1A98A

Xprtase from e. coli complexed with gmp
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
129
Chain Sequence
EKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLARELGIRHVDTVAIGDGEGFIVIDDLVDTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPISGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of free and complexed forms of Escherichia coli xanthine-guanine phosphoribosyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphoribosyltransferase
molecule keywords XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
total genus 35
structure length 129
sequence length 150
chains with identical sequence B
ec nomenclature ec 2.4.2.22: Xanthine phosphoribosyltransferase.
pdb deposition date 1998-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1a98A00
4WMLA 1CJBA 4RAQA 1R3UA 5IAOA 1IBSA 1XTUA 2XBUA 1Z7GA 4P82A 1O57A 4JLSA 2AEEA 1ECFA 4LYYA 5EUCA 1BD4A 1MZVA 4LZAA 3HVUA 5E38A 1UPFA 3GEPA 1UFRA 2JKYA 1ECGA 2E55A 5ESWA 1JLSA 1XZNA 1GRVA 2P1ZA 1ZN9A 1QB7A 4PAWA 1XTTA 1QK4A 4P80A 1JLRA 1QK5A 5BRNA 4RQAA 1QB8A 5KAMA 4QRIA 3DAHA 3ACBA 4LZOA 4M0KA 1STOA 4LZNA 1TC2A 1ZN8A 2H06A 2JKZA 3ACDA 1BZYA 5BQPA 4QYIA 4WN3A 3GGJA 1FSGA 1I0IA 2JI4A 4RQBA 5HKLA 1LH0A 1GPH1 4X44A 1G2PA 1A97A 4RHXA 1J7JA 2FXVA 3S5JA 1QK3A 1VSTA 4LYGA 4IJQA 3H83A 1VCHA 2HCRA 4RABA 4P86A 3DMPA 2EHJA 1G2QA 1HGXA 2YZKA 4S2UA 1ECJA 2DY0A 1I5EA 3N2LA 2WNSA 3KB8A 1YFZA 1P17A 1OROA 1Y0BA 3LRTA 5KAPA 1TC1A 1DBRA 3MJDA 1A3CA 2H07A 5BQOA 1W30A 2PS1A 4MB6A 4ZFNA 1P4AA 3G6WA 3DEZA 3QW4B 4KN6A 4RACA 1HMPA 1DQNA 3EFHA 1VDMA 1U9YA 1DKUA 4RADA 4PFQA 4JITA 1O5OA 1A4XA 4RHYA 1UPUA 2GEBA 3M3HA 1G9TA 3O7MA 2H08A 1QCDA 1OREA 5JSQA 2PRYA 1OPRA 1L1QA 2VFAA 1L1RA 4Z1OA 2JBHA 4F8EA 1DKRA 1BD3A 3ACCA 4RV4A 4RAOA 1A98A 1AO0A 2IGBA 1P19A 3MBIA 4M0UA 1D6NA 4OHCA 1I13A 1ZN7A 1NONA 5ESXA 4X45A 1ECCA 3LPNA 2C4KA 3OHPA 4FYMA 1A95A 1G9SA 1I0LA 1V9SA 4P3KA 5IPFA 5BSKA 1NULA 4P84A 4TWBA 5HIAA 1DQPA 1A96A 1P18A 4RHUA 2PRZA 1I14A 1U9ZA 5K51A 3NAGA 1PZMA 4QYIB 3GGCA 3OZFA 1WD5A 1XZ8A 3OZGA 1XTVA 4RHTA 4M0PA 4RANA 1QCCA 1ECBA 5JV5A 4P83A 4P81A
chains in the Genus database with same CATH superfamily
4M9CA 5F3DA 5K2MA 1S89A 1L5OA 4N48A 3OUUA 5CFLA 2BMEA 2C82A 2EIHA 4MARA 5KDLA 1L7VC 1UM9B 1UWLA 4WNYA 4ZT3A 4ZI7A 3LTEA 2X2EA 4DG5A 1H5QA 2DSNA 2PPVA 3CZ5A 5FUBA 1BDIA 3HY6A 4NNOA 1DC5A 2WU0A 1YQQA 5JAMA 3MW8A 3RGWS 2WWWA 1Y4AE 1IL0A 1Z8FA 1JFFA 5T4FA 3GDHA 2DR3A 2RJOA 2JFQA 2NAFA 1FRQA 1XZNA 4GGOA 5KYWB 1JG4A 4MIOA 4RYLA 5FLEX 5LU8A 1VLZA 1JFTA 2CUKA 4RFSA 2IHVA 3DB1A 3PTZA 3AILA 3NG1A 5DBEX 2QS9A 5FLXA 1DWOA 2Z1MA 1XHEA 2HQRA 4NESA 5G4KB 5HRUA 1F7VA 3NAMA 2ECFA 1XZQA 5LCXA 3WFIA 4F4JA 3DXFA 3ADBA 1DTSA 1J8VA 4BWVA 3COJA 2YIVX 3KZOA 1EYZA 1NMSA 2LR0A 3Q2IA 3NHZA 3A0RB 5GWXA 4CLXA 5A02A 5ARDA 5HW0A 1XMJA 1OGYA 1T4CA 4EAQA 3I0MA 1IN7A 4ZOLA 4LJ7A 1YIOA 4MIKA 5DE3A 3RU3A 5K0TA 1SN7A 1ZNQO 1ZMOA 3FNRA 2VQ3A 1L5FA 4WZAB 3WE7A 1HSZA 1KC1A 3NUGA 4RJJA 4YMIA 4ZYXA 5LFAA 5AOAA 1K5HA 2G0AA 2JI7A 5KNCA 2FMXA 1TQ4A 4J0FA 1QQTA 3ADPA 3PUZA 5TF0A 4A9AA 3FTFA 3JSAA 2HJVA 4UTOA 1I4LD 2AKEA 2G06A 1VSQA 4FKMA 5H16A 2FR8A 5FTMA 4OVKA 1FJHA 4BX9A 5AK0A 4GMDA 4WKBA 4ZQGA 2AE1A 4RADA 2O3RA 2F1KA 2QROA 3V1NA 1QIEA 5CAEA 2PZJA 1MENA 3Q5DA 4ZCIA 1EFVB 1EFTA 1XLWA 5DHUA 1ICIA 3RC8A 3MC1A 1K6MA 2VP4A 3O7MA 1CLEA 4RKRA 5L3QA 3FWZA 1JXOA 4EEXA 3GEDA 2X9NA 3W3ZB 4AYWA 4Z7QB 1CZRA 3UF0A 1J0BA 2LPMA 1ACJA 3IALA 3RIXA 1OZFA 4W5JA 1HPLA 1KI6B 1YCDA 3ZW7A 3T3OA 1CCWA 4TV9B 4DR1B 4OXNA 2O2DA 4NQZA 2AJBA 2KI5A 1WPRA 1AK2A 3JYPA 4QUHA 4ZVOA 4OJQA 4BMNA 2ZWAA 3AOEC 2GMWA 3I12A 2OZLB 3FE2A 4ZGBA 2XTMA 3L0ZA 4AULA 4GOXA 5H80A 5AM0A 4EMBA 4JY7A 3LIIA 3W9UA 4L3OA 2R6CA 1WAMA 3LGAA 1UXGA 4GLLA 3EF1A 1F9AA 1U6IA 2KYRA 1QV7A 4Q12A 4KMMA 3ZHSA 4EG0A 4M0CA 2PZEA 5HZHA 4TSKA 4BFUA 4ARIA 1N7JA 3O7WA 4N6NA 1OAAA 2GD0A 2CLLB 5DGCA 2N47A 1WY7A 5DGXA 4MUGA 3UMCA 4DR7B 1I24A 1XTVA 2Q4OA 3DEKA 1R0YA 4OP1A 1VJ1A 2JFNA 2OZVA 2RG1A 1P60A 3ANNA 3OKFA 3REFA 3S55A 1X77A 3AOGA 1UBFA 4KB5A 4LSWA 1G6HA 1WHTB 4H2DA 4JHLA 4GSLA 1H6CA 3HBFA 4LYYA 5A6VA 4C4YA 5BW8A 3AQ4A 1R5JA 5K3EA 1BD4A 3JPYA 5J43A 1Q21A 5LC1A 4LXIA 7ADHA 2VCHA 4MW9A 5I5EA 5ALHA 1CR4A 3HJNA 3CH6A 4J6FA 5D84A 4BKUA 1Q83A 4D9IA 3KZKA 1WG8A 1MQ8B 4KZPA 6AT1A 3IL2A 1AD2A 1XLVA 5JQGF 1EX1A 1H6DA 2EG5A 2R4TA 1WF3A 2QAGA 1GKKA 1HURA 1I3MA 1JZTA 1J2JA 1NVAA 3DKPA 3JD4A 4G85A 1Z4LA 4KSYA 3V8BA 3R7SA 3VX4A 4I19A 4EB6B 3BMCA 4HX2A 3LKDA 4JJZA 1MC8A 3R7NA 3LT0A 2V4ZA 3PGKA 3E1SA 2IVFA 3O2QB 4HGNA 1PKEA 2UYGA 2B98A 2XYPA 4JB3A 4GXNA 1UZAA 5EP3A 3TB6A 5I47A 4L2IA 2NV2B 3PHIA 1T2CA 3AFGA 3TE6A 3OCCA 4K9OA 1V6AA 2BM0A 1FDUA 1XALA 1JSRA 1IY8A 4MTCA 2F8TA 4R8RA 2BL4A 2ZT5A 3B78A 3I09A 4X93A 4CUKA 2AMYA 4OTZA 4NOLA 2FPPB 4OBBA 5KPDA 1KKUA 3HWWA 4J8PA 3FCOA 3UQYS 1BMQA 5JD6A 3P9SA 4LTDA 3ZZTA 4IG4A 1BRTA 4HQLA 4I8XA 1SBNE 1BCSA 1EX7A 4HPWA 2YKGA 4KVAA 5CP8A 4B17A 4M2LA 3ZVNA 2VDNB 3O5AA 4QECA 4RSRA 2AN4A 5DXJA 4CKWB 4OLAA 1M6VB 1KI6A 4OH7A 3OURA 3OAAD 2REQB 1ULSA 2KWIA 3R3ZA 5T8KC 3WGLA 4X8MA 2BJHA 3RREA 1E3DA 1VDMA 4R8SA 3I9MA 5EPUA 4BMPB 