8A 1XDSA 2F48A 1KC1A 4L4ZA 1RYNA 1ZCBA 4XWOA 4RSRA 1L5QA 1NFFA 1WA5A 1Z88A 2JASA 5C8DA 4DJTA 1IN8A 1VPTA 4REQA 3U62A 5DM60 3A26A 3OD1A 3ST7A 4ZI3A 5JRJA 1MIOA 3AFOA 4P9NA 1K4MA 2W22A 1NHWA 2C4VA 1VC2A 3EMKA 1TA4A 3PGLA 5HYVA 1KQNA 5JEEA 4YMGA 4ILEA 5ERGB 4IZOA 4OP3A 5E2BA 1T43A 3KAJA 4M1SA 5L3QB 2X8AA 1Y4ZA 5EJGA 2HF2A 4RD3A 5JDCC 2VBIA 5K01A 4BFUA 4WLFA 4L74A 3TSYA 1C4XA 1TZ2A 1HI9A 3CXRA 3HSSA 3LLUA 3BSWA 5K05A 4AMGA 1UFKA 3JTMA 3R6DA 3E9YA 2GZ3A 1EWRA 2QP3A 1V9SA 3E61A 2VAPA 3FAZA 3IAUA 2FH5B 3AR2A 3IS3A 4I6EA 3A1WA 4XQCA 1CC1S 3GN1A 4PPFA 4MGEA 4YCBA 3V1TC 4AJNA 2UUCB 4QTTB 4HGYA 1JDBC 3DBRA 3FETA 3NYIA 2SHKA 1X15A 3PRHA 2EXXA 2YJ6A 4HZUB 1IG0A 5CAEA 1CIJA 2VBFA 3NHAA 1EDZA 2AC7A 4A15A 1QQBA 5ERXA 5EJ9A 4LE0A 5FAXA 1DXOA 3ZDQA 2C5GA 4CIBA 3KQOA 3OF3A 1D09A 5DGDA 1FXSA 2CNDA 5DRYA 3HFSA 3FSGA 1E92A 4JEMA 4RORA 4BO0A 3GGOA 4XGKA 2UZ4A 4JXXA 3HL0A 4UTRA 1RXVA 2IOYA 3EC7A 3H4VA 1GXSB 2AOTA 3N2EA 3RUHA 4LMRA 2W93A 1A4RA 1F4LA 2R8YA 3F4BA 3NTQA 2IYAA 5TGTA 1QNFA 4IJQA 2J0UB 3N2LA 4FMDB 3BULA 4C0BA 3U7GA 3IEIA 4X61A 2Q0QA 1VJCA 3RTEA 1WE2A 2A30A 5TVKA 1PKEA 1QORA 2Q27A 4QWMA 2D0IA 3TZKA 2HQBA 2RGUA 4AU1A 4HB2A 1TA0A 4RULA 1GCAA 5TEWA 1L7OA 3GFVA 1U5CA 3M9LA 3RJMA 2BR5A 4BO7A 1QJCA 5FOWA 3I9LA 1JB1A 2OQVA 1L7MA 3OX2A 3QUAA 4G09A 2GYYA 5AM3A 4FGKA 1G8YA 2OC9A 2HHHB 1TMYA 1BS1A 2XMRA 2RGRA 2G1PA 1GUDA 2RBGA 1CQXA 3E9ZA 1SIUA 2FWAA 1ORDA 3K6RA 1TTQB 2VPYA 3L93A 4W1SA 1GRQA 3ND7A 4I1IA 4I36A 2JK1A 1C1YA 5K3CA 3ZX5A 4X65B 2AE2A 2MINA 1FSFA 3IXMA 4DA9A 4BJ3A 4BQNA 5A4JA 1CUIA 2OGZA 3HU2A 3GDFA 3WQBA 3P27A 1B1AA 4M4SA 5GM2A 4CM4B 2OQ2A 5HXAA 2IPOA 2W6PA 1GT91 3CMMA 2GZSA 4CT4B 2BFNA 1I8TA 3LJKA 2JLQA 4C4RA 1VJ0A 1GPWB 2Z5GA 4WNCA 1OPRA 5EXXA 1PFYA 3E7WA 3PGJA 2GEBA 4IKEA 4G41A 3ZWAA 1NUAA 4OJKA 3HV2A 2JGAA 3DW3X 1RM4A 4C4AA 3WGUA 5GIOE 1KFKB 3PDJA 4R8RA 2P6OA 2I3DA 5A5FA 3OVMA 4NSNA 4DEYA 1I1HA 