1A95A

Xprtase from e. coli complexed with mg:cprpp and guanine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
148
structure length
145
Chain Sequence
b'EKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLARELGIRHVDTVCISSYNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
molecule tags Phosphoribosyltransferase
source organism Escherichia coli
publication title Structures of free and complexed forms of Escherichia coli xanthine-guanine phosphoribosyltransferase.
pubmed doi rcsb
total genus 41
structure length 145
sequence length 148
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.22: Xanthine phosphoribosyltransferase.
pdb deposition date 1998-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1a95A00
3KB8A 1QK5A 4QYIA 2YZKA 4M0UA 1TC1A 5JSQA 2H06A 4PAWA 1J7JA 1O57A 4RAOA 1XTUA 4RQBA 1DKRA 1P19A 1Z7GA 2JKZA 3OZFA 3MBIA 1UPFA 4P83A 1BD3A 5K51A 1A96A 4S2UA 4RANA 1XTTA 2IGBA 3HVUA 4MB6A 1TC2A 4FYMA 5ESXA 1ECCA 1XZ8A 1STOA 3DMPA 1I5EA 1NONA 5HKLA 1DQPA 4RHTA 1G2PA 1I14A 2GEBA 3G6WA 3MJDA 4LZOA 1G9TA 1DBRA 3OZGA 1QK3A 4F8EA 5E38A 1HMPA 1L1QA 4RHUA 5KAMA 3GEPA 1OPRA 1ECGA 1QCCA 4PFQA 1BD4A 4M0KA 1MZVA 2PRZA 2JKYA 2XBUA 1UPUA 5ESWA 2P1ZA 4X44A 5BRNA 1ECFA 1GRVA 3N2LA 4ZFNA 2C4KA 3ACCA 1W30A 5BQPA 1GPH1 5HIAA 1OREA 4RQAA 1WD5A 4WMLA 2HCRA 4RAQA 3S5JA 4LYGA 3QW4B 1BZYA 1ZN7A 3GGCA 4RHXA 1Y0BA 4JITA 1I0IA 1NULA 2AEEA 1DKUA 4KN6A 3OHPA 1VSTA 1XZNA 1IBSA 2PRYA 3DEZA 1HGXA 4RABA 4JLSA 1OROA 4RHYA 3LRTA 1ZN8A 3DAHA 1P4AA 4P86A 5KAPA 4M0PA 3ACBA 4LZAA 5BSKA 1LH0A 2H07A 3NAGA 1DQNA 1P18A 4QYIB 4RACA 1D6NA 1VDMA 1AO0A 1R3UA 2FXVA 1QB7A 4RV4A 1A98A 3O7MA 2EHJA 1VCHA 3GGJA 1YFZA 3ACDA 4QRIA 1A97A 1P17A 2DY0A 1V9SA 1CJBA 2H08A 4P80A 3H83A 2JBHA 2PS1A 5EUCA 1ZN9A 1JLSA 2VFAA 5IAOA 1G2QA 4Z1OA 2WNSA 4LZNA 1O5OA 1UFRA 1A3CA 3LPNA 5JV5A 4X45A 1I0LA 3M3HA 1U9YA 4LYYA 1ECJA 4OHCA 1A4XA 5BQOA 1QK4A 4P81A 5IPFA 4IJQA 1XTVA 4P84A 4TWBA 2E55A 1L1RA 3EFHA 1FSGA 4RADA 4P3KA 4P82A 2JI4A 1A95A 1QCDA 1PZMA 1ECBA 1JLRA 1U9ZA 4WN3A 1G9SA 1I13A 1QB8A
chains in the Genus database with same CATH superfamily
2EF0A 4CIDA 1XAJA 1BVRA 1OXKB 5KDDA 4PAWA 4LAFA 3SIRA 2G25A 2I66A 3CM0A 2HK8A 5C7OO 4YDSA 1Z5VA 4M0CA 4K2HA 1JXMA 4I5DA 2J08A 4ISCA 4YUZA 1XEAA 1KJIA 3MOSA 4YQZA 2G77B 3RTDA 2KMLA 3WS7A 2CHVA 3D6JA 5KTTA 3GC6A 4Y30A 3LDUA 5CVVA 1QVAA 1ESEA 3DMPA 3A04A 3KT0A 3QMWA 2ZUFA 1U9JA 1O4VA 2C1EA 3KZXA 1NR1A 1NVEA 4F4DA 2GNPA 4TN1A 1DG3A 1QDEA 1VLJA 1UKYA 3DZ8A 3FUVA 3QV1A 4AURA 3GUHA 5LLDA 3O2JA 1GEGA 3P9KA 4U6SA 3V4ZA 4YPVA 4M8LA 1GKUB 3CLRD 3NDJA 2A2ZA 4GPAA 4FFWA 3FOCA 4MX8A 3MS2A 5E3HA 1RI2A 2UV8A 3OQHA 3VNVA 4EHAA 4RYDA 5LOVA 5BOSA 5DLQC 5D86A 2H16A 3WGOA 1UXOA 4XEUA 1FFCA 1ODCA 1NR5A 2J9GA 3UG7A 1AGNA 3KEQA 1SBZA 1IUKA 2JFUA 2HQ1A 1R6TA 2D2VA 2AQKA 3U2QA 2BMEA 3IILA 4GOXA 1JDNA 2C0CA 1L4BA 5FORA 1SC4A 3V6MA 2WIJA 5JCPA 1G41A 5AQ1A 1SBIA 2VSNA 4PBRA 3B13B 4RHXA 1Y0BA 3HSSA 2QU8A 3AONB 1S7GA 2CFIA 3A2MA 3AG6A 4K9QA 1XYGA 3RNOA 3AILA 3ZX5A 5KYNA 5MFZA 4UXIA 1P72A 4QPZA 3H3FA 5EZSA 3DVAB 3DVSX 4NE9A 3FCAA 1SZPA 2WKWA 4Y2PA 4P4UA 4PHCA 2DH5A 4L16A 2Q9AA 4Z9AA 2D0PB 4OOEA 5FA8A 4BE4A 4W5JA 4KHPB 3JQAA 2PNJA 4JLJA 2WF6A 3ROTA 1X0XA 3O3CA 3BM5A 3SHFA 3KKNA 1GILA 4ZVMA 3RSQA 2FX3A 2O8VA 3I28A 4X85A 3S1AB 1F0KA 1GVNB 1ZGBA 3RTEA 1ZN2A 5F77A 3AUSA 4QXAA 1KI1A 2EP8A 4K6GA 4C3UA 4C21A 1H1LB 2FYTA 1S01A 1ODLA 4UW9A 5FR1A 4ILEA 3TLXA 3M4YA 3WR5A 4KL8S 5AW1A 3AEQA 1U2QA 1IYZA 1SHKA 4N01A 4TV9F 3UV7A 3P2IA 1YQTA 1YT5A 1S8NA 2EZ8A 3G5UA 3V32A 4CTNA 1G55A 1Y7LA 1L8XA 3B1KA 3TIGA 3F9CA 3I42A 3I6ZA 1ZPDA 2I8LA 5GMOA 3OZIA 1VJRA 2FMTA 2H11A 4DCMA 1WL8A 2QRVB 1VKJA 5E6UA 4IJMA 4AZ3B 3K6SA 1PZFA 1VJDA 3I2HA 4RK5A 4C1BA 3F6PA 3KYDA 3MUEA 2OECA 4LJ5A 2ECOA 4QG7A 2IJGX 1K63A 3OEHD 1YE8A 2OV3A 1A7AA 1PF7E 5KIAA 1ABBA 5JJKA 1YI8A 3WIOA 4OQNA 2JLYA 3IRVA 3JQ9C 3AU9A 2LTAA 4EGSA 4Q7KA 4YAJA 4ZEXA 4FC7A 2EYQA 1IXRC 1E3LA 2HK6A 1P5ZB 3PFGA 4WERA 1E2KA 2W4QA 2OCIA 4ZQGA 4CN9A 3RYCA 3MCTA 4MK4A 3VKWA 1XF1A 2VPXA 2EFYA 2VP9A 3LGAA 3P0EA 2GZ2A 1OFGA 3KT8A 1UPXA 3D6AA 3QVOA 2ISSD 4NE2A 4GWGA 4AY3A 4NCBA 5C9ZA 4WXYB 1THMA 3M4XA 2H63A 1R0BA 2X14A 4IFIA 1W85B 5FI5A 4UEKA 5AVVA 3URMA 4C0AC 1CXZA 3B3JA 1N5RA 3JYOA 3R7DA 4X20A 3WYAA 5AT1A 2HU2A 1MDFA 5J3JA 2XQJA 4KKVA 2BE7A 4EHKA 6NULA 4BJ6A 3SMQA 2A5FA 3IEUA 4JIMA 4D3XA 3ZCPA 4C4TA 5IDVA 1R8YA 5BUCA 2ACKA 3G0BA 3V46A 1WETA 4Q12A 4YXWD 1WEHA 5CXSA 1K1EA 2R97A 2G5TA 4DWVA 4EECA 4TMKA 1GOTA 3WNZA 5H3CA 3VTKA 2VSOA 3TXAA 4C9BA 1QYIA 1MJHA 3QXCA 2F6RA 2SBTA 2J9FA 1Y8RA 1FDSA 5E9WA 1H3FA 3U39A 3DTTA 5CDFE 5TQ2B 1NJSA 4H3SA 5IJ0A 3QQPA 1NRWA 5LMCA 2X76A 1MXFA 3CG0A 2MSKA 3QLEA 1EFDN 3W7VA 2G5PA 4R0VA 1IG3A 4XWTA 1V5IA 4AYTA 1VIAA 2H5IA 4R84A 3TOXA 3LXMA 1CUZA 1Q77A 3ND9A 1SXJD 2VT3A 5DISB 1XZIA 2IWHA 3C3DA 4KPUB 3I45A 4DJTA 5JCXA 1HZJA 4K46A 3Q2OA 4FI3C 3I2YX 4Q4DA 3PL1A 5CJPA 4UOQA 3OJ0A 4RQTA 3PI6A 1HPLA 5IN5A 4A8PA 4F4HA 4IGAA 5FUXA 1R6BX 1JHQA 1QJCA 1DIAA 1E7QA 4EEKA 1WZCA 5KCMA 1IB6A 1N5OX 1DELA 1DIGA 3ANTA 3O4JA 3S6JA 3T7CA 3WLMA 4LCBA 4EUSA 2CJPA 2ZB7A 1ZKMA 