1A9BA

Decamer-like conformation of a nano-peptide bound to hla-b3501 due to nonstandard positioning of the c-terminus
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
277
structure length
277
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-35 B*3501 (ALPHA C
publication title Decamer-like conformation of a nona-peptide bound to HLA-B*3501 due to non-standard positioning of the C terminus.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (mhc class i/peptide)
total genus 78
structure length 277
sequence length 277
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a9bA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1a9bA01
3KYOA 4FABL 3FT3A 2W38A 3OJVC 3WS3A 3V4VH 4G8EB 1RZ7H 4TOYH 4KUCF 3T2OA 1UZ6F 4L8SA 2WINA 1QO3B 2NY2B 2A9MH 1LK3H 2AJYL 1U2HA 3DHMA 2DQTL 3BYYA 5HSFA 1NMBL 1QSED 4EN3C 2V5RA 4HPOH 5CIPA 4F7TA 1JGUL 5SWSD 5C0CE 4LP5A 1LVEA 4ZOAA 4S1RL 5C0AB 4MD5A 1VFUA 2D7MA 4LPTA 1M7IB 4NHUB 1N64L 3MXWL 4WHDA 3WFCH 1IEBB 4PRHD 4APQA 4OZFG 3FKUS 2XZCH 4GXUM 3REVA 2EDYA 1IZJA 4RMRA 1PG7L 3UZVB 5BOZG 1V8HA 1ONQB 3MJ8B 5HHME 4QRPE 1BPVA 3C5ZA 5DMKA 2Z92A 3O2WL 2PW1B 4U49A 1E4WH 3H9SB 3OXSB 3PP4H 1AR1C 1XGQA 2XOTA 5J9PA 4M62H 3S3SA 1XF4B 3GHBH 4HS3A 4AG4H 5IJKC 2NXYD 4WDIA 5DD1H 1SYSA 5EZOL 3HTLX 2FX9L 5IKCB 1T3FB 4PG2A 5SWZE 4MJ5A 4RFEB 5F96H 3JV6B 2MTPA 5SV3A 4D0BB 3QH3B 3ALXA 3GDBA 3KYNB 2UWEA 3O2DA 2KL6A 2OK0L 1R3JB 1JPTH 1U8NA 3FT4A 2YD5A 1QLEL 3RVXD 4OLXH 1J1XH 1W72B 2VDQL 2Y07L 3IB4A 4YK4C 2JJSA 3QDAA 2ITCB 4PTTA 1AGCB 3OKKA 1CLZL 1NFDF 3UAJD 1TZGH 1SBBA 4G9DA 3ULVE 1G9ML 3K8LA 3U7AA 4EXKA 2ZKHH 4Z7OF 4LSTH 2OLDA 1U42A 5KANI 1KCRH 1L6XA 2YPVH 5IMMA 1NDGA 2X70B 1LO5B 4JFFB 3S35X 3PL6A 3R0MA 1JI1A 1X44A 4KJYA 3VMNA 5C8JA 4G8GD 2YA2A 5DJ6B 1KF9B 2B0SL 3IRPX 4NQSA 2NW2A 4P3CL 5ETUA 5HI5C 3ARYA 2P42B 5GS2H 2OJZH 2R0WH 4LMQE 5EWIL 5LVEA 6FABH 4LRIC 1YN7A 4G6JH 1U95A 4AEIL 1Y6MR 2ARWA 3GJEB 4GRLB 4ZO9A 3HKFA 4LSVH 3QUZC 4L8CB 4Y4FA 1ZLVH 1N6VA 1VERA 