2WVJA 3UWKA 1T6NA 2B69A 4DCTA 3GRUA 3P8ZA 3V7NA 4UHJA 3WRVA 4ARUA 3CS3A 2ZB7A 1ZMOA 1OZGA 2Y1KA 4OXYA 1JTEA 3ABIA 5T6BA 5IJ0A 2CXUA 3RG8A 2XNHA 3AUKA 4WINA 1GVHA 1G4AE 2P2LA 3RU7A 3AU8A 4ZARA 3WP0A 4QICA 2CD9A 3K9GA 3VMFA 1KSFX 1SC1A 4B40A 4QYXA 5H3CA 3VKVA 4MGZR 4ZAGA 1WM1A 2ID9A 1TRHA 4BQPA 4GXRA 3KYDB 2XGMA 4RZSA 2OZLA 5H82A 1I0ZA 4IIJB 3SC3A 1CS4C 4L4RA 2H92A 2CUNA 4FZJA 1PEKE 4QLOA 4PC7A 1GAWA 3D8TA 4ZVNA 5T41A 3ZNPA 1P4SA 3ZE8A 4QAQA 1KI3A 2P2SA 3AEUB 4PIVA 4CT0A 5B58T 4C14A 2C7BA 2ZRCA 4ITRC 1PL8A 2F90A 5LZ5A 1Q0ZA 3LQYA 3F6PA 3FAKA 2PT9A 1CUWA 1A71A 3KOXA 5FJJA 2C5FA 1PGJA 4QUGA 3U7JA 4GBMA 3WKBA 3E05A 4F3NA 2PK3A 3ZR4B 2HHCA 1ZIOA 4F7DA 1H65A 2OHVA 3M70A 4FYIA 4HKTA 4OH7A 3C3EA 2XUJA 5HKKD 1J0BA 1EFKA 2R7MA 4PLGA 2EV9A 3AEUA 4EARA 4RELA 1AOXA 2W2MA 5GV8A 2ZRIA 5D7NA 3HUEA 3TJZA 3X43A 1C9MA 3ETHA 3G2KA 3LYAA 2HV9A 3C14C 1O8CA 3GVCA 1PP4A 4GEKA 5JJIA 5DCYA 5DJ5A 1W76A 2I55A 4NECA 3JZFA 1T5IA 3K7EA 1G8PA 2E21A 2YYYA 1D8TA 4ASUD 4BKUA 1CZUA 3VVBA 3WLFA 2G9QA 2B94A 1I2AA 4YJ3A 3EN0A 3MMPA 1CUZA 2WWRA 2ZIVB 4XIGS 2WG0A 4UREA 1XZBA 1JEDA 1QHEA 3E27A 3EPRA 2XWSA 3R5XA 1KMHA 3UO8B 1EXVA 1JR6A 1TA9A 3O94A 2C9CA 4B71A 5MN6A 2H51A 2AX3A 1FBTA 2E3JA 2QIOA 3DDSA 2WFLA 1PL6A 3FJOA 4B8YA 4DDHA 1ZWKA 4CEJA 1DZIA 4PNPA 1W73A 4DBZA 3OEHA 4DRYA 2XI4A 4N40A 2OLJA 4RVNA 4OHMA 2BDUA 1PZNA 3WYCA 2J3DA 4RD0A 2QK4A 2J85A 2D1SA 1M8PA 2VBGA 2GAIA 3RS9A 1CT9A 2BUBA 3VC7A 4BVKA 2BI7A 2XMQA 4Y2SA 3QV2A 2CN1A 2DQ4A 3DFFA 4L3VA 1KDRA 3WS7A 2V03A 3OLZA 1DHRA 2PNFA 1ZOIA 1GSIA 5EHQA 4UVEA 1R8SA 3A8TA 3P52A 5FPKA 2Q9BA 1WBDA 3WRYA 2CJWB 1X3SA 4HR7A 2BMJA 2ZCUA 3BTSA 4XX0B 4DABA 2FWPA 3DM5A 4FT2A 4GMXA 4OOEA 4LOKA 1SD5A 3A4IA 5DP2A 4DREA 3RVLA 2TMYA 1EEHA 1WQ3A 3SOPA 4DCGA 4EA6A 3EVCA 2PJRA 2VXBA 3AR7A 4UAGA 4PO3X 2BBSA 3E1KA 3ZZNA 4CHGA 3R3JA 2WF9A 2JFWA 3KWLA 2QENA 2Q9AA 3HJCA 3IBTA 2F59A 3L4BA 3UIEA 4C0AC 1YQTA 