3DB1A 3PF8A 2JPDA 4A2QA 4TV8B 5FBVB 3IYLW 1BVYF 2ZJ7A 3THSA 4BFVA 4QOIA 2DSNA 2EFHB 3FFBA 4EVRA 3IVAA 1YZQA 2JGRA 3F49S 4JENA 4JGIA 4RX1A 2PS9A 4TXJA 2XCIA 4O0MA 5E6UB 2O8DB 3A4NA 1VJGA 4FGZA 4Y98A 2VP5A 1G7TA 2IY8A 3C6KA 3HCWA 4YAWA 3OX3A 4OGLA 1ABEA 5DGXA 3VU1A 1J4AA 3BWMA 3RVMA 2MYTA 4AJKA 3E03A 5DNCA 5B6JA 3VZBA 1PZXA 2BZGA 4NMWA 5KTSA 3PHLA 3CCFA 4R6XA 2XKBA 4F9GA 1UBFA 1E7RA 2HJRA 3F47A 1V6SA 1W7AA 1LS6A 4UAVA 3W3AH 1YFLA 1Z4KA 2ADOA 4FFLA 1PNQA 3ST7A 3OURA 1ZMXA 2GN0A 2G9UA 1N2SA 3RH0A 1MVNA 3LKDA 4M8KA 1D9XA 1TAQA 1KY2A 3DMTC 4P3YA 3UWSA 2CMFA 2QGNA 4M8SA 4G2NA 1Z2DA 3H1FA 3MTGA 5DX8A 2ZYHA 2O8BB 1SD1A 4P84A 2R1TB 2I4TA 1IJKA 4LNHA 3T3IA 3ZU4A 3QLVA 5K0EA 4O2BA 3BWVA 2XNDD 2AJCA 3CURA 4S04A 2IUTA 1G5PA 4RADA 5EEGA 3SBEA 4KE9A 4N0QA 2ISQA 5HILA 2WMNB 3STXA 2G83A 3C97A 1RXCA 1I13A 1TX4B 1RXWA 1R8XA 1ORWA 1XSEA 2PWAA 3ENZA 2H06A 3F0TA 1U80A 3FYSA 4PYIA 1JAZA 1M54A 1T2AA 2JLSA 3BS4A 3JQRA 1EZ1A 5CB0A 2WIGA 3PFCA 2FQYA 3EVTA 1M74A 3WQHA 3X2EA 3GLHA 1UOEA 1G4AE 1M2EA 3RVBA 4Y2UA 3JARA 3JU3A 3VR2D 2IS6A 5CLFA 3KJHA 1Y6JA 4AT1A 1QRTA 4E7PA 4NENB 4N4AA 2FR8C 5B3JC 1O6ZA 2H65A 2P6MA 2P75A 4Y2RA 3SZ3A 4B48A 1LPNA 3F1KA 5M04A 2ZAOA 1CNFA 1DQSA 3GL9A 4GAEA 3V8PA 2MYPA 3IO5A 4MMYB 3UAZA 3W5AA 1Q1NA 1RQXA 1TFUA 4ZYYA 3A1CA 2XEXA 2FPXA 3PE3A 1QM5A 4NHEA 2XDWA 2P4SA 4GR4A 2PJDA 4MV1A 1P75A 2ZR8A 3M7IA 1C30A 3V2UA 2VS1A 3IKJA 4N48A 1AF4A 3NTXA 3AH8A 4Q66C 4QWWA 4YBZA 2ZRGA 5FNVB 4AZ0A 4EF4A 5J4KA 4YJHB 3T7RA 5LMNB 5B53A 3BORA 3OZRA 4BRUA 2QD3A 2HWYA 3VKFA 4ZT5A 5BO5A 4JZKA 5CHEA 4ETIA 1RBMA 4WY8A 1W5SA 5IXYA 2P35A 1GQOA 1GNRA 4R2HA 5JAMA 3GCDA 2Z9DA 2YQ5A 3F1LA 4XUGB 5ARCA 2QTCA 1K8XB 4ZQBA 2W2VA 4E2ZA 2OM6A 3PNSA 4O1MA 3IDOA 5EVJA 2FJ0A 1TM7E 3LP6A 3RSHA 2JVJA 2ZJ6A 1AIPA 4HWPA 2G76A 3QENA 5GJBA 3UAYA 3VH4A 1ANKA 3S40A 3F7OA 2ZANA 3D81A 4AJ2A 4TGLA 3TLJA 1TKCA 4FZJA 3L6BA 2GEDA 3I5YA 1JHOA 3PFNA 1NBAA 1R4MB 3FXAA 3I2FA 2H51A 3LO5A 8MHTA 4KPFC 4PXAA 2PNFA 4YR7A 3CVOA 3NOQA 2IF2A 5EJEA 1WRBA 1E2GA 2C2BA 2OA0A 3F6SA 2P6RA 1QGDA 3DXYA 1YU9A 3JYLA 3UWDA 3U3KA 1QQAA 1RI1A 1FMJA 3RADC 1GAXA 5FWXB 2AC2A 2HJVA 2IHBA 5D1HA 1LNSA 1U6KA 5JUWA 1QQTA 3MWDB 4HB3A 5H8WA 1OJ7A 4I4TB 1RAFA 1WHSB 1X38A 1NXWA 5I7UA 4YACA 2WM2A 4TZKA 4DV6B 1Z7EA 2PX4A 4HFJA 1M83A 1PK9A 2W43A 1MC8A 3PQ8A 3H8SA 2FHPA 2BR4A 5BW8A 5KNDD 1G6OA 1N0HA 3VPGA 3VPXA 1P2SA 3KSZO 2EATA 2YIVX 4N5DA 4OUDA 3EF0A 5CYPA 4YRLA 1IL0A 4WZBB 3K0CA 4ZOLF 3VGJA 3HNRA 3GPDG 2NTYC 4FYXA 3AY6A 4ARZA 4D4MA 1TJPB 5JLJA 4IJWA 3GEDA 4XTRA 4Q4JA 1W49A 1KH3A 3QBTA 1C4XA 2WPNA 2YWCA 4JA2A 5EWLA 5KJFA 3ROPA 5FTNA 4JS0A 1JHVA 2ZCVA 3KQTA 1F0NA 1K0UA 3R3HA 3SJBA 3LQYA 3GJRA 3R5SA 2M6SA 3I6QA 4E3WA 4ERNA 1SKYE 3CT4A 3VH3A 1QGED 2SNIE 4LRYA 1UDAA 2UXDB 1KVUA 2JAOA 3GUCA 5AJHA 3EMDA 1YD7A 5J1SB 1TEVA 3TNJA 3UA3A 7GPBA 5CX4A 2JJQA 2OO5A 2C4TA 3UXYA 4PO3X 5I9TA 4MUIA 1XMJA 4FB4A 3O2QB 1QTIA 1HE1C 1BQ4A 2C3MA 3C5VA 2LWIA 3WLEA 3K71B 2I4OA 4PZAA 2R87A 3FZEA 1QDLB 3KWLA 3RS9A 4RK6A 7REQA 2Z30A 5AOVA 4EKYA 4MDEA 3K70C 2HUPA 1C8VB 1EMDA 4WZAE 1XROA 2ZZNA 1G21B 2IYOA 2QL6A 3AIKA 4XD7D 1TVKA 4BFWA 2ZR9A 3C5CA 4YAKA 3TL6A 3G2HA 4UCQA 1AUQA 4JUAA 1O54A 2IITA 4HKTA 3ZLVA 1JL3A 5EXSA 1U8TA 1BMFA 4EITA 4GYJA 4R71A 5ENDA 2O59A 2I5PO 4F4CA 2G9ZA 1ZD5A 3K0SA 1E2JA 1EEXB 2P9YA 3K0EA 4MVJP 2GYUA 4NLLA 3QHPA 4UE6A 5FBRB 4ZYUA 2C00A 3D7NA 2XA1A 3UMSA 1Y6GA 1NT2A 1VBMA 2E37A 2HTFA 3DZBA 5FLXA 1QHNA 1LTKA 1JALA 3NTLA 4ZYVA 5JQGF 1MABA 3V2HA 1NFQA 3H97A 1ZGCA 1GUAA 1Q0PA 1BXRA 3GLHE 1OQAA 4JJKA 4OXYA 1I3LA 2H5LA 1QHYA 2GXSA 4WA8A 3IMFA 4I1RA 5KVVA 1GYQA 1P5FA 1ADYA 2OILA 3MGKA 2XGOA 4KXNA 5C8DA 2Y4NA 2O2JA 1EM8A 3LHIA 4FHZA 4D3FA 5FBZA 4R2MA 1OZGA 1QO7A 5KNCA 3EGOA 1QGAA 1XE3A 3CE6A 4DJDC 3D4NA 1UZLA 1RI4A 1GWNA 2C3PA 3FMFA 1JA9A 1X1SA 3PQ4A 1ENZA 1GD1O 4RZ3A 2XCLA 2G67A 3RBXA 3RTBA 3A2LA 5HIKA 5ETJA 3QWHA 2ID7A 4QASA 4R2KA 1ZN9A 2QT0A 3TSZA 1V26A 1Z13A 4ZV9A 3RWOA 4UEJA 3TLYA 4W5OA 3L7YA 4IZIA 4BHTA 4UHDA 1L4KA 1VKOA 5EJ4A 2OYRA 2B36A 4CTKA 3OPMA 3VUFA 1XZFA 2QAGA 3H1BA 3HKBB 4CHTA 1UANA 3EODA 1R7RA 3CX6A 1N9GA 3JQQA 4RNCA 3TQFA 1ZXLA 3QF7A 4OGWA 4B8ZA 3GEIA 4UARA 1IQUA 4V0OA 4YCSA 1VE6A 1JHXA 3FOFC 4MVJI 1XHLA 2CN1A 1CT9A 1K6JA 1P5RA 2BWJA 2DWQA 1O9GA 2PUHA 4D02A 2RD2A 3WYDA 4EYGA 4K9LA 4I4IA 2NO1A 4PFKA 4F96A 5BUQA 5B6IA 2Q0HA 2FP4B 4BO1A 1DO8A 4E46A 4YT4A 4DMCA 5IDWA 2K7ZA 1SXJA 3GQBA 1G21A 4EA7A 1B6RA 3W5JA 4X63A 4E1VA 1NW6A 2GO7A 1YQEA 3FNHA 4OM8A 2B69A 4IRXA 3S2ZA 1ZR2A 4NCIA 1WXFA 1XZMA 2ZSHA 4N76A 4IMIB 2FSFA 1CR0A 1K3FA 5CR9A 2J0SA 2RK3A 4PQYA 2AI3A 2I34A 3L7NA 3MWFA 2TRSB 1BU8A 5B3KA 4JC4A 3ZY2A 4DE5A 2AHOA 1M1YB 2HDOA 3OWXA 4CV1A 1EIZA 3PX3A 3I1FA 4UCXA 1MC1A 3DUWA 5CJ2A 5AMXA 2AFHB 1RJDA 2QP4A 1JA1A 3A9SA 3PUVA 2G70A 3WLPA 2XUQA 1XNQB 5IU6A 4JBYA 4N3NA 1G291 2VDLB 3HVHA 2E5WA 3SYKA 1KAEA 2DULA 4FKZA 4ZDJA 3VO2A 3LHDA 4PZDA 4L0QA 3JPYA 1LY1A 3RC7A 3UFXA 1E6LA 5F2NA 1JDUA 3TVTA 3NXKA 4KNVA 1BA2A 1G98A 1CZHA 3IVXA 2RARA 4BL5A 4J94A 1LPBB 3RRZA 3IV9A 1PNTA 4UVEA 3F4LA 1CYEA 4AY5A 1GQYA 1MXHA 2V7QA 2W22A 4HQRA 3F8TA 2RONA 1FVFA 2WJJA 3IMEA 4PLFA 4REMA 