1A98A

Xprtase from e. coli complexed with gmp
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
129
Chain Sequence
EKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLARELGIRHVDTVAIGDGEGFIVIDDLVDTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPISGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
publication title Structures of free and complexed forms of Escherichia coli xanthine-guanine phosphoribosyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphoribosyltransferase
total genus 35
structure length 129
sequence length 150
chains with identical sequence B
ec nomenclature ec 2.4.2.22: Xanthine phosphoribosyltransferase.
pdb deposition date 1998-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1a98A00
1DQNA 2YZKA 1Z7GA 3OZGA 1FSGA 1QCDA 1ZN7A 1I0IA 5E38A 5BSKA 4F8EA 3HVUA 1ECGA 1HGXA 1ECCA 1OREA 4OHCA 4RABA 5KAMA 2H07A 1A98A 1G9TA 4RADA 5ESWA 1L1RA 3NAGA 1ZN8A 1ZN9A 5K51A 1P4AA 1P18A 1OROA 1QCCA 1U9ZA 4JLSA 4Z1OA 5IPFA 1BD4A 1I5EA 4RQBA 3LPNA 1O5OA 4RQAA 2P1ZA 3OZFA 1VDMA 3G6WA 2AEEA 4WMLA 1CJBA 1QK5A 2FXVA 1U9YA 4LYYA 3M3HA 4LZOA 1A3CA 4RHXA 1UPFA 1HMPA 3QW4B 4RV4A 4M0UA 4TWBA 4X45A 1A97A 1I13A 3GGCA 4RANA 1DBRA 1D6NA 4P83A 4M0KA 4RAOA 4P80A 1YFZA 1STOA 1G9SA 2H06A 5IAOA 1I0LA 1TC1A 4RAQA 4M0PA 1L1QA 3ACDA 4QYIA 4P86A 1DKUA 1JLRA 1OPRA 3GGJA 1ECBA 1MZVA 3MJDA 1P17A 1XTUA 3MBIA 4PAWA 2JBHA 5EUCA 1J7JA 1QK4A 1QB7A 3H83A 5JV5A 1VSTA 1GPH1 1R3UA 4KN6A 4X44A 4WN3A 2PRZA 4RACA 4MB6A 4P81A 4RHUA 1Y0BA 1GRVA 1BZYA 1W30A 2E55A 4QRIA 3DMPA 1A96A 1LH0A 1PZMA 3DEZA 1G2PA 1G2QA 1A95A 1BD3A 1VCHA 2VFAA 1ECFA 4LYGA 4LZAA 5BQPA 2EHJA 3GEPA 1WD5A 1AO0A 3EFHA 1NULA 3N2LA 4PFQA 2PRYA 4LZNA 5BQOA 1P19A 2HCRA 1DQPA 3OHPA 1NONA 4IJQA 2PS1A 4P3KA 5JSQA 1XZ8A 3ACBA 4QYIB 5HIAA 4JITA 1UFRA 1XZNA 4ZFNA 3O7MA 1A4XA 1ECJA 1O57A 1QK3A 5BRNA 1XTTA 2WNSA 3S5JA 3LRTA 1JLSA 2H08A 4FYMA 1QB8A 1DKRA 2JI4A 4P84A 5ESXA 2XBUA 1TC2A 4S2UA 2GEBA 1XTVA 2DY0A 2JKYA 5KAPA 3ACCA 1V9SA 2JKZA 3KB8A 4P82A 2C4KA 4RHYA 3DAHA 4RHTA 1UPUA 2IGBA 1IBSA 5HKLA 1I14A
chains in the Genus database with same CATH superfamily
3HKDA 1QGYA 3D3JA 2X8JA 3VXKA 2CJPA 2CJWA 3WZ2A 2MYNA 3GXOA 4W5HA 4Z4IA 2B4TO 1YR9A 4WK2B 3M4YA 3GJ7A 4ETIA 5KOHA 5EIXA 1UPAA 1V5EA 4BVFA 3F8WA 4ZCLA 2HMWA 3ZU6A 4YASA 5G0UA 1U0GA 5JE8A 4DBVO 3IO3A 2C8JA 4AJ1A 4AJ2A 1X87A 3B78A 3QNMA 3Q3EA 2ERXA 2ZRNA 1G7RA 4K6KA 4KPFC 4OGKA 4OSOA 1LI4A 3FDXA 3II6X 3OE7A 1EFRA 4YR7A 3LPNA 4I4TF 4EI8A 2RONA 2BV3A 2Y9MB 1BNCA 1USUA 3AEKB 3LLVA 1T6BY 1K1EA 4ZOBA 5F5XA 3WLNA 4EQ6A 1G3MA 1B8OA 1QIDA 2FA9A 2SHKA 1X7GA 4I6EA 5K3FA 4B85A 1WUYA 1SUBA 2Q4TA 3GEIA 3HCPA 3AB8A 4GI3A 4J7AA 3TSAA 4AY5A 2A0KA 3ABRB 3L0BA 3I6BA 4BMDA 5HSGA 1E0SA 4GKKB 2VJLA 3AF0A 1LLQA 1LJ8A 3DDOA 2W90A 5EGSA 2EP5A 3GDWA 3BMOB 4F3KA 1VKHA 5KO2A 2WJGA 3N0TA 4Y1GA 1WDKA 5EPOA 5KSWB 3AJ9A 2OAQ1 2XA1A 2VNSA 2XRYA 1HY3A 1IB6A 3B1XA 3OC6A 4XWGA 2YL2A 2WT8A 4U7PB 5F78A 3X2EA 4PLPA 2NV2B 2YRXA 3I64A 2H4XA 3KSDO 1M2NA 4Z0TA 1SOUA 4EW1A 1ZAKA 2AFIB 5CHYA 3U7JA 5FWYB 2Y0EA 3KDAA 4IIYA 1SZDA 2A9VA 2IZ1A 3HXLA 3M83A 1F2TB 3EVDA 1Z6QA 4EBBA 3A9CA 5C8YA 3VNVA 1HURA 2O8FA 2C42A 3GFGA 4WKNA 4ESHA 1AU9A 4Q3OA 1L7MA 2G0NA 2DC1A 1TADA 1ZI8A 3Q15C 4GZ6A 3LCRA 1Y42X 1C0EA 3NC1C 1BJTA 3C16C 1CZRA 1U02A 3PNMA 4XDHA 2HC9A 5DGHA 2J6HA 5EKXA 5GOZA 4GBGA 4MUIA 2FP4B 1Z4QA 1CS0A 2DFDA 2GPYA 2G25A 2VSNA 3MCUA 4TQGA 3WXMA 4IAOA 3ZKWB 2R6CA 2VZLA 4MVJG 1IUOA 4DLKA 4CMAA 2OB2A 2NO4A 3LGXA 1X2EA 3EZGA 4WECA 3MJHA 1HYBA 3RW9A 4R0VA 3BCRA 1W0JD 1F2VA 4GPEA 5AJVB 3RHSA 2AKAB 1QYDA 4L74A 1L8OA 3LUFA 3PE3A 1RXEA 1KEVA 4NS1A 1C8VB 2BGKA 3F6SA 5EZ6B 4IQGA 4JLOA 3KSZO 3QLEA 4LNAA 3BERA 4M37A 3BWCA 4DBLE 3EEOA 3GLGA 2V3VA 2PWPA 4ZEWA 3DT9A 2VYFA 5AOVA 3WLLA 2P9BA 2VHVA 5MHTA 2G9VA 2O2GA 3SZUA 4C7BA 4D0RA 5LZ4A 4WDQA 1YOBA 4KN9S 3AF3A 1AQNA 2HADA 3OU2A 2KE5A 3CTPA 3W2HA 3OPXA 2KHZA 1ULBA 4P82A 4W5TA 4CEIA 1K8QA 1XMIA 3Q5EA 4KQIA 1VLLA 2H57A 2QUZA 4ANFA 1DFIA 1T2NA 1ZH6A 2OBYA 2RGCA 3KKPA 2BMVA 2FKAA 3JRXA 4LBYA 1JXOA 2OYCA 3WGKA 4P3XA 2PH3A 3IPLA 5K3BA 1OLSA 3F71A 3V1TC 2EFGA 1MH1A 4OJYA 5AK3A 5IZ4A 1OX6A 2FSVA 2QTHA 1KEWA 3DPUA 3N8DA 1M2VA 2J08A 5CXUA 1T0IA 2NTVA 4HDMA 1REQA 5FI0B 3S99A 3C3XA 2OHVA 4JI3B 4XEHA 2V1XA 1JPVA 4H59A 4TS9A 3RYCA 3EB9A 1IN6A 5HF5A 4QYSA 2OG1A 1NP6A 2GF2A 4RJTA 1IZ7A 1P2TA 4KMSA 4NNJA 4EB3A 4NCIA 1C50A 2JFBA 2NQTA 2GPSA 3WLSA 3OT1B 3G49A 1FYXA 3SVZA 2Q5JA 3RS8A 4R9UC 2EATA 4LMBA 2H4WA 3IPRA 1YQQA 5CT5A 3ROFA 1J42A 4BFCA 5I7SA 3BMQB 3K1AA 5FPSA 1L4NA 1G6Q1 4U7GA 1C8LA 4M99A 4BTLA 1S0UA 1CYDA 1OIXA 1CRQA 2ZJFA 3A0RB 2V7GA 3GAMA 3N7AA 4E5NA 3LS2A 4FC7A 5THKA 3E3NA 3ZE7A 3T1QA 4B6QA 1DMRA 4BQIA 3HY3A 5J2TA 1JL3A 3Q5GA 1CQIB 3FOBA 4BGUA 2W4QA 4KGDA 4LF9B 4WE3A 1MNQA 5EIBD 3F6EX 4GYKA 4MVJH 5IANA 1H5QA 4Q9HA 5K0ZA 4ENWA 3OAAA 7MDHA 5HQJA 5K3SA 4D97A 3TF5A 3QEBZ 1P44A 5JG7A 4CNBA 4HEJA 1AZSC 2RAUA 3P9ZA 2ZB3A 2E4ZA 3K0BA 3JSAA 1N9ZA 4Q4HA 2VP9A 2QLMA 1RMTA 2QIOA 2JJQA 4J0GA 1NUPA 3HHPA 5DLDA 2AJDA 4A23A 2D2FA 1SFRA 4H7IA 4CM4A 4I2VA 1LSUA 4Y6QA 1WXQA 4RHUA 4NFYA 4UOQA 3FDIA 4J07A 