4Q4JA 3E53A 2Q2NA 2HM7A 2XZOA 3EPLA 3KD2A 2QTTA 4M0UA 2G06A 3D6AA 4PPGA 3P9KA 4X0EA 3D02A 1YXMA 3BD9A 2Q5QA 1E94E 4Q4AB 3RLIA 5KKAA 2IYOA 3VAYA 2IFTA 4JYBA 3RV3A 5LN1A 1E1DA 3TUJC 4ZDJA 3PPIA 1YL5A 1HYEA 2WHYA 2ZRDA 4PFKA 5CH8A 5CR9A 5EIWA 3RVOA 2D2EA 1CHNA 3VU9A 4B6FA 4KO2S 3GLIB 2BCEA 3TQSA 4M6WA 3LQ4A 4E14A 9MHTA 4I2VA 2BKLA 3R7NA 3TTSA 5FWNA 1BEEA 3EGXB 2Z1MA 2YWEA 3H2YA 4PSAA 1YRAA 3TLKA 3OT1A 2GI4A 3ZCRA 4PTZA 1GKLA 4BV3A 3BTOA 3OHSX 4GI5A 4S1VA 2DXIA 5EL0A 3AY0A 1G9TA 3VBEA 2V3CC 1CY7A 5E7JA 4EVRA 4DLKA 3L1UA 3L7NA 2IOHA 1U6KA 4MVJG 4BZQA 1T2FA 3R3XA 4YUVA 4ZDIA 3ZJUA 1KP9A 1PTJA 2OZVA 3RYIB 4QBKA 3UYLA 2N47A 3WBBA 3I1IA 1J0CA 4D0SA 3R5FA 4MWZA 3KKZA 3CEMA 5AD1A 5CCDA 1SWWA 4C0KA 1E5TA 3PT9A 3HKCB 1DL5A 2Z5LA 1PLLA 1DUSA 2CLCX 3O92A 1SZDA 2HFJA 3IQHX 3ONVA 1WDWB 3FDFA 4HDNB 4LIPD 4Q3LA 2XWQA 1F2TA 1UMBA 5AHOA 2H5LA 5AJTA 5GINE 1HFJA 3KQHA 1NRIA 3JXEA 3M3HA 5DNCA 3U6BA 5DGXA 3WLTA 3U4IA 4PM4A 1NW4A 4Q9JA 1VQ1A 4C3UA 2WJ6A 1KI2A 4B2YA 4EA8A 2M2IA 4OFXA 3U4MA 4MWGA 2LP4Y 4R69A 4AC9A 2JA1A 5H8WA 1QP0A 4UD2A 4G5FA 4RTOA 1BD3A 3PFWO 4ZALA 4JQOA 2V45A 1M2OB 3KQVA 1DO2A 1SBIA 4XPZA 4NPHA 3E35A 5KNCA 2P4SA 4JGBA 3PEWA 4Y6RA 4JXZA 2O6HA 4YMTA 3SXUA 2H85A 3L05A 5AW7A 5DBOA 4R2HA 4EY6A 4YFVA 1ZU5A 5CLFA 3TI9A 4E31A 4RTJA 1G42A 1SVUA 3P9XA 3PX7A 3RW9A 4IL5A 4EOGA 3BHMA 2W2PA 2B5VA 1LBQA 4JJKA 1NJ8A 4OJNA 4G4GA 4R68A 5JC8A 1ILEA 1CRQA 4GI3A 4XJVA 3VSEA 1A77A 2DBQA 1E4YA 2XB4A 3QFRA 2E6UX 4JLKA 1ORHA 4Z1MD 3RK0A 4MHOA 4M0KA 4YRQA 2Z4RA 4CMCA 4D1YA 3E2PA 1OI4A 2G6BA 5CDSA 1DP4A 3FMVA 4JLWA 2WWIA 3SOZA 5DH9A 2Q49A 3PD7A 3AVTA 2OK7A 1TVEA 3OESA 4JBGA 4ZVKA 2WFMA 1QC5A 2Y0EA 1FSGA 4MV1A 4CMAA 3GHHA 4IGFA 1IC6A 1P3JA 4KH1A 5A0FA 3RS2A 1Q21A 3KK0A 3ZDRA 1E2KA 5B37A 2BZSA 3VXKA 2PQ2A 2IXAA 3D8RA 1LU9A 5JYCA 1Z22A 2RKBA 3AJ8A 2NUTA 4GW3A 4Q34A 2HKIA 3KM0A 4G3XA 3USCS 4DARA 1XPUA 3ICQB 4ALJA 1KY2A 2C94A 