3WIDA 4DC9A 4G0UA 4O4HB 3EDCA 4RVSA 2KLHA 3NIBA 4GYWA 4LHEA 1QU3A 2ZUCA 3G1UA 1M8PA 2BF4A 1XRJA 2CYAA 2VK4A 2YJZA 3A9VA 2GWHA 3L7JA 4QUBA 4ZQIA 3KXPA 2J7PA 3L7IA 5ALQA 3W5SA 1XYVA 3JARB 4A16A 1WCXA 4MXDA 4FCCA 2RBKA 5IANA 3L7AA 2AK3A 1XRPA 2VUHB 3IDZA 4MCJA 4QICA 4F3YA 2C2XA 4MVWA 5K8LA 3D64A 2DR3A 2OFWA 4MW0A 3SZLA 4IUCS 2HRZA 3IOBA 3CR3C 5H59A 1ISIA 4LOAA 3C8ZA 3L18A 1XMXA 3B20A 1BJKA 3A14A 5A04A 1RWVA 5A3RA 1U90A 1PL8A 1N77A 1U9IA 1XD9A 2ASEA 3K8YA 3QU7A 3VNRA 1FL9A 4X8HA 1WCIA 3V55A 1DKNA 3EOZA 2JFOA 2QN8A 4D42A 2OQRA 2AOUB 3NHKA 3CUYA 3GI1A 4WLVA 1NI5A 3AR9A 1N5LA 4NJOA 2H9AA 4R40A 3K9WA 2CB9A 4UOZA 2FLWA 1B43A 1ZNWA 2SECE 3BXXA 5EEHA 2HA3A 3EVAA 2SCUA 4NNJA 4LV5B 1SOUA 4S35A 4RZ2A 1A3CA 1FYWA 2VLIA 3M5CA 3PE6A 1RXVA 1I30A 1BWSA 2EX4A 5LUAA 4M0FA 5BR8B 1U7OA 2W2NA 4G65A 4D92A 5TPZA 2AA3A 3EZ9A 3PV0A 4LUCA 1G6KA 3VYRB 5BWLA 3EFOA 4ZOAA 2FFQA 1Z3IX 2L18A 1S3SA 1ZNQO 2BN4A 2IYEA 5DBFA 3M6AA 1ZNZA 3DHEA 6ADHA 1YUBA 3KYJB 3U3DA 3VR5H 5CGZA 5EKXA 1E99A 5AJWA 3V4SA 4Q4HB 4P7GA 1PW5A 1GCOA 1ODJA 1N2XA 2VHJA 3L1UA 5EOVA 1AXEA 3WYEA 1J8FA 4AC9A 4I9NA 5FFFA 3RC9A 5FUYA 4YY3B 3UK6A 1JSRA 3A1SA 2VK2A 3ZE0B 4L27A 4HMPA 1Z6YA 3KKEA 1DAMA 5CVCA 2MSLA 4GOND 2PAAA 1A5BB 3BILA 4K88A 4WUVA 3ESBA 3WC4A 1SHJA 4D98A 1WF3A 1X0VA 2Y05A 4MWBA 1IB0A 3P2YA 1Y3DE 3E81A 4TM7A 2BHLA 4U8HA 3QX9A 2DPMA 4QUHA 4DVJA 3A05A 3RFCA 3EIEA 4CG3A 2QSZA 5FPPA 3FUWA 1XQ9A 2GPNA 3RSOA 3E70C 3C5WP 3I8SA 1LVUA 3RM3A 3DZKA 4RUKA 2FPLA 1JTFA 2JLVA 5INTA 4LX8A 4NG5A 1W9MA 1E2IA 2D00A 4F3CA 1TZKA 4U2GA 4MR7A 1RQNA 4RGVA 2L82A 1HLGA 1ND6A 3UBMA 1PS8A 1ECGA 3GJ4A 3V7FA 4ALJA 1Y3BE 2FPRA 1UK9A 3HDGA 3LZDA 1WU8A 4FILA 4NI5A 4HDOB 1RNLA 4M0MA 2XBUA 5ESWA 1D0IA 3AI7A 2P1ZA 3WK7A 2DTDA 3UVEA 1FS5A 3CBQA 3H9QA 4WCDA 4BVKA 3BTUA 4LVUA 3WV5A 2IYWA 2NAFA 4AZ0B 1VB5A 2LUOA 1T5BA 1GKKA 1PU2A 3IMGA 5FHRA 4E03A 3TF5A 1W73A 4GZ5A 3UGJA 1DDGA 3WA6A 4XQEA 1SXQA 2NQ2C 2GXUA 4B6OA 4ABTA 4FT2A 3BK1A 5IHXA 1EPUA 2W37A 4ND7A 3UHFA 2RHGB 2VIIA 6CHYA 1LRKA 3SQOA 4ABYA 3X2FA 4BO5A 3TZLA 5GZ3A 1TUEA 3NEYA 5HZKA 3M5WA 4K9NA 4E07A 3CEHA 3E61A 3N8IA 1ZZEA 3PUZA 1CY0A 3PDIB 1OB2A 1I01A 4Z4IA 1B23P 4X54A 1TM2A 1P8AA 5TQ0B 1U4NA 2PRYA 3EG5A 4HDRB 2X0NA 2XTAA 4DV3B 1XCBA 3NX4A 1ZN8A 3AXSA 3EXEA 2CNDA 4GMFA 3S1SA 2I1LA 2DHCA 3FBWA 4MRVA 3F3SA 2RBGA 4N3CA 4UVGA 2IEYA 3WYFA 1BE1A 3A27A 2ZYVX 5EZ6B 4DAOA 1WUHS 1QKKA 4M6WA 3ZU5A 4B7ZA 2RH4A 5AI6A 3RSFA 1HMYA 1B76A 1DAKA 1O2DA 2DFLA 2WF9A 3PUIA 5KB3A 2W6OA 1CQWA 5LWHA 5E7JA 2ODWA 3LL4A 5DCWA 1Z38A 1GG5A 1S7CA 3HYTA 1DPFA 1W44A 1MF7A 3DS8A 3QM1A 2PLNA 1UBRS 4MEBA 1LCIA 5ULLA 4RZXA 2P6NA 1O0SA 4D8UA 4UBIA 2I8AA 1ODIA 2JIPA 3PLNA 4KR2A 1HDIA 2OVFA 2GRUA 1H2YA 4Q3NA 2DFVA 3FETA 2GZDA 2XV1A 4QSHA 1DJMA 1UJMA 1PHPA 2QN2A 2DBYA 1LX7A 3GPLA 4FFBB 5DHTA 2MSEB 1HG1A 4Y2GA 5C8YA 3VI4B 5CA0B 3D6VA 2AIRA 2PD3A 3B1JA 1KFCB 2E4UA 2JGDA 1YDGA 3DDCA 4QYTA 4R8SA 3RUEA 4MICA 3U4QB 1T0HB 1P4SA 2WUEA 4JR0A 3IS3A 3OIWA 3P9RA 4CQLB 1IBMB 5CLJA 3WFJA 1E2MA 3MRSA 4QHTA 6PFKA 1GCAA 2GSDA 2EIXA 1JMVA 4OA8A 4ZCTA 1JIIA 3TZEA 1TUGA 3K15A 1PX2A 3K16A 1U0RA 3N2NA 3D3WA 1TFRA 4QUIA 1U11A 1Z0AA 3P5BA 3VR3D 1EFVB 2QMUA 2C8VA 4D8WA 2P2CA 3FWPA 3P9ZA 3SR0A 2FVXA 5DGCA 2XMSA 4FQ5A 1MHPA 1DBPA 5HTKA 1CZKA 4RAOA 5B1DA 2ZJ8A 1MA0A 2BFEB 1YNSA 1GO2A 1RPTA 2YYSA 2N1MA 3PPIA 4KSYA 2VHZA 1JR3D 1PJ4A 3OIGA 1N6KA 5HJ5A 5ALWA 1FRNA 1R4NA 3I30X 5MF6A 2GK7A 1JKJA 2X5JO 1B3RA 1RAAA 4QRDA 4R9NA 3TW0A 4C08A 3RRBA 2C4NA 3NPMA 2GKOA 4HQLA 1ENPA 3CZAA 5ER9A 1P6QA 4GC9A 3GX1A 3E1SA 3PDHA 1JECA 1VRWA 2BEVA 4M2LA 4W8GA 2REQA 3PPYA 3WGNA 2ZXUA 2WJPA 5CH5A 2GEVA 3U9SA 4GF5A 4LOIA 4PYQA 4DSNA 3K72B 3KLOA 2YY6A 2I2WA 1F0YA 1WX1A 4FDMA 4G0XA 3FSGA 4CQNA 4JP5A 5B1EA 4YJ2A 4MGHA 1RMYA 1P45A 3BSYA 3DCIA 5M7EA 3OQMA 4YV7A 4DLAA 4BQEA 1WBJB 2PRJA 4DGQA 3O8OA 3OTIA 3UK0A 1E2BA 3QE3A 3OMXA 4H7IA 1GKLA 1J1IA 3WMXA 3FOAA 3K9GA 4MUNA 1RSZA 3ZDYB 4P6VF 1XP5A 2AL7A 4CMEC 3H5IA 3FHTA 2VTBA 4ZICA 1QC5A 1RQGA 4JI6B 2XWQA 3B82A 3VZSA 1OI2A 1T3GA 2Z2IA 3O1HB 3NDPA 3N3BC 4A2WA 1ZX1A 3GLQA 3O7WA 1RXEA 1RBZA 2RFLA 2XYGA 3JW8A 4Y2XA 4HQ6A 3STTA 3X1ZA 4UC0A 1PTJC 2MYUA 4R1PA 2ZJ3A 4ZZ1A 4F92B 3D8SA 5FPKA 2Y1GA 1I6KA 4XOUA 4MKXA 3JVEA 1CJKC 2H07A 1WHTB 3P1JA 1WCWA 1KXZA 1OFUA 1VI2A 2R8RA 4DTCA 4BLQA 5CDYA 3AGQA 2TS1A 3AF1A 1R3UA 4PWZA 4Z9FA 1LXCA 4MV9A 3MUFA 1E7WA 2OXFA 4XVCA 1YQXA 1YB6A 3G9TA 2RMKA 2OWDA 2Y1EA 3BC1A 4YALA 4EVIA 2OCAA 4CBVA 2JHPA 4Z51A 2DQ4A 3H84A 2WICA 4JP8A 3EZ2A 4R1TA 1QO0A 1KGSA 1WSWA 2P2SA 2YV3A 3SIPA 1A77A 2A88A 4A8JC 1QRAA 3H2SA 3GLGB 5LD2C 1XLWA 2DBZA 4HDNA 5GZ6A 5JYBA 2H1RA 2A92A 2YV5A 3NT5A 2H1SA 4TLAA 4OHVA 3MWEA 4UHKA 2ZKLA 2Q0QA 4WESA 1EFLA 2OO5C 3E3LA 2EZTA 3L6UA 3MERA 2ZUDA 3R09A 4W4TA 5ECYA 3JWPA 5ARDA 4KPEC 2Z58A 3VAAA 1LSSA 1O97C 3KHSA 3LW7A 4FYJA 1KAOA 1V8OA 4C07A 3QVJA 3C3AA 5CDSA 3L04A 3SG0A 3JAWB 4JKYA 1R4NB 1YZHA 1MCZA 3GLUA 3OD1A 3GJZA 4QUEA 4X1YA 3DSRA 1UC4B 3FVQA 3KFVA 1J1ZA 1LDMA 3ISJA 3KQQA 4J3FA 4EY8A 3E9YA 3IGFA 3KB6A 3A1WA 1PV4A 4U0JA 1I80A 4PR0A 3GWGA 1PLKA 3O6VA 5H9VA 1UMDB 4BWFB 5AK6A 5IJ9B 1V45E 4Q6WA 3N8KA 2GN8A 