2IXEA 3FOZA 3CPJB 4YDRA 1QZXA 1Z4PX 3A3YA 4K87A 1KIAA 4GSKA 4PCVA 1G8SA 3DEYX 5KKAA 1HR0B 4D8WA 1OLXA 1DO2A 2IU6A 1QCDA 1R2QA 3E84A 1QVWA 1ISSA 1IUPA 1GTL1 2J33A 5JH7B 4FWBA 1SEPA 3F5QA 5I7OA 4R40A 2PKXA 2BFOA 4P31A 3P94A 4I3GA 4W8OA 3E5HA 4QFBA 3G59A 3GEIA 2I54A 3H1FA 4UJ3A 4WVLA 1KQGA 3L3BA 2EKBA 4NS4A 4LSGA 1UJ2A 2O7RA 5DN6D 3FZGA 4B3XA 1MIHA 1VLHA 3HGTA 3R7LA 5K6TA 3T7AA 2AUNA 2OHOA 4YJHB 2A9KA 3OZDA 4UQLA 4QFCA 1IMOA 2FDRA 4XTRA 4Y2VA 1KP3A 1A95A 2Q5CA 3UANA 3HSKA 1RHKA 4H31A 2BOVA 1U3GA 2HBYA 1IUNA 2X3YA 3SC3A 2RCYA 1GGNA 1OKKD 1A9ZA 2OVFA 4HXFB 4DEXA 1J0CA 1T4CB 2C07A 2I8CA 2R11A 1RRVA 3CX4A 3FN4A 1ZD1A 3HKDA 3OZXA 4KR0A 1DCTA 1PE0A 4OV6B 5E95A 1NJ5A 2Q49A 1P9NA 3WLOA 2YQZA 3TJZA 1ZM3A 3LYHA 5A7GA 3CZQA 3PKZA 4MI9A 3U4CA 4XYLA 1QCCA 2QG9A 4YAFA 2XIQA 2Z3ZA 2KW5A 4TYMA 4ZI5A 3EXFA 5TQVA 1T9GR 4LK3A 5IN5A 1E3QA 4O2AF 4QC2A 2IIQA 3IR6A 4QGFA 3VC2A 4Q9KA 1A9RA 1BWRA 4U6QA 2X58A 1SHLA 3DHWC 2HO5A 3FGZA 2R4QA 3H18A 5DYYA 5IDYA 5B2FA 2FQYA 3T52A 2QM0A 4NBTA 3AKYA 3QLVA 4KPFC 3L6EA 4EARA 2HTEA 4C9BA 1XJWA 1JDTA 2PWPA 1G18A 3AHIA 3FCYA 1NR1A 3MS4A 1ZK2A 2WU8A 3NEJA 1XRNA 3ORYA 1UJCA 4UXIA 5H5JA 4YMGA 1T1JA 2BIFA 3VR0A 1IEQA 1TA0A 3IAFA 3Q0EA 4BWYA 1K5GA 4LYEA 4BZPA 1FJ2A 3A1NA 3UB4A 1OC2A 4FHGA 4CN8A 1E2IA 3DLAA 1TUBB 4P4LA 1P9WA 4QL3A 4H4EA 5DLPA 3IKVA 4S3MA 3O38A 1JH9A 3FM9A 5FFMA 3D6VA 3K0AA 4C04A 1H66A 2OXRA 3NJ8A 3NXSA 3SQNA 3K5WA 4HNTA 5DH9A 5LSAA 4C7MA 5AJVB 2JI4A 4F91B 1NQUA 3IUYA 1KP9A 1NVDA 1KS9A 2GBLC 3U62A 3QV1A 2GCOA 1ZJYA 3GRUA 1M5UA 3LK7A 4ZQFA 4XIIA 4CKZA 1PD1A 3HV0A 2V7WA 1BXRB 1CJTC 2WNIA 3NHFA 2CXXA 2ORED 4IV8A 4AJJA 2ILTA 4B80A 5AR1A 1GOTA 2IYFA 3UN1A 1Y82A 1NRJB 3MTBA 1JXAA 1Y3DE 1DX9A 4IRXA 2JCVA 2DJ5A 1MN6A 1GNRA 3AR9A 2BGKA 4CMAA 1ABBA 3T3PB 4JVSB 3TNJA 3E9NA 4B09A 1SKYE 3TEFA 3OF5A 3KSAC 2GKOA 2VYND 3D0QA 3SF0A 1YDGA 1RLOA 2Y1KA 1WMDA 1YB1A 3NV9A 3QYPA 2JASA 2OD2A 4UZEA 3F4KA 4U9UA 2ONKA 4KXLA 2WDPA 1KMIY 3CLRC 3W5CA 3GG2A 2C2YA 2VJYA 3KQMA 1MNAA 3O83A 1WLYA 3TIVA 4BFSA 1P62B 4JLPA 2XGMA 3TIIA 1HX7A 1RVV1 1SVMA 3LKZA 4LY9A 3SDZA 3C4QA 1OXBB 3O4GA 4OL0A 3B1XA 4DTIA 3F98A 4QXQA 5LQCA 2CJFA 2Q6VA 2WPDA 2C9OA 1A5ZA 1W4LA 1VKRA 4PLVA 3E3LA 1HG0A 4FILA 4B2YA 3UGKA 1GLNA 2WFZA 2W0MA 4EW6A 2AG6A 1MQSA 2JAHA 2Z56A 3R9WA 1UQTA 1T9GS 2WMDA 4HGOA 3RI3A 2QQEA 3WHLA 1UJMA 4DOMA 5IJ9A 2ZKLA 3ZIUA 5D2CA 1L8QA 1HRKA 4PHTA 4HDMB 1Y42X 2FZKA 2OUKA 1TDJA 1O94A 2H4HA 4UVDA 3OJCA 5CURA 1RSZA 3UEOA 3F6PA 1Z82A 3HB5X 1ZJJA 2QXTA 3RRNA 3P27A 2YY7A 1KJQA 5IZCC 3A1SA 1ZBQA 1EUYA 1AC5A 2I7XA 3JD0A 3C3XA 4FFRA 4TWBA 3ZLTA 1S1MA 5EP1A 4HI0E 3AV3A 2G4VA 4OXYA 3Q3HA 2EERA 2XF8A 4UVIA 2GRJA 1Z5GA 3AESA 4DJDC 5FBWB 1B8VA 1MW9X 1XVVA 2WQ7A 3R3JA 3R7AA 3TSYA 3OPMA 1MT3A 2FFHA 3EH1A 2UYQA 2ZIWB 3FUCA 2B4KA 4LFCB 5I7VA 5JRDS 2B3TA 3UV7A 5CEEA 1A04A 4MYHA 2O3UA 4I14A 4UHBA 1E6KA 3TTWA 4GKKB 5K0BA 4PG6A 3BF7A 4R81A 3CLUD 3JATA 2NYVA 3IEUA 1QIGA 1Q0TA 3CVUA 3IEMA 3RCBA 4XSHA 2QUIA 1P6QA 4LZAA 2X76A 2QQGA 5HJEA 4UBKA 1GV0A 1MFZA 1OBHA 2J9RA 1E32A 2Z43A 4OXKA 5CGZA 4N47A 3W2HA 3I1IA 2G40A 4L9AA 4B3HA 2W2QA 2XTAA 3BH0A 3GA7A 3OZAA 4F21A 4X3OA 4F9GA 1NPYA 3UWDA 3MMNA 2A1UB 4HY3A 1BVUA 3HRHA 1SC9A 5FUXA 3FOCA 3P19A 2VZ8A 1LNZA 3N2EA 4Q7MB 4AKTA 3QG5A 5K3BA 5TVGA 4RQAA 1V5FA 4G9EA 3B8EA 2O0LA 1K6IA 5DCUA 5CR9A 1AZWA 2I4LA 1O2DA 4X1KA 1JTFA 4B3DA 2WSIA 4B34A 1KP2A 4NF2A 3TSOA 1LI4A 2BBSA 3GWGA 3UXMA 4MAFA 5JR3A 3U60B 4MQFB 4KMRA 3JAWB 1YQEA 5KYKA 1PS8A 2R60A 3G5MA 4NY1A 5EJIA 3H2BA 4ARUA 1E8DA 5FOQA 3OQNA 4JBGA 5KNLA 2D5LA 1TAGA 3HBMA 3I9V6 1PWHA 2P65A 2H59A 4BQRA 4BP9A 4TTTS 3FNBA 2UU9B 4AZWA 1Z5NA 2ZE8A 3PD7A 4H17A 3T1YB 4HH3C 4E12A 4CEIA 1DKQA 2PCJA 1Y1LA 4ATNA 1Z26A 2CSUA 2OFOA 1PLJA 4BEWA 3UMBA 4C0LA 3FUVA 1MO2A 2BDTA 4ZQCB 5CCEA 2UVPA 3U80A 3EUAA 4DC0A 4H0FA 4F3TA 3DBIA 4YRBA 1OD6A 5J4HA 3EF0A 3PB3A 1NJ2A 1JV2B 4QDJA 4DV4B 2XY4A 3KYDB 5IJ0B 1BQEA 2HU5A 2PGAA 4HJXA 4MWZA 5AKJA 3ZC3A 2AG8A 3QVKA 4GHWA 2R6FA 1BE0A 4HNUA 1MXFA 1X7HA 1V2GA 2JFUA 3E35A 3LSYA 3SQDA 2VAXA 2WSSD 4EHLA 1R6XA 2CNLA 3G2LA 2IXBA 1GPUA 4GFDA 4RPKA 1KKLA 3ETHA 8OHMA 3PFHA 5D6OA 5LP6A 2P9ZA 4IHJF 5FO1A 5FQNA 4X94A 3W7BA 1HEYA 2IE0A 3LG2A 2YHIB 4GR4A 1WMEA 2FF7A 3LUAA 3DL2A 1J07A 1NBEA 1W1WA 4MICA 4J7AA 3SFZA 2OK7A 1QG4A 4ONEA 2Y1CA 4MP3A 5CHEA 2VBCA 1ZH6A 3FOWA 3WGJA 1L7RA 4HDQB 2VTVA 3WWCA 1T1GA 1T35A 5JATA 5EJEA 2RARA 1BKSB 5JZVA 4HRYA 4C20A 4UMEA 3CKYA 3WL5A 1MDBA 3HUEA 2KJQA 2IC5A 4PQRA 5ILOA 4J7UA 4LDZA 1V96A 4B6OA 3WISA 3GFSA 1VKOA 2XLCA 5DDIP 4TUYA 3W6UA 3C6BA 5KKNB 1NXSA 2YHBA 4DLWA 5IBCA 4WOJA 4MHTA 4HMOA 1X70A 5LZ5A 4A6PA 1RIIA 4ZJYA 2ZSAA 4RPGA 4LWQA 1N2CB 3L6BA 4F7DA 3EY9A 5KJ1A 3ETJA 3IEIA 3H7AA 5IU6A 2MSDB 2SCUA 3D0RA 4R8MA 2RSLA 1E9EA 4WGGA 1M2HA 2BSQA 2O7VA 1E8NA 2PZGA 3C24A 5FTKA 3KQPA 4ITVA 4R9UC 1FLAA 1EWQA 3NT4A 4F3RA 2BF4A 2QBYA 2AEEA 4U2BA 1AMUA 3HB4X 2Q62A 4D0RA 1JDZA 2R68A 3KNZA 5LNK1 2FRDA 5LOVF 1PDWA 5CFNA 3OFKA 5CD1A 1OB5A 3AUUA 2W11A 4MITA 3SFVA 3WGHA 1RRGA 4HWKA 4U7FA 3VDXA 3G0DA 1JTVA 3RADC 4MS3B 2NVBA 4O4HA 4Q21A 2VT2A 2P41A 1BE1A 3B52X 3PJDA 4ZYTA 3S7ZA 4REOA 4P80A 3S6JA 3L1HA 