4Y4HA 1YY8B 3BIBX 1QD0A 1MCPL 2P5EA 2YPLB 1YYML 3MNVA 3GJFA 1KJ2H 3H0TA 1NBVH 1N5YH 5IESH 3BIKB 4ZPTA 5L2JB 1WWBX 5CUSL 1CL7L 1S7VA 3W5MA 3QI9A 4XNQA 2WWKO 4IRSC 4KGJA 4F37F 5I1KL 4ODTL 4PJEF 3K4DA 4TRPH 1J88A 3CXDL 1KB5H 2GSIB 4YIQA 4RMVA 4FABH 2R23B 3O3EB 5T1MA 4G5ZH 3VXUA 3W0WD 5E8PB 1ZTXL 5F1OB 3RWJB 3U36A 1JNHA 1SMAA 1UKQA 2IAMD 2OR8A 3CH1A 1NMBH 4OCYL 4D0CB 2YD7A 2XTJD 4Y16C 3MRIB 4LSSH 1T22A 3AC0A 4HC1A 3NCYS 1JGUH 2VLLB 2ZG3A 1S5HA 4M00A 5D70H 4K3JL 3H3KA 5IV2A 1TJGH 1QFWM 2MMXA 3D18A 4H5SA 4X4XB 3VXSB 1N64H 3MXWH 1YC8A 5TPWL 3KNBA 3B5GA 5B3JE 1EIBA 1WFOA 1HYSD 3MMEA 3QEQB 3LEYH 3GBML 4DOHE 1OAXH 4KDTA 1J8HE 3K7UA 1NAML 2PF6A 5JOEA 4XPTH 2XY1A 3IS1X 1EFXB 2FSEA 5DEGA 4P4KC 2NY1B 4MXQD 3ULSA 3RPIA 1TJIH 4MQ7B 2B2XL 4CW1B 5TJWK 1WIOA 3L95B 3CFBA 2WWMC 1XCQA 2VO5A 4XI5D 1BEYL 3THML 1GVIA 1OP5H 2WUCL 4HPYH 2Q6WB 2X44D 5EU4A 5EZOH 2FX9H 4ZPVB 4NN7C 3MACH 2A38A 5GRJH 5DO2C 3ZO0A 2BNRE 3QULB 5AG9A 1EXUA 2OK0H 3HE6C 1QLEH 1PEWA 5DJ0B 4YHLL 2Y07H 4FQPA 3C8HA 5DJ2B 4JDZB 4UOW1 5L88H 2DTML 2R2BB 1CLZH 1ADQA 4RFNC 4HJ0D 3ZKMC 2V2TA 3BZ4B 3OKOA 4IEFB 1G9MH 1X7QA 2ICEA 3P9LA 5EBMA 2W1NA 4H88H 3BVNA 2P45B 3HMWL 4JZJB 1MELA 2DIBA 4Y5VB 4Y7MA 1JTOA 4ZD3L 4OKVA 1ZHKA 4C83A 3X12B 1UACL 3IDMA 1IAIM 5E2UH 4MAYB 1EHNA 3PIQB 1BWMA 2PO6D 3PABB 2XN9D 2B0SH 4HZLB 4UTAL 5HVWA 1FG9C 5EWIH 2VIRB 1B4JH 2AJVH 1XH3B 4X6DA 1RUKH 4PYHA 1OPGL 3WS6A 4UT6L 5TQ2H 4LIQE 2Z8WC 1S78D 2G5RA 4KH2A 1J8HD 4YGVB 1FYTA 3Q1SL 1F3DJ 1H0DB 4G7VL 5JQ6H 1FC1A 3K2MC 5JO5A 3PQYB 3QQ4A 4NRZA 3QXUA 5IW6A 4Y1AB 1VA9A 1YYMH 3EFFB 4F80A 2P5EE 2R0KL 4YDVA 4PV9B 3VI4E 4JHBA 4TUKL 4WO4C 4PGZA 5I1IL 5I0DA 2Y7QB 4GG8A 3QIWC 2VXSH 4R4BB 5C92A 5CUSH 5L9DL 1S9YA 3GHEL 4F7PB 5I1KH 1S7SB 4ODTH 5EU3B 4N9GA 4TUOB 1F02I 2VLKD 1EZVY 2W65B 4WU5A 1EHLH 5IEHA 5DVKA 4BFGA 2PTTA 1ZTXH 1CR9L 1TQBC 2BNRD 1AHWC 3LZFH 2KQMA 2EXWC 3D0VA 1P4IH 2OTWB 2D7TL 3BDBA 4GSDH 5EU6B 1T2XA 1TPXC 4DFHA 1A3QA 1YNTA 4MA8H 2GFBA 2C7UB 1FP5A 1C7TA 4OUUA 