5JROA 3WO0A 1P6UA 4DLBA 4YUYA 5JT1A 2HRQA 4R3NA 3A0RB 1QIDA 4PBTA 3F6EX 3AM1A 1NBMA 4G0QA 4RTQA 1EX1A 2WJWA 4MPTA 4EF6A 5LOVB 4RZQA 1CIVA 3MFYA 1KQPA 3NHAA 1YS6A 4F3KA 3BDAA 4XWWA 4LRUA 1STOA 2EHDA 5I3CA 4XDHA 5KOJA 3GEEA 1J2TA 4OFZA 5C32A 2VHYA 1RLTA 3SX0A 3HYCA 4MUKA 4R1QA 3S2UA 4ZGWA 3SQNA 4MUXA 1HXHA 4M7PA 5CMLA 4ZA2A 3CWQA 3TJMA 1DAPA 2R25B 3Q4GA 3S4YA 5DOVA 1VKNA 3CUVA 4GP9A 1KU0A 4LPKA 4MUHA 5EZYA 3MINB 1IRIA 3EDQA 3KHTA 1UPAA 4W8HA 3MS4A 4W1PA 1HNNA 3TUIC 1OXSC 2JFWA 1YTUA 1BRTA 3UANA 3OT1A 4M36A 3ZVKA 2YVUA 3K8ZA 3IAUA 4GZMA 3GFPA 4EJ2A 4F4JA 1BFDA 1PSZA 1HKUA 1NF3A 3L7MA 3U7HB 2BONA 2X9VA 2JI6A 4YDHB 4KPGA 3OFKA 4PN7A 3U40A 2F1RA 4ZAXA 5A71A 2NU8B 1GU1A 1M8GA 3U1TA 3SQWA 2AKEA 3NW9A 4W6ZA 2HSZA 2I1WA 1L4FA 2D2IA 3RB8A 2FP3A 1OU0A 3GN1A 1D1SA 4JITA 1WP4A 1ZU5A 2X5XA 1JJAA 2OMKA 3CLSC 3ESXA 3LLSA 3NHUA 4LJSA 4LSGA 3FTNA 5AJUA 1NVMB 3AF4A 2GEFA 3RU9A 1KNQA 5A3JA 4M9SA 4Y6SA 3K6KA 1QGOA 3QLUA 1P33A 1X80A 4LHZA 3B3QA 4MV8A 2GDJA 3RIEA 3GGPA 3UJ3X 1WWKA 1SVNA 5FNZA 3SJCA 3EB9A 4KR9A 3OQIA 3INRA 3GOHA 1PUJA 4PPYA 4YHBA 5BV1A 1S2NA 1T4CB 3PGKA 4A82A 1OVGA 3I6IA 4UVIA 3GDFA 2G06A 5HUHA 1UCFA 2FMIA 1V96A 4F0JA 3VR6H 2PL5A 1U81A 2R5NA 1NNUA 3EDYA 4F9FA 4JC5A 5L3QB 1XD8A 1YB5A 4KC0A 1S6YA 2WJ3A 2FY8A 3UGKA 4R05A 3QNMA 3DO6A 3EAGA 4NFHA 2WU8A 5FPQA 5JMWA 4UBLA 2WYHA 3IT2A 4MIKA 1VB3A 1V1RA 3N8NA 3HN2A 4DMKA 2AG1A 1UM9A 3VOSA 2Z8XA 2GNOA 3VR1A 3PS9A 3WDMA 4CQMB 1ZM7A 4G41A 1T5IA 1H2HA 1KO1A 4F6LA 1Y3IA 1C3XA 2RB4A 4WFKA 1YASA 1PRYA 3AWDA 4JQCA 1KMQA 1NVFA 1KGDA 2CXRA 4RZUA 3ZG6A 1OWOA 4ZI7B 3V8RA 1LFAA 2X5NA 2FDCA 1F06A 1TAUA 4HDMB 3I3SR 4FUQA 3TQCA 3HBFA 3Q41A 3N53A 2UUBB 3T1TA 3FNBA 3HHEA 3ODGA 1R0ZA 1IZ7A 3JS5A 4JLMA 4UPVA 2ZUBA 3WL7A 2QQGA 4EO4A 4LGMA 5I45A 1RRFA 2FV8A 4Y3UA 3N6XA 3HADA 2A9OA 4HPJB 4MRAA 1B2LA 4OSPA 4DMHA 2PT6A 2ZPUA 1Z6XA 3CNBA 1J7JA 1DSSG 3WL4A 1SZDA 2WILA 3WZ2A 4KN5A 1D7AA 3KVOA 3NEPX 3O3NB 4XGIA 4XWYA 1ESZA 3KP1A 4RD0A 5B1YA 2MR5A 1COZA 1FFBA 1TK3A 2MYNA 3EA4A 1EQAA 3IVRA 3WK9A 4C2BA 2NU9B 3O8QB 2KYRA 2PT9A 2HSDA 4HDKB 5TLSA 3A06A 3FMGA 2QMZA 1OV6A 1W4BA 3FW1A 4NU0A 4N8DA 5HE8A 3ZWMA 2C2HA 3I1JA 5DW0A 3W1VA 1IUOA 1ORVA 1JJBA 2BFFB 4P98A 5JCOC 4DDMA 2WSLA 5EC8A 3CB2A 4D82A 5I7AA 3UUEA 3QKSA 4OXRA 1MH9A 2FOXA 3H9CA 4IDHA 2D1YA 3ESZA 2CFRA 3P9SA 1MAWA 4K9OA 3V34A 4F1KA 1WA5A 3T7KA 2GPTA 4XQ9A 5HYVA 1NJ1A 1YQQA 2REXB 1ZOPA 4A10A 1PSDA 3LYHA 4EJ0A 1N5IA 3SFZA 3P97A 4DDUA 1AKQA 4CM3A 1CS4C 4R3UC 3CN7A 5J43A 2GESA 3P4UA 5I7VA 5KWSA 1VIMA 3ZZ0A 3EZGA 2BZ1A 2PG3A 4E30A 1ZLXA 3ZU6A 5BURA 4I14A 4PG6A 5K0BA 1U9IC 2CXUA 2NU6B 2VF8A 1UZAA 4FCTA 4PSUA 1OT5A 3BWDD 3GVCA 2RBEA 3K9NA 2BHSA 4GKVA 3T9CA 4CM8A 4UM9B 3TFOA 1WBDA 1TZ2A 4WWHA 4GFDA 3WLHA 1H2WA 3DYIA 4YLYA 2BI4A 4KQ6A 5ER6A 3L9XA 3ILHA 2WKSA 1G5TA 1SKAA 3FUUA 4RS4A 2H1CA 5AM1A 2N47A 1M5TA 3GUUA 1GT6A 1J2JA 2AJ8A 2DWUA 4I36A 5F4BA 1JKJB 3FVTA 4N5MA 5AJYA 5I51A 2F4VB 1W93A 2VXOA 3DBLB 1Z75A 1MB4A 4RF5A 4IDDA 1P7PA 1XL0A 1MR3F 2PGXA 3BRCA 3LT1A 1W46A 3MBOA 3ORFA 3CSDA 2GDZA 3GPBA 2PUVA 3BH6A 5ADUS 4PW0A 5FOQA 3AVVA 4FDAA 3MJFA 4PAOA 2FX5A 3QBVA 2HLHA 1E5VA 4P58A 5MGBA 1O03A 4L0MA 5AHWA 5BRJA 4MGKR 1WZNA 5DYTA 5K4GA 4NMHA 1E6CA 2CXSA 2VRCD 4RVUA 3V4VB 1NDUA 1CR2A 3C14C 4TTQA 2YJTD 2JI9A 1JIQA 4Q9JA 1OSNA 1XWWA 3KHUA 4M46A 1Q0SA 1D1PA 1UXJA 2H4YA 3QOWA 4P5EA 3BZUA 3CJRA 5D5HA 2C07A 2VRCA 4R9UC 5D3QA 3BMOB 1PFWA 4F5WA 4REQB 4Q4LA 4GWKA 3BEOA 2AZTA 4V3BA 3EZ7A 2R6HA 4YLEA 1T6ZA 1GUZA 2EBHX 1GR0A 5FOWA 1X94A 4LDAA 3M6UA 4JEMA 5AVZA 2QUZA 4BVJA 3WHKA 1T3ZA 2Q3BA 3MPUA 4K0KB 3VPAA 2IUSA 1N6PA 4EO7A 4NX2A 2IHZA 5AVQA 1CUIA 5CURA 3TOCA 2JEOA 5JE8A 2C20A 3GA0A 3DT6A 2RHJA 2FKNA 3JWJA 3QV2A 4ND3A 3WGUA 2D1SA 4LI3X 4E4YA 2FR1A 2WAYA 2IE8A 1EGQA 1W9HA 1O57A 3G82C 3MT8A 4RXMA 3E9EA 4YAFA 1VM6A 1AKTA 3D8UA 2IPMA 1F8GA 5DK4A 2O1WA 1AM4D 1QOQB 2Z3WA 4KX5A 4UJ5A 1RXIA 3SP1A 2BD0A 3QNWA 4PGFA 5L3RA 4GMGA 5K3FA 4B87A 1Z34A 4J8PA 2NM0A 2ETVA 3ZXXA 4X8OA 1NJ8A 1GQSA 4IMPA 3GLKA 2MT9A 4WZAA 4A6DA 1AV7A 1B73A 3BRWA 1JLLB 2OGUA 5LP6C 3TR5A 4GL4A 5IZCC 4AN0A 3FGZA 5EKTA 3TLBA 2GTPA 2ZM5A 3OSZA 1MHTA 3KJIA 5LU9A 1QCCA 3JQ9A 4KN9S 3VAYA 1OLSA 1DE0A 1U28C 2J41A 2NPIA 3MB5A 3NGMA 3MTIA 2XDQA 4H9GA 1AJEA 2GK6A 4RHFA 5B58C 4RMIA 3QTLA 3LV8A 4Q00A 3TLZA 1ELOA 1I0ZA 1XMOB 1WKCA 1HZZA 2EBWA 1N0IA 2E5FA 2HK7A 3PX2A 4KQGA 1L9KA 1OA0A 1RP1A 1SBQA 4EHJA 5KO2A 4PONA 1DT3A 1JEEA 1PDVA 2Z9BA 2Y0CA 4ADSG 1O5IA 1ZOLA 2CJWA 3IQDB 4HXYA 3NIWA 1W36D 1T5HX 4CM4B 2VF4X 2HW8A 5A9SB 4YC7A 1JWBB 5LYJA 1RRPA 2H7YA 1VZ3A 2R00C 1X9HA 2VK8A 4ID9A 3TPZA 1QYWA 4NZNA 1B6SA 4XJVA 3WV4A 3X1MA 4S05A 4MUAA 4C7VA 3FUXA 2JAXA 1FNDA 3V7YA 2F8LA 4NZYA 4G63A 2A9JA 2FQXA 3DAGA 4OK5A 4D8XA 4G9GA 5J59A 1CJCA 2IQ5A 4EFKA 3WYBA 3ZWDA 1GDDA 3W9BA 3T9FA 2R1VA 2QENA 2ZBEA 3DE0X 4D9BA 1PFUA 4UAUA 1NE2A 4B09A 2G3YA 1Z4IA 1P5HA 1V11B 3FN4A 2HHHB 3NNSA 3SHQA 4WVFA 1MW8X 2P2DA 3KUDA 2D2XA 3AV0B 8AT1A 1FP2A 2QUIA 4X20B 2NYAA 1PQYA 2BFPA 2AJDA 3GPIA 4RFVA 3UUWA 1KS2A 1VHJA 5AHKA 4P4TA 3TRFA 5IJWA 3H7IA 5JARA 1MPTA 1ZMTA 2DE0X 4PGHA 2PUGA 2IDZA 3AI1A 3PUWA 2XADA 4QRIA 4RPIA 