2O9JA 5ANRB 3TLYA 4RESA 1KJWA 4N18A 1Q2XA 2H2GA 1DWUA 4D43A 5JWRA 1UKAA 3R5JA 1AKUA 2A8YA 2JGLA 2PX0A 2VAVA 3L40A 3L9XA 2J3JA 4TTSA 1QG2A 1ZIPA 4ENTA 3ZOKA 4ZEOA 5JCJD 1XD9A 4A23A 5BQPA 3ZXXA 1N1DA 4RBNA 5DULA 5C34B 1YA6A 4YT5A 3BVPA 3M89A 4AKSA 3IIIA 6REQA 3UTCA 5IRCD 1UDAA 4L6CA 2G7MC 2FOIA 1AGYA 2DTDA 2POCA 1W5EA 4NBNA 3AVPA 5CBPB 3T9DA 3L2OB 5CVTA 2QTFA 1KI4A 3P2MA 4QOHA 5KNDH 2WIFA 3F73A 5B1YA 2DKOA 2BN4A 4JVNA 5A5FA 2TYSB 2ZSHA 4AZVA 3ITNA 1D2NA 2QXYA 1G8PA 4OHFA 4KRYA 5IVIA 4YJ2A 3M4XA 4PFKA 4FCTA 4EHHA 3JTEA 2X5NA 4TT3A 4F6RA 4EG3A 5KWVA 4PQYA 5FUYA 3E9YA 1CIVA 1L4GA 4EY8A 4RTRA 3KLPX 2Q6OA 4N01A 4YJ2B 4CUZA 2FUNB 4KXNA 2R66A 5BUCA 5IC4A 3I8OA 2E4VA 2XQFA 3GLRA 4H7EA 3QVUA 1U9YA 2WHQA 3HXMA 4RK0A 4PO3X 5DPMA 3OOEA 4H35A 3Q3EA 3EVCA 5AW2A 2BGUA 3D1JA 3IBGA 3CLSD 4PGGA 2WUEA 4BRZA 2PGDA 1EUCB 2WC1A 2ZJ7A 5J58A 1KXJA 2RH5A 5CM8B 4CCYA 4B3RB 2CLHB 3RO7A 1PFKA 2FPLA 2DU8A 3IP6A 3GJQA 1MG5A 3GH1A 2J3MA 4NNJA 5FT9A 1QPBA 2OLEA 5DBGA 4MPJA 1MAUA 4D5GA 1SUAA 5FDFA 1U4NA 3WKCA 4BPBA 4GZ5A 2VLIA 5C7OO 5LZ8A 2X86A 3MWLA 3CWZA 2H1WA 3PL1A 3QKWA 4MWOA 5DCLA 4P3YA 4E32A 2JIPA 1O6GA 3EG9A 1UKBA 1NT2A 3FCSB 1ECCA 1RHUA 2ATVA 4G2TA 3PC6A 2P4UA 1G9SA 1X1QA 3V2GA 1NXOA 3IDSA 3MGAA 3ESBA 4I55A 3K0EA 2W6JA 4UHCA 3SOPA 1HETA 2POQX 4GPBA 4LBYA 3RAJA 4I4LA 3W3AD 4DMFA 1ZVMA 3QMWA 5DI3A 2YOFA 3VR3A 2RHJA 4HL6A 1OWNA 1MRNA 2NZVG 4KXYA 5WRFA 1EGQA 1Y3BE 1C3LA 4C0SA 4IGAA 4EBFA 1P1FA 1RTTA 2OC4A 3ST7A 3WSWA 1Z29A 2I2XB 1YVEI 2K2WA 3LHSA 1V26A 4PPGA 1L7NA 2PXXA 4WFQA 1KE2A 2OB2A 1HFJA 2YDYA 4I1VA 4O4IA 3W9SA 5KSWB 3TTSA 1GTZA 1U2QA 1JEEA 1FFAA 2ID4A 2W6IA 1N2CA 4RL6A 2IYNA 2QRLA 2UVQA 3WNZA 2C84A 4G5SA 1D7OA 1HE5A 5JSYA 3U4GA 1NVUQ 6ABPA 2Z83A 1RFLA 2QOEA 2BEKA 5FEMA 3C87A 3I9FA 1E7RA 1NN3A 2JW5A 5J9FA 1U7OA 3LUBA 4JQCA 3WRYC 2R6AA 2NXNA 3S70A 2OEPA 1GNTA 3RFXA 3RS9A 2G72A 2QLTA 4MW2A 1W7AA 5L4LA 2ZJ1A 1T4BA 3MYRA 1G3QA 3T7JA 1G60A 3SLGA 4NLLA 1WHTA 2IV7A 1XE3A 3FLBA 3MTIA 4UVHA 1Q77A 3ENWA 5KQLA 2R2AA 4KWIA 4PTYA 4UKDA 3ZDAA 3M6UA 5REQA 3ITDA 4CM6A 3A1DA 2WA1A 5B30A 5FA6A 1PT6A 2Q1TA 1UT6A 4UBNA 2A6PA 4PXAA 3EPLA 3IEVA 2C78A 2XQKA 1PWZA 2PPLA 2V6JA 3IERA 2G1PA 2AJ8A 1FTWA 4XRGA 2V3VA 5TF4A 1ZAKA 4AWXA 2B36A 1Z5OA 1AKWA 5JSFA 1LI7A 2VUTA 3UJ7A 2IUYA 3I4LA 5FBZA 3K3PA 4G0XA 4LVUA 1GITA 1VSTA 2ZZMA 1USKA 3FJ1A 4RABA 4HD8A 2RI6A 2E1RA 2WIAA 3BEOA 4KITB 4J2OA 2HNAA 4TYPA 3TOCA 2JF0A 2VN8A 4OQ4A 3C5CA 2VUSA 4HB3A 4K6CA 4TTJA 4OSOA 2RC5A 2BMJA 3AB8A 3GWZA 1U99A 1GSHA 3MTGA 3OLZA 3P9PA 3R9XB 2YTZA 2X8JA 1DBRA 2JKVA 1XJ0A 1QYCA 4N5MA 1ORIA 2YN4A 4H3KB 5K0ZA 2HMTA 1M1NA 1NLZA 2X22A 2YY5A 3JQFA 3M7IA 2OK8A 4LS3A 4UE3S 1MUUA 5DCWA 4DGQA 3P45A 3CNLA 3D5QA 1SBTA 5AUQA 4EKYA 4OKNA 5KNCD 1KMQA 4J2HA 5JWHA 2CB0A 3G8YA 1X7YB 1XAHA 3I6IA 1PEYA 3JW8A 3QUBA 5L95A 2OAGA 3A05A 4QQNA 4PWYA 1YS4A 2EU8A 3HCCA 3ANLA 1QAMA 2V1UA 3C85A 3E1GA 1CNFA 2R62A 3L41A 3LY9A 2EJBA 4NAVA 4Z3DA 4BQFA 3P0FA 1E94E 3M6AA 1TZKA 3LW8A 3CLKA 1BHSA 1TZMA 1J0EA 1VC2A 3D0KA 3IEPA 5LYYA 4D97A 4DJ5X 1WUJS 2FWIA 2GCGA 3V4ZA 1B2LA 1K9SA 2I80A 4PLGA 3UAWA 4B46A 3LT1A 2O52A 2WHXA 2O0HA 4C2UA 4J29A 3ZWWA 1X74A 1DHRA 1VSVA 3DP9A 4GXTA 4UE2A 1LDBA 2QX4A 4G97A 2JGNA 4E5KA 1QF9A 1KOLA 4FT2A 2CE2X 1E89A 3HLKA 3DQPA 4KCGA 3PVZA 1FNMA 4UC0A 5ADWA 3GZNA 1XRQA 5IPFA 4RETA 4PZ9A 3IDZA 5KTPA 3DLIA 1K4KA 4ZVPA 1MHTA 2HMUA 4DPLA 4WXRA 2GK4A 2XMZA 1XA3A 1PZMA 4GDFA 1RXYA 5FBKA 4BFZA 3Q5EA 2EKLA 4TS1A 2DH5A 3CRNA 1FDRA 1OBFO 1M6NA 4G3XA 4LC1A 2BSXA 3ED5A 1ZQ9A 1XZGA 1BX1A 4DKXA 1HL7A 2YXBA 4GYYA 4DL9A 4GEGA 5CDGA 5EJ5A 1N0HA 2HLPA 3NV7A 4REQA 3QU9A 1MC5A 2XDAA 3AESB 4H1WA 1E59A 2PLFA 2VK2A 3HKBA 4ZGWA 2WAOA 4FOPA 2G3YA 4DREA 2FTKE 3E58A 3JWGA 1J1IA 1YBMA 3W78A 5I9NA 3KOWA 3LWNA 3O3CA 3B5EA 3FETA 5AI0A 5FOVA 5H7XA 1RJDA 3INRA 5B53A 3WJAA 1C29B 1C8VB 4WFKA 1YCHA 4PWZA 3SS8A 1I94B 1FMTA 1RXCA 1YQUA 4F60A 4PYKA 4JZKA 4UNPA 2ZUVA 3AEKB 4BLUA 1F2TB 2ZE7A 4OQXA 1QGAA 1DUVG 2I0FA 2I29A 1LPBB 3ADDA 4QOJA 3OEYA 3IVGA 3DCYA 1FU7A 1F1BA 4RVSA 3NKFA 5FJIA 5BVHB 1L7QA 1P5FA 2BFFB 1N3BA 1BFKA 2DWUA 3DKKA 4B7AA 1O97D 3R0ZA 1SQFA 3B1YA 3A9VA 3BKWA 1TQ8A 3GV0A 5C8DA 3JQPA 4HFMA 3V1KA 3WA7A 3QPBA 2RE8A 1CYDA 1CR6A 2WUDA 2Q3CA 5A05A 5LWHA 5E2BA 2RKWA 3R4CA 3BJMA 3UWSA 1U9IA 3PPVA 1OH8A 1E64A 1Q15A 2FR1A 2GZDA 4HAWA 4FHEA 1KNQA 4B4UA 1PQWA 2FFAA 5TMEA 1C8LA 1XU4A 1WABA 3G82C 1KJJA 4LJKA 4HZGA 1SIOA 1PN3A 1WP9A 2VXBA 3FZEA 2ZAGA 3KT8A 4QFMA 2D1QA 4YRRA 3H9QA 4E5NA 3JQAD 4OO3A 2J46A 2RG7A 3VZRA 1SKUA 4EQ6A 5GINE 2C29D 3FHTA 1OXVA 2ZEJA 2B9VA 4EJ6A 5H83A 4BIMA 3QOFA 3FYDA 3EIOA 4D8TA 3IIKA 3CRZA 5EIWA 1KZGB 2EDCA 4BLWA 5A4FS 4J4BA 2R84A 4QEKA 2CL0X 4PFQA 3TW0A 2VEOA 4Q16A 1AQ6A 3R7DA 4PYNA 2FQ1A 2EKPA 3KZMA 1E4EB 2GZSA 2HLNA 4QGGA 4EJMA 4JXZA 4MWTA 2VJLA 5C37A 3MJEA 4H6PA 3QUAA 4QBIA 3A9TA 5JDIC 1L7MA 1B1CA 2B7BA 4JKOA 5ITZB 3K8YA 4UVGA 2GILA 4YRJA 4U2FA 2VTEA 3I9KA 3AF6A 4DANA 2HB6A 1PJ4A 2A1TS 5JZ9A 4U02A 4M54A 5B4UA 5JC1A 4QAQA 3JY6A 1ZR4A 3KZCA 1VI2A 2EYQA 5IJWA 4KLAA 1HFEL 3QELA 3I1YA 1PR0A 1QDLB 1RQPA 4PIPA 4XXHA 1T3HA 1T8TA 3I30X 5TIIA 3WKBA 2Q28A 5A6SA 5KINB 2XUAA 