4N0CD 2FEDD 5F7YC 1NCWH 2IJ0C 3ARVA 3CUPA 4LU5H 1UXSB 2UZIL 3CLFL 5D6CB 5HD8D 3MJGX 3PHOB 1EA9C 3ARDC 3GBMH 4X5LA 3SJVA 4XBGA 1BIIB 1T0MA 1R5VB 1FFQA 1RJZB 2ZUWA 1L9MA 3X3GL 3D85B 3QPXH 4O51B 4EDXA 1MIEH 5D1ZC 1Q0YL 4X6EB 4R0LC 5JPMB 2WUCH 4L8DB 4NC1E 1WIPA 5GSVB 3OR6A 2F54A 2QSTA 3W82A 1ZA3A 2ED7A 2HLAA 3B6SB 4LSRL 2D7PA 1E4XL 2Q3ZA 1U3HD 2NZ9C 4M6MH 3MBEA 5GGTH 1I1FB 4JRYD 2NTSP 1FL3A 4F7EA 5CZXC 4L4TA 2ZUVA 4NSKA 2UY6A 3QUXD 4KJPC 3V79C 2O5XL 5FGBA 4G9FE 2Z91A 5SV4A 2XKNB 4YBLC 4YHLH 1CGXA 3S96B 3HAEG 3I6KA 2W9LA 2GK0B 3MO1B 2HVKB 4Y8AA 2DTMH 5IHZB 3KYAA 3U9PH 5IHLB 2VE6B 2VUOA 3DURB 3BH8A 4MD4A 2M8XA 2WMPA 5IEKB 1SEQL 4LFHG 5KVFL 5L2KB 5I1GH 4WTWA 5K9KB 5E1AA 2DYPB 1A6PA 5D7KD 3F7RA 3QHZL 3PXHA 4RAVA 5MEPB 2PYFA 4NJAH 1UACH 3U30B 3EYSH 1MCBA 2I25N 4KV5E 2QHRH 1NBYA 4UTAH 2NYYD 3NN8A 3WJJC 3RI5F 2UYLB 2FJGA 1U8MA 1JVKA 4X8JA 1A1OA 1U8JA 5DLML 2AV7A 2JKXA 3FB7A 2Z35A 3T4AB 3G5YA 1FFRA 2HFFA 4DW2L 4UT6H 1MSPA 5B4MD 4JKKA 3Q1SH 4P2RA 3KLSA 4G7VH 4P2OA 4NHCL 4OV6F 4KQ3H 1YMHA 3MV9A 2R0KH 4IS6A 1FJ1B 1G7PB 5HYJA 1Q9WA 3RZWA 3UBXB 2Y4SA 5I1IH 1J18A 2FEEL 2XT1B 3MV7A 4P57A 1ZT1B 4KK5D 3UROR 3GHEH 2VQ1B 1XT5A 1K8DA 4R3SA 8CGTA 5JW4N 5F8QC 4KHTL 5E8OA 5C07B 1X6NA 4K55A 5B39B 1CR9H 3MZTA 2V17L 4P2CG 5DZNA 2YK1L 4G9FD 2H32B 1U93B 2D7TH 1PZ5A 5C09A 2HFGL 3RVUD 1A1NB 3N1MC 3IFOB 2ICWB 1OB1B 5HI3C 4ZUVA 4M4RA 2X4SB 4JFEB 4TVPD 1MRCL 4PP8C 1T2QL 2UZIH 4M1CD 2ESVA 5L8KB 2QBWA 1KIRB 4KVNL 2BRRL 4RIRB 1KXQE 1KACB 3AREB 2BVPA 4NGHL 4XNUL 1UWEL 2AGJL 4NYLA 4Y88A 3SJVE 4MX7A 2FECI 3BPLC 4MCZA 3RWHB 4Q9CA 1NFIB 2DQUH 3EYUL 4HKZA 4WI5A 4YDJB 2C5DC 1P7QA 5J4MA 2XY2A 5EZJA 3D3VB 1Q0YH 5EOQH 2QQLH 1ZGLB 1MAKA 4ODXA 3EJJX 4QGYA 4RDQG 2C3XA 4ZFZA 4MJ2A 2F54E 2AK1L 5EOTA 1XR9B 4MAUL 5GS1B 2CK0H 1D5ZA 1PQZB 2V2WA 3LEVL 1F00I 1A02N 2CLZB 4U6XB 1CDCA 3VFUA 4GJTB 2V9RA 4PJEA 3PF2A 3PWPB 2O5XH 4XCYA 4UV7L 3G6DL 3QXVA 1MLBB 1JFQL 3GMLB 4P3DA 4X99B 3L6FA 3EO1A 3TH2T 4QHUA 1MRDL 3T0VA 1WV7T 3FZUD 2EDRA 