3KETA 2PMFA 2QRZA 3KELA 4XX0A 4E7PA 2F9FA 2JGRA 1YT5A 3PEEA 4WV3A 5AI0A 2BEWB 4FR5A 4HXEB 2O1EA 2WRZA 2QLBA 3H8VA 1FL9A 4ZU6X 1JTFA 4BQFA 2I6XA 4K8RB 4L3OA 4DIOA 1D1QA 1R6XA 3QF4A 5JVDB 3R3UA 2J5BA 4JT8A 2FN8A 1SMKA 4KH0A 4P4GA 3USES 4D3ZA 1J9ZA 5GV7A 4XJSA 3BVPA 5FH9A 4E13A 2XVZA 4Q3CA 2GEJA 1ZICA 2TYSB 3DF7A 3FA2A 1MQ8B 5ADUS 1WUKS 2G77B 4BNYA 1WLYA 3LO8A 2HIAA 3RKUA 1RBMA 4KXXA 2QVGA 3AUSA 3ZLBA 4M46A 4JYZA 2ZYRA 1KE2A 5K4GA 1AQIA 1NYLA 3NO4A 5A7GA 3SC2B 4HVCA 1UQTA 3GCXA 2PH5A 5DHPA 3HCCA 2C78A 1EBBA 3N28A 3L5OA 4WKCA 2C57A 1WUTA 5I8ZA 1H6BA 2F62A 5IMSA 5DLDA 3GG9A 5JRZA 1UBUS 1J0XO 4LF6B 1C1DA 2PZ8A 2J3LA 4KXWA 3FTPA 3U3XA 3CUEF 1B15A 4H7HA 3DC2A 1YJXA 3OZGA 5TMDA 1EWYA 4B5KA 5IT9A 2FE1A 2OAGA 4U9IS 3VR1A 1G8MA 2RHJA 4GWKA 1GHTA 4MAAA 1RVV1 4YRJA 4EQZA 2J6BA 2PQ0A 1FFXB 2ZSIA 3WFJA 2DEUA 4Y6QA 2PEYA 4EWLA 1OLUB 3PQ8A 3FWYA 2FZKA 2WD8A 2QWXA 1E1NA 2XJ4A 4UD6A 1OZFA 1L5FA 3A1DA 2JA2A 4M9QA 4OU5A 4LX0A 1RI1A 1UC8A 3TAHA 4MUNA 1JB9A 4NPAA 3T9FA 3M2TA 1RIIA 3FDXA 1XROA 4HL6A 1W36C 2GHIA 4PBSA 3SBOA 1J56A 5F4ZA 5C5DA 2XT0A 1Z4LA 3PP8A 4GI2A 2PLFA 3B6JA 5JBIA 3B7GA 3O84A 2RH5A 2FETA 1DC8A 2H16A 4HPJB 2OHIA 3WYBA 4DMFA 1CUVA 3IV7A 3E8XA 3I83A 2GJ9A 1PLJA 1TU3A 2A6PA 2QUKA 3TB4A 4MCHA 4TZ0A 3I5AA 2OCGA 2WQZA 2GZMA 3UV6A 2BGTA 3GDOA 1IWOA 2JCVA 3M4JA 1EM8A 3I52A 5B1SA 4HNVA 1RMQA 1ZXXA 1LBTA 3RRBA 3W90A 4C78A 1CJUC 4J2TA 4B4VA 3KKOA 1EFUA 3T5GA 2DCUA 3OJWA 5C18A 1G5RA 3TH5A 4F1KA 1JHOA 1QIFA 4MTCA 4Z9FA 4KITB 2X13A 3CLUC 4FBMA 1W52X 5SZHB 6GPBA 1RKQA 3OMXA 2G4CA 4NEGA 4R1NA 3SHOA 3F67A 4B47A 4DR5B 1J1UA 4F4CA 2ZJ0A 2Z6UA 1DHTA 2X86A 5FNZA 2OB2A 5IKMA 4C0LA 3ICCA 4KXMA 2NYUA 4NEHB 4UNQA 5JZBA 3E5HA 3KSBC 2BEVA 1Q44A 4F6RB 5I7AA 2VDWB 2VHCA 4C0HA 1W1UA 1MPTA 4Q1FA 1VSTA 2QE7A 4MR7A 3HCDA 1KP2A 1MR3F 2XTMA 4HX2A 3PFGA 2PWBA 5FOQA 4NOKA 1BHQ1 1KY5A 3ZE1B 2FZ4A 1AC5A 5KWSA 3RT9A 1X8KA 2IUSA 3HJGA 