1GPNA 1Y1PA 3TZKA 3ROEA 1TCAA 2VJQA 1GTRA 2ZVDA 2PXAA 2H3EA 3BE6A 3E18A 4CKWA 1KVSA 2JLRA 1H5UA 1QF7A 1SY7A 4L28A 1EKXA 3JQRA 1YOVA 1ZPDA 3C98A 1VI5A 4YFYA 1Q50A 5BQ5A 3RK0A 3OOWA 3DLPX 3EXFB 4M0PA 2QYOA 5D5PA 3W8FA 1R00A 2FP4A 5AVKA 1WW2A 2A5GA 4M1YA 5E6SA 2K6GA 3WGZA 4LF5B 4F2WA 4MUKA 1CUAA 2WJHA 3RRBA 2QQ0A 4C7JA 3JQDA 1JHRA 3NTRA 3ZIDA 3Q6MA 1SBQA 1EXNA 4GECA 2ZBGA 4RA9A 4RXMA 5I45A 4Y2HA 3OIGA 2BZ1A 1TK3A 2HPZA 1U2TA 2Q4EA 2DFDA 4Q7LA 5EMJA 2NTEA 1SZJG 3P2KA 2ASEA 1CUYA 1P8JA 2GI4A 1V35A 1ZD3A 1PR6A 3CIOA 3IQGX 3AW9A 2UUOA 2XVYA 2X7JA 4IMRA 3BDAA 4MCHA 4OOEA 4HRAA 5H3CA 4DDMA 4LOJA 4OA8A 3F4BA 1Z2EA 1L6IA 4QHSA 1P3Y1 3OD1A 1L7EA 3OEWA 3C3BA 1EK6A 5JH7F 1QGUA 2AEFA 3HVHA 3IVRA 3DE2X 4HHEA 5FXMA 2YDXA 2VP3A 1QTQA 1JBQA 1EE9A 1RLUA 2ZUBA 5E7MA 1UIMA 3HBLA 5KOHA 3AM4A 1OLXB 3U7HB 4EYQA 1BROA 2OFWA 2NUAA 2P2SA 3V46A 2C8LA 4YMTA 5LL6P 1P2VA 1Y3CE 2IZZA 3BSYA 5HEKA 1HE1C 3DMPA 3A7EA 3TR0A 4AF8A 3GO4A 1WB9A 3LDHA 1E9RA 3AJAA 5JPIA 2FCAA 3BK1A 1MXHA 5I51A 2HM7A 2FW6A 4TRMA 5JFGA 2AXQA 4O25A 1KI2A 3ZLJA 2JLVA 3G9XA 2QRHA 2V0CA 2RKBA 4F4UA 1GNLA 3RJZA 5AQ1A 3TIGA 3IO3A 3W4IA 4LJSA 2NG1A 4IJKA 2CWWA 2PFKA 3ER6A 4EHNA 3M1LA 1PEAA 4GF5A 3S0JA 1A9XA 2WZQA 3WLSA 2X1VA 1USIA 3B3QA 5EHQA 3QPVA 1CFJA 1OTYA 4KYUA 2L18A 2BUBA 3LMKA 2M6LA 1FUKA 3C8ZA 1CDZA 2FEWB 4RDIA 3NHLA 3BHNA 2ZITA 4NC9A 1BSVA 1OREA 3OFSA 4P33A 4XJTA 4JI2B 3PHBE 4D99A 2JVJA 3KBBA 4EW1A 1A5BB 3ASVA 4LHZA 3CSDA 5EWMB 2H1VA 4CG1A 3GL9A 2HL6A 1XQYA 1H2XA 3QENA 3UENA 5KU1A 2QX8A 3CVJA 4EUKA 4IFBA 4IQGA 3QNUA 1YRLA 3OLCX 4HAXA 1SUFA 2VA8A 3WLPA 1FDTA 2PGIA 3TW6A 2QVBA 2WICA 1U1EA 1WM1A 3KTFA 2F2TA 3T9AA 4DILA 1FNSA 3F90A 3L0PA 4L7VA 4PXYA 5KDOA 1W6UA 2V3WA 1L7XA 1SBCA 2EBUA 3DQQA 4H7KA 3SGLA 1W5BA 2QLMA 2HGSA 3L1UA 1FK8A 3NIDB 3DTTA 2GZ1A 3LXUX 1WRBA 1NP3A 2I2WA 1JLLA 3R6WA 1C9YA 4D8UA 4JS0A 3X1JA 5G02A 2HZ7A 2X6TA 4N0MA 4F4IA 2VPTA 4J0HA 1FDIA 1US8B 1VJCA 3MJHA 3O82A 3WS7A 4MHOA 3CURA 2WABA 4M37A 1WY5A 2IUTA 3FWYA 3S27A 5HRCA 4TVBA 3LPMA 3OQJA 4DSZA 3ZDBA 1ZGZA 4K9LA 4JOQA 1UXKA 3HVKA 2A57A 2ZQZA 3RLFA 5ARBA 1S02A 4I0WB 1NV9A 3ZX4A 1DPFA 3DYBA 3I05A 4W9NA 1XXHA 3OLYA 1LC0A 4ZCTA 4L7QA 4UTZA 1UFRA 3P71T 5A1JA 4XPZA 1Y3AA 3FKJA 2WHRA 2EP7A 2ZJAA 1ECGA 2I22A 2J87A 2RFLA 1PG5A 5JXJA 1OT3A 2J3LA 5FI3A 5HMMA 3R3VA 2H9YA 4N0EA 4KSBA 4N9QA 1UODA 1WCWA 2JJ2A 2WJIA 1E2DA 1KYZA 1E58A 5DNAA 3WX0A 3WZLA 4D5EA 2J32A 2NP6A 1JJVA 2IW3A 3PD1A 1FTGA 3EQ2A 1Z68A 3O91A 4FLEA 4E5PA 5HHTA 1ZWLA 3AIMA 1W2WB 3TD6A 4YCAA 1WDLA 4X7BA 2O05A 1UJ6A 1VQ1A 1Y37A 2BT4A 3C6ZA 1DQRA 3RSOA 3QTLA 1JE0A 4IXTA 2Z04A 5CK5A 4IFEA 4OHZA 1YTUA 3SXUA 5FWYB 3I5AA 1Y1KE 1M54A 2PXHA 1JA9A 1DQYA 2JLCA 4WA8A 2ILVA 2FXVA 4JYZA 3P0EA 1W96A 4GMGA 4BGUA 4ZV4A 3PR3A 3SPXA 5HYVA 5A1TA 1IWOA 5I6DA 5KNDA 3Q7PA 2HEGA 1ECJA 2DY1A 3OZ7A 2IQIA 2VH5R 1W29A 3LWZA 3DKVA 4FZ5A 4P36A 1Z0DA 3ELBA 3PFGA 3RRYA 4LY0A 2FZ4A 4HNAB 3H9UA 5ETJA 4BMZA 4EABA 4ZI2A 4LJ6A 1OH7A 3CUWA 2Y0PA 1XTIA 1F1JA 2E49A 4LBVA 5BV2P 1E9AA 3LLVA 2KBFA 2QVCA 1EINA 2YIJA 5TRTA 4AZ0B 1JHDA 4JP2A 4PO9A 3I4FA 3VKVA 4RM2A 1Y1TA 3IP5A 2GCIA 1NNI1 4FFDA 1DOHA 1NFQA 2DPHA 2G8LA 3GLSA 3HEBA 4U7HA 3A9SA 3M82A 5M2QA 4OP2A 1N3LA 4WZAA 2GZHA 4XIYA 3SJ7A 2VT6A 5E3JA 5F7XA 2IBSA 1QX4A 3RDPA 3WL3A 2XUKA 2P6UA 4CZ2A 3ZVKA 4KJZA 4DJTA 3HJFA 3ZHXA 1EK2A 2A5DA 1HZZC 1XDSA 5DWQA 3SLRA 4BVFA 4B3MB 4HYYA 1DAKA 1CUDA 5DI9A 2JGJA 3K92A 1YVRA 3LVRE 2W8BB 3DBRA 4FQ8A 4YP7A 2QNBA 4NE9A 5KQRA 2PGNA 5JDIA 4XQ0A 3UG7A 1JMKC 2FUG6 2GLXA 2OV8A 4LJ5A 1FU8A 4QNRA 4D96A 1PNVA 4LRSB 5TEWA 5EJ6A 4HLDA 1U2DA 3REQB 1DG9A 1I5RA 3FJYA 1JTEA 4RFSB 3ZBPA 2RAFA 2F1HA 4UFPA 2PVCA 3EFOB 1ZM4A 2H0QA 2DT5A 3GBPA 3E53A 4WCFC 1U6KA 3BH7A 1AV7A 4XJSA 4TRJA 4FYMA 1O77A 5A9TA 1TZBA 4BJ6A 4F5EA 2H1SA 4U9HS 4JC8A 4RCZA 2FUG1 2VF4X 5KYUB 3KEMA 2DC1A 3WAGA 2FZ5A 3IUBA 2LXNA 4BMYA 2IEAA 2B69A 4GW3A 3O03A 4JJKA 1ZONA 2VNJA 4KO1S 5E9AA 3X2FA 4BBPA 2O2GA 5EHXA 4E3WA 1Z5PA 1VP3A 2BMWA 3AIKA 2HRRA 3EAFA 5K6RA 2GPYA 4E5VA 1TZ2A 1PJTA 3Q3JB 4ZI7B 2PK3A 1XDZA 4RHTA 1JB9A 1MMFB 3X1KA 2EFDB 1NXQA 5F52A 4ND3A 4B4KA 3OTIA 4GE3A 1T15A 1TM2A 2OV4A 3AOEA 3HB0A 3N2IA 1Z07A 3PFCA 4NDNE 4XM0A 5CDFA 2WWHA 5G1NA 1VOTA 3UY4A 2ISQA 2NVUA 1VL2A 5HJ2A 3OCUA 3I23A 4Y0AA 3B2NA 3TOZA 2NPFA 3ECSA 1IEXA 3E9ZA 3SK0A 1H0SA 5CEJA 3QKRB 4Q3BA 1SXIA 5I4IA 1RKBA 3RIMA 1P0PA 3AHCA 1IOZA 2FYTA 4F86A 5A7FA 4KR2A 1KDPA 3WHPA 2RAVA 3V32A 1R27A 1P4SA 2QIPA 1EFHA 5IH3A 3FIUA 5JQWA 2W4QA 3E3OA 1LNQA 3JAKA 3IR5A 2UXBB 3PXEA 2AYYA 1Z18A 2YRFA 2B2XA 3DZFA 3LTNC 4EI7A 4C2BA 1RKXA 1SPBS 2C4WA 4KO3S 3BGOS 4M49A 5F3WB 2JIQA 2ZVJA 4ZOAA 3TSWA 1OYOA 4IAOA 3HCDA 5CITA 1G41A 1LS6A 1ZM7A 2J45A 1GKUB 2X4GA 1J2UA 2C2GA 1Z7BA 3IKLA 3NHBA 4FYYA 5C4IA 3INNA 1BN6A 3KPJA 3L7NA 1NN5A 3VPHA 4FINA 1MGPA 2IHJA 4X44A 4RHXA 1VJGA 4AP5A 4HQNA 3TLBA 2C4MA 3RNOA 1YCFA 4F1WA 5A5DA 1BDMA 2CK3A 3CSSA 2JAPA 2G1JA 1X7WB 4Z4HA 4C7VA 1VJ5A 2HU2A 2PA3A 2PKYX 4JGBA 2RJ3A 4DBZA 4MJ7A 3RRFA 5LJIA 3ZJUA 4JLWA 4ZAWA 1RBQA 2VRWA 3DV2A 2FX3A 5AW3A 5L9AA 3AF5A 4URFA 2HSJA 1N1GA 2O7NA 4M6WB 2VPQA 3DEAA 4MQBA 2XITA 1TLLA 2MMCA 3P2EA 3BIWA 3PQ7A 