2C9OA 4OL9A 1D4AA 2GJAA 2WQZA 2CL0X 1XEWX 3BERA 2QD5A 3BRSA 1WV0A 3FMPB 1Z8DA 4TMWA 1O94C 1UEIA 4MUFA 2GF0A 3W2GA 1X1QA 2WFLA 1CJUC 1WZ2A 1Z88A 1T35A 1CQPA 3WOVA 5CK5A 4DM3A 2P9ZA 2ATCA 1DBSA 4QDOA 5G1PA 3T06B 5IF9A 2Q3JA 1D2RA 2QXYA 5AVOA 2J6CA 2V8OA 2OAGA 3H5TA 4N0DA 4OJNA 2E49A 4HFNA 4XVRA 2QRMA 4N49A 1CUCA 4XUEA 1OC4A 3KFLA 4D9NA 5A6VA 3AEKA 4G84A 1WKVA 2PVPA 4OQZA 5GM1A 4OIMA 1KPHA 3DG9A 3NVAA 2AXEA 2OLKA 4JUDX 1W581 2JB9A 4JYCA 2BI7A 3BPSA 1IXZA 4Y1EA 2GJKA 1JLRA 2BP7A 1DWPA 3FZNA 3IAEA 1NXSA 4L9WA 3WY9A 4EPRA 4QXRA 1DCFA 4WNYA 3DW3X 4A73A 4OLBA 4MYDA 1JKFA 2FDXA 2ORYA 4I1PA 2NNWB 3FKJA 4TV8A 2CK3D 3OEED 4CQMD 1EX7A 1OV4A 2EKBA 3HL0A 4HNQA 5BSVA 3DBHA 4DMUB 2WZBA 4Y0AA 2XHZA 2ES4A 1A88A 4KXVA 2VPPA 3VNBA 2ZZKA 3LJKA 4XB1A 4HZUA 2V7EA 4I4CA 5C8VA 5K0JA 1H6CA 4XWOA 5EXDA 3PPXA 1H0KA 3LQ2A 3WFIA 5AUNB 2ISCA 3WRYC 5G0SA 1SVSA 3OZBA 4HWGA 5CXUA 4R9RA 4HFRA 4CMCA 4FIZA 3RIXA 3WMGA 3H8JA 1F2TA 3FPJA 4PC2A 1HA3A 1QG0A 1TZCA 3NT4A 5ALHA 2X22A 3U1VA 3WL3A 4EMUA 3EA5A 4RYLA 1Y5IA 1E1LA 2QN7A 1T6NA 1NKTA 1PL7A 3R1IA 4G0PA 2V0GA 3HCFA 3I2IA 1O9HA 1NR7A 2FJPA 2ZVJA 3QEAZ 3SN6A 1HEUA 5BRNA 4EP1A 1XDBA 4GMXA 3TIXB 1AN0A 5U9CA 2ZI4A 4JLKA 4KH1A 4WCFB 3GJ3A 3RABA 1H65A 1QU2A 5E1BA 4CIVA 1C3OA 4KXMA 3IBGA 4XM2A 5E4YA 4J1NA 3AVWA 1AUPA 1FU4A 4FHCA 1F6WA 4HS9A 2CLKB 5B3JA 1T3TA 2RGWA 4PPNA 4KTTE 5J5CA 4Q3EA 3EPHA 3QVXA 4KACA 3QUCA 4MHOA 1NATA 1XTZA 2HNKA 2HZ7A 5GGYA 3FIUA 3KYCB 4OXIA 1KZ9A 4PSKA 1XVUA 4E51A 4YX9A 4CG0A 2FRVA 5AP9A 4NAVA 3RFTA 1RKBA 3VPSA 2P91A 2D59A 1NN3A 3MWGA 1ZM2A 2Z4RA 4LVCA 2OQ2A 1ZH6A 3KVYA 1S2LA 2VDPB 3VFDA 4FEEA 4HDKA 1EX9A 2IBTA 1YZTA 3TPCA 2IXEA 2C88A 4P34A 3OZUA 4JP2A 1KU6A 3CUKA 2HQSA 1ETHA 3LHSA 2GARA 2INGX 4B43A 1BJTA 4J16A 2R62A 1XCJA 1ZIOA 3AR6A 4KV9A 1J00A 2Q21A 2LZ0A 3BRWD 3EVDA 4XSGA 4MKGA 3ZZMA 4FNOA 4NF2A 5IARA 4PV7A 3RRYA 1CVRA 4GI7A 1O95C 4MH0R 3LFHA 3WDKA 4AX4A 5CB6A 1F8YA 3OJLA 4CI0B 4U8GA 3L4SO 1PGNA 4IXTA 3G2JA 4QLAA 3KLNA 5CB4F 3QYFA 4EY4A 2J67A 1AO3A 2D4AA 1TLTA 3PQ3A 1ZGZA 3KT3A 3Q72A 1NBMD 1P1BA 1NVWQ 1RYMA 4RKYA 4LWQA 5EUCA 3KDAA 1R9NA 3LMKA 3HCRA 4FGKA 2DPGA 2PUAA 1HYHA 1NRJB 4MVYA 2IZ0A 3WNCA 1YTLA 3GCGA 4RTRA 5K7SA 3HN6A 1L7AA 1HETA 2Q4BA 2OEPA 1F8XA 1SCNE 3U4DA 5DEOA 5LIRA 1VPLA 1KNXA 2QVXX 1XXLA 4R54A 4ZI7A 3LUHA 4J0JA 1N9KA 2B5WA 2DSTA 2GVZC 3KR9A 4MVCA 1HDCA 1KVQA 2ILTA 2PJZA 1W87A 5IX8A 2X0KA 5DTQA 5JOQA 5TVGA 3L6CA 4Y8VA 4HAZA 1VPVA 1ZMRA 3UA4A 1RQPA 4EO9A 1NNI1 2VYVD 2PRIA 3ZH9B 2W2MA 1IY8A 4ZV7A 3II6X 4Q4AB 4XYMA 2Q9UA 4ER0A 1NC3A 1ULZA 2XVMA 1VP9A 3C1TA 3GG9A 3H9BA 2I2BA 3DFKA 1JG7A 3K1TA 4F12A 1KOGA 4KMRA 3GJXC 4XCVA 2HU8A 4V2UA 5A05A 1Y6ZA 2J07A 5I9BA 4YJFB 3U7QA 1IHPA 3UIEA 1A9YA 3K0CC 4DDWA 4Q3OA 3KUCA 2B30A 3ZBQA 5KYXB 3OFSA 2A33A 3RJ9A 3FOWA 2K5UA 5ALZA 1MG5A 2WG1A 3GMTA 5JFGA 5E9JA 3VR5A 1OXXK 5FI0B 2NU7A 2RHRA 3ZHXA 5IZ4A 2VUIB 1T9HA 4OBXA 4RHUA 1G7CA 1P7CA 3FHJA 4ZT6A 4ZI3A 3AHGA 3C4QA 1YZVA 5I4IA 5LVAA 2OCKA 1IUPA 1QIHA 3GELA 4Q48A 1VHLA 3L0BA 4XQ0A 4YRZA 4X44A 1CQIA 1IPHA 2W42A 1JYFA 1LWOA 3H9UA 4Y6QA 2DP4E 4AKSA 3ZTYA 3FPSA 2FG6C 3SDSA 1WLSA 1H4QA 3OECA 5BVHB 3FTFA 1BS2A 1EWKA 3WSVA 4HAVA 3ZQUA 3ZUPA 4DA6A 1XRLA 3RVRA 3R3YA 5BMVF 1TJYA 1ONSA 1JIKA 3GG2A 3HWSA 1WXQA 2EFCB 1Z37A 2PV7A 3KQHA 1N2EA 1RAEA 1X2EA 3KPYA 5F5XA 4D9JA 5EJ9A 1RVV1 5BV2P 3IXQA 4QVIA 1YRQA 1GAWA 2I6QA 4DYHA 3E1KA 4EI9A 2JRCA 1GPUA 2KWIA 2VAVA 1RXUA 2ZWIA 3QVMA 3CH6A 2FSSA 3AZPA 3LCUA 3UQZA 3WG9A 2QAGB 4GOLD 1JE0A 3CJQA 4TYPA 2GBPA 3K0AB 5KJEA 4OB7A 5EIEA 4P86A 1XD2B 1ST3A 1B8OA 1BA3A 4QDXA 4DJAA 1SVLA 4HH0A 4B5LA 4RK4A 1KP9A 1WW3A 5DM70 2ZTLA 4BO4A 1DAOA 1ZM9A 5IM4A 5DM60 3LUFA 1OWNA 3AKYA 4N82A 2K2QB 3IX7A 4NV3A 3OZEA 5TARA 1N5KA 2XT9A 3DV0A 1O6BA 2XYQA 3JD0A 4FHFA 4RV4A 3CRZA 3NDRA 4MJXA 1CG6A 3QKRB 3L0CA 4XJTA 1QBGA 2O0MA 2XE7A 3MQ2A 4X71A 4ZPXA 3WMWA 2IVZA 1BVHA 3EC7A 1MX9A 1XYYA 3DHYA 3REOA 3D31A 4YJ3F 3QSGA 4MA5A 1G20E 2FG7C 3LKZA 4K86A 1EVKA 5AHOA 2OO7A 4RPKA 5G53C 5DWQA 4F1WA 1QTQA 3ZI0A 4ZO4A 2OQVA 1P7WA 4REOA 3NHPA 5AVSA 1E1QA 4NFLA 3RR2A 4W9RA 3HBNA 3IT3A 2IDJA 1NLFA 1GZ4A 3FE2A 2FUCA 3NBZC 5IAGA 3TNDA 3AF0A 3PFWO 1UBGA 2XB2A 1YR6A 2O5VA 3WTBA 3M89A 3P0RA 1E6UA 1MO2A 5HF8A 1Y1QA 5J2TB 3AEUA 1OZAA 4IIDA 3QG1A 2HQRA 4DQXA 5JS1A 4TWAA 5A62A 1R9MA 1K6EA 2XOXA 3PSAA 1C9KA 3PTZA 4JSTA 2HEGA 4BWVA 3UWPA 4C7OA 1LB1B 2Q49A 5L7TA 1DRVA 4S3MA 2OP0A 4G5RA 1LUAA 4I9HA 3BK2A 4E6EA 5JS6A 5LDHA 1IAQA 4RLQA 1IEXA 3IHKA 4TRJA 2Y1XA 5TPWB 5E7QA 4EPXA 3BREA 4LWOA 4LMAA 2ZRIA 4D41A 1NXPA 2H18A 4CUZA 2HRRA 2C5SA 2JCBA 3OHSX 4OJKA 1LJLA 3GRCA 2GFIA 1XKLA 4Z99A 2PQMA 4AJ1A 3K0BA 3NUGA 4WA7A 5AIBA 3D3EA 2ASVA 1SAYA 1NYRA 2OM2A 2WWRA 1CR4A 3M9WA 5DRYA 3FOEC 3CRQA 1MAUA 2FPSA 2G0AA 4IW3B 5IP5A 3I12A 5JVDB 4K5QA 5D3MB 1ZW1A 2FB9A 1ZMOA 3GB9A 3JVUA 3O4GA 3WNVA 1OTYA 2PTGA 3QLTA 3F2VA 3I4FA 4J90A 3E7PA 1ENYA 3LZ6A 3V6LA 4AKIA 3M1AA 2CZGA 4M7WA 3ESCA 1V3QE 4IV5A 2XD9A 3CR7A 3AUFA 6Q21A 4NYMR 4AWXA 1DAIA 3KAQA 3KPVA 2RB5A 2I4RA 4L8FA 4P4SA 3UKDA 1WCIB 2NN3C 1ZGJA 2WKQA 1SVKA 2JANA 2LD4A 1PR1A 2WC1A 4Z7OB 1FXWF 2OBFA 1I36A 5CT5A 1LV8A 2JLCA 1UFOA 