2PXYD 1F8TL 1SEQH 4JKMA 4DGIL 4N0FA 4P2YA 4LSUH 1P4LB 3UAJC 4OTXH 1HN1A 3QFJD 1Y0LA 3LN4A 4P9MH 3QHZH 3P73A 1IC4L 1DSFL 1CK0L 4FZEL 1FL6B 4LCIH 3CVHH 2P8MA 4MA3B 3ZSSA 3QIBB 4I1NB 1KIQA 3MC0A 3SBWA 3UJJL 2R2EA 3EO0A 5FGCB 2CKBL 4PP2B 2O61A 4Y4KD 4PJGA 5DLMH 3DETC 5B8CC 3DX7B 3VD5A 3WFEH 3JWOC 3DROB 3D39D 4M61A 1X4YA 2VABB 2Y5EA 4DEPB 3IXTB 2A6DB 4GLRH 1PG7W 1ZHLA 5EO0B 8FABA 3T0BA 3C9NB 4P2RE 1QTYT 1BAFH 1EV2E 5K59E 2AABL 3H9HB 2ATKA 3CD4A 1NGXA 5IVXB 2NXZC 2XV6B 4Z0BL 5GRWA 1PVHA 3B9KC 4HWEL 3P4OB 2BMKA 4RZCA 3MV7E 3KLAA 5E4IA 2BVQA 1UH2A 1HINL 3DVFA 5J11C 3L3JA 2AK4B 5HYSG 4I2XE 2V17H 5FO7A 3MRMB 3VG0H 3BRDA 3C6SB 3HZKA 1WZ1H 3K4ZA 5GIRA 1BGXL 2YK1H 4PJXF 4ONHA 5D1XA 4WUKL 3IAQA 4HX1A 5C09E 4S0UC 3V7AE 2BC4B 3NGBB 4ZUWA 4MXVF 2AI0H 1LO3H 3WNMA 2ZOLB 3FQUA 2F8OA 3K1DA 1UKTA 1KTKE 3HI5H 1I8KB 1PKOA 4I3SH 5E2TL 2K3TA 2IBGA 4X6CE 2DWEA 4EUPH 1T2QH 3NA9H 1MHEB 3DVIA 3F7PC 4Y2DB 3STBA 4X0KA 3EYOB 2PETA 1ED3A 3AS2A 4IMLB 5E00A 4KVNH 4OZIA 2BRRH 3ULVC 1NC2A 4LHUD 4NGHH 4XNUH 1UWEH 2AGJH 2FLBT 4NP4L 3RGVB 5JR1L 4Z78A 3OKDA 5I2IA 3FRUB 1HYSC 1BQSA 3EYUH 2D0FA 3PHQB 5T1KA 3OR7A 1I3GL 4TNVF 5J1AA 3QDGB 1UC6A 4ZS6C 2C3GA 3PJSA 2X05A 1T1YB 4DJMA 4YNYA 2X9YA 1MF2L 3CH8A 2AK1H 2Y5TA 3TF7A 3GKWL 4LNRA 1IAOA 4OI7A 1A0QH 1JF6A 4DK6A 1LNUB 4TPRH 1EDQA 2DDQL 1UCBL 2V5YA 1ZHBB 1YEGH 1T7YA 3DMMA 4P46D 2E27L 3L3IA 3VFPA 4LCWA 1YPZB 3PWUB 4NZDA 5EIIB 4GW5A 5C9KA 1JFQH 4JFXB 2LVEA 2CRYA 2LU3A 4Y5YA 3MLPA 4PTUB 4DTGL 1M7DA 1MRDH 3QIUB 2OL3H 1MHCA 4JFPB 1F8TH 1XGYL 4DGIH 3QCTL 2VN7A 2DOCA 1MRFL 4PJDB 5GGRB 1C5DB 2NY0B 2HN7A 2FYYB 4X6BA 1CK0H 3TZVA 4FZEH 3RTQA 2G75A 4L8SC 1MFDL 2DRUA 4NO3A 4XTRD 5CGTA 4OGYH 4NC0B 1C08A 4JLRA 2CMRH 5KSVA 2DKMA 3GGWA 1OL0A 3HPJB 1AKJA 4HIIB 4PJGE 2E7LA 2N7AA 4HF5L 4PJ9B 4X7SL 1SJHB 5EUOB 1F58L 2XIDA 1T04B 4PJ7F 4U2YA 1KN4L 1I1YA 1WTLA 4APQC 3RBSA 2BHUA 2YPKA 4YFLI 1MCCA 1RZGA 2AABH 2Q87A 3B4NA 3MLTA 4P2QA 4HUUB 3ES6A 3VXPA 1IJ9A 3NFPA 3L3KB 5M7QA 5FO9A 4XC1H 