4UMEA 2JPDA 4OQZA 4TVSA 5M3BA 2ZJ2A 1SVIA 5KTRA 2P9EA 3VU1A 5CVCA 3ABSB 1YKGA 4EF4A 2H1OA 2XUKA 5ISMA 3QVLA 3C43A 3DFFA 1KZGB 3DWEX 2C20A 1QH8B 2A1TR 3FOWA 5JXIA 2YCLA 5EXXA 1GILA 2EWVA 2YFKA 4LOLA 3MOSA 2VSFA 3OQIB 3OF5A 1NQ5A 4GQAA 2ZYWX 1FIUA 2IV3A 2O2ZA 1K27A 2BKVA 4LTNA 4UCXA 1T2EA 1Y1KE 3KSBC 3T3HA 1R3DA 4EUKA 3BHIA 4K6OA 1NT4A 2I1QA 4R1TA 1YJBA 3ONVA 2KBEA 1FXUA 1M7HA 1YVUA 3QI7A 5IJXA 3WQQA 4E15A 4C2AA 4DMCA 5AVVA 3OEHA 3E3LA 3BXHA 3BWDD 3HGQA 3VR4A 1SCIA 1ZRMA 4HZGA 3C85A 3RUCA 1E1CB 2GSWA 2WAAA 4O2BB 1KO1A 2IHZA 5HWSA 1SUWA 1TW2A 4Y9SA 4F6LA 5I6DA 1GM5A 2ZAGA 3Q0EA 4MP6A 4WN9A 5DWDA 3H99A 3LUPA 1EHCA 2DPHA 5JH7A 2ZRLA 3U80A 4JBNA 4E3WA 1VGRA 2A94A 3AFIA 1B23P 1CUDA 1HEIA 2IHYA 3PVSA 5AUQA 1E59A 3AV0B 5JD3A 2IEYA 1M0TA 5AW4A 1P0FA 1V8ZA 2PH7A 2C77A 4X1YB 5JT1A 4PYKA 1I6WA 3ITKA 3HR4A 3LO8A 3ROGA 4RXTA 3U3ZA 3VR0A 1EUQA 1CQJB 4H6VA 1Z0SA 4KP7A 5DYWA 3CEPB 1VZ3A 2P2NA 2FFBA 3LUDA 4FYVA 2OESA 1NZJA 1LC3A 4KXVA 4YCAA 1UBRS 3DPIA 1LK7A 4NBUA 2IE0A 1GL9B 4G0QA 4GI7A 1JG7A 2FFQA 4F9EA 5M5BA 2IKQA 2ZAOA 2WUEA 1BEZA 3DOHA 2F1OA 2GUGA 3KOZA 1R10A 2LZ0A 1L3BA 4B75A 3P4UA 4BFXA 4XQ0A 4CLRA 1KQ3A 4R7TA 3WKAA 5SY4A 2CLEB 2C9OA 4UCQA 1XVTA 2CSUA 5EZ5A 2XRZA 3OX2A 2W98A 4KMMA 2PLRA 1K08A 4JIMA 4XYEA 1WB9A 3VZBA 5ETJA 4M0MA 1ZGZA 4XGQA 4CKBA 1P2UA 1DKOA 2NPOA 4OOFA 2IIQA 4ZVVA 3U3DA 3THSA 3CKYA 1V5GA 2Q3CA 1WB5A 5GM2A 1Z7BA 4TM8A 3PX7A 3CNEA 2RK6A 1AK2A 3DOJA 4P2BA 4O6VA 2H1FA 5BT8A 4A26A 4TUYB 3GROA 1OAAA 1IBMB 1E3WA 2X2PA 3LRPA 3FSJX 4CLXA 2GR9A 3CPHA 5KTKA 3MQFA 4ZVMA 3KAKA 2QUIA 2ZCVA 1CD5A 4KXYA 2GVZC 2R7MA 4II7A 3WK9A 4CUKA 1MHPA 2ZI7A 4DV2B 2V6JA 4AQ7A 1U8FO 2B1JA 3OP4A 1YS9A 5DM60 3C74A 4ZU1X 4ZVSA 3IBSA 3TXAA 1XRMA 1EM6A 1RTKA 3WDLA 2QTAA 1SWWA 4LXYA 2F17A 1GA6A 1R7RA 1UMBA 1VIYA 3DAGA 2Z8YM 4EQZA 2P3SA 2PBFA 1WSAA 5IMSA 5KNDD 4YAWA 4GWGA 2FJUA 3RS4A 1IFXA 4A3SA 5B7PA 1M1NA 2ZIGA 3JWIA 2PKCA 3FPSA 2FPMA 1WOYA 2D7JA 2HCFA 3DAOA 3VOTA 5GVSA 2XMCA 5IDYA 1XRSB 4MSUA 2PR7A 2R1ZA 3A3NA 4A8TA 3FIUA 3IGFA 4IQFA 1Q2XA 3WL6A 3B8HA 5H59A 1IL0A 2BSAA 3PUIA 4WA8A 5IU6A 5FLEX 1NOJA 3OPNA 4O2BF 5GIPE 1U63A 1LBQA 4O4IA 3VDXA 2OHIA 2OBMA 4QQKA 4BS9A 4UFPA 3N2GA 3SAJA 3GQBB 1UM9A 4ENQA 4DIMA 2W83A 4MW6A 2AN3A 4Q1FA 3ZG6A 1TYCA 3RQIA 5KU7A 4F93B 1BQ3A 4O29A 1TM1E 1OE0A 2PXAA 4ITUA 4WEQA 3VI4B 4LOIA 1M2OB 5LNK6 1KQGA 1OKKA 1PR9A 2JAXA 4WQMA 3ICQB 1BKSB 1RYEA 2QI9C 4FE4A 4LGYA 1TA0A 4FN5A 4ALIA 4J4BA 2ZYGA 2I4TA 2ZTVA 3ECSA 1DQNA 3QYPA 4QXRA 4CXMA 4GWLA 5CG1A 4QNMA 1W93A 4WHMA 1IY2A 1R16A 2WIJA 3CZCA 4PLYA 2B8TA 2OGWA 3T15A 1TFRA 3VBCA 3FCYA 2FPRA 3GP3A 2UZ1A 4RVFA 2QTRA 2PRJA 4XIYA 3Q2OA 5JLAA 1DDGA 3SSMA 3D1JA 5K6TA 1DJMA 4UC0A 3NDIA 3RVSA 5I5GA 2FDRA 1EDBA 2AC4A 1XMXA 2UZ0A 1OBHA 1UK7A 3JS5A 3LU1A 4G89A 4NCHA 5JRJA 4GW3A 1F6DA 5AKKA 2A14A 3ELDA 2VP6A 3GAFA 3SF8B 1UPBA 4Y2GA 3K35A 2XQGA 1F51E 2C2HA 2P8JA 2ZWOA 5DGTA 1KI2A 2R8ZA 3A1CA 4XPZA 1PQWA 1TUGA 5K0CA 4TUYF 3V9PA 3HJTA 1ZHOA 3DFZA 4K3VA 1S2GA 1ZM2A 2ZRQA 1UAAA 2OMKA 4Y2VA 4Q93A 3ONNA 3T7KA 1KDVA 3NXKA 4BUJA 3I30X 4YT8A 5IT5A 2KSQA 4MA0A 2MT9A 3IT0A 5DXJA 1FBNA 4ER6A 1INLA 2W2QA 3VSAA 4BUZA 2A58A 2IHTA 2QZPA 4OJKA 5BV7A 2BEVA 4L76A 4PW0A 5TGTA 2WWYA 4DA4A 2PEYA 4J0DA 1I2ZA 1SCQA 1YQWA 2JGKA 4NBVA 4PVDA 4K0RA 4C4ZA 1LLUA 1VBFA 4WOKA 2VDWA 3L1KA 4B4DA 4CKCA 1WSBA 1P1HA 2CK3D 1V8BA 4K88A 1SC6A 1AHNA 2NSYA 3URMA 4HMQA 1R5NA 5EGNA 3G7UA 2YZ7A 2J5KA 4B4WA 3V4RA 1QX4A 5F1KA 1XALA 1Y63A 1GAEO 4KN6A 5A06A 1X86B 4GP7A 3UY4A 5JARA 3K0HA 3L5KA 4M1WA 1C7QA 1W6UA 3DKIA 3O4VA 3OFKA 2VQEB 2R00A 4NU8X 3SYRA 1CLUA 1KQPA 1POXA 5CVEA 3RV3A 3F74A 4CM9D 1OF1A 2WJ6A 5K3EA 2VT7A 2IS1A 2D06A 3PWKA 1II9A 2BHNA 3AR8A 2J0QA 3VR2A 1VHWA 3UYKA 3X1YA 4MYDA 1FNDA 5CVJA 3C4JA 3E7WA 2VR1A 5FQNA 1FX1A 4LNUA 4JT2A 3R5KA 2D13A 4RDCA 1QPZA 3L46A 4MLPA 5K3OA 4RSMA 4QU9A 1AUVA 1NVKA 4C2BA 4B7UA 3IBTA 3CF4A 4B6OA 3KPYA 1FL9A 2PRSA 5EA2A 2IYRA 2GX6A 3HCRA 4QYIB 2ZRMA 3E5RA 3DOEA 5EWMA 4MIOA 1H2FA 3WWZA 1RZRA 4C0SA 1FDUA 1J8MF 1NDUA 3PVZA 4EA7A 2FW8A 3O8LA 3JQ6A 3CURA 3LDUA 3M6XA 1CFJA 3NC0C 1W85B 3U4QA 5KSPA 1BAPA 1SOWA 1SQ6A 2I80A 3OIYA 1VPEA 1JTEA 1XROA 2QLLA 1KH3A 4MIYA 1WA5A 2AN1A 4S1PA 4FDUA 2JD1A 1US8A 3OZSA 1V1MB 2WMNB 5DYYA 5LSAA 3UAGA 4KITB 4Y6GB 1TLLA 3K8OE 4AM8A 1Q7TA 1LTHR 2CXUA 3CLRD 1W4RA 3SFTA 3HS3A 2P3LA 4HK4A 4MR9B 1PR1A 3GYGA 3UXYA 3WLHA 1ZH2A 3GLFA 3S1AB 5LA6A 3JZDA 3UQYS 2YV4A 4F5EA 1FYEA 3L84A 3O3NB 3L6EA 4UUAA 1AK9A 1QE5A 4YMIA 4WRRA 2AVDA 1PSDA 4MO9A 5K09A 1EVLA 2HLDA 3B6MA 3OFJA 4LY3A 2HQBA 5KTTA 2JH8A 2B35A 2R6R1 5KDLA 4O4HB 1KNXA 4D9KA 2HQOA 1QRDA 1EX9A 2AR7A 1Z9BA 1T6XA 2PRIA 2QBYB 1HSOA 3ILSA 3SWWA 1K98A 4AW9A 4PPYA 3LW7A 1W4ZA 2QTVA 5KB3A 4GLJA 5JYDA 1JBEA 3BJEA 3Q5DA 3ZWBA 1OJLA 5L4LA 4IG9A 1JEQA 1RWWA 1W4CA 2QR2A 1ESEA 1FNNA 3OZBA 5TEWA 3IJEB 4MW5A 2PBRA 3CX4A 3JTMA 1T1GA 4YTEA 4XWOA 3DC2A 2HZBA 3HKEB 1GQSA 1XHLA 4P4SA 1IEWA 2AOVA 2AKEA 5K6AA 4RA9A 2FZKA 2QMEA 3E82A 3NP9A 3PXDA 1EDDA 3P2KA 5MN5A 3MT8A 2DKFA 5GWXA 3ZNNA 1H2HA 2EZ4A 1XE3A 1CRPA 1LRLA 3DW1X 3DTYA 3ZLUA 5SZJA 2VBIA 2AXPA 3CVJA 1GFZA 2VJCA 2YJ4A 4M1ZA 4PQYA 3KQKA 