4WCFA 4OU4A 1WBBA 1K4YA 2YNMA 1WMEA 1ECBA 1QH1B 1SVOA 2Q28A 3D6HA 1Q22A 2B99A 1U04A 2C03A 4U2DA 4BAGA 3KEOA 4DQ0A 1YDFA 1QFSA 3AVOA 3JYHA 3UGTA 1QPZA 1X14A 3MTAA 4RLSA 1SC4A 2O8CB 3ZHXA 4F0JA 1OIXA 1FTQA 3I1YA 4YASA 4OJQA 5CFMA 1B0AA 1FFCA 4B46A 3WLSA 3PI7A 1J2YA 3GA0A 4K6CA 4MWSA 3KSAC 5I9LA 3NALA 1Y8RB 1Z2PX 5KC8A 3ZW8A 2IE0A 5T8KC 2AOVA 2VH2A 4O3FA 4COOA 5HBGA 3TRHA 4PCVA 3VPHA 2GCNA 5SYNA 1X6VA 3DB1A 2L18A 2E82A 4XWWA 2PLWA 4ZCQA 3WLMA 4N8DA 5I9SA 1Z5PA 2M6RA 2W2LD 1U65A 1KYZA 1XZEA 2C3MA 4MDEA 1SR8A 3KT0A 4FW9A 4JVSB 1WP4A 3SYKA 3A3KA 4Y2JA 4K0RA 3FYUC 3CXUA 4Q7MB 2GNPA 4C06A 2R66A 4FOTA 2XHEA 3IMFA 4I4TB 4R0NA 1OFUA 1I4WA 5IEBA 5KINB 2H5IA 4P7GA 5MGBA 1RM0A 5IXSA 1CRLA 3VAZA 1ZUNB 1IXZA 2IPLA 4TLBA 4ZVSA 4B3JA 5FPSA 6ABPA 3JQAA 3P9RA 2WIBA 2ZRMA 4PX5A 3DS8A 2O0KA 2YXDA 4MP3A 5ITVA 3BM5A 2HWYA 5FNVF 2D5BA 3LK6A 4H2DA 1R4NB 2VJLA 3IAM6 3N1UA 3R20A 1T6XA 5F1KA 5B2ZA 1G4UR 2OBMA 2VK2A 3KAQA 4KODA 3G2HA 3M6MD 4QGHA 4YS6A 5DTEA 1SUBA 2IU0A 4MWTA 4M0EA 1DS6A 2V0CA 3DAGA 4L85A 4PTYA 1X9HA 1DEKA 4L08A 4MRNA 1V4NA 4Z4IA 4EFMA 2EWMA 3LVRE 4M8LA 4AJHA 1Q0TA 2YC4C 2RK6A 4FS8A 4J4TA 1IJEA 1KYYA 1IYZA 1H4TA 4Q4JB 1ZD1A 1JPVA 2PGAA 5CFLA 1LWNA 2YYZA 5G0WA 2XBUA 3F49S 4BFLA 1KYIA 4QULA 3E9DA 4U00A 1TO6A 2ZJ4A 3WA7A 2A4KA 3FBTA 2WDPA 3MJDA 4P7BA 5DT2A 2WM2A 3AX6A 1UWCA 3G68A 1VMDA 4RJJA 2RC6A 2FX2A 1DKUA 2IS6A 5BNTA 4HJRA 3NEAA 1S4MA 3GLIA 1NXQA 4JVLA 1PDOA 4M98A 2M32A 3S2UA 4LK3A 1DTEA 4GVPA 2EFGA 1L7XA 4XYLA 2R25B 2PUAA 3M6WA 1V37A 1L5KA 1QYVA 2ZRHA 2Q5EA 3OEEA 1GPYA 3HFRA 3UQYS 4C7JA 4KK4A 1N8SA 1ZK2A 3RFXA 2Z56A 4F9TA 2D1RA 1XCOA 3WLPA 1JR4A 3CWQA 4M0LA 2QRHA 3ZE9A 2TECE 2QXYA 4IICA 4FXOA 1FJ2A 3SEAA 4D9EA 2FW6A 5FAKA 1KVRA 3U4QA 3FTDA 3PJDA 3BT7A 1NVWQ 1IIBA 3OF2A 3ZW7A 4M8IA 2A5JA 2NNWB 3N58A 4H08A 4K9DA 3O4GA 3PC6A 4EJMA 4F2WA 1G60A 5THKA 1N2ZA 3EXEA 4AY4A 2JVKA 3SZMA 1CF4A 1TYEB 1AIPA 