5A4AA 3S2UA 5CA0F 2UYCA 4O3MA 2VPIA 3DGFC 1X94A 2QD3A 1MJFA 3IDOA 5LR6A 2FEKA 3P4XA 5JXIA 5ALYA 2UXCB 3RVDA 1NUUA 2Z09A 1AIPA 1THZA 2NZXA 2IX3A 5CVUA 2X0IA 2WUFA 4AN0A 3AUKA 4N76A 1BFUA 4WOPA 2CLKB 1CQPA 3W6ZA 1N1EA 3AXTA 4Z1OA 5FUMA 1N5JA 2IHZA 1OFIA 3I73A 4CLOB 2NO5A 1T24A 3RAEC 4QG3A 1U9CA 1L1EA 4RV4A 4J16C 1V8PA 2G04A 5LB4A 4DMLA 2WP0A 3CC8A 3ZK8A 3D6NB 1DO8A 3HDQA 4ZZ2A 2YY6A 1MJNA 3TQRA 3KFLA 3KOZA 4LX0A 2QMOA 2ZZKA 3RUPA 1ORHA 4XYGA 2VK8A 1C4XA 2H4YA 4QUAA 3CVXA 4S24A 3SD7A 4R41A 6PFKA 2BBOA 5AM5A 5JNLA 1H65A 2I34A 1DCMA 1PSZA 1UBHS 3NM6B 5ICCA 3CRW1 3JYQA 2WKWA 1JG1A 1RQ7A 1HDXA 3FFWA 2IYYA 3GT0A 2GR9A 2H18A 5D5HA 5CFOA 5JZSA 1ZCZA 4OSPA 4MLCA 3DBOB 3K72B 4IFTA 3GDWA 1Z0FA 4Z86A 1DIOB 2B99A 3EXAA 4DRZA 1RFGE 4PTZA 1UBGA 5AFSA 5JJKA 2HSWA 3NHKA 1BXGB 5KMGA 2LCQA 1V3TA 1T26A 2Q3EA 2G6BA 3EG5A 3LBIA 1UBLS 3QFCA 3H1GA 1SUPA 3U3KA 2PZKA 3PE3A 5HF9A 3VR3D 3RYFB 2E7ZA 3I34X 4P7GA 2HKIA 4W5NA 1YV9A 1YJAA 1LGYA 3FHOA 1PJCA 2GAFA 1TPYA 2B5WA 3CZ9A 5AH0A 3U39A 1ADCA 4OAPA 4MR7B 1QLWA 3MOGA 1E2GA 2QRVA 4X20A 3RRMA 5K3SA 4EX7A 1JT2A 1OR8A 1NZJA 5K3CA 1IQUA 1I01A 2VQFB 4MQ6A 4ER6A 1LBSA 1T0IA 2QTCA 4DCSA 2HWKA 3ZYZA 1I1OA 2GEFA 3DMNA 3D6UA 3HJGA 3BQ9A 3KB1A 3TLXA 3V7WA 621PA 4IXWA 5HKAA 2XDYA 4PLTA 2X3UA 3HB9A 4OYLA 2A7XA 1XD2A 3G2NA 5B7NA 3KQLA 4KR3A 4W9RA 5I7AA 1H2AS 1QH9A 1ZMBA 2TSYB 3N2YA 3PA6A 4J4HA 5A4DA 3L79A 1CUFA 1VE3A 3HU2A 3WLNA 5ELXA 4PR0A 421PA 1TM7E 2CJXA 4CW7A 1U8TA 3LQQA 4DKJA 2GN6A 3EX7C 2WSYB 4L5AA 4AO8A 1JWBB 3EOAI 1ATIA 1BN7A 1HE3A 4DBVO 2IYTA 1GCOA 4QJBA 5FEUA 1BVYF 1NVMB 2QP3A 4OB8A 4Q24A 4GOMD 3IEXA 3CZCA 1Z88A 4HDRA 3I62A 1R88A 4ZYUA 4IJQA 4KIGA 5C1IA 2V6MA 3A1FA 3IPRA 1Q1BA 3URKA 3LHFA 4C6TB 3GLTA 2HI0A 1XXLA 2YMLA 2C4UA 2QE7D 4I9UA 5EOVA 1FMFA 4MGEA 5BT9A 3AF0A 1URPA 3MCTA 3M8KA 3BWCA 1S0UA 2H00A 1Y5MA 2BM8A 3LRTA 3KDSE 4PSUA 1H1LA 1M1UA 1XZFA 3WWDA 3GFFA 2BBWA 1A5AB 6GPBA 1YUBA 1JDSA 3DMRA 1NVKA 2DCMA 2QVYX 1ZVQA 1AMOA 1DQNA 5D6NA 3KD2A 3H8VA 4I4NA 1VPDA 4L0QA 4L72A 4YACA 2CVHA 3PGJA 4D1YA 3RF6A 4TS9A 5EJGA 1U5CA 4NU0A 3MJVA 4FMPA 4YUXA 1WOMA 3KXIA 3WIUA 4X71A 5HTOA 1LPMA 1RRKA 5BSEA 1E9DA 1M72A 2EEZA 2J6CA 5AVVA 3VPFA 5FUQA 1BX3A 1MRZA 1M3SA 4O4LA 4CCWA 5BMVF 4OJMX 1ENYA 4CLDA 4RF5A 1VJ0A 4EKDA 3N2GA 2IZ7A 2P67A 3NETA 3MAAC 4QYSA 3GQBA 1TIKA 3HJCA 4U2EA 1KTVA 1MAWA 1W4ZA 4DJAA 3RWMB 4EPTA 1RIFA 5KYTA 2J31A 1HO3A 2Q1XA 3GFRA 4UATA 1C3VA 1ONBA 1IH8A 2LNDA 4TZTA 4DWWA 2FDXA 5DXAA 1DKOA 2BFAA 3QWIA 2I3BA 3B20A 2ZBQA 4K1LA 5BWOA 1FDVA 1E3TA 4GKVA 2QD1A 3KWJA 3KSRA 2WJWA 3OO1A 1U8CB 1MABB 4BMOB 4LECA 1ZK1A 4LGVA 5BW4A 1NAIA 2JCSA 1J0AA 2PRZA 2BR4A 1E0JA 1R4MA 1V5IA 2ZIFA 4R5HA 4RNDB 5DW3A 4AZ3B 4ANFA 4CLRB 1F7UA 3U4QB 5B12A 3QE4A 3D6JA 1VL0A 3ZCUA 5HUJA 3AUXA 1RWWA 2VDUE 4L4RA 5BNZA 3IPXA 4GR5A 4D46A 4CTOA 3B38A 4FP9A 4LZJA 4BLOA 2D1RA 2BC9A 2PUAA 1UINA 3H17A 3ANYB 4XWTA 2CKMA 3LUJA 5DHPA 5BXQC 1HOXA 3G1UA 4MIEA 3GNLA 4DY6A 1DBIA 3LGXA 3ZD6A 4IVQA 4FI3F 2FZVA 3PFNA 1RCTE 1K2WA 5HFAA 2QRMA 4GMXA 2J6HA 3VC7A 3K31A 4F5WA 4ZO4A 1Y4UA 5TC4A 1XZCA 1ZA2A 4P7KA 2LRHA 2P1DA 4MV8A 3CEJA 1EM8A 4HEHA 4Q34A 3QM1A 2C8KA 5TPZD 2PMEA 1NXWA 2BUCA 2BFBA 3DVAB 3LBHA 5AOVA 1CB7A 4E1BA 3QJGA 1FLDA 1TMGE 2O6LA 2PMCA 4DJJA 2WWYA 3THXA 1N2ZA 3NRBA 1P5HA 4A8JB 1PAUA 4ZKEA 3SJBA 4B32A 3MJFA 4CJXA 2YV1A 1RMQA 1TZJA 3DHEA 1EP9A 4IHJB 3WOHA 3TMYA 3L8HA 4AURA 4POAA 4B44A 5HKLA 5C8YB 1KFCB 3K9LA 1CHNA 2BELA 8ATCA 1N33B 5I7RA 1K97A 4V24A 1PNQA 3VO9A 1OA1A 2LUOA 3C14C 2OHJA 1RYNA 3A1UA 3CN9A 3DAPA 3QLJA 4IIEA 2WVJA 4URVR 3N28A 2X6RA 4H3VA 3LHDA 4DSTA 2BISA 3IUPA 3QLEA 4CIXA 3UCXA 4BNDB 3OECA 1C1YA 4IZIA 2AMLA 1D0VA 2VSQA 4QLAA 3F3MA 4JLNA 4C78A 4EHJA 4EHFA 1M0EA 1T9AA 2PUEA 3KB8A 2XCSB 4WKGA 3QI2A 5TMBA 1EM6A 2HQBA 1Q91A 4U5XA 2QSUA 3U3MA 5FV4A 3VJMA 1TOAA 3OT5A 3QYFA 1G64A 1T5IA 1EVZA 1LNSA 2YZMA 2B1RA 3DOIA 2ZRNA 4K26A 4C0KA 2I33A 5CGQB 5JD4A 2DQKA 3TB4A 3I92A 4YCCA 3GF4A 3KVVA 1FUIA 5M3BA 3CVOA 4IIHA 4G6ZA 1IBCA 4B48A 4FE3A 2PZFA 2PL9A 3AHFA 1HDIA 5KYVA 3ZQUA 2D5BA 2PX8A 2JRLA 4GIBA 2CBZA 2VJCA 3EOZA 1ST3A 3KEFA 1Z7WA 1ZZGA 2X5JO 3QFTA 1DC7A 3KJQA 2P91A 4M9ZA 3F7OA 4UNNA 3AHHA 3JQGB 4FYPA 2OCAA 4HS9A 4QO8A 5DTJA 4D44A 721PA 3U09A 4XH9B 3I1FA 2CHVA 1YOBA 3QIAA 1X2BA 5F35A 4UQOA 3T4PA 1PFUA 4OM8A 3QEJA 4M3NA 3VDQA 3GJ8A 1YA8A 2VPXA 2JGFA 2WM2A 4RVHA 2FOXA 3W2IA 1XT6A 1KXZA 3TQOA 1GL6A 1N8NA 1XA4A 3AJRA 3DP7A 1X9IA 5JSZA 1CQIB 5CX4A 4QSMA 3DOUA 3KJNA 2VP0A 3Q9UA 4HUQB 3VTKA 1KEPA 4L6IA 1GZ4A 2OV3A 4R3UC 3VNBA 4DSUA 4HV4A 3EDRA 1NSYA 4KQFA 1V4VA 2OCPA 1TJPB 3ZCRA 5L53A 2IV2X 3KLBA 2JATA 2HXSA 5K51A 2GSDA 1TW3A 4QQKA 3VU1A 1V48A 3G8AA 4X7MA 1L5SA 2NSJA 4E6PA 5FHRA 3UAZA 1NOIA 5EEHA 4IWXA 4HNHA 4M8NE 4OAQA 5ENZA 3P9KA 1CDDA 3FI9A 3ITKA 1U0GA 3EDYA 3WB9A 5IAOA 4LJ8A 4H18A 3VZCA 4U7PB 3L02A 5JHGB 4RTJA 5F4ZA 1S7GA 4OGGA 3RARA 4RH1A 2XUOA 5ALSA 1MLDA 2X3FA 5KVVA 3QXHA 1T0HB 2QQ5A 1V4NA 4MK4A 5IDXA 2AGVA 1BU8A 4YPVA 2F3QA 5T64A 1WDWB 2M6SA 1TD1A 3S7TA 2YXDA 4JJ6A 1GNSA 1VL6A 4KFSA 2CLCX 1NATA 2QTMA 5KYYA 2J9GA 2ZK7A 2DKNA 3IP3A 4IUCS 1P5ZB 5D85A 3G0CA 4XPIB 1GUYA 1NUAA 1W52X 