4NYIQ 1P17A 2ZSDA 3BJZA 1EK2A 2FG5A 2XCQA 4RHFA 4J2TA 3T1HB 2YH2A 5CNMA 4MGEA 2DHEA 3ABQB 2WYVA 3FVVA 3TAXA 1U2DA 4TTRA 2WYWA 3PUHA 3OZVA 1H4QA 4LX0A 4QGBA 5F1PA 3R9KA 2ONZA 5FOXA 4BX3A 3VA7A 4EG0A 1Z6TA 1PFWA 3M6LA 3COSA 3D3WA 4MKHA 4L8VA 4OXXA 3OESA 2J67A 2UYQA 2VNJA 2VZEA 2WI8A 4TTSA 4I4NA 1DG9A 4YAFA 5ELMA 3AERA 4EPTA 4N40A 3MF4A 1XVAA 5FLYA 4HV4A 3GD5A 2JIDA 1EHIA 4NBNA 4QUAA 2H7YA 1Y82A 2ZRIA 3MELA 2W2VA 3WNBA 1XRLA 2X0KA 1U1FA 4FBMA 3EFEA 4DUGD 2OECA 3VTKA 5ICEA 5DI9A 1PAUA 3ORYA 1P9NA 3B82A 1MG5A 3FBGA 4IICA 4UM8B 1KZ7B 4XGNA 4MHSA 5F5NA 2BH2A 2NPIA 2BTQB 1QHNA 4UVHA 4G37A 1T9BA 3EDQA 2NYAA 1MIOB 4I1SA 3RVBA 2XQJA 3ZY6A 3CPSA 4A2WA 3UF0A 3DSRA 1O6FA 3L8FA 3FDZA 2JH9A 3H1BA 4JP1A 2FW9A 3WX0A 1XLVA 3MAJA 1LY1A 3TMAA 3AF5A 4WCFC 5LKAA 5IW8A 3WV5A 2KBFA 4ZAVA 2NACA 2X40A 3PE6A 2OPHA 2HSDA 4PCLA 4IDOA 3DOCA 4D80A 1SZJG 4RL4A 4AECA 1UOPA 2WQ7A 1XB2A 1CTQA 2YVLA 4LGCA 2IDZA 3T9FA 3K6JA 1SU8A 3GZ4A 4PZEA 4GVXA 3COZA 4O4HF 5CXXA 3Q7QA 3H2HA 4ZC8A 1E20A 2IWHA 1J90A 1JUDA 5H4HA 4YJ2A 2DHDA 1DXHA 4YRQA 2SBTA 4HUTA 1OA1A 2AYXA 2HA6A 2ZWPA 3SQNA 5ES4B 3QWHA 2V0CA 3LD9A 3CBGA 1IIRA 3EQ9A 1IM8A 3ORHA 1U2RA 3O38A 4UXJA 5DWVA 2GI4A 4YP7A 5HM6A 1SVSA 2H5LA 2PVSA 1IPHA 2VCEA 3T94A 5A9RA 1EQUA 2BBOA 2PKWA 1N7GA 3OMXA 3Q7SA 1I3CA 3KKQA 4PR3A 1DC5A 4NONA 2QW8A 2UVQA 1P33A 4RNCA 1MHTA 4IV0A 5BUCA 4AN4A 2XKKA 2H2DA 1R9GA 2QSZA 3G2JA 4KL8S 6CHYA 2WTUA 5DN9A 4S24A 4TWAA 1U4NA 3RIEA 3B9QA 2HRRA 1GKLA 4FT2A 4IIGA 3WLAA 4FJ1A 4WMLA 1VL5A 1G8JA 4PFJA 2WR8A 2WSBA 4UZEA 5B1HA 3V32A 4DMMA 2IIBA 1D1PA 1R18A 2GCGA 2X1MA 4NJEA 5YASA 3U1VA 1H0RA 1M2GA 4H6XA 4UPVA 2CVZA 3WRYC 4DMKA 1KMCA 1JAXA 2XSZD 2WWVD 1U3UA 1V43A 3AVWA 1EIZA 3R9XB 3B3JA 2WFZA 1Q83A 2WU4A 4YWJA 2YASA 2J7PA 3KUCA 4QJIA 1JLHA 2F3PA 1BN6A 3QPCA 4PC1A 2Q5CA 3C3PA 3AVPA 1KGSA 3O8BA 3GCDA 1WLSA 4HDQB 4Q7EA 3WTBA 5AVWA 4J0FA 5KQRA 5NULA 1RBYA 2MWMA 5EL0A 4AG5A 4D4KA 5HFNA 4UBJA 3KD2A 3OJWA 3QLUC 2RH9B 3AKDA 4IEIA 4QEDA 4RFSA 4ILKA 5BSHA 4KSYA 1DFHA 2A3NA 2WDZA 1ZJZA 3BH0A 4OM8A 3ZJVA 2KJQA 3UQZA 1U3CA 3GHYA 2QN1A 4QDJA 3HWWA 1CVLA 2PQ0A 3K4QA 1OCEA 5B1YA 2P9YA 3RSLA 1YNOA 3VR6H 3G9XA 2YY5A 3L7LA 3QFRA 4Q4DA 3GRUA 4ZQHA 5IAGA 3F3YA 4KO8A 2OCAA 1ZD5A 3M1YA 4NH0A 1Z39A 2Q6LA 1KEZA 3GAAA 1CDZA 4FDVA 5H81A 5I8PA 4OI1A 1AZLA 1Q16A 4TL8A 4Q5IA 4UOEA 4M89A 4LJYA 3K9WA 2E4UA 3KYIB 3UG6A 4AWXA 1R0BA 4LE0A 3GRCA 2DBVO 4EABA 4AY2A 3IPCA 4LJLA 4BNNA 4R1OA 1TA9A 2IUYA 1JVBA 2EIXA 3K9QO 4EGJA 1QGOA 1GYRA 3DS8A 4MDEA 1Z74A 3DV2A 4KQGA 3HB0A 1C9DB 2D1QA 2P4SA 1YBAA 4OK6A 5TRTA 5F23A 4BO7A 3V46A 1NA5A 4IDEA 3G0BA 4G0OA 2X8AA 4UQOA 1DHRA 3GJZA 3LAWA 4QJ4A 5BW5A 4MEBA 1YKSA 3PXXA 5AKEA 1YB7A 5IG2A 1AS0A 1L7EA 2P7IA 1RPAA 2OWDA 1VZ2A 3O92A 4YCBA 4CCYB 3HV0A 5LP6C 1DKPA 1NM5C 4HNTA 3JXEA 1Z5NA 3U9SA 2XUQA 3A2LA 2REOA 3CZ5A 5A7HA 1G4UR 1KY2A 3GJTA 4KREA 3KOWA 1I2BA 1LPSA 4Y18A 1E1RD 3QFHA 4JB8A 1TNDA 4RGYA 2C4KA 3CH5A 4YRTA 1FFBA 4C1NA 5LBIA 1VCNA 4BMXA 2IFTA 3UEOA 1J06A 1GL7A 4L5AA 4Q39A 4WL0A 4LQLA 2OFPA 4BXOB 1TYAE 1ZN7A 1A77A 1NMZA 4LV5B 1I3OA 2FPIB 3U62A 4E2WA 4KJZA 5I9LA 5J4YA 2ZT6A 4E08A 2JNWA 1FYDA 1FY2A 4X8HA 1VPDA 4PE5B 2C3UA 1UMCB 2QTZA 5D2CA 2AFRA 2OOKA 3EIHA 1F8UA 1WDMA 3Q41A 4KW7A 4L6AA 4MVJA 1Y81A 2IHKA 5LQKA 4D79A 1WETA 3HZHA 2G04A 1E79D 3DTTA 4HFMA 3IRVA 1SVUA 4Z0HO 2JFPA 3EC1A 2VA9A 1H2BA 3F6PA 1UDCA 4CFSA 1IATA 2VHJA 3EXFA 2X3FA 1JALA 5GMOA 5T57A 4AG3A 4E5VA 2WPDA 2YOHA 2ZPAA 4U2BA 1YUNA 3UJDA 3VC7A 5B6IA 2NIPA 5E4YA 4GKJB 3SZ3A 2OGSA 1ZK4A 2YNMD 2ZVDA 521PA 3K6KA 3S8MA 4HOYA 4X84A 4AUMA 2NU9B 2AB0A 3Q3CA 2DECA 1A9SA 4BNTA 1QVVA 1QE3A 3LY7A 4R01A 1JPUA 4J0QA 1FF9A 4W4TA 5A71A 2WSYB 3RC3A 3RT1A 4R8MA 4B7ZA 1SCDA 4EY6A 1OJ7A 3PB3A 4G4SO 5FA6A 3OPYB 3PTZA 3PFCA 3R24A 4ZT6A 5DEIA 4HH4A 4U39A 3DBOB 4NYIR 2YXDA 1B8UA 3H9GA 2OO7A 4A0SA 4BVLA 4BB9A 2IEBA 1DINA 4G23A 2O6LA 3KTAB 4AMUA 3KG2A 3DF7A 5LPNA 1UBMS 2GFHA 2QE7D 3H2YA 4D41A 1JVNA 2MJLA 3IP5A 3PNSA 3RHFA 3UAZA 2AFHA 5DYIA 4Z4CA 2IL1A 3QEOA 1RZ3A 3UUEA 1KSJA 4FWBA 3UM9A 4QU0A 4ZYTA 4EYSA 2E82A 3E6AA 4INJA 4WWHA 3B51X 1TU4A 1QONA 3FYUB 2QX6A 3G1WA 3KFXA 3MEQA 1YQEA 2OY0A 4X00A 2PMFA 2XAUA 1XVIA 3CLSC 4WJKB 2C7BA 4QUJA 3PDHA 3A3YA 3TJRA 3AETA 4R0NA 4MB0A 3SU8A 3N2NA 5DJ5A 4Z51A 5K3DA 2BP7A 5EIBC 4E70A 3CPJB 2COUA 3S8EA 2A88A 3CVUA 5KNBA 1DLJA 1OLOA 1BIFA 2DAPA 2HL6A 3MB8A 4Q4AA 4QWMA 4URFA 1CU1A 3E05A 2XVZA 3K9GA 3KZCA 2GAJA 2VXCA 3KYCB 4K1LA 4MQFA 4F4JA 4L9AA 1XYYA 4A6EA 2RBKA 1QR2A 4QQ8A 2QVZX 3I9NA 1ZGCA 3M5DA 4BN5A 4MK4A 1AMNA 3WJ2A 2JIZA 4BEBA 4HDKA 2O3JA 3JYPA 3KZKA 2CFOA 5B3JA 5BRNA 2QQ5A 3TBFA 2OPBA 4J1TA 5C7IO 1E1NA 4LQ4A 4N5DA 1CR0A 2I78A 1Y4AE 1J39A 1MQ8B 5JQWA 3OE7D 1EFRD 2NYVA 3AY0A 2ACKA 2CNKA 2IHNA 4RV9A 1JZTA 4XA8A 2X42A 3AP2A 1N33B 3OD1A 2EG9A 3A05A 4GYYA 3CYFA 4NJMA 4RHYA 1RWBA 5AVSA 1BE8A 3HSSA 1G8GA 1JAIA 1HYQA 1U3TA 2BGUA 1E98A 3REFA 4AJPA 2ZANA 3SXUA 3OURA 5HFJA 3TQHA 2LUOA 2XDAA 2PKEA 4EYKA 3IMEA 4QULA 5AXDA 4TLMB 4QARA 4G1FA 3CT4A 2PXCA 2RHCA 4NCJA 1GFIA 4V0MA 2P4EA 4FNGA 1TEZA 3JZAA 2HXYA 2JLCA 2V3WA 1BXZA 2JGDA 4GAEA 3RIYA 3UC5A 2J6IA 3E70C 3VH1A 4YJKA 