3AZOA 4QE3A 1YIDA 3WE7A 2PR2A 4CTNA 4KE6A 4Z9BA 5TGDA 3K70B 5HFJA 4WDQA 1ZPDA 4WTOA 1X7GA 2BC9A 2GCOB 2V9PA 2F1KA 2WIGA 3WTCA 3L6OO 2PH1A 4Y30A 3ZWVA 1J20A 2SKCA 2AJ8A 1I4TD 1NL3A 4V1CA 4JIGA 4H3HB 4BGIA 4U2GA 1M0SA 2ADMA 2VSOA 3L6CA 3OC0A 4XM0A 3QTBA 3TZCA 4RZXA 1LTQA 1UQRA 1X7ZA 4AO6A 3CUSA 3E2MA 5EUMA 5JHGB 4N54A 1QE3A 1KSGA 5C4MA 2EKLA 3GJSA 1C1XA 2CDCA 3N2ZB 3QELA 2O5EA 1Y6QA 2A59A 1HZZA 1V16B 3NB0A 2QBYB 5A5VA 1VCMA 3L8DA 4HEJA 3RJTA 3RU2A 3UMFA 3VPCA 5JYEA 2WWWA 4ZKEA 4LTDA 3BIFA 4AWAA 2VPTA 3NBZC 1F8FA 2GCIA 4JJ8A 4KHPB 4ZJYA 1JIVA 3GCGA 1KAGA 1EWKA 2JFVA 2OT3B 2QPLA 1YR7A 3B5JA 2Q5OA 3GEHA 1W5SA 5TQVA 3WLJA 1BXRA 1U0OC 5ES3A 3WAJA 2O8FB 2VDLB 1K6IA 4GX0A 4US0R 3U39A 2UUBB 3C39A 3S1AB 4UAJA 3MLEA 3GFPA 3A7EA 2HJWA 3AVVA 4FFMA 4GKJB 1M1XB 1OH6A 1JR3E 1BCRA 5LYJB 1KIMA 1XA4A 4OHPA 4JT9A 5DT9A 5F21A 5TY0A 3RWMB 1FS5A 3ABZA 3Q8LA 4RQUA 2AMLA 2TS1A 3KSZO 2MYPA 3RVBA 3S28A 1SXJC 2MSCB 3ZXUB 1H1DA 1XUOA 4M89A 4BLWA 2LZ0A 2R1TB 2GBLA 3L4EA 3LC0A 3TTWA 2GYUA 1PQUA 2PTGA 3TEMA 2QF7A 1R8JA 3DOJA 4GAEA 3RFUA 1GPNA 1D7AA 2OCLA 1PZGA 3FUWA 3RH0A 1RRGA 3R7WB 3W8NA 2CMKA 3X1WA 1E3IA 3PPXA 2IEZA 1MLDA 5T5QA 4YRRA 2C4UA 4P4UA 1C8VB 3ZCQA 1XXHB 3O21A 3TLYA 1G5IA 2C00A 1M76A 2Q1UA 4HDNA 3TX6A 3WMWA 1ZMTA 4IHJA 1JSRA 1ONNA 2JFGA 4BHTA 1J21A 3COYA 1GN8A 3UAYA 1HDOA 4KMOA 4YCJA 2CXSA 3OIGA 3MJFA 5ERYA 3EFOA 5JAMA 3H04A 1RW4A 4UTVA 5B4VA 1IU9A 1XJWA 4G1MB 4GM0A 1QVVA 4C2UA 1O03A 2I4TA 5H80A 2P69A 3Q87B 5JSZB 3PVZA 4OLHA 1W6UA 1R27A 1PBNA 2C5LA 4IR7A 2IX3A 2PANA 4JX8A 4BTVA 1SH7A 2MTBA 1ZX1A 2N1MA 1L5WA 2ZSUA 3SKXA 3ICEA 1C5KA 4W5HA 2OP1A 3CLTC 1WNTA 3EPPA 3JD4A 1B23P 4DF3A 5IJZA 5DN6D 1BCSA 2FPGB 1QZUA 2J9GA 2XYVA 3DUFA 1QV9A 3KAKA 1GNRA 4REQB 4ZAYA 4DUZB 3ICVA 3WDMA 1JIQA 5KZMB 3RQIA 4GD3Q 4XH9B 3QBVA 2J67A 3KOYA 2A9VA 3IP6A 1BKSB 2BUAA 3GK3A 3AL0C 1D0IA 4O1IA 2OGSA 1T8SA 2PSEA 4Z86A 2YUTA 5FRDA 2CMHA 