2DKUA 1H8NA 3QCVH 3AB0C 4HULB 4GFTB 4HWEH 2SEBA 3C5ZC 3H42L 3J8F7 4MA7L 3HZMB 1MCNA 2MNUA 4XNXL 4BSWA 2OI9A 4N90D 4GMTL 1W0VB 5E8NB 3SOBL 5I1DB 4KKLC 4OIIH 2GJ6B 3MRHB 3HAEB 5ANMB 4E5XA 1AI1L 1AXTH 4JRXA 1TZHB 2EDKA 1QG3A 2JLLA 4XWGL 4U1IB 2ZCKH 4NKOB 4WUKH 3VFMB 3VH8A 1AO7B 1A7RL 4U3XA 1MCSA 3UCRA 1KJ2B 1MI5B 5KSUB 1J1PL 5MEOA 3AS1A 3UEZA 3V6OA 2BVEA 1OD9A 4WUUD 1IGYB 1RFDH 3FONB 4HUVB 3DUSB 5E2TH 1X4XA 4U1HB 5CGYC 2BOBB 3MUHL 4HK0B 2JJSC 1FDLL 1UEYA 3QQ9D 5E6ID 3O9WB 4I77L 5ICYB 4N0CC 4OZIE 2HVJB 3NFSL 3HPLB 2Y36L 5JOPE 5JW5B 2QADC 1JZ5A 4NP4H 4QRSB 5IROA 5HD8C 1EO8L 1DVFB 1RUMH 3A6BH 4PJCA 1IGCL 3PL6C 4M8QB 5D7JD 1Y18A 3O3BB 1NBZB 3GIZL 3S5LB 5JOFB 1AGBA 1VEPA 4EIGB 1HDMA 1TNNA 4CJ1A 1RVFL 3MCLL 4HV8A 2J12B 3BO8A 5FYLH 5TE7L 5IB3B 3FQTB 4LLYB 4X5XB 3VMOA 2ZP0T 3L9RA 3L3GA 2DDQH 3MX0A 1UCBH 4KJWC 5CJOL 4AQOA 1CLYH 2OJEA 4QTHA 1U3HC 2YUXA 4Y4FC 2IPTH 3EDJA 2CIKA 5HHOA 4QRQA 4MJ4A 4LCWE 4UV4L 5FKAB 4Y4HC 1DQQB 3LMJH 1DEEB 3CCHB 4DTGH 2QQKL 4NQED 4RA0C 4ESKA 5JXEA 5DRNB 2XKSA 2JJUA 3QXDA 1R3KA 4GKNB 4Q58C 2DQJH 1WZLA 5K9OB 4OIBA 4H26A 1MRFH 2ZJSL 1QR4A 4WTZG 4DKAA 5ESVA 4BQ8A 4I13B 4IMKA 2GTWB 4NQCD 1ROWA 2HP4A 1RMFL 4MHHI 3OZ9H 5ESQA 1MFDH 3EKCA 5ISZB 1I1AD 2AQ2A 2CDEB 5C0DB 3G9VA 3QBTB 4D94A 4MXWL 1WCQA 3B83A 3TBSB 3ZHLA 1JZ2A 4QT5A 3QA3A 1NC4B 1MLCB 3ZKXB 2IALB 3V95A 3BEWB 3C6LB 4QY8B 2E7LE 1F58H 2V5TA 4WVRA 3VRJB 4YFEA 1KN4H 1XGTB 4NKMB 5IVOA 4WHCA 3HUJB 4ZTPH 1WBXB 4WI7A 1FO0A 1ZHNA 4KHXL 5IJVB 1WFUA 4HCRL 4EIZC 5KVEL 4KDTC 4P2QE 4GS7C 2VXUH 2IH1B 3X11A 2BNQA 3QHFL 2GSGB 3A67L 2CKNA 4G8EA 4MA7H 5CJ8A 4XNXH 5AYQA 3ESVF 1QO3A 4W68A 4F15B 3VGAC 3BDYL 4NC1C 4PJAE 5DJYB 1RU9L 1S9XB 1XIWD 1K2DB 2Y72A 3SGJA 2IFFL 1A9BB 5TFSL 3VJ6A 1GC1C 1RJYB 3E2HB 4JM2B 5C0AA 2R0ZH 4FA8A 1HNFA 2YRPA 3QG6B 4ZODA 2I9LA 1M7IA 4HUNB 4QHKI 1IEBA 4D9RE 4J2XA 4HJJH 4K3EL 5BQ7B 3RVUC 2C3VB 3EJYD 4O4YH 1FDLH 3OGCB 1S7QB 1OQXA 4L9DA 4XMPL 3VW3L 1ONQA 3QYCA 4I77H 3MJ8A 2A83B 2F8VA 1UB5B 5T3XD 3IFLH 