5F3RA 1YQXA 1T8RA 3WYAA 2O1EA 3LBNA 4MUMA 4EVRA 1RDFA 2Q3HA 1WNTA 1ZNQO 1RRFA 1L7RA 3GCWA 4UTXA 1UINA 4LRSB 1MX9A 4AMZA 1MG0A 4DZRA 4DAEA 4D9JA 5B1EA 4HGZA 1NNLA 3JD0A 4PN3A 3K9BA 1SBTA 2X86A 1G3QA 2X8BA 1H66A 3BGIA 2C4UA 1FXWF 3C5VA 4QIHA 5CURA 4ZN6A 1UPFA 4HT3B 5JFTA 2AFVA 2ZYUX 3WFIA 4BASA 2AZTA 5BN3A 3JALA 1DDIA 1TYBE 5LQSA 2DWPA 5J23A 3WL4A 2BR5A 3NBYC 4EW6A 2HPAA 3CX7A 5ARCA 4F4DA 3CE6A 3SX4A 2QTWB 4HNGA 1E89A 4FT4A 4J7UA 2IZ5A 1X7WB 2ZDQA 4M0PA 2CLHB 3RUPA 2JLVA 3VNUA 1YQUA 4P86A 3BHMA 5CJJA 3B36A 1U8TA 2A9KA 4QT0A 4K9QA 4XCXA 3IEKA 1FYVA 3A9TA 3G3EA 3AJAA 3BWXA 2VT2A 4O02B 1X74A 2F62A 3I83A 3WLIA 4D6PA 2IUSA 1BCSA 2PXXA 3MWEB 3JQBC 4GLBA 1T3LA 4WESB 5EZYB 1E32A 2OZVA 3LY9A 5F73A 4BJHB 3SNHA 3A3PA 3EEQA 3PYMA 4QG3A 3EG9B 1XNGA 1VSTA 5KNLA 2DPLA 3SQXA 2BMAA 4L08A 3RHZA 5IDVA 3C8UA 2BM0A 4OAOA 1GRVA 2CMFA 1I1QB 1H22A 1IMOA 1YDMA 2AG8A 4H7PA 3TW4A 4LF6B 1UJBA 4J7XA 4KV9A 4QOGA 1C7IA 3UK0A 1IOVA 5HKKA 4P0PB 1T0UA 4DRXA 5DK6A 5JCXA 2J85A 4D9EA 2VPZA 2EHJA 3EWNA 4N0MA 1CBUA 4M8KA 4PGMA 1NPTO 4XE5A 2CXSA 4I4TA 3KQHA 3KZ1E 4GP9A 4KI7A 3IAAA 5HGJA 2Z30A 1ACMA 3N9IA 3K70C 1SXHA 5B4VA 3I6IA 3THWA 3LM8A 3A6PC 2WF9A 3GFVA 4R16A 5L3SB 3GLIA 4QREA 4RPIA 3SSAA 1R27A 3ZBTA 3ILHA 3C3DA 3ITNA 4NZ9A 1U7UA 5HKAA 1QRTA 1RW4A 2XMQA 3NHSA 4WXEA 4TVKA 5BSWA 1GN9A 1N2OA 1LPNA 1K66A 3ZW7A 2WNSA 3IQFA 3W5UA 4OLAA 1ZCJA 3L0PA 8GPBA 2R96A 3ZR4B 3L4EA 1DIGA 1THZA 2C4NA 1QGUA 4TWZA 3IAS6 1V8FA 3PR1A 1ULZA 1Y8QB 5IBRA 3WK5A 1QH9A 1TKCA 1XGKA 3FJOA 4HBZA 5HDBB 3TXYA 4F38A 5EIOA 1PSWA 4RMJA 3T35A 1WUHS 3S44A 1E3LA 1YH3A 4WFQA 1XXHA 1CJVC 2OG2A 3OECA 1Z12A 3HDJA 4DA8A 3FPJA 1J0EA 1R0SA 1Q1EA 2GM9A 2CLFB 4FZJA 2YC4C 5E2AA 4JSRA 4ARZB 1OR8A 3UKDA 1DLIA 3ZNQA 2X4LA 4RTOA 2BYTA 2C5GA 1RXSA 2CY0A 4UZSA 3DZGA 2HDHA 4ZCIA 1P2SA 1A8UA 5ULLA 1HE1C 4DDHA 2R2GA 1PEDA 3MN1A 2PUAA 1GKKA 3F78A 2I4IA 3RGGA 4B3CA 4Z9BA 1HR0B 2HMSA 4HNAA 5B55A 4OJNA 2PX5A 4BCBA 5DRYA 3OAAD 1HZZA 4OXRA 5LD2B 2QTFA 4FLMA 1YK1A 2ATVA 1R0WA 2LV8A 2D1SA 4KIJA 2RCNA 1FDIA 1Y3HA 3DTVA 1SB9A 3GLHA 4QX6A 1QHGA 5B1IA 4H16A 1ODFA 3PUKA 4AIRA 4RYDA 2PX4A 2VBCA 2AUNA 4OATA 1WXEA 4C3VA 3QXXA 3RK1A 5FUWA 4P0QB 1LK0A 1T4MA 1XX6A 1GFSA 2DY1A 4PHGA 1O6ZA 5AW6A 2OHOA 2WP0A 4CQMB 1JN0A 1KJWA 3AW9A 1NN3A 4GMFA 5L3RA 4DREA 4MV6A 4XRRA 3BD6A 5K0LA 4AU1A 5BXYA 5EZYF 3H0CA 1QJ4A 3GW8A 1L6RA 2FUKA 5JSUA 1H0SA 3SJCA 4CG3A 3MAAC 2RH5A 5I9IA 4H3HB 1GUFA 2YZ2A 2ZIEA 2YHSA 4X64B 2R1UA 5DV9A 3WO1A 1IN1A 5JS1A 4IPTA 1E4OA 1WXDA 1P8JA 2BDEA 2G63A 3DL7A 1KO5A 2J48A 4JJEA 3OPMA 4QGGA 2A0UA 2O06A 4CU2A 2O1WA 2XYQA 1GTZA 1JDSA 5ICFA 1YBHA 2PSDA 4CT4B 4V02A 3ANXA 2RH8A 3GFRA 2WABA 4TTQA 2B6NA 3F67A 3UJ9A 3I9V1 3WB1A 1J23A 3AEKA 3G17A 1WW2A 3OEHD 1CIPA 4CBVA 3K5PA 2WG2A 3VR4D 1N2CB 1GPWB 3HJGA 4FFRA 2GN9A 3A6KA 1A82A 1Z25A 3U19A 1M2WA 2ERYA 4YT2A 3WE7A 1BRMA 1D7OA 4QAJA 4L73A 2XE4A 3QHQA 2K6GA 4WKPA 4ETWA 1KI6B 1PK9A 2IYSA 3LFUA 4HYEA 3G13A 1PD0A 1M0WA 2ZOSA 3PNPA 4H2DA 4R9SA 1LI5A 2QA5A 3GVIA 5D3MB 2X9LA 4DVGA 2QW1A 4HWOA 3I9FA 4DY6A 5ITVA 4HB2A 2BC9A 4PZ9A 1OXBB 1ISJA 4ZI7B 3JQGB 4MJ3A 5DNVA 4IQ8A 1FYWA 2ZJZA 3H6HA 4ZT3A 2ZAIA 2X0JA 4NPAA 3SQOA 2Q49A 3RRNA 5AHOA 1SKYB 3P0RA 2CL7X 3V80A 4DWOA 4EYGA 5FWYA 1CUGA 2XE6A 3ONDA 4QOEA 4RTLA 4P5EA 5TJHA 1EFCA 2HRBA 1Z7WA 3M89A 1DKRA 3DV9A 1Q50A 1ZZGA 4CHGA 1AO3A 4PPFA 1ZOOA 2G28A 2BCJQ 3ZQ4A 3KVOA 3FW1A 2JKYA 2OGZA 4UEOA 3HM9A 1XYVA 4Z53A 2O2JA 3I45A 5D7BA 3NNDA 5DHUA 1ULSA 2Z5LA 3IULA 1J1ZA 1TF2A 2ZQYA 3D8BA 3R5TA 4TMXA 4ALJA 2FP4A 2QU8A 2PFSA 3ZKWA 1QRSA 2AKYA 1FVHA 2F48A 3MRVA 5J40A 5JJCA 1WPQA 3WTCA 2GYYA 2HHJA 2EXXA 3LY5A 4M0FA 2XMRA 2WLTA 3BB1A 3KPWA 4RK6A 4EHKA 1YC5A 4KDCA 3UUGA 1EX6A 3A1UA 4F9TA 1DQYA 1YDEA 2VPPA 3I6YA 1ZOLA 3ERCA 2E85A 4B35A 2BFNA 1Y98A 1RHMA 4KQ2A 3LYAA 5EJ9A 5HYVA 3AUYA 1RWMA 2OCBA 4FW8A 2AZDA 3OM1A 1Y6ZA 4ZAYA 3WMFA 4KWCA 3RTGA 4JELA 4FFPA 3WA6A 3F49S 3N59A 4IHKA 5BN5B 3TTTA 3HYNA 4C0AC 3K94A 1ZGJA 2PD4A 1MC5A 3ADPA 3BSWA 5T7BA 4EARA 2A9QA 5EIEA 1BN7A 1NBMA 3RS3A 3L8DA 2AEEA 3R5XA 4C7XA 5KYGA 1DC6A 3CLRC 2V55B 3LLMA 4DA6A 3FMVA 4W5WA 5HR5A 3D2CA 4IJVA 3SR4A 5JJBA 1E3MA 3MGKA 3ONEA 3TNYA 4KAJA 3EOZA 5JIBA 4KO3S 1DBRA 3K05A 4L8FA 2DPYA 4WY2A 2X2OA 5AR1A 2B6HA 2Z43A 3OM0A 3WGNA 3ZQ6A 1N2BA 2R9VA 3LUCA 4LYDA 3PV0A 3O73A 1YS6A 4K5QA 2XZPA 3QPUA 4IHQA 1VA5A 2QX9A 2H65A 1ZH8A 1M8JA 2GLTA 4M7OA 1G9XA 3V1MA 1U2SA 2HJGA 5JY1A 1OTXA 1T5OA 4QBIA 2JFQA 4JGGA 1S8FA 1U0JA 3AKCA 5CB4A 1RIIA 5KDOA 3QQPA 3MS2A 1QANA 1M2HA 3QM1A 1JBKA 2B3TA 4G07A 3M9WA 5JPDA 3RO7A 1V6AA 2Q6TA 5B7NA 1JQ5A 3HP7A 1IONA 3O31A 4ZDWA 5JI2E 1T3ZA 3BMQA 1FRZA 1P1CA 2ODWA 3KFVA 1B8VA 1OKKD 4L5JA 4ZI7F 1CF4A 2ZE5A 1M1UA 3ZUPA 3K92A 1COWA 3T3GA 3PUZA 1QZZA 4GEGA 1X38A 2CW5A 2VOJA 5AJUA 4ESVA 2PS0A 2WJHA 4LVNA 4NLLA 5AKXA 5CITA 5JDCA 4C08A 3ZV7A 5HF6A 3D7NA 3DR5A 4ZMBA 1KOLA 3L1IA 1CQIA 3H6GA 4U8HA 5GZ6A 3ZZNA 4JI1B 4AUKA 1P0QA 2R60A 1ICEA 1XLTC 4MR8A 1RYDA 2RK3A 1I4EB 4C03A 4K9LA 1QVZA 1N8TA 2XA2A 3RWMB 1TGVA 2WTXA 5MN4A 2V6IA 3Q40A 3T9CA 1SUPA 2DBYA 4J76A 1IJEA 1F14A 1NRWA 3UWDA 4GL2A 1FK8A 3LQYA 2PCLA 3IS3A 1A9QA 4H3KB 1W8IA 