4MQEB 1XNRB 5EE0A 5LXTF 1U8ZA 4L3VA 2RCYA 3ADPA 1KO8A 1JIXA 4PLWA 1FLNA 3E15A 4ZO9A 3P7MA 3B53X 1KDZA 4OQPA 5JI3E 4IDCA 1HF3A 3EK2A 5IEJA 2QZZA 4RE6A 5C37A 3ILSA 4YCMA 4CTMA 1QHFA 2Z95A 3D2BA 1M2OA 4FZVA 3L7CA 1PJLA 3BFPA 4XUCA 4AY2A 4WJZA 1PYDA 2BTQB 1IDN1 2R751 2I67A 3ETJA 3KLMX 3EUWA 4K03A 1TQHA 5AKZA 1L8OA 1LH0A 1YDFA 1WXDA 1Y7HA 2DETA 3DDZX 1GTZA 4E1AA 2NO5A 5IHPA 4D57A 3ZW9A 4CQJA 4QGAA 2FNAA 1IK6A 2C2YA 3I0MA 1EXDA 1I3NA 2FWIA 4TUYF 4KE6A 3FCSB 4Q7QA 1K8ZB 2FA9A 2PGOA 5FOTA 2NGRA 3RVPA 4YPOA 3PITA 5KTYA 4A1FA 4MW5A 3NWEA 3KYIB 5JRDS 2FZGA 1E9RA 4O29A 1M5RA 3ZV4A 2F62A 1LF5A 3SXPA 2V96A 4K9MA 1A9SA 1MORA 2ALJA 3SIWA 2QZSA 2C8KA 3RFVA 3NHSA 2ZBVA 2UZ1A 4KK3A 3RTCA 3JVDA 3RIYA 2AYXA 2C29D 1XEXB 2WJYA 4HT3B 3FWYA 3PRYA 4R4JA 5EWMB 5TGTA 2M6KA 5F98A 2BR5A 2V9CA 4I55A 2QPOA 1ZUD1 3N87A 2FLVA 2D7DA 2RAUA 2WSYB 4RVNA 2OCDA 4NMLA 5JHGB 4WLEA 4CGZA 4B2IA 3NDIA 3OKAA 1CZNA 3STHA 1ZD4A 3IDAA 5DW3A 1N36B 5AW7A 3FWZA 4N6OA 5CHYA 3IPYA 5SY6A 3UGTA 4EB6B 4XIIA 1YDMA 3SX4A 3OPQA 5BRAA 1QB8A 2FMUA 2QE7A 4WL0A 4A9AA 1TCVA 2ORED 3V48A 2XWSA 1NHWA 2RHMA 2V9ZA 3ET5A 5EUQB 1ORDA 3UJDA 2HR1A 3O38A 1UFVA 3ZXYA 1P77A 1MOSA 1QH1A 1Y9EA 3WWCA 4UU8A 4MUMA 1T1EA 2YWGA 4HQFA 1C8KA 4TTIA 2V9PA 2IE0A 2WQ7A 4V0QA 4EHHA 3D7KA 1KMIY 3C3BA 3O21A 1T2VA 4PRLA 3ZBPA 2W6QA 2XH8A 3EULA 1UK6A 2QKYA 4MPJA 4WLUA 4BFXA 4BLTA 2GXAA 1HRKA 1NI4B 2XECA 4C5CA 3UMYA 4U39A 2J9RA 1W5FA 1IIRA 4P31A 3ZY3A 3G88A 2XE4A 3OJOA 1V35A 4NJMA 1PJ8A 3V8QA 2I1VB 3GJ8A 3URKA 3X1DA 1RRKA 3C70A 1FFGA 1R0CA 2QRJA 2L17A 4OB8A 2CVQA 3L1KA 5C5DA 3UCXA 1DQZA 1GZDA 1GQQA 1SQ6A 2ZTUA 3A3YA 3FMVA 2D74A 2VRBA 3LC1O 3EIWA 1CS0B 3UT6A 3NAZA 3WK6A 2WZQA 5KTPA 5M5BA 1HEIA 1R5OA 1KAMA 2Q3EA 2ZB4A 4Y9SA 5CAEA 4N41A 4ZT2A 3ZXUB 2NPOA 3JQGA 2AWNA 1YA4A 1W85A 3BIOA 2IZ5A 2X8JB 2AUNA 3X43A 3VJLA 1SBCA 5EGNA 5EP2A 4CTOA 2VHTA 3UWKA 1D2AA 3JQAB 2DH6A 2DUWA 1G2IA 3FTDA 1TEXA 2B20A 2E18A 2BGTA 2EWMA 3V1KA 1YOVA 4E2YA 1MIHA 3ESQA 5IKMA 4H0NA 4GS5A 1H2EA 3PI7A 3T5TA 2H2AA 2OV8A 4IIUA 3NTOA 3IMKA 2ECKA 2W2XA 3H17A 3NOOA 5KHAA 4MWOA 1NTRA 2DPXA 3I62A 4ZVTA 3R5JA 1FRZA 3ROQA 3TR6A 3LTNC 1OROA 4WCFC 3HXKA 3SC2A 3TKAA 1VYUA 3UJ9A 3IESA 4Z0NA 3THWA 1XV5A 3DQQA 5LZ7A 5G4KA 1SZJG 3LO8A 1XZKA 5FP0A 4JLVA 4MS1A 5F12A 2XCOA 2CXHA 3T1YB 1DRUA 2X7XA 3W5BA 4EG5A 1PQPA 3OPYA 5C7YA 1BS9A 1GG9A 1KI4A 1II9A 3HYLA 4QGFA 2OSVA 2XUAA 1RLIA 1V9SA 2R6CA 4NCXA 5EWJB 4DCNA 1DTWB 2FSIA 3WWPA 3ORSA 5C5CA 2QBYA 5LQAA 5LA6F 3AB3A 5FWYA 3GRKA 1JFRA 3LQFA 3OM0A 1NQAO 3OLCX 4XD2A 5B55A 3E18A 3Q88A 2PBZA 3EIHA 5DULA 3JQ8B 1MTOA 4MARA 4J0DA 3G8BA 3BQ9A 3I9KA 1L5HA 5JXGA 5LNK6 3PVZA 3NKFA 2IU3A 4LHYA 2FSVC 3LI2A 4NS4A 4TYNA 4KREA 3AB7A 4XXHA 5DBEX 5JXHA 5BVHA 3IIIA 5CIQA 1YB2A 3IALA 3JQ7A 4C4SA 4MWCA 1K7FB 1AZLA 4D79A 4QEZA 1ESNA 1QGZA 4BN5A 2VCEA 3K0KA 5CX1B 5D7BA 1JBEA 4YAGA 3OJCA 4DR2B 3BK7A 1OIVA 3GNTA 2YNMD 4M9XA 5SZHB 2PZEA 3ZY4A 2DHDA 3RC2A 1KSHA 2YZKA 5LQUA 4Q4AA 1U3UA 2H1WA 2NZWA 2FN9A 1BCSA 3H5WA 4J9VA 4KCGA 3FJOA 1LW7A 1XJ0A 1I8TA 3OCJA 1F6BA 3ASVA 3RFFA 2P2ZA 5I3ZA 2BSAA 1ZP6A 3L7BA 3WBJA 5FUVA 2JFXA 4CKCA 5A4JA 5GWXA 2FW9A 1W0JA 3DMTA 3LW8A 3PXUA 4AJPA 3AETB 2ZQZA 4A4DA 4A0FA 1GZUA 1XZ8A 5CNMA 1NIJA 5SZKB 5J4YA 3MEQA 1JH9A 4ARVA 1OWLA 2BIFA 1RHJA 1ZKDA 4WT7A 2TECE 1HI9A 5T3UA 1Y8ZA 1GN9A 1O7JA 5I7HA 3I0NA 5C0OE 1KXJA 1JFTA 4GKBA 3Q1KA 3WKBA 1T5LA 3T5CA 1PLJA 1TA9A 1W35A 3AK4A 3D7SA 4QNMA 5DU2A 4IVPA 4E5PA 1TQ4A 3EEOA 3AR5A 5L4SA 1Y89A 4KE8A 2OG1A 1ZJ4A 1CQIB 2O7QA 3C6ZA 1KRWA 5B3LA 4BLUA 1IJFA 5AVTA 4J16C 1YRAA 1Y8QB 4D4IA 2JAWA 2JDID 4RW0A 1CCWA 4IVQA 4NMMA 3FPBA 5HIAA 4K9PA 5HHTA 3OETA 4OVKA 1P1JA 1XVVA 5HZHA 1P2GA 3BICA 3BXFA 4M86A 1TKBA 5FL3A 5ALFA 2YUIA 1VE1A 4WZ6A 1NIPA 1QLHA 4Y6RA 2Y99A 5EMJA 1J24A 4G8BA 1REQB 3PHCA 1G1MA 1U2EA 3HCNA 4JLUA 3CH5A 4ZCPA 3SCZA 4ETMA 3HZZA 2XOKA 5A4MS 1GZ5A 1JDBB 4K05A 3EIXA 5HDQA 3O03A 3W9YA 2HTEA 2RG1A 1H3NA 1MQSA 5EJ5A 3H11B 3ZCTA 4DT1B 3B6KA 2UZ3A 3TFQA 3PNQA 1LLDA 4W7HA 5DTEA 4DUGD 1Z12A 4QKQA 1D9ZA 4DV4B 3QFCA 3OIYA 4NFYA 3T6KA 1KMHB 1DOZA 2J5KA 4RACA 3E3NA 4XGNA 5D5PA 4PSVA 4G9EA 1AO0A 1DU4A 4X0EA 4IIJB 1DIRA 4DADA 1F6DA 4E14A 3PC2A 3E5HA 3CLHA 4FW9A 5HS4A 1NSYA 4C7MA 4XJXA 4JLNA 1L4GA 1GTSA 3NTVA 4QAQA 4QPCA 3HP7A 1KBZA 2EJBA 3TBKA 4LNUA 4HWTA 5K0ZA 2UVPB 4R81A 3TG2A 3CH4B 2O2XA 5LCXA 3CBGA 2IYXA 1TZJA 2LCFA 2WJ4A 4K2AA 1C41A 4LV6A 4ZP1A 3MD9A 2RH5A 3MJ4A 5JV5A 1DEXA 3GROA 3ZDRA 1M10A 4J03A 3RG8A 2O1SA 5L3VA 4H4CA 1A04A 3FD8A 3HI6A 4M54A 3BWYA 1FMTA 4IHJA 1J70A 4DSTA 4JBWA 4Q93A 1A76A 2OQIA 1RZRD 1L7XA 3U4CA 4Q7EA 1GQRA 2RK4A 4G5YA 5FFMA 2OAQ1 1V1MA 2QQEA 5ADHA 1C0IA 3RIHA 3GA5A 2Q8PA 3Q7EA 4KR0A 2NUTB 3R4VA 4ZGBA 1W59A 2IS2A 2WIDA 5T4HA 5JH7F 3P4XA 2F2TA 2WVAA 5F78A 4DREA 2VWGA 3L8CA 4DJJA 5DWVA 5GONB 3AFNA 1YL5A 5AJXA 4J1TC 4DCJA 5FXMA 1AKEA 5DXAA 3SJ7A 1Y37A 2V58A 1NP6A 1QE3A 3GRFA 4B3JA 3GN2A 4AO7A 2R5WA 3OTHA 3CE9A 3R41A 4JX8A 4M38A 2H48A 3H5AA 3RTGA 5I9NA 5F1OA 4D8TA 1G17A 1Q44A 3EUAA 4ZD6A 1NV8A 2X0FA 1G2PA 1F4LA 3TZHA 1MO6A 3AJ8A 1USUA 3AB8A 3NHRA 3SF0A 3KE8A 4D26A 1HDZA 2NO9A 4MJLA 3NHLA 3CO5A 1KDTA 