2Y23A 5ID0B 3TO4B 3M8OH 2PW1A 4YFLF 4U0QB 3H9SA 1EO8H 3OXSA 2XI9A 2E5EA 4UUJB 2DQEH 4PJCE 3OB8A 1XF4A 2EXYC 3SQBA 3GIZH 3IKCB 1M05B 4DK3A 1T3FA 2P4AB 4RFEA 5J56B 3JV6A 3U4BL 2WAHA 4JO2L 4D0BA 3HRPA 1YY9D 1MJ8L 4KJQD 3QH3A 2EE6A 3LY6A 3JWOH 3KYNA 4M7JH 4HK3J 3VE0B 2YWYA 1R3JA 1FBIL 3GSRB 4M6NH 3WS6C 4R26L 3SDXB 5CJXA 1W72A 1NAMB 1N6QL 5J1TC 5EFIB 3U82B 5GGSB 1CLOL 2MPAL 1AGCA 4UV4H 5HYSB 3B2UC 1T5WB 5CP3H 3UMTA 2FNBA 5I6XC 4LVNC 2X70A 1LO5A 2ICCA 1QBML 4JFFA 3U46B 3HC3L 4U0RB 3SE9L 3RVTC 1IILE 4K7PX 2ZJSH 3RIFK 5I75C 5DJ6A 5L7XL 1K6QL 2B4CC 4Z7UF 1YNLL 3EJZC 3ILQC 2Q7NA 3AAZB 4H1LH 1SQ2N 5KSBF 2DB8A 4PRNA 1D5MB 4JO4H 4D9RD 4WY7H 2DF3A 2E9WA 1JGVL 4PJ5D 4D9QE 3O8XB 5HPOA 3QWRA 2Q8BH 1NL0L 3ILPB 1FG2B 2VLJD 3GJEA 4GRLA 4R90L 1WWAX 3E0GA 3MRCB 4OLWL 4X6FB 1JZ8A 4JG0L 4L8CA 4ALAL 4M43L 3OB0H 3VDAA 2WWKT 1YY8A 4NWTL 5FB8B 3ULVH 3TIDB 4B0MM 4O00A 2OMNA 5DJDA 4LPWA 4OBSA 1P7HL 4KHXH 1KCVL 4HCRH 2H2SC 2HTLC 3V0VB 5JUEL 1JN6B 2GSIA 4LPCA 4YZFF 3TJHA 3QHFH 1HHKB 3A67H 3PWVB 3SKJH 2R23A 5GRUL 2BNQE 1LDSA 3WSQL 2NX5D 3RWJA 2P5WD 4Z9KB 3DVNB 4NNYB 4U7SA 1CBVL 3HB3D 4WHYG 1MREH 2ARJB 4GXVL 5CCKH 3TYFB 4LARH 3MRIA 3ZT7A 2DBLL 2GITB 3K3QA 3MUZ1 3MBEC 2VLLA 2Y9RT 3MR9B 4LNVA 4ZFOL 1FV1B 3RWCB 3OX8B 4X4XA 4LDEB 2NY6B 1KYOJ 4ZQKB 4NHUE 4UIKH 4PLKD 4K3EH 1HQ4B 5GZOD 3MRLA 3QEQA 1VGKB 5DUML 5CEYB 5F1KC 1N59B 4XPAL 4XMPH 2XRAL 3IFPB 3ARFB 1EFXA 4HWUA 3HG1B 4JB9L 4YUEL 2YKLL 4AM0B 4F3FB 4GH7B 5HDOA 1TZIA 1RIHL 1SEBB 1DLFH 4L3AA 4MQ7A 3VWKB 2RAMA 4CW1A 3H9SE 3L95A 1ZEAH 3N50A 4QCIB 1IGIH 1RUPL 2Q6WA 4ZPVA 1NLDL 4ZUTB 3U4BH 4JO2H 1SY6A 4XVTL 3NIDE 4M93C 2O5YH 4OD3H 2LE9A 2ZSWB 3QULA 1YEEL 3HNSH 1ND0B 4BSJA 4ZDHB 2FX8L 1MFBL 5KSAD 3UYPA 1CLOH 1EGJL 2MPAH 4JDZA 5DJ2A 2MSPA 2R2BA 1MEXH 4JQIL 4DCQB 2L7UA 4P2OC 4OCSL 3FN9A 1UM4H 4NBYB 2GEEA 4KXZI 4JFHD 4YEEA 2VJXA 1MCOL 2PNDA 4JZJA 5D5MF 4CN6A 4Y5VA 1B2WL 1Z3GH 3H8NA 3QG7H 4ZXBD 4ENEC 4BQCA 3PE9A 3IYLW 1I8LC 3OG6B 3STLB 3HC3H 4JFFE 3X12A 4GXUN 