2XUGA 4N03A 4S2UA 1UKYA 4IXDA 3N7UA 3PF8A 5EIAA 1RWXA 3F8SA 3VFDA 5K05A 3EUAA 4FR2A 3WIDA 3PU6A 4LJRA 4Q6WA 1HFJA 1KETA 1M7GA 2GBLA 2O3UA 2BI4A 2OHJA 2R8YA 3I9JA 3L0IB 4LJKA 2GM5A 2ZDHA 3PEFA 3PSHA 4JWKA 3L8EA 4OHMA 4Y0NA 4KIGA 1J0AA 2G0TA 5D1NA 1ZHHA 3IEPA 3ZVLA 3P5SA 2M6LA 4G0ZA 2JEZA 3KTOA 4I55B 5FUMA 3L2OB 2CLOB 4ITRC 1NJ6A 1XT6A 2K87A 2WJJA 5TE9A 3CUTA 4U1RA 1QH8A 1SU7A 1RR6A 5LJLA 3R7BA 2F43B 3IEUA 1V3VA 3PIIA 3OQIA 4GNKA 2O8NA 3I6ZA 2IXAA 3LH5A 4PXAA 2V3CC 5LZ8A 3NHZA 1NBOA 4HN2A 4L4SA 3FVWA 3PFNA 2W0SA 4JUIA 1S8NA 4Z0PA 3IJ5A 2CXQA 2EX1A 4C43A 4BKUA 2MSCB 1XZQA 3FZYA 1XEWY 3NHWA 1CT9A 2P67A 1FP7A 1FP1D 1RAGA 3L05A 4PX2A 3FDJA 3V9AA 2XODA 3I0NA 5DTIA 4FMDB 3UAYA 3ZCRA 2BF4A 1JFVA 2RGUA 4HAZA 4YHBA 1E1CA 2AN9A 3H5RA 2CVOA 5CH3A 1NQWA 1QC5A 1T10A 2C88A 4O2BA 4Z7NB 1OA0A 1GGVA 4B83A 3LSYA 4BN0A 2P62A 2HF2A 4GMXA 1GNVA 2OEPA 4JP8A 2MSDB 3VR2D 4ZO6A 3BH6A 4BU1A 5JAHA 3IOEA 5B5SA 1AKRA 1N1EA 1K3UB 2H7XA 1PFQA 2BSQA 1ZVKA 4C14A 1CUSA 4BFZA 1MAWA 3SSNA 5CIYA 3ZD6A 3DZBA 1X94A 3KAPA 1QQ5A 2QTMA 4X1YA 4B3JA 5JNRA 2W2PA 3HYSA 2VNKA 2K7ZA 4KOAA 5LMCA 2W48A 1CUBA 2H1HA 3V97A 1NWCA 1XTUA 5BQFA 2IZ7A 4D9HA 2ZM5A 4KACA 3HDVA 2WIAA 3LC7O 2GXSA 1Y9AA 4TM7A 2R7LA 5DIFA 3MTBA 3HB9A 1IPFA 3DQZA 3JVDA 2WQZA 1LZLA 1RZRD 1L5QA 4LKRA 4TLAA 2EWMA 2BGIA 1MQAA 4ZRNA 3FROA 4NOKA 4GVLA 4MLZA 4F06A 4PICA 1QS0B 1SOVA 3ELYA 1PKXA 4Q1AA 1S2MA 1R8YA 1W6RA 1VPWA 4RPGA 1L7XA 3E7FA 1CR2A 1GADO 4IXNA 2Y1WA 1QBGA 2UVPB 3BN3A 3RYHB 1YUMA 1DJQA 2WHRA 2QN7A 3I9KA 3P2IA 5IABA 3FMPB 2YV1A 4W5OA 1KI1A 3WYFA 1RXCA 2LGJA 4E94A 3PVCA 4LDJA 2BD0A 2YHBA 3BWEA 1NAIA 4RLHA 3SD7A 4AZSA 2ZXEA 2Y27A 3A3OA 5HUHA 2NP6A 1JFFB 1D2NA 5L9AA 3PJEA 3NEPX 1XZNA 3GFTA 3JVIA 3VR1A 2HLDD 3L93A 3S1SA 5JMPA 4CCSA 2ZWIA 1YBFA 4V2IA 4ZD6A 1EEXB 3HNRA 3GFSA 4ZVOA 2GA8A 4PS1A 4X8OA 3UFBA 1SZCA 5H8WA 1OWPA 3NM5A 1M33A 4RJIA 1QWOA 5B2EA 1ZITA 4FFSA 4NFHA 1IZYA 4X1KA 3HL0A 5ALDA 3WLKX 2DR3A 2XT6A 4OV6B 4M9RA 3THOA 5JTUA 2NUAA 4L5BA 4O4LB 2HTEA 3F90A 5TQ0A 5U4XA 4F9GA 3SX0A 1ZUWA 3RQSA 1MVLA 3ZZ1A 4Q3AA 4E31A 1NLYA 1T2DA 3C24A 2HRCA 4RQUA 1K6EA 3EZ7A 4CTKA 1SCNE 1WQ4A 3LCJA 4AC9A 1C2TA 1RLOA 1Z7GA 4HVTA 4QOFA 1ZCAA 3E18A 4V38A 2NUPB 4NZYA 1M1ZA 1P29A 3FRJA 2QR3A 3PC6A 1WABA 3VH4A 3MG9A 2R1TB 4GL4A 5GAJA 1ZJ5A 2OBLA 4PYJA 1Z0DA 4FMDF 2WSSA 3IAHA 1DBPA 1IHPA 1Z0UA 3E8MA 3HU3A 3K2IA 4NMLA 5KYXB 2B20A 2ZS8A 3N8HA 4EUFA 1GZDA 3B6EA 3ZBQA 1Q0TA 1A8SA 2P6PA 3W1WA 2XMZA 3H3FA 5JDIC 1P2VA 3K4HA 4WZZA 1Q95A 3AL2A 5D5QA 1IVNA 2XUHA 3GQBA 3H5VA 4BV2A 1VLMA 4KTTE 1JEAA 3OTHA 4TTVA 1T15A 1OU4A 4PC6A 5ADHA 3ZNOA 5BUSA 4LJ9A 4JVNA 5JBNA 1QG6A 1RQNA 4FNOA 1YDFA 2J0SA 4D4LA 1QX3A 1RWVA 3IUJA 4PANA 2Y68A 3GLUA 1BE0A 2CHVA 3OU7A 5ALXA 4C9BA 2FRVA 4WCFB 1EA5A 3RFCA 3SKXA 2OXIA 1LEHA 3PA6A 2EGUA 2Q7XA 3PPYA 3IQDB 1H9AA 4M4SA 1LBIA 5H4GA 1JVSA 2VHCA 4EX6A 3GFBA 3OZWA 2EU8A 2QMUA 3HKBA 3JVUA 2ZSEA 1UC8A 3AWDA 1UMDA 2VH2A 5I3CA 1QF7A 4KNYA 4FQ7A 2ID9A 4L8WB 4LA4A 1EGMB 4NXMB 1S2IA 3PX3A 2VP3A 4O8CA 5EUBA 4EL0A 5KQPA 3JX9A 3MT9A 1J2EA 2AOUB 1O4VA 3CA8A 2HDOA 2J3QA 4FYJA 4IILA 4YMUA 1NOIA 3QXCA 5A4MS 2XYRA 5CFOA 2JLXA 1PV4A 4ZOEA 2YNMC 1M5UA 1MQ9A 4RACA 3UAXA 1HQKA 7MHTA 5CVUA 2AXQA 2IU4A 3EA0A 3REQB 4DDKA 4RK4A 3S8YA 3EGWA 3ZWXA 2M9MA 3DZIA 3C2QA 1OYWA 1C80A 3EVFA 2GD2A 4KVGA 5E3IA 4IO0A 4ZMSA 2VLIA 1WSWA 4NZOA 4FXOA 4J1NA 1DIRA 2GT1A 1K0UA 1W35A 3UK1A 3Q0IA 4KK4A 4NMMA 5ECDA 2JLSA 1RHRA 4MS1B 4B3HA 1U0FA 3OUUA 4LOJA 3WYBA 2A9PA 1N0WA 4P3OA 4RSRA 2Y2UA 1J9EA 3TD2A 1HC7A 2IEGA 1Z37A 4D96A 3GF4A 2UXBB 2CHFA 2ZB2A 3KD3A 4IIJB 5EUQB 3V6LA 3JYLA 5ALZA 5JCPA 2PMEA 1JJAA 1BH2A 3ZCPA 1XQVA 3ESAA 4DHEA 3UUWA 4OH7A 4O4LF 4AUEA 2GN2A 5FOSA 1P3Y1 5EESA 3KB1A 3U4GA 1GPAA 2VQSA 4RHEA 4F3RA 3ABIA 4JOQA 4WKOA 3D6AA 1DB3A 1E62A 4ZYYA 5HHTA 4KWEA 3IIIA 1PFUA 2D62A 1NXTA 2ZSKA 3HI6A 4OLJA 2HPHA 3AEQA 3OT4A 1JNXX 4DY4A 3A06A 4CVNA 2W7TA 3F5FA 5DOZA 5AHXA 3U7QB 2G72A 1OGYA 3AZQA 1NI3A 3NYRA 3MJ4A 4HAIA 1H23A 5EIHA 2V59A 4YRBA 2YMMA 3C7DB 4KXXA 4UFNA 3EOBI 4Z3OA 3SQMA 3VQTA 1GSAA 2H8GA 2ZRAA 3KT6A 4LXGA 1DOZA 1G8FA 1P73A 2J7PD 3CZ9A 1E1LA 1KYVA 4O33A 3ZWMA 4QD3A 3UHJA 1WTCA 4E5UA 4EENA 2ZUVA 1QQ6A 1KU6A 3DLAA 2CB0A 1KDOA 3FMIA 4GO1A 4J0KA 4KKXB 4BQQA 4FFLA 3Q6IA 4ML3A 3N8KA 5EJ6A 4YEDA 1FS6A 2O5VA 5IVIA 3RJ9A 5KSYA 3L0DA 1ZK2A 3P20A 5FBRB 4HFNA 4OGFA 3EZ2A 4Q37A 2Q07A 3UTDA 3N07A 2O8EA 2VDRB 2ZXUA 2AA3A 1RXIA 1NXWA 1W85A 3ETHA 3ESCA 5LP6B 2NU8B 1FBTA 3U26A 2RI6A 1A9PA 4JFAA 3I3SR 4F2GA 3SZLA 2WJIA 3TLKA 4FR0A 2V74B 4I14A 5DBHX 5FO0A 2VZ8A 1W52X 5K3CA 1J97A 1ND5A 4M0KA 1KI7A 2E89A 3PL5A 3C3CA 1PE0A 3CF0A 5ALUA 4E7PA 2AOXA 2B9EA 3G7SA 4PN7A 4DV1B 2PL5A 2PKQO 1FB5A 3QX9A 4MR9A 5EWJB 3VZQA 3S1AA 3SLGA 4A8HA 4B2LA 4URXR 1MTOA 2XCSB 3BXPA 3FRIA 2VAVA 5J5AA 1XVLA 3GJYA 2CKMA 2Y93A 3PHCA 2OKGA 1XWIA 4KIFA 3ELUA 1NGSA 4KMRA 4BKRA 3H5AA 3ZS9A 1CE8A 1N8SA 2FEXA 2BFBB 2PQMA 3AKYA 4FFMA 5SZHB 2LCQA 3UICA 5IXJA 2XYPA 1D1TA 3BICA 3NR2A 2QBYA 1NF2A 2JAUA 1BWRA 2DBQA 3YASA 3RU2A 1KMHA 1JNYA 4OB8A 1X7ZA 3C6ZA 3IBGA 1TUBB 4MDFA 1Z4LA 3SYNA 1HTBA 2Z0MA 3EXIB 1TU3A 4M98A 3U9TA 2PV7A 1RI4A 