5KSPA 4UEOA 1YV9A 2XA1A 4B7UA 3S2YA 2C9MA 2JBWA 4LYEA 2OM2A 4Y9DA 3CEJA 2CY0A 3KXDA 3REFA 1MC4A 3ZBUA 1JHMA 3SSOA 2W70A 1G21E 4V2IA 1HT3A 1NVXQ 2UVDA 3JQ7A 3U61B 1Q57A 3DG9A 1RWPA 4DJ5X 2I2FA 4NYIR 5JMPA 4CMGA 2IYYA 3L02A 2ZJ7A 3W79A 5SZKB 1SXQA 1JG4A 2GYVA 3MOIA 3PGXA 3BIXA 4QBHA 2H3HA 3NYWA 1AUXA 2HA2A 3M0EA 5FBKA 3I6QA 2NSJA 4MI3A 2FLKA 2RB5A 1X1SA 4YLGA 1LK5A 2R48A 1MFZA 4BNFA 4MVCA 4DANA 4COKA 1M33A 4CKWB 4U63A 1YB1A 2XQIA 2Q9CA 3GUUA 4RFLA 2XLBA 4Q1DA 4P3XA 3E15A 3BEDA 4H18A 3A2NA 3Q7TA 1RKXA 3K1JA 2LRHA 5DHFA 3F97A 4AG3A 2WMYA 4HN4B 3QFTA 4IJKA 1OAKA 4JOBA 1ZD2P 1D6JA 2BMEA 5EHIA 1JVNA 2BZ1A 2EQBA 1MB2A 2H29A 2WT4A 3IQXA 3V7WA 1QWOA 1EXWA 3EQ2A 4D74A 1JN0A 2YJ4A 3OZ7A 4EY7A 3AKCA 3D5QA 1FUKA 4AKIA 2VYVD 3B9RA 2QQGA 4LGCA 1UPUA 2ZRPA 1Z2CA 3ZEAA 1R88A 1QWSA 1UPTA 4FDLA 3QMPA 4UKDA 3H5NA 2DQZA 2PDAA 3ILVA 3N87A 4XTRA 4EMUA 5A9SA 4J16C 3B3AA 4U2FA 5JXWA 3E22B 1FC0A 3AYXB 2PAFA 3CR7A 1V5IA 1PFGA 4HEA6 1ZH4A 3DE5X 3MAAC 1P19A 3B2EA 4OB8A 4Q15A 3ELDA 3EBPA 4UQPA 4Y3UA 1JZSA 4JLSA 3EZ7A 4ND3A 3BS4A 3SN6A 5HKAA 1L5MA 3W7VA 4PRYA 4R31A 1W0CA 2XDYA 2EX0A 1VPEA 3A6LA 3PPWA 4BTEA 2HDOA 3H16A 3LLMA 3D1LA 4MUAA 2WTMA 1DCFA 2D5AA 1R0SA 3KT3A 3TQQA 1P4JA 3VZSA 2FI1A 2PSJA 1N57A 3A1TA 1RE0A 4XGRA 3LECA 1U1GA 2JLXA 3ZVNA 1X7WB 1XKXA 5DOVA 1VXRA 1U3DA 1SOAA 2C2YA 2JI7A 4G01B 3MJVA 1ETUA 4PO1A 1WXEA 2W8BB 4F3RA 4A91A 5CH5A 5EN4A 5ENZA 4UCWA 2FSSA 1DAMA 3GT4A 3COJA 2FQQA 2IZZA 4Y2RA 3QFHA 4QJIA 5DWDA 2DF8A 5IC5A 5DCWA 4BNUA 2FQWA 1NA5A 1QG4A 1SUWA 1TCCA 2DFPA 4QLAA 3TB6A 5IH7A 2NQTA 1JT9A 1HQKA 2B4KA 1U90A 2N46A 4POAA 3T5AA 1C3EA 2LKCA 4O0LA 3OCUA 4EF5A 4PYKA 4MTLA 4ITUA 1XFAA 1PVOA 3PK0A 1OGJA 4V39A 2PY6A 1IONA 1JFFB 5KU1A 2X58A 1Y80A 2O20A 1EPUA 4Y6OA 3H3JA 5D5PA 2F43B 4MQEA 1U2DA 2VFAA 1U4SA 2YICA 3CF4A 4XFDA 4DQLA 5EJ6A 4CV1A 3JPWA 4J43A 4YJHA 4F46A 5CM9C 2WMDA 4HPXB 4CKZA 4TM7A 3RREA 1OQAA 4RSGA 