3SE9H 5E8DL 3GSNB 2DD8H 4MAYA 1G7JB 3PIQA 3PABA 5MP6H 1K6QH 4G8IB 1YNLH 5DD0H 4Z0XB 4HZLA 3QRGL 4JN2B 4XWOD 4YH6A 4MYWB 3QR2A 5D7LB 1EJ6A 1GC1L 3CVIH 2VIRA 1XH3A 4PYGA 5GISL 3UYRH 1NL0H 4G42B 1X4ZA 2DLFL 4NN5C 4KTDL 3GBNL 4H8WC 3FFCD 2WY3A 1A14L 4IRSB 4OLWH 4CKVX 4JG0H 3ULUE 1H0DA 1WFNA 4N0YL 1V3KA 3PQYA 4LKXB 4NWTH 4A6YL 4Y1AA 2EDBA 3EFFA 4TVPL 4Q0XL 2CUHA 3QUYB 2YPLE 3VMPA 4PV9A 2Y7QA 1KCVH 4QO1A 4R4BA 2LFGA 3WUWB 1S7SA 3DARA 5EU3A 3MPCA 4TUOA 5JUEH 1A2YA 1F3JA 5A43C 2W65A 5CAYB 1YPZF 2WZPD 2DAVA 3R1GL 4MHHG 5C86A 1PW3A 3G08B 4FFZH 3RDTB 5TQ0L 2OTWA 4C56E 3IFNH 1JGDB 5JHDB 4GG6F 3LKSB 1QBAA 1IQDB 1ORSB 4RGMC 4LIQH 1L0QA 1RURH 4M1DL 2AJSL 4PJ8D 5EU6A 3N85L 3WIHA 2NLJA 4F8TA 2C7UA 2J8UF 3IETA 3RWFB 1OAYH 5FUCE 1KEGH 4H20L 5ID1B 4GRMB 1UXSA 2F53D 3FOLB 2ERJB 3GJFH 5D6CA 3VXSE 3NAAL 4HXAL 2YA1A 3VWJB 1J1OL 4GUPB 4Z7VB 1DUZB 3PHOA 1G7MB 5E2JA 1AQKH 2C1PA 2V7NB 1WITA 4GQPH 1ZVSB 1C7SA 3W5NA 1BIIA 1S8DB 2XRAH 1C8PA 1R5VA 4HS8L 4JB9H 4QRTB 4X7EC 3T3PF 2B4CL 2AVGA 3SDAA 3D85A 4O51A 4ORZC 5I8OH 4NUGH 5D7SL 4WFGD 4X6EA 1E27B 1RUPH 5JPMA 4L8DA 4ELKB 1AQDB 5DURD 5DQDH 3NZ8B 4CVXB 4F9LA 5I19L 1WCBA 1I1FA 4XVTH 1J5OL 5D7JC 3SBWC 3D25B 1II4E 5EU7E 3KXFD 5D1QB 4PLJC 2AEQL 5CJQH 2X1XR 2YPLD 1MJJB 1YEEH 1ZANH 5L8LB 2XKNA 2FX8H 3S96A 1MFBH 2GHWB 3R8QA 2NY5C 1BZ7B 4JFDB 1EGJH 2GK0A 3MO1A 2HVKA 5BXFB 4JQIH 3HFML 4OGXL 3WHXB 1QKZH 1LO4L 2VE6A 3DURA 3LD8C 3G6JB 2H1PL 3EDDA 3DTXB 3UTTB 4CGTA 5L2KA 5K9KA 2IQ9H 5TH2B 2DYPA 4LPVA 4C56D 1E6OL 5MEPA 4KROC 4OZGF 5IFAH 3CFEB 2NNAB 4HUXB 4DZBA 2AXGB 2NY4B 4U2ZA 3OV6A 2PTUA 1GC1H 2UYLA 2XZQL 1INEL 3HMXL 3VXSD 5GJTL 4ONGL 2KBGA 3WHE1 4WO4B 5D1XC 3T4AA 2RFXB 1DQDH 4KTDH 2VDOL 1A14H 4ELMF 2WBJB 4FS0A 1EEQA 3QDMB 4WFFE 4FQIL 3S35H 4N0YH 2JIXD 3PQYE 4P59H 4WWKD 1QFWH 1FJ1A 4Y1AE 1G7PA 3BP5B 4UI2A 3UBXA 1SJXA 1PJ9A 3O6KL 3LB6C 1ZGLM 1ZT1A 1BECA 1VPOL 3BIAX 1KBGL 2VQ1A 2P8PB 3BJLA 5AEAA 4FZ8H 3S37X 4QRRE 5LWYH 5C07A 3GSVB 5B39A 4J3VA 3DSNA 3R1GH 4CVZB 2CKBB 