2BJVA 2ZUCA 4H7FA 3DYVA 4M1YA 3TZKA 3V2GA 2XNDA 2NZYA 1Z63A 1E92A 1QDEA 3B7GA 1O9HA 3G8BA 4UTPA 2PIDA 4WDRA 5HX7A 2GWRA 2ONKA 5HZKA 3AQIA 1ZVJA 3GNTA 3KEGA 3MMXA 1DFGA 3OZXA 2WKWA 1NSFA 2FMIA 5G1PA 3TOXA 5BMOA 5F51A 1R0XA 1KYIA 3GP8A 1IHDA 2J59A 3CHYA 4X7RA 2CL0X 2DR0A 2NTNA 1Y1TA 3LHSA 3MWDB 5D86A 1NVWQ 3WBJA 1MT0A 1PJRA 3EK2A 3K15A 5HIAA 4RO0A 1AB6A 3GNQA 4MTLA 3SS9X 1HXHA 1Z8NA 1E2FA 4XWKA 4R2JA 2QE6A 5K2OA 4MVJD 3ENNA 4X97A 4N0PA 5EJ2A 4JBGA 2FWMX 3ZWKA 1EGHA 4PAQA 3IPXA 4FMBB 5CLJA 3TSZA 4JXZA 4KN8A 2J4DA 5KSOA 3GNSA 1DTEA 2WMOB 4RVCA 1D2GA 5E8RA 2QRGA 1VLJA 4ND2A 1ZOIA 2Y4OA 4L3WA 4DOMA 1ULAA 2R62A 2XMBA 1GTVA 1LVHA 2KM1A 1O54A 2WPDD 3C1AA 4G1BA 4HH3C 1NN1A 4Q1DA 4IJ5A 3LPCA 5KS2A 2C7GA 4IGKA 5A9TA 2ZZKA 4DSTA 1V96A 2EAUA 3ELBA 1I14A 2R44A 4UASA 3CH6A 1LBEA 5CD1A 2NXEA 3AJDA 5BSRA 5BR4A 3AVYA 1DIAA 2FSVC 3FZEA 1TT5B 2YWXA 1JKXA 2VK4A 4BPRA 2EJVA 1NLUA 1RYYA 4UMFA 3RSFA 3B1FA 4AS3A 1RPZA 4QFDA 3HCOA 1NQAO 2B92A 4NYJQ 3SC6A 5LP6F 4R4JA 1F5SA 2OD7A 1U9ZA 2P75A 3QIAA 1N5DA 5HKOA 4QOJA 1C0IA 3FKQA 1YGYA 1VTKA 1HOXA 3BGDA 2BTQA 1NURA 3U5ZB 1SXIA 1PVOA 4ZT7A 2H3HA 3TEJA 1Z6PA 2X15A 3K0FB 4C4RA 2VTBA 1HYHA 2PSJA 2EFDB 4XGRA 2V7BA 4RF4A 3V4OA 3WYCA 4DM7A 1SVOA 2HN9A 2XZDA 4XZ3A 2LWIA 5T5QA 2Y3IA 2XD9A 1GG2A 4BX2A 4ECEA 1NI5A 3ZKAA 1WX1A 2GEVA 5JSFA 3M1LA 3OTIA 3VR3A 1SA0B 2YV5A 4KR9A 3CR8A 3KUDA 1M1XB 2IU6A 2V6FA 4BRWA 3PIDA 1E69A 4KE8A 4M3NA 1YZTA 4B3IA 4WT7A 3AG6A 2D2IA 5KNBD 2PMBA 1GYQA 1ZL0A 1DVRA 1GNQA 5AW3A 2XUAA 1DIOB 3AYZB 5K4GA 2YJ6A 1QKKA 4OP3A 4ZDJA 1TO6A 4U7TB 4XXHA 4Y9DA 4TZ6A 1R00A 3WFJA 2BJWA 5T4BA 3J81k 2JIZD 4NL4H 2F8SA 2WU3A 3KOYA 1RQLA 4WN3A 3ZI0A 1LSSA 4JNKA 4LTMA 1U8UA 4DCJA 5AVQA 1BU5A 1U7WA 2QENA 5CEEA 2RB4A 4KKVA 1Z0JA 2O14A 3WMWA 3ZGZA 3LLSA 4KLAA 1VLQA 4RF2A 2DYKA 3C3MA 3BGWA 3IUEA 3QFTA 2YOGA 2GILA 3RRMA 4EY4A 2YW9A 3JQCA 4G8JA 3WKDA 2DHRA 3MRTA 1NUHA 2CVHA 2IIVA 2GA9A 1GXSA 2G1UA 2Q29A 4QVGA 3MJTA 4BVEA 5A3JA 3WNQA 4LZNA 3TGWA 4AJOA 3ANYB 4Z9YA 4AMVA 2OD2A 4ZZ0A 4DJEC 5C1DA 4COOA 4RVNA 1EJ0A 1XEXA 3MBOA 1R9JA 3HDYA 3H1PA 5DB4A 1PVDA 2FQXA 2SCUB 4G4IA 2ZVJA 3FVQA 3KX2A 4ZTBA 3AINA 1GQQA 1VMDA 3KUKA 4IY1A 4XVHA 4YJGB 4CF7A 3ZOKA 4B82A 4UMVA 2C58A 4JVSB 4BAGA 2XUZA 4B0PA 3D5TA 1GPLA 2G9ZA 9ABPA 4LG1A 1JQ3A 2QMQA 1HF3A 2YHUA 3QV2A 3ABOB 4JLDA 4FI3C 4LI0A 5DGXA 1RE1A 1MR3F 2BMDA 4LHZA 2Q8QA 4XD7A 3IKMB 3ZY5A 1TCAA 4LXQA 1G66A 1MBZA 4M49A 5CM9C 3ETCA 1YCDA 5IVPA 1UXKA 1VIDA 3UZUA 1JHMA 2F2TA 2J8ZA 1F2DA 3UMFA 1Y3IA 1BMDA 3LQFA 3VM6A 1JDJA 4B6SA 2O05A 1ZNYA 5IMBA 4EB0A 4RK1A 4I46A 1CK4A 3TPFA 3LP8A 4A4DA 1NXOA 1YL7A 1LJLA 2O2IA 2P9CA 4FFOA 3OQMA 2L17A 3O4RA 3OE1A 1J8QA 4MKXA 3ZU5A 1PJ2A 1DJLA 2JW5A 1DBSA 4B4OA 1E2UA 1YAHA 4ZREA 1FX0B 5FB3A 2FF5A 1BVUA 1SHTX 2Q28A 2WEKA 3D6UA 1NYRA 3GR6A 4IOLA 3TVYA 1JWBB 2Q8PA 3CN7A 2FEMA 2ZYRA 4JZKA 4M9UA 4E1VA 2ZRHA 1QRAA 4MINA 4FFBB 2IYPA 4OB6A 4OHXA 4RHXA 4Q15A 4YHHB 2HMTA 3IAS1 2OQVA 1ZRNA 2BZ0A 3GH3A 4U6QA 4AJJA 4DMRA 3CQ9A 1GKIA 2DLDA 3AXSA 3QOWA 4KR0A 3RVOA 3DWIA 3JPYA 3LZDA 5HKKD 3UAWA 2Z4SA 2YWFA 5CFMA 4FCVA 1M0EA 3D4PA 4HGYA 2I4RA 2FPIA 3LLUA 1AOXA 5IC4A 1UAYA 2IK8A 5H9VA 1WF6A 3WMRA 1Z6AA 4CDRA 4LECA 4F6RB 4RIFA 2P9JA 3TKYA 3PDCA 1UMCA 3AEUB 3LX6A 3CO0S 3QEJA 2YRWA 3UGQA 2VPTA 1JDNA 1G7SA 5AW7A 2FPGB 3P9XA 4HDNA 3C15C 4PINA 4EHHA 5CDTA 3P9SA 1YRYE 4MPRA 1GDTA 1ONNA 1MA3A 1N92A 1A7KA 4JR0A 1QQTA 4OJTA 4P5DA 4RZQA 4G4SP 1SOMA 1YR6A 1P9WA 2PV0A 2PMWB 3LCVB 3SG0A 5K45A 4CWAA 1XQYA 3HLYA 3O0TA 2BZGA 1CVRA 1RVDA 1U7XA 1AGPA 3VHXB 2QMOA 2W6PA 3W2FA 3FLAA 1J1IA 1NI4B 4F4UA 2V65A 3B1KA 4U63A 2B4AA 2ZJ3A 1MXHA 3FF4A 2NU9A 4QHTA 1AZWA 2VAMA 2HRZA 3ER6A 4PZ0A 4RUKA 5GGYA 3L0SA 5TC4A 2PTGA 1XZPA 2A1UB 5D7NA 1SC3A 1S8AA 2KI5A 4LQDA 2RSLA 3ET5A 3T4PA 5CFQA 1N57A 2VS1A 2O7QA 3SR3A 1KKMA 1NLZA 3BH7A 4K86A 1QGAA 1GA4A 1QYXA 4IVNA 1H85A 1DPGA 2R5FA 1LWNA 4Z3KA 4HLDA 3WK4A 1X7XA 3ICWA 2QNBA 4HEA1 1FXWA 2FE1A 3K2BA 3HWSA 4AJKA 1OXXK 4DUYB 3ITDA 3S27A 1CNFA 3KTAA 4WCDA 1PNOA 1PJCA 2O3RA 4XJSA 2AC7A 1JP7A 5GV8A 1IN4A 3BFPA 3C7KA 3FN4A 3GRZA 3BQ9A 4GPBA 2WA2A 3DTVD 4UTVA 2BGGA 2F1KA 2JA2A 2HCTA 4PSVA 4WGFA 2JBAB 1QAOA 3VVLA 1YS1X 4MA4A 4BMNA 3ZVMA 5DTJA 4KQXA 4FHZA 3FYUA 4JH0A 4CMEA 5AXAA 1USIA 2JEYA 1L5KA 4KSCA 2A92A 3CUVA 1PZHA 3OKPA 3QF4A 4LE1A 4MRNA 2HHHB 2P7HA 5G1OA 2AD1A 1ZI6A 2WYIA 4I4CA 1N5KA 3U9LA 1ZVMA 5LQJA 4B46A 3USCS 1VPVA 5DNCA 1ISHA 2H1SA 3LDFA 4KQ9A 2UYOA 221PA 3IVRA 5AM3A 6GPBA 1JDTA 2ZRPA 4RFVA 1C1XA 2VPQA 3MPOA 1D07A 3E9EA 1NKTA 3EQ2A 4RZUA 4Y0VA 3LE8A 4GF5A 3UJCA 4Y6RA 3UXEA 2R8BA 1OIWA 1Y8ZA 3BXOA 1F4PA 1Y89A 1TKRA 4F5YA 2P1RA 5BN4B 1WCYA 1YR7A 1UFKA 3FF1A 3NKLA 2PMKA 4O5AA 3STHA 1KI4A 2QUBA 2C0QA 1O96B 5FWAA 4LXTA 2VH5R 5ED4A 2NSJA 3AIMA 1L4BA 2BGWA 4R8VA 3U4MA 3B60A 4GEKA 4ZTUB 5H9WA 3UJHA 3ADDA 1VMEA 3W77A 1ZGBA 4F86A 3KEFA 1PT9A 2V97A 2QG9A 1LW6E 2ANBA 4JA2A 1T9HA 4RZHA 1DHTA 1VB5A 3JWPA 3M9LA 3C87A 3NGLA 4OM7A 1S7CA 4YRLA 5F21A 1W29A 1YRLA 4IMIB 2E6UX 3F6RA 3SBOA 1BDBA 3CT6A 5AK4A 3OE5A 4C5BA 4QM7A 1Z83A 3LL7A 3I52A 2EFHB 3QX8A 2BFMA 1JIQA 2I7DA 3L49A 1FU7A 1MZVA 4V0QA 1PDOA 3MT0A 