4II3A 4L8WB 4NESA 4WBSA 1OC2A 3C3YA 3NGXA 3Q2IA 2PL3A 4FKMA 1OA1A 2BGUA 2WYUA 2XODA 4IJ6A 3TW8A 4PCVA 2PO5A 5A0TA 1KAGA 2ZJ2A 3ROXA 1UK8A 4KN8A 3COJA 1SMKA 2B7BA 2WIAA 3AKCA 4PTLA 3K1AB 3W6UA 4U7DA 1CUFA 1OYOA 3MSCA 3N2LA 1F7UA 1V8ZA 4P93A 4KDCA 1H1TA 2HIGA 2QSYA 3LY9A 3NTUA 4QGGA 4XDZA 1D03A 2F48A 3T41A 2VSXA 4BV2A 5F33A 2P5TB 2WJGA 3CGGA 3SE7A 2PWYA 1RWKA 3LNCA 3Q3CA 4O3FA 3I34X 1U7WA 1ORRA 1TRKA 2RAVA 5BW5A 4C0XA 2PX2A 1KKUA 2YC4C 4A5SA 1JIVA 1BZYA 4EW6A 1E3EA 4ISBA 1YMUA 4D25A 3B8HA 3H3JA 1DC4A 1NPTO 1E2QA 3W1WA 2D0DA 3DTVB 2D62A 1DIHA 1EXWA 3PICA 5JAHA 1KTIA 5B7PA 2QTRA 3DZDA 1YOBA 2WF7A 3PA6A 1P1KA 1SO8A 1Q3TA 4G6ZA 5E0OA 3ZNPA 4KBYA 2QOEA 4RK1A 3VKVA 3MTAA 1QPZA 3DTVD 1HZZC 1RYHA 1Y6RA 1OZ0A 3U9TA 2FQ1A 1EXNA 2RCNA 4RDHA 1E1CB 4L57A 4LISA 3W5HA 4MR8B 1SNYA 4GZ6A 4YP5A 1E9VA 1I4TD 3NBYC 2ZSJA 4HXGA 3G5TA 4J0KA 4D0GA 1MW9X 1NZJA 4RL6A 5H0IA 1MN6A 1CR1A 2FMKA 3BF8A 4CWAA 2JCVA 1H2RS 1AXGA 3HCEA 2CLEB 1OGIA 4ZODA 3DJFA 2NLOA 5JEDA 4ZZ2A 3HA5A 4ZAGA 3D7RA 3RDPA 4Z0PA 5IAOA 3ZIUA 2O3UA 1D04A 4CIXA 4C03A 1H8HD 4H2DA 2XI4A 2HY7A 3OTGA 3ZCRA 4B2LA 2MWMA 4IHKA 4EI8A 3VU9B 1DMSA 3T3MB 2DG2A 3D3JA 1LA2A 3DEIA 2ZCUA 2ZDHA 3AKEA 3DO5A 3TINA 3WZLA 3UV6A 4NENA 4BKRA 4OI0A 1DWUA 1VJ5A 2GCPA 3MYRA 4BQIA 4B6QA 2W11A 1XALA 2SICE 4LYHA 2A1TR 4ZOBA 4O25A 3M49A 5D87A 2I76A 4NR0A 2B4TO 2RSLA 1KH2A 1WBBA 2BBSA 3NJ4A 1E7MA 1NW8A 4TMTA 2YJ3A 1BN7A 3T3NA 3B78A 2ONCA 4QQRA 3LC2O 2H9YA 1EBUA 1ECBA 4XPIA 4O0LA 1DGQA 4AXBA 2P68A 3R0JA 3T12A 2OORC 3ORHA 3LZCA 4MHSA 4EYEA 1QV7A 1ZRSA 4XIGS 2FW0A 2UKDA 4RKWA 3WGYA 3LXUX 1DB3A 1AN9A 2MOKA 5A4IS 5GIOE 3FB4A 1KQGA 3LPDA 1UPFA 1G21E 5ALDA 1MV8A 2VP2A 4TMXA 1JQJC 1Y3AA 1USKA 2AXQA 3OPYB 2QW1A 4OK3A 2UXCB 4JLOA 4HWOA 3H6HA 3JWGA 4H1TA 2VF7A 5CD9A 1PKEA 2C9MA 4IF6A 4LK2A 4BTVA 1KO4A 3O8LA 5JW6A 1SBTA 3QVUA 1NW4A 2W2PA 3BRQA 1UOPA 4QJBA 4G26A 4HB0A 4R3WA 3VC3A 1H93A 4LEIA 3LDFA 4D7AA 3FTEA 3C39A 3EGIA 2GBGA 3JQ8A 4ZK2A 2XKKA 4HTFB 5KYWA 2W90A 4XCQA 2RE8A 3AXTA 1UAYA 2WLTA 1EJBA 1ID8A 1BROA 1R15A 5JADA 3W1EA 3ER8A 1HQKA 1BXZA 2BCEA 5K3EA 3NBXX 3MUOA 5DHFA 1FYVA 3OZTA 4UULA 1KI6A 1N8TA 3F8SA 3FJYA 1N2CA 3ZS9A 3KDSE 5FEUA 2M1XA 2P27A 2QRUA 4FWTA 2BFNA 3ONEA 1DJQA 4K9SA 4KUHA 3DHVA 1FNMA 3PQEA 4X7RA 2IYLD 3H86A 4PG4A 2W9XA 1MNQA 1KI9A 1AUXA 1II0A 2QPAA 2Q9BA 3G68A 4LZPA 1BRMA 2WVGA 2RH8A 2J3HA 1E96A 1CY7A 1Q92A 2VUSA 3KDPA 2PRKA 3DEFA 1XMSA 4H59A 2Q3HA 4UCWA 2HREA 1T1SA 4BKQA 2GILA 3CTPA 3UN1A 2QNRA 3HXOA 3ZLTA 3IAM1 2RJ3A 1P8JA 2BBTA 5IKXA 3GUYA 5JH7A 4GL2A 3ICPA 4YDRA 3TEJA 2H59A 3CKMA 3DE4X 3NONA 5HM6A 2C3YA 4IEIA 3ZWPA 4JWTA 1XAIA 2HUNA 1GITA 4KVAA 4XLTA 1K86A 2WFZA 1K89A 4JB8A 4Q4JB 1P3JA 2X4GA 1GTVA 4U2CA 4R68A 1U0OC 3KYBA 1J90A 3LY8A 1J8DA 3GZ4A 3F5FA 4EHIA 3DLPX 3HA2A 3ZV5A 1QB7A 2E5LB 1HT2E 2QRHA 3CZ9A 2FPKA 2IEAA 4B44A 2Z5GA 3WAGA 3QVGB 5IULC 3NYRA 4B35A 5JFOA 4MVJG 4UCFA 3ET4A 3QE0A 2Z6UA 4C2TA 3KCQA 2BFOA 3EHEA 3QFRA 4QULA 1L7PA 2D5CA 1FFYA 3HG7A 5HOEA 5IXSA 1IMJA 1W48A 3IERA 3QBJA 4G07A 4TKVB 4WXHA 5BSRA 3T9BA 1W6RA 4BGVA 4DYVA 2ZUEA 2WB4A 2V7XA 4YRJA 4MIYA 1PVOA 5T64A 4F1JA 1FFAA 4KXXA 1I7SB 2R86A 4BNNA 2F64A 1DUVG 2UYHA 4M0LA 3KJZA 3ABRB 3EQ2A 5EMMA 2NG1A 3UWMA 2VYNA 3AY3A 3NAMA 4OMCA 3ENNA 3DGFC 5ELXA 2AJLI 3QG5A 1SHZA 2WTUA 5EP3A 3EFHA 1A72A 3EWIA 2PH3A 3K4HA 1WMEA 2RHWA 2W6MA 2YWEA 3K53A 4M1ZA 16PKA 1EVZA 1ODKA 4XGRA 1CB0A 4FWIB 2GK3A 2VOJA 1P31A 3UC5A 1LRLA 1VJTA 1G8AA 2XLCA 1G18A 3PQDA 3SS9X 3OP1A 4N5LA 1B42A 1JKMA 2I29A 2JJ2A 4MW1A 1DKRA 3WGGA 1XJ5A 3WSTA 2NYUA 2ATEA 3QWFA 5AVUA 4Z0HO 1OZFA 2VSYA 1D09A 2YMQA 1TRHA 4LBVA 2HPHA 1RPAA 4MP6A 3KOYA 1E1KA 1J0AA 1L6RA 1XR3A 1ZBQA 8ATCA 1W88A 2J59A 4N12A 4JLPA 4XYBA 5TQ0A 2JGLA 2ATXA 3ETDA 4PCUA 1Z56C 4WGGA 2Q5EA 1GNQA 5EQJB 1M6EX 2C59A 3ND7A 3HSKA 5D5QA 4DR4B 4ZCMA 1X2BA 4QOEA 1CDOA 3DBOB 3C15C 1L1EA 1DQYA 4FD3A 1MNAA 4FZRA 2IL1A 4YP7A 3VDQA 2I03A 1Q0ZA 2G82A 4FEGA 3M0EA 4LCEA 3W4IA 4AG3A 2BCGY 4OH1A 4U5QA 4Z4HA 1IHDA 3CKKA 5EHXA 3HCDA 1NF9A 4MITA 3RUPA 1ETUA 2HAEA 3AFGA 1Z6QA 4AKHA 3EXHA 5E8RA 3C85A 3ZGNA 1HLDA 4HH4A 1HYBA 2AOTB 2ZE7A 3K9BA 4CE6A 4W5RA 4BO0A 1JG2A 2PR2A 2VF2A 3HNOA 4CTJA 3QU9A 1LLFA 4QDJA 1SJ9A 4BNWA 1KJZA 3KKQA 3FNIA 4DRZA 1JFFA 2VDJA 2XF8A 3R9XA 1C9EA 5TDHA 1YZKA 1NI3A 4YVFA 1KQOA 4WIAA 4DCCA 4O02B 2ZUUA 4ZAFA 2ZRBA 5GZ1A 1PN3A 4LG1A 5JR3A 2P0AA 3ZDEA 1MOPA 2R48A 3GDHA 3P9IA 5COQA 1WXGA 1X1RA 2HKIA 4K8RB 2FSUA 5EUMA 2UUAB 4A8HA 3BJRA 2X8AA 1WQ3A 4TROA 5CFOA 3A6DA 1PUIA 1SZCA 1QYDA 1KZ1A 1Z8FA 4N7MA 2IGTA 4RHEA 1LBHA 4B4OA 1PQUA 2AN9A 2P11A 2QF7A 3CZ4A 5CTJA 4A1OA 1EUYA 4TT3A 3BWXA 3GBVA 4LQLA 4NWIA 4D9GA 2UU9B 4RA6B 1GXSB 3ELYA 4X24A 4D8VA 2JGAA 1DO2A 1Z74A 1UP6A 2BJVA 4N7RA 5DVZA 1V2HE 5EP1A 3G79A 4P32A 4RTOA 2C03A 2O2IA 3RYTC 4L8VA 4BZZA 1FFWA 1USGA 5LP1A 2HCTA 5K0GA 3O91A 4KAAA 3MSXA 3QMPA 2DPHA 1VLHA 4W5NA 1NNEA 4QPPA 2IU0A 2RI6A 1AX9A 5J23A 3MTBA 4DW8A 1DC5A 4GKAA 2O50A 4GX1A 5CB4A 2FUEA 2B2XA 5AI4A 2ZWAA 3DTNA 4AP5A 4F84A 2PCLA 2VDRB 2P9EA 4LGVA 1SG6A 1B8PA 4B34A 1AQLA 3LPMA 2CUKA 5BSFA 1W36C 2A30A 5K8UA 5IDYA 2YN4A 3F7TA 4AJEA 1NN1A 1QVWA 2G04A 4RJKA 