2C7GA 3NVDA 4HMQA 4AJPA 4HOYA 2BHLA 5F23A 2NWQA 4KXFB 4PSKA 4HDNB 4FMDB 2GBGA 1Q0QA 1TCBA 2O2CA 3FLEA 2PS3A 3INGA 1N6OA 1D9ZA 1FUYB 3K6RA 3TTUA 3V33A 2IYUA 3ETCA 2V7GA 3LDAA 2P6OA 3HEAA 821PA 2J67A 4PANA 5DNCA 4JL6A 1ZXLA 1C7IA 5HKOA 1PT7A 2JRCA 3DEFA 1YQGA 2A30A 2QLNA 3ADOA 1N2HA 4Y9RA 5DLDA 1N8KA 2GM5A 3WXBA 5C4MA 1CS4C 1M66A 5KNCH 2ERXA 2EW2A 2AZTA 3GMSA 9LDBA 3D3EA 4HCJA 5MHTA 1V1MA 1V16A 2ZJBA 3AF2A 3GCZA 3COYA 4QVKA 3VVLA 1B93A 5DASA 1O96B 1WBDA 3CIFA 2CHQA 2ZIZA 1H8ED 3H3JA 5JLJA 5KOJB 4S1VA 2BTEA 2J4FA 2LVBA 1KOFA 2OZKA 1JLKA 3OY7A 3RROA 4UM8B 1J2RA 1NKTA 4DUGA 1S2GA 3L7KA 4RUKA 1XTSA 4C3UA 5B55A 1PG0A 1YB6A 4K1XA 4NSNA 1NI3A 5I7EA 5JAZA 5LNK6 4MUEA 5TLSA 4U2DA 2XYGA 1Z5WA 4O6VA 2H4FA 3V7NA 1RHQA 5SYAA 1ESMA 4MVXA 1L5KA 3RSQA 3D6HA 4XM1A 2CVQA 1LCIA 1NI4A 2ZIVB 2F8SA 4GICA 4N7BA 4JELA 1H2RS 1FEZA 1MHPA 2DWPA 5LQSA 1NG9A 2WPDD 3CLSC 4LWPA 5DMHA 4QVIA 1P2BA 2IODA 4NCKA 3RU9A 1RMYA 3RSFA 3VAYA 1YQDA 1AGRA 1H1DA 1KQPA 4ND8A 4DN6A 4D0GA 4F1JA 3I2JA 1DBPA 1U7ZA 5IASA 3N7UA 3LO5A 4D42A 1SCJA 3QOXA 1PQUA 3FYTA 2PT5A 1NF9A 3SC2A 3WRVA 5B7PA 4RD6A 4TS4A 4H7JA 1M33A 1NXVA 3ISVA 2FK8A 3RQIA 4MRMB 3KX2A 1D5WA 1W0KA 4JJ4A 1JB1A 3L18A 1EAYA 1K8YB 3D59A 4KX5A 2J0EA 4BNKA 4F45A 5REQB 4M87A 2DQZA 1UJ5A 3ZKWA 5CFPA 2X0NA 4BBZA 3MJ4A 4N4AA 3E23A 4HTFA 4C4ZA 3C8DA 3Q72A 3ANXA 3D4NA 3QPUA 3SQMA 4AJLA 2JEYA 2WJAA 1SHTX 1JSCA 4L75A 5JAQA 1I10A 1MOSA 5GADl 1IY2A 1YJCA 1O87A 1Z3IX 2AR9A 3I1JA 4LWZA 2YYAA 4A03A 1OV6A 1SM4A 1E6WA 4ARSA 2QGNA 1QIKA 4LE2A 3PHCA 2W6QA 1IAQA 4ND5A 1JJ7A 4Q9LA 1N5RA 3CEPB 1XN4A 2Y0EA 1P45A 4QPNA 4BLQA 3OTOB 4G5QA 4YRQA 1NQ5A 4E5MA 1FMCA 1KEVA 4GD3Q 4DQVA 2RHRA 1GGMA 1ZJZA 4LCBA 4F3KA 4LIPD 4WACA 3U7QB 4MV7A 4D9MA 3ICVA 4BJ3A 1XMSA 3HA3A 3SQXA 5L3RA 3GARA 1C3JA 5KPJA 5GONA 1OJLA 1LDYA 2XHEA 3QU2A 4IHAA 4RK4A 3TVYA 1DAHA 1COWA 4MJLA 1M2OA 1XK6A 2Q99A 3GUCA 1EWKA 3DL4A 2YHAA 5FPKA 2OXIA 3L7BA 4XSGA 3PICA 1UJNA 3GZTB 4O4JA 2GXAA 5EIEA 1R8QA 1ADYA 3DAGA 4HATA 3LO8A 1Q7RA 1TMKA 5J1SB 4RKQA 3NKVA 2XMGA 1UKEA 3NIBA 2ZG6A 2HJWA 1P61B 4WLEA 3ZHQA 2FFBA 4JFAA 4XDGA 3VV3A 3FPAA 3GI1A 1JPVA 4LJAA 2AW5A 1WMAA 2VPZA 2C4VA 2XMPA 5KJFA 4D3YA 1DUSA 1T9ZA 4AI6A 2OM6A 2QLLA 2AIRA 2IL1A 2OYCA 5F4BA 4E21A 4EJSB 1ESDA 3M6FA 1EVIA 2H1LA 2XA1A 1TQHA 3FFTA 4O08A 1KZ1A 1GKYA 4UMFA 1FTSA 5SZJA 5CDYA 1N32B 3CO5A 2ZUTA 1DEHA 3ENNA 2C3MA 2I3GA 4YB8A 2BWJA 3A25A 3F2VA 1AM4D 2P62A 3ZEAA 2GF9A 2XRYA 2JHAA 2PRSA 2ZDHA 3FFXA 4KU4A 1HNZB 1IOLA 3K0CA 2PWBA 2XE7A 4UNSA 5DN6A 2VYVD 2ZI5A 4NBUA 1L5MA 4O2BA 3IBTA 1K1EA 3BEDA 4HVTA 3SYTA 4CV2A 4ZDJA 5FUWA 1XU7A 2IITA 4EPRA 1AO0A 4EYKA 3AB3A 1W581 3JQFC 2J59A 3RPEA 3ZW8A 1RLTA 4QX6A 3KTDA 2ZOSA 1N9GB 5BPFA 4AS3A 1DTWA 3BFVA 3A14A 4MINA 1MIOB 1X14A 3ETEA 1SUSA 3L82B 5ADHA 1KMHA 1QR2A 1SVSA 2R1TA 2HFKA 3KP1A 4Z7OB 3AEUB 2HMAA 1WZNA 3GLGE 4JEIA 3L6CA 1IZ9A 1O89A 4DNFA 1PZNA 4Q01A 4B43A 2EW1A 5DXFA 2BFCA 1SZDA 2I2CA 1GUFA 4NV3A 2O8DB 2X1MA 1O6BA 4J4TA 4HXGA 1AQIA 1R16A 1GPDG 1GGKA 3BD9A 3CUTA 5TS2A 3M5DA 3BICA 5CNJA 2AJTA 3FHCB 1YZTA 1Z4OA 1W19A 3RH0A 4EHKA 5C9ZA 4EA9A 4H1UA 3TGPA 1ZZEA 3THWB 1JKIA 2SKEA 3FVRA 2YS6A 1ZC3A 3BCUA 1G59A 3LLMA 4Q18A 1FFEA 2NUPA 1CJBA 1AS0A 2JFYA 2ZBVA 1T13A 1R0RE 2ZTVA 3PUIA 2V5AA 4J0QA 1ZHOA 3CH4B 3MUNA 4GDMA 3S2ZA 5BYBA 3FPCA 2F3TA 3OQVA 5YASA 3THSA 2WZCA 4DAEA 3FYHA 3TR5A 4PYLA 4MS3A 4O4HB 4TWIA 1P1KA 4HVLA 5IJZA 4HGYA 3FPGA 3K53A 2D7JA 5IJXA 2XV1A 3ABZA 3GGDA 5JS1A 2DBZA 2O5VA 4W1QA 1ESCA 4LDAA 1E7SA 4YP5A 4DSNA 2WJVA 2GX6A 1MQ9A 3GAZA 1O9BA 1ICEA 3LD9A 4LJ9A 1DBVO 5G0WA 4YXWA 4PHCA 3KQHA 3Q10A 3DKIA 3H99A 3HN7A 4R9VA 4EUNA 1G20B 1RHMA 4WZZA 1GAXA 2C97A 3PD0A 3LFUA 2A1TR 2VKQA 3AHGA 1PNOA 2I67A 1J0XO 3FZYA 3L6RA 3PFBA 2HC9A 4Y8VA 1JHPA 1EDZA 4B4VA 2F4NA 3L7IA 4HEA6 4AM8A 4AXBA 4EKGA 3CR8A 4BO3A 4HWPA 3DJYA 1J4AA 3CR3C 5FA8A 2QL5A 4AF6A 4JJIA 3CMCO 1ZIYA 4QUDA 3SHQA 1ZC4A 1DVRA 2WU1A 3LVQE 3I32A 5FTNA 3ZW9A 2KQUA 5F9HA 3PNVA 1BIFA 1UBCA 2I6QA 2NYRA 3ZBUA 4L4ZA 4TQ9A 2BKAA 1UT5A 3EIUA 1ZLXA 1Q5PA 1U8AA 3UMGA 3HN6A 4NJMB 3B3JA 3R74A 4DE5A 2D6FA 2FJUA 4B6PA 2XWSA 3QYAA 3QVLA 4PYJA 1T1RA 2JA2A 2AQIA 2OVBA 3EZ6A 3H97A 3PL5A 4IDFA 5E9QA 5BN4B 2HTFA 1V8ZA 2XDWA 3II6X 3NYQA 3H8JA 3QEMB 3AYZB 3NORA 3SKXA 4B8WA 3GCDA 3LY7A 4BV8A 1JEQA 4LX8A 4OQNA 3EK2A 3U3RA 3PCTA 1IQPA 4G0YA 1YGYA 2YHIA 5FF9A 2WBLC 5E7IA 3ORFA 1FX0B 2HFJA 1JAYA 4OU4A 3PBKA 1ZD2P 3QWAA 4TLEA 3ODPA 5HIJA 4EG8A 3JU3A 1M76A 4M1TA 3D7LA 3H5AA 3T5CA 3ADCA 4GQBA 4BNLA 2YR0A 2GYYA 2VSYA 4CKCA 4MPRA 5FA5A 3I83A 4COKA 1DKLA 3GJ6A 4YJGB 1D2CA 1AKRA 1I30A 3CPHA 4FVTA 4JB2A 4YIKA 3TR6A 3G13A 3RFVA 2IDMA 2XJ9A 2YINC 3B8HA 1FSFA 1RQLA 2QR2A 3PWTA 2GK7A 4UCWA 4C4RA 1V43A 4PF1A 1VMEA 4TVOA 5AVUA 2P9BA 1HEIA 2WILA 3EXEA 3QXXA 1VB5A 4X1YA 3BMOB 1EFRD 2DLDA 2V03A 4OGWA 3U26A 1Y1SA 1H2FA 2ZI6A 2PR2A 3C70A 3ROMA 3RVSA 3R7WA 4Q6WA 2QA5A 1ISIA 2Q6IA 4ZODA 1J8FA 3N3AC 4RQUA 2OZEA 2WJJA 1YR6A 1D2HA 2WJ4A 3R2JA 4G1BA 4QG7A 3RJ5A 3QVGA 2CFOA 3NM5A 4MV0A 5DTMA 5FKJA 1T3SA 3GIWA 5JAIA 1VP9A 3PC8C 5M29A 5EWLB 1RAHA 4TVKA 2AFVA 2XTNA 2P0EA 2QVXX 3L7DA 1SHZA 3GN1A 4XSVA 1JHOA 3DKRA 4ZN6A 