3GFQA 4TRRA 1S7GA 4PLFA 4FDAA 4YC7A 3SKYA 2HQSA 1VG8A 3PGMA 2YUIA 2HIHA 3ZHOA 3AFNA 5DI3A 1HE5A 1JHOA 5TPZD 4YXFA 2P41A 3OCXA 1FQWA 4R2LA 1C4OA 3TQQA 2R00C 1OILA 3P2EA 4BAUA 2QY9A 5I7WA 1LQTA 4XWAA 2Q1YA 2X9NA 4YQZA 2W6JA 1NY6A 2QTLA 3AEXA 4KFTA 1CZNA 1MC8A 2Q1WA 2ZYAA 3G88A 1H6CA 4ZQCB 2WY2D 3ZZMA 1PCXA 3STYA 2GZ2A 3OM9A 2DQ4A 2FUEA 2YX1A 2IYXA 4RFLA 3MINA 3DD1A 5IBQA 1XMSA 3PZRA 4AWBA 1C1DB 5A2QA 3GN1A 4UDOA 1FDVA 4IDPA 1Q92A 5L51A 4B3RB 2WF5A 1VRWA 3TZLA 1C5KA 4H17A 1MEJA 1ST3A 2V6BA 3ANSA 4ZQEA 3SJAA 4R84A 1FFAA 1MW8X 2ENWA 3NV7A 2B0JA 1SUEA 2A5JA 2HEGA 4PZAA 1V35A 5ALWA 2VF4X 4QO8A 1UFRA 1UQRA 2JS7A 4JFRA 4NMWA 5B3AA 4ENRA 3W5CA 4P31A 4OLHA 5DCYA 1GLNA 1NLMA 1P77A 4BMSA 3QY0A 3ONFA 3S81A 3KYJB 1QFSA 3IXMA 1VCMA 1E9EA 5BV1A 3BQMB 1HM5A 1H5UA 1KP3A 1Z88A 4I1VA 4EG4A 3HZOA 3ADKA 3FUXA 2QLBA 4Q9AA 1PIWA 4CM8B 2A4MA 5AW2A 1KI3A 2IEIA 5AK5A 1F20A 1BVRA 2AK2A 3UENA 3K5WA 3WGQA 2JKZA 3PC7A 4DZTA 1NBMD 1OGIA 3L7AA 2CFSA 1Z6ZA 4DA7A 1ETHA 1P6QA 2QV7A 2GK4A 1LDEA 2OR3A 3DVSX 4NBSA 1YSCA 1OIVA 3QGMA 4CGZA 1XMVA 2MTBA 2BCEA 3VHQA 1P31A 4PGFA 2YZKA 4NAHA 5CPBA 2M6SA 1E77A 4DQ0A 2QM7A 3P1JA 1EK0A 5AW1A 3ORFA 5B6PA 4U8GA 2Q7DA 1EFPA 5EKUA 1E8MA 4YUZA 1OREA 2HM7A 2BGMA 2LKCA 1JXMA 1KXJA 2ZS9A 4UM5A 2FU5C 3OP1A 1HT0A 2NQ8A 4GR5A 1JSRA 3SFZA 1V6SA 3ETLA 1SKUA 5L3SA 2ADOA 1IM5A 1F5NA 3EEBA 2GMWA 2UZ4A 1TPYA 4L27A 5AD1A 4BJ1A 4P34A 4RULA 1I2MA 1VOTA 3BGOS 3A4TA 2QRKA 5BT9A 4B3BA 4C87A 1BOFA 3FSGA 3OLXA 5KKCA 2DM6A 4AKEA 1JQAA 3AUKA 4CTOA 1WR8A 4EGAA 1YR8A 3AM4A 3O7WA 4DLUA 4NOMA 2ZTMA 3D3EA 3UMSA 5KQSA 1Y8QA 1J2UA 2EKZA 2XWQA 5EMHA 3BT7A 1JA9A 2HO5A 1HMPA 3AIOA 4C78A 1NJ2A 2BH9A 2D1TA 4Y6LA 2QRHA 2WYUA 5F33A 2OV8A 4MRPA 3D3NA 3RF7A 8AT1A 5K6AC 1Y5NA 1I7SB 1Y7TA 4GKVA 4DYHA 4BP9A 2LPMA 4GICA 3IQZA 2ZAMA 2VK1A 1COWD 1BGVA 3ABZA 5AH0A 5AKJA 2XECA 2E49A 1SIBE 2W8ZA 3OIUA 2QYHA 4HUQA 4MB2A 4A92A 1TYDE 2WOJA 2G83A 2OB1A 1M2JA 4MEJA 4P4UA 4MS4A 1DBVO 4ZT2A 3RVKA 5BOSB 1DUVG 2BFCB 3QSGA 2B83A 4JJ4A 2IU0A 2G9NA 2I2WA 3KSUA 1QOQB 2P65A 3DXFA 1U2DC 5GP1A 4LMPA 3EIWA 3RU7A 1I5OA 1X77A 4GPD1 3GYBA 1S1CA 1B43A 3V2IA 2WPNA 2REQA 1YZVA 5CLHA 1LLDA 5FFMA 3EC7A 1Z2AA 5FJIA 4PIMA 2HSWA 1LF5A 3FETA 2A7XA 1B42A 3OIGA 1EIWA 1W30A 2FW6A 3NNSA 1OXUA 1KHHA 1J33A 1XV5A 1RAIA 2Z1MA 4YLGA 3VU3A 4CQMA 4YPOA 2W2NA 4N5HX 3E3AA 3WKEA 1JIXA 1DCMA 4GBJA 4EI2A 3WGUA 2PD6A 1RQ2A 1VB3A 2FQ1A 4H08A 3RSCA 2NU7B 1YTUA 1I9GA 3WRVA 1XQXA 2VYNA 3DL0A 4BVHA 5I5EA 1FFSA 5HTKA 3SC2B 5ICMA 5KVVA 2QYSA 2AI2A 2YJGA 1BKYA 4X63A 3OHSX 4ZVTA 1J70A 4HPJB 3FUWA 4P38A 1YU9A 1MEOA 3I04A 4RS3A 3TOVA 4ZODA 3I5MA 1A9ZA 1N3BA 1QK3A 2ZI5A 3E9MA 1UIMA 3IMGA 4KN5A 1BDHA 3RIGA 3AOEA 4OK3A 3H4MA 3ZE1B 4AJIA 2VHQA 2ZROA 5KYWB 1TC2A 3FOEC 1XPOA 1AN9A 5EKTA 4DDTA 1JWAB 3JRWA 3L41A 4U9UA 5DK4A 5FIUA 1ESCA 5B3LA 5H7XA 1KZYC 1WZEA 2CBGA 2J09A 3ANMA 4D8VA 2CBZA 3GL9A 4OCZA 3DFMA 2QUAA 2HW8A 1PT5A 4BNDA 3FOAA 3QP9A 2ZBGA 1VP3A 3SGLA 3NS7A 3RKSA 4F4FA 4LZPA 1CUFA 2I62A 2IDKA 2H9IA 5BRAA 4XB6B 1A8HA 3PYLA 4C88A 1KI6A 1PGPA 3A1TA 5HRUA 5C8DA 5I48A 3DYIA 1UBJS 4QQFA 4F60A 5BORA 2KPOA 2ZE6A 4DNXA 1ZCZA 4HRYA 2I66A 3KJFA 1TMKA 5L7WA 5IT0A 2GPAA 5CA0A 1QPGA 4ECAA 1HDXA 2BR4A 4W6QA 4G41A 1VGQA 1P2FA 2OXTA 4IIEA 4DCPA 3ZJYA 3TVDA 3TSOA 4BE9A 4HVLA 4JEHA 2P6UA 1SXJE 5H5JA 3EVBA 3JQGA 1G21E 4C6SA 2VHXA 1M72A 4OL0A 2QXUA 4ZI7A 3OOJA 2G08A 1L7DA 1M6WA 2XNHA 4RE5A 4LHEA 3F3SA 2B4RO 1HA3A 2P1ZA 2FPKA 4AJHA 5I7OA 3IYLW 1SVLA 4UNSA 4FFWA 1U81A 3VZSA 1T9KA 2IOFA 3ZWCA 1JQKA 1J5XA 1MAVA 1TE2A 1UKCA 4L6IA 3GVCA 5I8WA 3DCJA 4BWYA 2CCJA 4S35A 3WK8A 4KLCA 5LLTA 1HLGA 1V8OA 3F73A 3VU8A 3THYA 4ISBA 2IZ0A 1JHYA 4RTSA 1IY9A 5AI5A 5G41A 3WB0A 3P71T 1IHOA 3SSOA 4R3WA 4BNZA 1R4AA 3QFSA 2OUKA 5THQA 5LU8A 5H3HA 2WWXA 4LXIA 3K5IA 3OMWA 4A0GA 3J80A 3MWJA 2INGX 2G5GX 3R0XA 4PZCA 3OTQA 3TXXA 4JI7B 3JQRA 4PPQA 4WXMA 2O2XA 4QPDA 1W0CA 2O0KA 4HAXA 2IEAA 5K0SA 1E3TA 2HOQA 4FYPA 4GPIB 2DUWA 2FK8A 2MYTA 2J3EA 3HCEA 2ZJ6A 1K63A 3RIMA 5BR7A 2KMLA 3X1ZA 1LUAA 1N6OA 3LKBA 3D2LA 3HZRA 2E9SA 2GN0A 1OI4A 4X41A 3Q8WA 4A91A 1XTPA 3EW7A 3O9VA 4G81A 5FTNA 4XUGB 2MMGA 1UBEA 4A8PA 5IHPA 3FUCA 1JIIA 3MD9A 1KPGA 2UAGA 3QQ5A 3U4CA 4B6JA 4G0UA 3W9YA 1TRHA 1KMMA 4I3FA 1Y9ZA 4CTNA 3NEYA 4TRNA 1GTSA 5GOTA 1PYDA 3E3OA 3EVAA 2NN3C 1EXMA 1PHRA 3ETJA 4UEKA 4WJLA 3QVUA 5BN1A 4DWVA 1E7QA 2E21A 2GYUA 3JD4A 3KCNA 4KC0A 2VTKA 4WW0A 2V9CA 3W79A 1AKQA 3FB1A 5ADVA 2HT6A 2YQ4A 3ZPXA 4BBJA 5T6MA 1PV1A 1P7CA 2NYUA 3K16A 2ZEJA 2CMKA 3CJRA 5GM1A 3G1TA 5CLLA 3VKUA 2WB2A 4BBPA 5HIKA 2P77A 4J0IA 2HK6A 4YMWA 2WSSD 3HY4A 1R6DA 4EEXA 2R97A 3IVAA 1SQGA 3S40A 3U31A 3I2GA 4WFJA 3TZCA 2X7HA 2ZR9A 4M8NE 4N0EA 1W1UA 4X66B 3U44B 4URVR 4ZPJA 1J00A 3NTXA 4RD1A 4P84A 4HR7A 2ZBRA 2W70A 2MSKA 4FQ5A 1Y5RA 4BCCA 1EG7A 5BVHB 4KQHA 4Y8VA 1L5MA 2VTDA 1N3LA 2E4AA 4ZCQA 3MJSA 1ML3A 2C8KA 2P3QA 4J0EA 1BGXT 4KRXA 4MUNA 1IBRA 4RD3A 2HH9A 5BYKA 3DP9A 5KMGA 3T7DA 3D59A 2MDTA 5EE5B 4ETNA 4RTPA 1QHXA 3L82B 3DOIA 4ND8B 4B40A 4CF3A 1EBUA 1ATZA 1LFDB 3MLEA 1XJQA 4ZC1A 4XQEA 5FBHA 1TQ8A 3B5EA 3D7SA 4YUXA 3CRZA 1CUXA 3H9BA 2J1LA 4B7CA 3HNPA 4L8GA 1TAHA 