3RGGA 3U7QB 4CNQA 2DWPA 1EUCA 4M3NA 1L5FA 5F9HA 3E2PA 3JWHA 4DL9A 3NBQA 5AKXA 4YPFA 2HH9A 5K5EA 3BTVA 4J4TA 1N7JA 4CCAA 2IHKA 2YOFA 1NA5A 2W48A 1TC1A 2ZE5A 4JU9A 4TRNA 4D99A 4F93B 4JC0A 3BT7A 1SIUA 1CY2A 1VFPA 2HX1A 2ZYIA 4PZ0A 4HDAA 2JCXA 3BWBA 3OIDA 2MSDB 4DR5B 3QQ5A 5TIIA 3AVUA 4FZ5A 1UEXC 1H2BA 2PWPA 4C5AA 3AP1A 5JNUA 3IT0A 5B12A 4KBGA 2YQ4A 4EPWA 4ESHA 4OBWA 4UVHA 2ZU0C 5KPDA 2BFCA 5DN6D 1IONA 2UZ0A 4I46A 4OSEA 5B36A 1YUNA 2EYUA 4QYXA 4E15A 2Y2VA 2PANA 3EXFA 4RETA 4TQ9A 1IEQA 3S2GA 4Z2YA 3WGHA 3WYCA 4HFMA 5LDDC 3LLVA 1IOVA 1IPFA 4DLVA 2J0QA 1K27A 1E79A 1YBAA 4P53A 2GBIA 2Q1YA 2OBYA 2A1UB 3QPVA 4P4NA 4PNHA 4QHYA 3VDRA 2CJXA 3KQLA 2AQHA 3C1AA 2O8EA 4W5QA 4HRXA 1XKXA 4KIWA 1JDTA 3IPCA 4YV2A 3TTVA 3I2GA 3K1AA 1XFDA 4LBYA 1X9GA 1IG0A 4TXMA 1DQRA 2XMGA 1V5EA 4YWJA 4ER7A 4ND6A 4FOSA 3PLAE 1DADA 1WF6A 2AJBA 4YCNA 1NQOA 3KUKA 4IP0A 5JBNA 5FQNA 1OD6A 3T94A 4DUZB 2ERXA 3W2FA 4ZVQA 2QTLA 1YCFA 1G20B 5LQMA 2ZB8A 2PSFA 2WOJA 1L9XA 1SY7A 1LQUA 4X6UA 4BRWA 1SVWA 1QANA 2VHEA 1BH2A 4KNWA 1QMPA 3NVKI 1IN8A 2XVYA 3ZK7A 2FAXA 4QU9A 1GQ2A 3AFMA 5HCUA 4TWIA 4NBUA 5LUBA 3TRKA 3BOSA 4FUTA 3K30A 3K9CA 4NJEB 5A3VA 1OWPA 3L8ZA 4QUJA 5TEVA 4OEHA 4CL0A 5A1JA 5KYYB 3LNTA 2CLDX 1T8SA 1FC0A 4YREA 1VECA 4RCVA 1X7YB 1YJXA 2I99A 3OAAD 4UNIA 1J0EA 4NYJQ 5DLDA 1TO2E 4KQKA 2HHJA 4YBRA 1GDTA 1Z2PX 3IQFA 3JYNA 4R8LA 3DCJA 3S7TA 1O96B 1IN5A 2P79A 3AHIA 1KJ9A 1VHQA 1JXQA 2EVWX 2IOQA 1EK2A 1HH4A 1OJLA 3E27A 3W6NA 4L4SA 1RMQA 5KTOA 4IO1A 4RV9A 2A14A 2X3FA 3HMKA 3U7IA 3ABZA 1RWXA 3ZQ4A 2Q0XA 1RKQA 3WWZA 3WQSB 3GH1A 3LWDA 4YRBA 1A9XA 5K3OA 2YJ6A 4NH4A 3OU7A 1IOZA 4JEUA 2IXGA 2LDXA 3E4CA 4EHNA 4ZYLA 2QTZA 1N2HA 2VYVA 1KO7A 3CW9A 2C2OA 4AECA 2HIMA 4QTXA 4WADA 4B8WA 3BL6A 1FUIA 5BQOA 1PJCA 2ECQA 4AMGA 2AE2A 5EJ7A 4ZOLA 3FMOB 4RH1A 4YGYA 1LF0A 1LK5A 1VIYA 4WDRA 1YQDA 3IPXA 1LDEA 3IP3A 4XI9A 3DAYA 4Y2SA 4EGCB 4CL2A 1H1LA 1SIOA 3O3MB 3VQTA 2XUKA 4Q9AA 3ZOKA 1K7SN 5PNTA 1Q91A 2AZ4A 4A2PA 1VPEA 5H68A 3ABQB 3IA2A 3DFUA 4OBBA 2GYVA 1JHZA 5BSMA 5CDHA 2JCYA 3KTAB 5CCBA 4KOEC 1V7PC 1NYLA 2IYYA 3WGLA 3TUZC 1CVIA 1JDPA 2E6UX 4GLOA 5AH0A 1QP4A 3DLHA 1Z6AA 2QR5A 2AN5A 1P81A 4PX2A 3I73A 4RIFA 4Y1RA 5FTMA 5KNCH 3ER9A 3OOEA 1SA0A 1C2YA 1KYVA 3N2KA 4TX1A 3O8DA 4FNMA 4DC1A 3SY8A 3ZHRA 3ZJ4A 2OGWA 3S2IA 3E7DA 1NYTA 1UPBA 1LPSA 5HP4A 4A0QA 2QUBA 4FOPA 1K5PA 4FGWA 1GSOA 4MLCA 1LBIA 3H65A 4AFNA 4N65A 1RWNA 4EUHA 4MRMB 2XMPA 2DCMA 4C3OB 2OESA 3E2MA 5A2QA 1AZTA 4XRGA 1FLAA 3HJAA 3Q9SA 1AGRA 1UOOA 3CLVA 4H15A 2AC4A 1T4CA 2ZIZA 1QQ5A 1Z0DA 3ZQ6A 1V48A 1FBNA 3MMPA 1X15A 4AP9A 2LGJA 4J0HA 4RD4A 1ZCFA 7YASA 1UBLS 5TGDA 5SYMA 1IWPB 4QOHA 2YKGA 1TYEB 1BSVA 1Z4OA 5F7XA 2N9UA 2GMWA 5GADl 5AHRA 3ZD8A 3S2YA 3OFVA 3MUNA 4EPVA 2OCLA 3HXLA 5KYUA 3SXUA 1O9BA 2NZ2A 4WK6A 3OCWA 1JB1A 3TH5A 5F5NA 3Q3VA 4C4YA 4MUJA 5B2EA 1CUAA 3DOIA 4JASB 1COWA 2HQBA 2VSFA 2PMDA 1S02A 3V8VA 4JOBA 4LOHA 1DC8A 3A36A 5B58T 2OKGA 4E5MA 4AO8A 5CT9A 2GRJA 3PC8C 4QXOA 3RSSA 5G0VA 2O6HA 4BMYA 2I2CA 1IBSA 1YS1X 1U2ZA 4WEQA 3DD1A 3VTAA 1SVMA 5JNTA 2Q99A 3F2IA 5T4FA 4BLSA 3THYB 2H1IA 4LZAA 4BFYA 2BJHA 1S4QA 1RADA 4LDQA 1T9KA 5AVRA 1KFKB 2XUHA 1CP2A 2WPDD 1Z5WA 4FR0A 4GI5A 3QYJA 1V5GA 4ID3A 3WDSA 1EG7A 2DFPA 1U2TA 1MJFA 1VYTA 2V7BA 4N47A 1Q14A 1TT5A 1QX3A 1JI0A 1Z5UA 1YIOA 3DKIA 5IVKA 4ZYZA 2HYIC 3WKCA 2QJRA 4Q1CA 4BC1A 5KMGA 5D1NA 1VJ0A 2N75A 3ZCXA 5ITWA 4LJ9A 1KYIA 1E0AA 3ED1A 5FH9A 4G1FA 2EQ5A 1VHWA 4DRXB 5ISMA 1W5TA 2VCYA 2CW5A 4JJ8A 3G9UA 1DPGA 4ZRMA 3LT4A 1W0KA 4CV3A 4OHKA 1E18A 4L8YA 1V1JA 1P2VA 1G3MA 2G80A 4H4DA 1KFBB 5DWDA 1RDFA 4AQDA 1AKNA 1F20A 1EINA 1X9IA 3T54A 4EYOA 1GGJA 1VYHA 4KO2S 1D6JA 4MR9A 5EI5A 3W4KA 5EUBA 4D3DA 2ZYTX 4HEA6 4GVPA 4BWGA 2XB4A 3SZRA 1L7OA 3MZ0A 4AICA 3AOEC 3OX1A 4G85A 4XCXA 5EJIA 2EF1A 4LXIA 3S0JA 2RJOA 4DMMA 3HKEA 2W6JD 1C3VA 1CERA 1P9WA 1VZ2A 2X58A 3N0RA 1M72A 3EJWA 4CV0A 1T4DA 2XZOA 1KK1A 4MUBA 3E53A 1UBSB 4DCSA 2O8BA 3ZR4B 3EOAI 3OM9A 3UGQA 4XB2A 2JA2A 4BGUA 2R00A 2XMRA 2ACWA 5IAKA 2J9ZB 5B3AA 2KBEA 4M9QA 4QNRA 3KC2A 4XFKA 3U49A 2GN4A 3F4KA 3JD4A 5CA1A 1XAGA 4I1VA 4LQDA 1HTTA 1MC5A 5ICGA 3MPOA 1F8UA 1YB4A 1WOMA 2ECFA 3N59A 1I9CA 2QRLA 3TPFA 3ITKA 1OU4A 2DOKA 3GRYA 5LKAA 2LV8A 5JVDF 1LPMA 4AN1A 5BMOA 4TZ0A 3H2GA 5AI8A 1DS6A 4FI3F 2EIHA 5DM1A 3WK5A 5C5IA 4LY6A 1YJ5A 1T9ZA 4JR1A 2C9YA 3C8MA 2B6HA 1PJ3A 1NT4A 1QOPB 1ORIA 2I0FA 1X8JA 3LCJA 3ACCA 1QMGA 3SC2B 1O97D 3T5GA 1XDDA 4ML3A 5C1DA 2AQ8A 3F7NA 2QN3A 4LDRA 3W7BA 3R5FA 3PYMA 2X9QA 2Q5IA 5ERGB 1V6CA 4LKOA 1QH0A 5AM3A 4GM0A 5KYVA 2Z98A 1PZNA 4GUAA 4AY6A 2VWPA 2YJ4A 1DKUA 1R6DA 3JY6A 2YVLA 3PQ7A 4L3OA 4WBXC 4RKFA 3ORYA 3EEFA 1ZNYA 3L0YA 2A0YA 3O9VA 3ZWWA 1OZHA 1QVZA 2FPGB 2ZJFA 3ESRA 1TF5A 3MG9A 4M0PA 2WSMA 4AB1A 2JG3A 3NCTA 2WF5A 3ZKAA 2Z5FA 4LHVA 1FFDA 1I3KA 1LGYA 3IQXA 2BMAA 2OO3A 2F3RA 4M89A 4NECA 3L93A 2X0EA 1JLKA 1ZA2A 3F6YA 5CG1A 3ZHTA 2IBSA 2QAJA 4CL3A 1S0UA 1PJZA 3EC1A 2A1UA 4GHWA 4QUAA 4ZC8A 3EVCA 2B1RA 3AVYA 2VDMB 3FG9A 2W2LA 1CHNA 5DGHA 4ND8A 3R2JA 2OZKA 2R1TA 3BSSA 4GOKA 1ULSA 4LE0A 2OHJA 3LQ4A 4KMOA 3ZV7A 5CPBA 4K6KA 3GP3A 2FPPA 2PX6A 4C29A 2ANBA 1YL7A 2Z08A 4XX0B 4DB4A