1R7RA 2YXEA 1ZNYA 3L0YA 9MHTA 4UULA 4Y2GA 4PR3A 2G07A 2VIIA 1KDTA 2EBHX 4W5HA 3EGXB 1Z34A 2ODBA 3A04A 3JZFA 4QWMA 3TH5A 1C9MA 1JVBA 1R6TA 4C4PA 1KNXA 4IIYA 4AP6A 2YWCA 1T10A 4XGRA 2E9SA 1GTSA 1VG8A 3A6GA 2ZJ3A 1ZUNB 3GPDG 4K0KB 1QHYA 4CXMA 3QU4A 1EJ6A 1U3VA 3PUHA 4G5RA 4XWAA 4AUEA 2ORVA 2QRUA 1QANA 1UPFA 1W2GA 1GU7A 2HDNB 1X1EA 5JCXA 2I87A 3ONWA 3BAFA 4PZAA 4EVQA 5FYDA 4FDLA 4INZA 4OJKA 1KEEA 4KL8S 2J5BA 2NT3A 2PA0A 2AB0A 1DCKA 2JK1A 2PSEA 1NOKA 3PC2A 1VZ3A 4TTVA 2ZJ5A 3QVVA 2Z57A 5LQJA 1P0MA 2Q0HA 1U3CA 1DRUA 4DDWA 3Q11A 3RKSA 2A84A 3W5AA 2IZ1A 4EFMA 3L6DA 3IPCA 1IN8A 3PCXA 1QYRA 2JZOA 1QAQA 1T9CA 2OCLA 3T4UA 4EOGA 1Z8NA 2WU3A 2PUBA 2V7VA 1O95D 5TS3A 4D3DA 4DARA 4HUTA 3Q41A 3OC0A 2Q7XA 1FVXA 3AGQA 3I64A 3OPQA 1AGPA 4KGVA 1GZHB 4G5YA 4QULA 3ZZMA 4E46A 3F5SA 2VQEB 3KV3O 5CB8A 4ZCRA 3T9EA 3K9HA 1JZQA 2PCLA 1Z6TA 3G68A 4Y6QA 5H68A 1JIVA 2JJMA 1FP2A 3BRSA 2ISCA 3NVMB 4G24A 4GQAA 4LXTA 4M1QA 5JVDA 3KVYA 3LQKA 2GKSA 3VZQA 2JGAA 4BFXA 4X7RA 4UBLA 1XVIA 1A2KC 2YJ3A 1LLFA 4IUDS 4K9RA 1ODFA 2WHYA 4ND7A 4JLUA 3PXAA 4WSOA 4Z2AA 1NNEA 3SVZA 3GW8A 2RH8A 3X1ZA 2AWOA 3ZXYA 2OD7A 3B1JA 1Z62A 2B4YA 3DTYA 3UMVA 4FGWA 1SOVA 1Y8ZA 4MCJA 4UEOA 2OFFA 5DM0A 3FNFA 3PDWA 4PHHA 5JOQA 3FPSA 3JWHA 4M9UA 4P6VF 1DKUA 4IVRA 2HRZA 2FZCA 4G4SP 3NPMA 3KKEA 4ZT4A 2Y67A 1W0JD 3UV6A 1PD0A 1I2DA 4YDSA 3Q2KA 4N3NA 4F72A 3WIDA 1WTCA 4NBVA 3ES9A 2XQGA 4RA6B 4EY5A 4LV6A 3UMJA 1E0KA 5DX0A 1K86A 5BYAA 3TNDA 4ZD6A 3N6RA 1A77A 1EXDA 3TX2A 1OIWA 3EYWA 2IZ5A 3E0XA 4GPZA 3IDAA 3T0FA 3KFVA 1DAEA 2ZSDA 3PG5A 4ZT2A 1KYVA 4ARAA 4YYZA 2QJOA 3KR9A 2ZJ2A 2BHNA 2HWXA 2QY9A 3AX6A 1FYVA 3WWOA 1UC8A 1PGQA 2P2NA 1HRDA 4KBFA 4RZ2A 4EFDA 1GXSA 3Q1KA 3MHTA 2P4EA 4MS1B 1CQWA 1R8JA 4KHPB 4G5FA 1R0CA 1TT5B 3X2EA 4JIGA 5ABPA 3FR7A 1AA9A 3S2FA 3V00A 2BGWA 1ZVVA 5F7JA 1EDOA 2PKEA 3HADA 4RY2A 3ZE2B 4CL3A 3K32A 3O92A 3SHVA 1NLMA 2QLFA 4XWKA 1PL8A 5INTA 4NZZA 3LUPA 1LSOA 4EHBA 5FRDA 3T5AA 1V1RB 2J8ZA 4URUR 3HCBA 3SX0A 4N9WA 2FLVA 3IOCA 1FQKA 2WV7A 2YFKA 3OT4A 3KTAA 1BX0A 4XKJA 1FY2A 1ZWKA 4NG5A 4QHTA 4KR9A 2YZ7A 1QQ5A 4DRXA 4WFJA 2GHTA 2PX2A 3HU5A 3F6CA 3E9EA 3LPAA 3NOOA 4K03A 4Q3LA 3EQ7A 1JQBA 2GASA 3EJWA 3RSZA 3FMOB 3OJXA 1MJGA 3JZAA 4D4JA 4ZANA 2H1OA 4YRGA 2XVXA 2OYSA 3OIVA 1EK0A 4PV7A 4YI5A 1N3IA 5FAXA 5KWJA 2GWRA 3PYXA 5FBHA 4B84A 5AJUA 3VR6H 1RQNA 1R0SA 2AZMA 3KJHA 3CR7A 4HR7A 4L4UA 4O2LA 3WLIA 3VTAA 5IK2D 2CNWA 1ZGBA 2UAGA 3PNKA 1C1XB 3C97A 4R1LA 4Q5IA 3AKZA 1U02A 3L8DA 2HWWA 1X9GA 3BRWD 5B64A 5CFZA 3LIPA 3ACBA 2W00A 1GN8A 1CF9A 2FUKA 3PFWO 1QTRA 2D4HA 4MR9B 4QXOA 5CX1A 3TLMA 5LA6A 4FYWA 4BDTA 3NT5A 5BMVA 4NMHA 5BQFA 4BEJA 1ESNA 2GB4A 4BZZA 3OHMA 2IXFA 4Y2SA 5JCOC 1OOEA 2XWPA 4L1KA 4QXAA 5JSKA 1GUAA 1ZH8A 3H5WA 2WI8A 1FFXA 3DNPA 4UNQA 1RE0A 3NHRA 1XDUA 4WXPA 1E3SA 1M74A 1NYLA 2RHGB 2QN7A 3LOUA 4NVRA 1TYCA 1YXMA 2Z08A 3R41A 3A1TA 3D8TA 3KK0A 1C9KA 5DWDA 3CLTC 1E4OA 4BYMA 3OI7A 1N57A 1CEYA 5GJCA 4R1TA 4MB2A 3GLVA 4CMCA 3N05A 1DNPA 4UHEA 4QDZA 5JNSA 4LNUB 3DAYA 1QONA 5JPCA 2GERA 2AYZA 2O2HA 3H5NA 5DYNA 2VDQB 1SG0A 1N2OA 2PQ2A 3CNNA 1BXZA 4IUYA 3WQBA 4DCJA 4ER3A 1VPWA 3ICCA 3ISTA 1U2DC 2RAPA 4JHXA 2PTHA 1UOEA 2WINI 2AF3C 3RBXA 3PNOA 1RC1A 4QDTA 3ZUGA 1Z17A 4PSVA 4Q4DA 3NI2A 3FROA 3IV9A 1KRHA 5EIFA 5LDHA 2JARA 3ZU3A 2EZ9A 5SZIA 2H08A 2COUA 3EIFA 3K0FB 3PPXA 4MCIA 1LTHR 4X41A 1GGVA 1NASA 1WB4A 2FK7A 1T8YA 2IKSA 1EVEA 3GJ0A 3LT5A 3RSSA 1Z2OX 4MW6A 1NW5A 5HZKA 2W43A 2QYSA 1D4OA 1NZDA 1O7JA 1DBSA 2JGDB 4GUDA 4RIFA 1F4LA 1ZU4A 5HCIA 3Q15C 2R0QC 2HK9A 3HO8A 3O4RA 1HK7A 3IOBA 3NBMA 4QTTB 4D3SA 4R0MA 1QH0A 1SRRA 3M2TA 5ALUA 4L95C 3UMFA 2GOYA 1I13A 3NXKA 3Q40A 3WO1A 2HHCA 3QX8A 1DKNA 1Z6QA 3OX4A 4P32A 5ESXA 4WJKB 3PCRB 4JSYA 3OCJA 3CUKA 2F00A 2JFBA 5AJWA 2HOQA 4XX0B 2P9GA 2H5EA 4KLZA 3KSUA 3RR2A 5ITVA 4M1KA 3ZQKA 5CA1B 3G2KA 2CNDA 3SN6A 1HZZA 2QX6A 2H2WA 4DT1B 3UQZA 1NUPA 1Z2PX 2XNDD 2BTQB 2OESA 3BXXA 4S12A 5ALGA 2OZPA 1BJTA 1SR8A 2O3SA 4MAMA 4UBMA 1N8SA 2QTBA 1Z8DA 1YR9A 1OLSA 1Q0UA 2BCEA 2H8GA 2Z2IA 3SCZA 4P4GA 1JG3A 1LC3A 2V4UA 1UMCA 3FYUA 4ES6A 2ASVA 3AU8A 5DSXA 5DT2A 2BP7B 3OIYA 4QRHA 1JYFA 3HTXA 3HXTA 2YXLA 3O93A 4HLNA 3EZ2A 1PSDA 3L01A 3JARB 4MPDA 1CUCA 2E37A 3M0EA 4ZVLA 5KYXB 2EEPA 2CE7A 4Z3KA 4KKXB 1TO6A 2IS2A 4TTPA 1XG5A 3PS9A 3AFMA 1TF5A 1XDBA 3UJNA 4KO4S 5CLHA 5BO5A 3PEFA 1E1DA 3HY4A 3G02A 4XR4A 3K9BA 1G8GA 4LDQA 4LHVA 3TUZC 3AQIA 4LYAA 2VQSA 5I4CA 4YDHB 4JI7B 4DM7A 1DPGA 3WKDA 3L8ZA 4GAEA 4B6SA 4EF4A 1ORWA 3UV3A 4RDHA 4RDXA 2RGRA 2V6GA 2Z4SA 1F5NA 1RZUA 4DCOA 4Z7NB 1ZINA 4OPMA 2ZJFA 3T3DA 3ZCVA 3LQFA 2I55A 5DF1A 4AY3A 4C01A 3RFUA 4MUXA 2BR3A 5K8VA 3EEYA 2Z30A 3G2PA 4BFVA 1XZLA 2ZI9A 4S0ZA 4QDOA 4V3CA 1D1PA 2YZNA 1RHRA 4KQ9A 4OFZA 2QX7A 4N41A 3QI7A 3HXPA 4L5JA 3PP8A 4UUPA 3NUQA 4P4SA 2Q2QA 5BURA 1SA0A 2DF8A 4RZ3A 5DTIA 2FLWA 3GT3A 1CJKC 4JGGA 3WNVA 3ZNOA 4EL0A 2DJIA 3MLAA 1TM4E 1JSLA 3UMRA 4M36A 2Q1YA 3TCXB 1R50A 2PWZA 2W98A 4WPGA 3ZWVA 3P20A 2A78A 5EZYF 2BEUA 4DBLC 2OCXA 4V3BA 1Q1NA 1WU7A 1QX3A 3EXHA 4ECAA 3OWOA 1HLDA 3OTHA 2JJQA 1W44A 1EGMB 2VO1A 3PT9A 4R83A 3RFCA 4DR3B 3JQ9C 3KWLA 3RYIB 2WSSA 3ND7A 4GOND 4Y1RB 2H1RA 5KHOC 