3BE8A 3KQSA 1UBUS 4ASUA 3KVYA 1G21B 2ZIVB 4GDMA 5ICSA 3NT2A 1KMQA 4IUDS 1SCUB 1KZ4A 4TV9B 1DL5A 3NHBA 5HE9A 4ZO9A 5HPYB 3SIRA 2ZRDA 4MW7A 3GLGE 1SD2A 1VDMA 2H5IA 3INGA 2ILVA 3AUJB 4MI9A 4YMHA 1YFLA 4YIHA 3IAM6 3H1GA 1U9IC 1KVUA 1PGQA 2GHQA 3ROEA 1W4LA 2SICE 1I7NA 2V9PA 3LNTA 1ZUHA 3I92A 1NYTA 2V54A 5I9SA 1XN1A 2PK3A 2OCIA 3BC1A 3WL5A 4AP9A 3D7RA 2B1QA 3G0OA 4X9XA 1E2BA 2YKGA 4OQYA 5CTAA 3V4VB 4H1WA 3HKDB 2XWBF 3DDSA 4GT1A 4I55A 2X8JB 1C3OB 1VHQA 4K8RB 1UMKA 2CJWB 4D57A 3HA2A 4DMGA 4U2FA 2QXTA 3AHHA 2EP8A 4TMTA 1YHZA 4OHPA 5FT9A 5KOHB 2EWWA 3GV0A 3HB1A 1WY5A 3O74A 1KY3A 2Z3WA 1T9AA 2BM1A 4TXHA 1IC6A 4TYNA 2WD8A 3H11B 5CNIA 4ZZ1A 1U9JA 1K3TA 3I37X 5IHXA 3OM8A 1S6YA 3HJUA 4BLRA 4U5QA 2REBA 3IKTA 3MWFA 2RIPA 3K73O 1CR1A 3ZIAA 2I4NA 4JKIA 2XW6A 1V3TA 4TVOA 3U56A 1U0NA 1QNLA 3FWYA 4G36A 2FMFA 1A4IA 4P81A 5CYFA 1ECLA 3B53X 4EQ6B 4XD2A 1VGVA 5J4HA 5K3FB 3TPZA 3OPQA 4PIPA 3S7ZA 4QTXA 1RU3A 1PFYA 3DM5A 2MYPA 5AW9A 5ITWA 5FUXA 3CF6R 1N6RA 5JAZA 1E5XA 1LTKA 2FPPA 2XA9A 3Q87B 1Y4DE 1Z68A 4YAIA 2QL9A 2PT9A 2G77B 2ZJOA 2DQZA 3OG9A 3GIWA 2YYZA 3G0GA 1W9MA 2G82A 3IJRA 3L3BA 4KQFA 1U28A 3QUBA 3C5EA 2JHFA 4FILA 3E2MA 5DLPA 1VKJA 1AMUA 4W8OA 3WRXC 1PEYA 1G60A 1GL6A 2E1PA 1H6DA 1WEKA 2QL7A 2NV0A 4I8XA 1XZLA 3T61A 4IGFA 2VJAA 2PN1A 4BUCA 3ENQA 5DBEX 4AY3A 5KYYA 2YN2A 1TLTA 3HN7A 3QLTA 2HEIA 1IULA 1M54A 2RHTA 4FKZA 1HE8B 4J1TC 5FL3A 4AJNA 1RXYA 4Q7QA 2QG4A 1I3NA 3IURA 4XSGA 3SNKA 1WDTA 1PWHA 1IN7A 1ONSA 5DASA 3PCRB 3FPFA 2C57A 4KDRA 4KX3A 1GN8A 2ENUA 3HJRA 3KXKA 3R1IA 5FLXA 2B4QA 4EW3A 1ZK0A 3F7TA 4NNPA 5C8YB 4P4TA 5K0FA 5JI3E 4KR3A 3WHIA 1PO7A 2YMPA 1TIBA 3FZGA 3MZ0A 5ALPA 1DV2A 2FMUA 4DV7B 4KO4S 4C2TA 3EQZA 2HA7A 1ESDA 5E6RA 5EKDA 4QKQA 2Q0XA 5BW4A 5AVUA 1FFEA 1HE3A 3KOXA 1YVPA 2OV3A 2RAPA 1S3GA 1WLYA 2FLVA 3AL0C 4TLEA 4OX9B 1J1UA 3H8JA 4UHFA 1BS2A 4V2UA 4R9VA 2F8LA 3EDMA 4TV9F 5G40A 1VHLA 3RYHA 1IEQA 3HPRA 3ZXXA 1OXKB 1MAHA 4A03A 5JFGA 1ZC4A 1AG9A 4ZIRA 3V1KA 1OH5A 4C29A 1XQ1A 3G2HA 3CVOA 4K6FA 4X92A 2RGBA 4B71A 4QHSA 1RABA 4TMZA 3UJ8A 2ZDGA 1U98A 1GQFA 1JFFA 3F2VA 3CB4A 2JFNA 4KXLA 5ALQA 1G1MA 2AZ4A 3QIVA 4GP6A 4WTOA 4OYRA 1KI9A 4P36A 2X1HA 3DFUA 4ENUA 3GLGB 2BFAA 1HEUA 2J31A 3UC9A 3SOPA 2QAIA 1A04A 2ZWAA 3OQNA 2IS4A 3W05A 2ZQZA 1JAYA 1ZONA 1AQ6A 3D3QA 5JC1A 3ZCSA 1TK9A 4AVYA 1KRXA 1B6TA 4DZZA 5JEDA 3I8OA 1U7DA 1E6KA 1YXMA 2AW5A 3P4YA 5ADWA 2BIFA 4FTWA 3E81A 4O4LA 2XMDA 3QMMA 5EMMA 4B1FA 4MPPA 4LI3X 3CEHA 1V47A 5LB2A 2ERCA 5BWCA 5FWNA 3RTDA 5IZCA 1BXKA 2XNDD 5E6UB 3WB2A 3NKFA 2E0IA 3QOFA 4P80A 3KWFA 3ULKA 3KQTA 3NVKI 5AHWA 5JWOA 1XPRA 5AP9A 2FSFA 2Q5FA 4UQPA 1XUOA 3IHLA 5AM0A 3O1HB 2CDNA 5FR1A 2PJUA 1KJNA 2JVIA 4LF4B 2XYGA 1M2VB 1RI5A 3FWNA 4XYGA 1FRVA 2GZ1A 3PUWA 4RKYA 1TF7A 3I73A 2JI6A 3LP5A 1CRZA 1OZAA 4WADA 2XT0A 4M7RA 4WK6A 4IMRA 5FLKA 5IJ9A 3TBKA 3HO8A 1UBCA 4JU8A 3A6LA 4MV8A 3K20A 1JSCA 4F85A 3AP1A 4EJ2A 4D26A 3HBFA 1E0AA 1HQDA 1L5YA 3H13A 3QSYA 3CWZA 1TJYA 4L1KA 4MB6A 4RSHA 3TZHA 2Z5FA 4EFNA 5EUMA 1T8PA 4JHXA 3SOZA 721PA 1K5PA 2CD9A 2RGGA 5C5IA 1QIMA 1NYLA 4BQNA 5E7MA 3K1AB 2MR5A 3CGWA 4Z49A 5BXQC 3PKIA 1XRQA 1QMPA 2PKRA 2GTPA 1Q19A 1T24A 2ZSHA 4FP9A 1A8QA 4GSYA 4N8DA 4ZHSA 5KCMA 4H7JA 2ZBDA 3O3CA 4IZ6A 3FTEA 5AI6A 5ELXA 4U4AA 3K09A 5E4FA 1VPTA 4DCUA 4DC9A 5J2TB 4B3TB 3RROA 3AHIA 5C8YF 2D0OB 2R47A 2OCPA 1NF9A 1PR4A 3PXGA 3M3DA 4YRDA 2W2OA 2JGFA 1UJNA 1U0HC 1V7ZA 3RFVA 3GUCA 1B1CA 4B34A 2RAFA 4RJ2A 3IBYA 4JY7A 1XFDA 2N75A 3GOQA 1CHNA 3OCWA 4R8KA 2BKAA 3HNOA 2FFRA 2CDRA 4DLAA 2H08A 4Q4HB 1B8PA 2FZCA 5A4KA 1NXSA 1IPEA 2QYOA 2A78A 3FNFA 2DUJA 1NVTA 4WKCA 1TB4A 2YQZA 3IQWA 1JSLA 1ZLYA 5AHKA 2J5QA 1U2TA 2RG7A 1X8JA 5AKIA 4BVGA 2IHUA 1K75A 5LC1A 4YAOA 3T5PA 1TUEA 3KJNA 1WCWA 3P9CA 4UCWA 2NO7A 4CQNA 3DGEC 5DW3A 2PL1A 3GRAA 1PYGA 1E5TA 2AEMA 5BQXA 5JNLA 1F8YA 4MS1A 3VR3D 4Q3BA 3FPKA 2B21A 1P7VA 4Z9FA 5BSKA 1XTZA 3U61B 2GWHA 2Y76A 4OFZA 2NXCA 3RJTA 5AT1A 5EI5A 4LMRA 4IIJA 3OWXA 2FB9A 1HZZC 1NT2A 2VF7A 3U6BA 2J07A 2PBLA 2PGDA 1P72A 4DLZA 4BEWA 3BE4A 2WUDA 1Y6JA 3NTQA 1QU2A 3TZ6A 3S2IA 4LBWA 1P2GA 4NCNA 1WVGA 3VNAA 2VT3A 2GCEA 4NEHB 4OFBA 3C8ZA 3CZQA 1ZN2A 3RHTA 2ZR0A 2TECE 4L4ZA 3PLNA 5IP5A 1TTQB 5AVYA 1PLJA 1U9YA 1UQTA 3HTXA 4YCJA 1R6BX 3QMVA 3QW4B 1NF8A 3TRHA 1R6TA 3V7YA 4L6CA 3U7QA 3HZZA 2DERA 3E9QA 3VKGA 5F5LA 3B3QA 3TNJA 1E6EA 1R74A 1RCTE 8ADHA 3TLXA 3NOOA 4MIKA 3CH4B 5JH7B 2QQEA 2YICA 3M6WA 4ZEOA 4RGVA 1A71A 1B8NA 3GEMA 3QPDA 4E1BA 1EJ2A 1Q6YA 1XZJA 2AS0A 3R7WB 4FZ5A 4AMGA 3BXEA 1XL1A 1DQZA 1SR8A 4LMAA 3SXJA 1E8NA 2VK2A 4PX9A 1OFUX 2OHHA 2Z8YA 4WERA 2IEZA 4RY2A 3MSXA 1ZXLA 2CEAA 4I2NA 4M7PA 1ZOPA 5A62A 3GIDA 3D0KA 3QE0A 2CWWA 4N4AA 3DH0A 1HDEA 4R1UA 1CUIA 4L95C 4S2EA 2O8CB 4NAVA 1CF9A 2Z9DA 3EBOA 2Q4BA 3B1JA 3C4QA 3MJRA 5JMOA 5J2TF 5KTMA 2NVBA 2L69A 3I2KA 4PLWA 1Q1BA 1AH2A 2B5OA 2NU8A 2FETA 2CSXA 1PZMA 3OIFA 5C35A 3V4FA 3NTUA 2LCFA 1JI3A 1HZJA 2ZT8A 1I01A 1L7PA 1ORHA 3WWPA 4DXAA 4URHA 1WVIA 4XD7D 4QJ3A 4GZMA 3HCWA 3LVBA 5CJPA 1JTVA 4D3DA 3KB2A 1P5HA 4IVRA 4CKBB 2VRCA 4PXYA 3S2UA 3LKZA 3S2SA 3LPMA 1WWKA 3SM3A 3ZYZA 1XD2B 3W8DA 3NWJA 3LBAA 1J0XO 1M9NA 2EQAA 2IA5A 3O3OB