4KLNA 3LUPA 3EFOB 1J8YF 3ORQA 4UPVA 1A5BB 4C0SA 2ZR0A 3BFPA 2QJWA 5IZ4A 2A9OA 5JBNA 1OTHA 1V39A 5MDHA 3HYLA 3JAWA 1AKRA 4XE5A 5BSHA 3RF6A 1V95A 2GAAA 2OCIA 3PHGA 1RJ9A 3E5NA 1VPWA 2HLHA 1FMTA 3KQSA 3NBUA 4LECA 1CE8B 1M83A 4IPTA 4MK4A 4LXXA 2QTCA 1DBRA 5CNJA 4LF4B 5JI2E 4QVIA 5EVJA 3GX1A 4QECA 1T8WA 3ZQUA 6REQB 2W43A 1F48A 2H0RA 4YDHB 1QIGA 2CUTA 5BOSB 4KRFA 4JFAA 4AUEA 5FI1B 2BHRA 2QZSA 3C7DB 1M10A 2CXTA 3MIZA 2EAUA 1YBAA 1YKSA 3GXBA 1Z2AA 1AJEA 3I8OA 4LV8B 1ZDMA 2BKUA 3AUUA 1I51A 1DOZA 3OF5A 2H2DA 4LBYA 4PLPA 1NC3A 4KVAA 4DMUB 5JMWA 1YBMA 2IL1A 3HU3A 1W93A 1ZO8A 4HAWA 3JQEA 3PQDA 5HRCA 3OUUA 1CJVC 4ZAWA 4NZNA 4CMIA 3KB8A 4UBIA 4X91A 4BKPA 1KHHA 4CKWA 5F5LA 4A9AA 1NW3A 1ML4A 1YZLA 2HDNB 3L8FA 1XD2A 3QU5A 4WKNA 4I50A 1FVOA 3VZBA 4EVSA 1Q1GA 1LLFA 1NP6A 3KSMA 3TSZA 3UN1A 5TPZD 5EIEA 2YJTD 1MRNA 3PNYA 2AI3A 3E9NA 1I2DA 2ZLBA 5HQTA 2QTFA 3OG9A 2PG3A 1IHYA 1U2PA 1WXDA 4W8HA 1KORA 2P40A 1VI5A 1GZ4A 5HIJA 1D1PA 2HFKA 1Z4NA 2XUPA 1PWYE 1Y89A 1JXOA 2PUHA 3GLHE 3ZU2A 1ZWLA 4BLSA 4OI4A 4RCYA 3UCXA 2GPNA 3IV6A 1P9RA 3I2KA 5LD2B 2FKAA 2B1IA 1GADO 1WXIA 2QJOA 4UUMA 3CQ9A 2WWVD 1YI8A 4YP6A 3TLMA 4AJ2A 5JH7A 1AB6A 3KPJA 3H1PA 4RD4A 5AJUA 2AI2A 3OU7A 2R86A 1LPSA 5FUQA 2GLUA 4LYYA 4BNKA 4D9IA 1IXKA 2AJCA 1H2FA 4J9UE 3QLVA 4G5QA 4K6FA 1AUPA 2RJNA 2FSVC 2J6CA 1MJHA 1L5GB 3FWHA 1W87A 5C1PA 1SVSA 3SHQA 1RXUA 3A1EA 5IHPA 1ESNA 1W4ZA 1T3LA 1VG0B 2I8AA 1OHHD 4ZP1A 5FO1A 5B36A 1LI5A 2ATIA 4MQUA 1HNXB 1VA4A 1Z4IA 2B1QA 5JTTA 1ZI6A 3HYCA 3MVEA 3IHKA 3CH5A 1H9BA 4WZAB 1NBMA 1CU1A 1OR8A 2AXQA 2Q2OA 4MRMA 1U80A 3GRFA 2XNDD 1WZCA 2OHFA 2OYSA 3EVAA 3GFFA 5KQGA 2IHBA 2PPLA 3AZQA 1AA6A 1PX0A 4IKOA 1E66A 2ZIWB 3KB1A 1H5UA 4F97A 5CFPA 3EVFA 3K2QA 4ZVPA 2CKDA 1BC5A 3G1WA 1IN7A 1HG0A 1SN7A 1V35A 3BMCB 3HBJA 3I0NA 2R6CA 3JYQA 4L95C 1NE2A 4DG8A 2Y1FA 1Y3IA 5KOJA 3IDAA 3EXFB 3L43A 4U9HS 2AUTA 4RPCA 5PGMA 3UATA 1IBMB 1MA0A 2DE0X