1KYXA 3RK4A 4MQEA 2DPGA 5BQXA 5KC8A 2WTXA 1GCIA 3GMDA 2CXQA 1XRJA 3D0OA 3D54D 1MR3F 1D1TA 4TXMA 3DYIA 1UZLA 4E6EA 4YBRA 3U13A 2ACWA 3EHEA 3FTDA 1XJQA 4TL7A 1V7PC 3CG4A 1HQCA 1XNGA 1C0KA 3ABOB 3CN7A 1YR1A 4HLCA 2XSZA 2FX2A 1TJ4A 4WY8A 3U2QA 1KWGA 4Q1DA 2BM1A 1P1BA 1V7ZA 2R8EA 1VBFA 4X64B 4CG2A 1ZLYA 1FMJA 4EFKA 3WP1B 5L3VA 1RD4A 4XZ3A 3G0HA 3MIZA 4QBFA 5BRJA 4CI9A 5MN5A 2APJA 1MAAA 4C0JA 4IQ4A 3A11A 3IAUA 1I6KA 1ADGA 2VS1A 3C16C 4JENA 4EG5A 1V37A 3IHTA 4IIUA 4DCVA 3H5LA 5BV7A 1IRIA 3K35A 4OH1A 2QW1A 1QLHA 4H3SA 5HUQA 4BKQA 4UUOA 3T54A 4NL4H 2NVWA 3T8YA 2V6IA 2VYNA 3RC2A 1EK1A 2OBXA 1QAOA 3B89A 1DAPA 3T7KA 1G98A 1WDKA 2AFHB 3WI7A 5JAUA 1BXKA 3WXMA 5EESA 5C5DA 2Y4NA 4C0XA 1JBEA 1RAAA 4MVYA 1J1UA 2H7CA 3AZQA 3L0CA 4J0GA 3V4FA 3OESA 4KIFA 4EY6A 3I76A 4CV1A 1GT6A 2OSVA 4J6EA 4K6OA 1ADJA 1K4MA 1KQOA 1P2TA 4KN9S 4E09A 2Q1UA 3GMIA 2GARA 3G5LA 2QVZX 4XUCA 4O1HA 5E4TA 2RH4A 1N7HA 1XZIA 5EKDA 1KF0A 1M8FA 2GAJA 2VHJA 2MINB 4ZYLA 3NCTA 2AD1A 5CNIA 2P9HA 3JRWA 5FAKA 1JW9B 3Q87B 5JCZA 1O6ZA 1WEHA 2FMIA 3EYAA 2AQKA 4AY5A 1ZESA 2CL6X 4DHWA 3OU6A 2GPBA 2NU6A 3CF4A 4HFJA 4FTWA 2J0SA 1WZ2A 3EW9A 3JWPA 4GP6A 5EMHA 1E3WA 4EMSA 2C88A 1QGED 1G291 3SJZA 1OIVA 1N3YA 1EXMA 1P7WA 2JK0A 1QNFA 1KBOA 2O14A 4YMUA 5F78A 4YJ3A 3A2KA 1HTWA 1Y9ZA 2AV6A 2PLRA 3BPSA 3CNHA 4M88A 5GGXA 4MYTA 1JFSA 4Y6SA 2M6RA 3OZRA 1Y48E 2XKBA 2FEAA 1NVVQ 2ENWA 5JJBA 1XU9A 3SU8A 1XYVA 2DRIA 3A37A 2DX7A 3NDIA 4NMLA 1T5TA 1H2BA 1RQGA 2FNAA 2F64A 3OTWA 1Z45A 1GAJA 2B83A 2Q5QA 4FZVA 1WB5A 4JEUA 2VDRB 4IDQA 1TI7A 3EXIB 5H02A 4CM9D 3KALA 4HDSB 4B3TB 2ZQYA 2BBTA 3GEGA 2Z1DA 1UDWA 3K0FA 4XGKA 3UJAA 1JQJC 3FPKA 4UEQA 2COEA 2C5HA 2FR8C 1L3IA 3DE6X 3RS0A 1SVUA 3ELWA 3WVNA 1J00A 3GUYA 2XOKD 4L9WA 3VZPA 3KXDA 1E69A 1FNCA 1P9OA 5CDUA 2Z98A 4Z9YA 5C35A 3JX9A 2EKZA 1CPYA 1DRJA 3SJAA 3TWOA 2Y99A 2ANCA 4KP7A 1X86B 4HWRA 3WGYA 1HH4A 4V38A 1Z2AA 2WIGA 5J4VA 1VA5A 2WWIA 4I4TB 1ZD5A 3GJZA 1TK2A 3EZ7A 1S9DA 5EP2A 4YN3A 5A3SA 5EIHA 2JL1A 3HPRA 4I1UA 4LFBB 5DIFA 1FUEA 1H9CA 4ND2A 4MI6A 2B1JA 1WSAA 4DSAA 3O0TA 2NP7A 1KZ9A 4KWTA 5EJ7A 5IK2A 1Y8RA 2FPIA 2AOVA 1HT0A 1YQWA 2OHGA 1GQ2A 1N78A 5JQGB 3ZVMA 2HK6A 5CYFA 1R64A 2GF0A 3S2EA 1IHYA 2P5SA 1XIVA 1QRTA 4N54A 1SCQA 4UDOA 2O19A 3V7UA 1KO4A 1L5QA 1Z4MA 2C2HA 1LVUA 3EVEA 3P9RA 4FKBA 1HG1A 3R3HA 3HBNA 3T5TA 4CKBB 1TXGA 2Q8PA 1WX1A 3PWKA 1EZ4A 1Q7CA 2ON6A 4MDHA 1IHUA 1Z0AA 2FPRA 4OQYA 5CX1B 1S6YA 4NFSA 4X7PA 2PHZA 5KREA 2ZYSA 3FYUC 5I8PA 4HGZA 4BX8A 1QTIA 1NE2A 3ZV5A 2NO7A 1M0WA 3TZQA 3ZOZA 4K5QA 2I7DA 1O57A 4PEVA 4AYXA 3EWAA 2CXRA 3R1IA 1CLUA 2WOJA 1TVCA 2QN2A 5EMKA 1U94A 4IDHA 2GBFA 2YWBA 4Y2RA 2VUIB 3V3TA 5NLLA 3K0SA 1N6IA 5L3SB 1U5AA 1EFCA 1UBOS 1NVTA 1GPBA 2I6GA 1G21B 1P74A 2IT1A 2ZS8A 3H86A 5HMLA 3OQIB 3U3OA 1C1DA 4G4SO 2F1RA 1VPLA 2K5UA 1Y5LA 3Q3CA 4QUEA 4PCAA 1LRKA 2GXUA 3SZOA 3O3MB 1VHLA 2W5UA 4JLVA 1KHHA 2ZAIA 3OCWA 4QTXA 5CTJA 3ROFA 4EATA 4HYEA 1UKCA 3A4IA 4GL4A 4H7IA 2QAGC 1YR3A 1I6MA 3FUUA 4Q4HA 3STVA 8MHTA 3CB2A 1JYSA 4IIXA 1BNCA 1D2MA 1CIJA 1T9KA 1PFGA 2A9RA 3LSTA 4NARA 5DRTA 5G0VA 4MRPA 1YRQA 1QHHB 1Z2NX 2CNWD 1U0BB 2O8VA 1A4RA 3LUHA 1T2FA 3PEUA 4B73A 1XLTA 2FR0A 1N5MA 4CETA 2H29A 2R6ZA 4QDKA 4YJFA 1GR0A 2R5NA 3DZGA 2BZSA 3BUSA 2VOJA 2J41A 2QUKA 4OGFA 1FP6A 2ZSKA 1RRPA 1UUFA 1T8RA 3IELA 4MKZA 1UXOA 2H0RA 4KH1A 4WINA 3S1LA 3X0DA 3KB2A 1MAHA 2AZXA 1Z0ZA 1A50B 3A6KA 4HAVA 1LLDA 4UM9D 5AJYA 1VG1A 2AVDA 2ZJ8A 3A4NA 3PKJA 4PSDA 4TYQA 4EG6A 4N39A 3WWEA 4PZYA 4M0MA 3K1AA 1S2DA 2CMGA 3LYAA 4OLBA 1FUUA 3IQXA 2NZUG 2H3HA 2WF5A 3Q2OA 1P17A 1C7EA 1G8KA 1QHEA 2CFSA 2VTKA 3D5TA 1SULA 3EW7A 3LA6A 3K16A 4TMKA 5CH5A 4E2XA 4JD5A 1WKVA 1QIMA 1R9MA 2QTWB 3TDMA 2NSDA 4P35A 4F97A 2OM2A 1AA6A 2WVAA 4DLLA 1YC5A 3F1KA 3EXHC 1GPJA 2GRAA 2OMKA 1HV8A 1XD8A 3A6ZA 1B0ZA 2PV0A 3JSXA 1T2VA 4KI7A 3ZDXB 3C5EA 2VXYA 3JQ9A 4PSAA 4FSHA 3EH2A 3R3YA 3AVOA 3BJZA 2P68A 3AO0B 3G9ZA 4G0QA 2FQWA 1DJPA 5AKKA 1U3UA 4FFBB 3IOMA 4RZUA 4UUNA 3J81A 2DPLA 4OOFA 4NR0A 5KTKA 4BAUA 4KNYA 3GAAA 3PIDA 3X3HA 4B3JA 4CGYA 4M53A 5DX8A 3L8CA 3AVXA 4MVJF 1QKJA 1UP7A 4L08A 4GPAA 2ECKA 3BULA 5EZYA 4R2KA 3DBHA 3QKSA 2QL6A 2QUAA 5BR8B 1NW9B 1F2DA 3PLRA 1CUSA 1NC3A 2GPAA 3JQ7A 4RGBA 1PTJC 1EUDB 5JJ5A 5KTOA 4NYIQ 5DU2A 1WSBA 1GADO 1OXSC 3HR8A 4FD3A 2A5LA 4O4IF 3GEHA 2M32A 3IB3A 2ECPA 2HWUA 1LKZA 1K0FA 1YB5A 4Q39A 4PBSA 3NIGB 4LUCA 5HR5A 2YWGA 1R0KA 1XRLA 2E4AA 3M4JA 4IDEA 4WUVA 2C98A 3WMEA 1QPZA 4OX9Y 4U8GA 2HK7A 4ZVTA 3TBHA 3MSCA 4G4JA 1J22A 4UTRA 2VCYA 4JLDA 2ZB3A 3W8RA 7REQB 4HYQA 1W1UA 1IMJA 2QTNA 4PZCA 4HZUA 1OWMA 3QPCA 1MV5A 3U9SA 2XKKA 2XVAA 1L7BA 2R1UA 3DV0B 3L84A 1OY1A 3V34A 3DPUA 2A2ZA 1K0UA 3HP1A 1NVVR 3KO8A 3ROZA 2YWFA 4NFYA 1L5VA 4LXGA 2E4ZA 4FFMA 4ESOA 1Y34E 1U31A 1F48A 3W2TA 1KHTA 1JQDA 3Q0TA 1UL1X 3DTVA 3LM8A 4MUBA 2WY2D 4TROA 1OH6A 1PFQA 2O07A 4NH0A 1B6TA 1GG2A 3DTNA 3L1VA 2YASA 3EGWA 1E18A 3DD1A 3L43A 3GRYA 2ZRKA 3WJ7A 3QFFA 1Q20A 4JOSA 4RX1A 1QRUA 1YJQA 3O1HB 1FLVA 1XZHA 4P0TA 4RVGA 5TARA 1EXWA 2F8MA 3HDGA 2QK4A 1F8FA 3DL7A 3VNVA 4TWZA 3MINB 4XD2A 3NHAA 5G53C 3H1TA 4DW8A 2D0IA 4I50F 3ZG6A 2O8EA 2AR7A 2YC2C 3BXHA 2NLOA 2FKNA 4HQRA