5INCB 3T2NH 5TQ0H 3WNKA 2EICA 1U93A 4LLVB 1MAJA 1A1NA 1IMHC 3IFOA 3IS0X 2ICWA 4MA1B 3TF7C 1OOAA 3N85H 4I18B 4YHKH 5EU6E 2AS5M 4OLVL 2X4SA 2APFA 4JFEA 5BO1H 1IGTB 4ZOEA 5DA0B 4OLUL 5D7IE 3DMMC 3NAAH 4HXAH 1D9KB 35C8L 1J1OH 4Z7UA 2HJKB 1ACZA 1KIRA 1UWXH 4S1DD 4RIRA 4KK9D 2VRAA 1T03L 3RZCD 4Y5YC 5I15H 5FCUL 1FZOB 5I76B 5GJSH 4U1NB 4X9HA 2EDJA 1NGYA 2ILLA 4K3DL 4HS8H 1FFPA 3RWHA 1NFIA 2BY2A 1OTTD 2B4CH 4YDJA 3FAWA 2G2RB 2DJ4A 4TSAH 2D4FA 3D3VA 2OTUB 4QWWD 1ZGLA 2YD4A 5HHNB 1D5BB 2AW2A 4P5TD 1X5LA 4G3YL 3TZVC 3MROB 1IAIH 1XR9A 4I0PB 4G8FB 4XNZC 5GS1A 1PQZA 1J5OH 2CLZA 3OJDB 4U6XA 2AEQH 2Q86B 5F7NC 1JPSH 3PWPA 2EKJA 3MREB 4KJQC 2E7LC 3X3FL 4H0GA 3S3PA 1ZK9A 1MCWW 1MLBA 3PWJB 3GMLA 1PLGL 4X99A 5F6HJ 5F88A 4FTVB 1JPST 4QRRD 1L8JA 3REWB 1OGTB 3LKNB 1NJ9B 5I71C 4V1DD 4RX4D 1RI8A 4KKBD 2H1PH 5F9OH 1P4LA 3CZJA 4LRNH 5L2KE 3TM6A 1NGWB 3I6LE 4XCNB 3SDDC 1GGIL 5BV7B 4R2GB 3ZL4H 1FL6A 5HDBF 2YXFA 5DJAB 3KVQA 2M26A 4KVCL 5FDYA 4MA3A 3QIBA 4UIMA 2Z4QA 5ESAB 2A2QT 1HKLH 3WFZA 1FNAA 9CGTA 4MQSB 4PP2A 5FHAL 4M48L 4MDIA 5JDSB 1G7LB 3WV0A 3DROA 4KDVA 2VABA 1JZ6A 4LVHC 3IXTA 3DSFL 2A6DA 4QXGL 1T21B 2P7TB 4PJFB 1QYGH 4HLJA 5EO0A 4ZFGH 3C9NA 3WIFB 3BQUD 1AGEB 2EDFA 3H9HA 5IVXA 4F57H 4U1KA 4JKPL 5KTEL 1KCSL 1ZE3C 3EYFB 1VPOH 2JJVA 3P0VH 4BZ1L 1KBGH 3SDXF 1OGAD 1DFBH 3NFNB 5IROC 4M1GL 3OG4B 2AK4A 5TDOA 5HJ3B 1NMAL 3CK0L 4NRYB 2LAAA 2DMCA 1QSEB 3P0GB 1G7HB 4DGVL 2YC1B 3TBWB 3MRMA 3C6SA 5KG9B 3IDYC 3X13B 2J3SA 5LQBL 3KLHC 5SWSB 1JFMA 5KVGL 2BC4A 4HGMA 4PRHB 1JE6A 1OAQH 4GLRI 3PV6B 3BT2H 1GHFL 1I8KA 3OPZH 4LL9A 3NH7L 4WW2B 5F7KC 2GT9B 4NNPL 1G6RA 1RHHA 1MHEA 5HHQB 35C8H 4Y2DA 2QJDA 3EYOA 3Q0HA 4IMLA 2Y06L 1DANU 4QLRA 1PKQB 4KU1A 2V7HB 3D69B 1IT9L 1GCFA 5FCUH 4NO0D 2B8OT 1MJ7L 1DQLL 1EEUA 5GZOC 2WBKA 3KPPB 2DQHL 3D9AL 3FRUA 4K3DH 5DMIL 5HVGB 3TYGH 5JXEC 3Q6FB 3PHQA 4WFHE 2NXYB 5I1CH 1YA5A 2QR0B 3TO2B 3QDGA 4RWHA 1YJDL 3D3VE 4YO0B 3B3IB 1UM5H 3MCG1 4FQXD 2N4IA 5DDHB 4UQ3B 4G3YH 1N8ZB 1JYNA 4ETQB 4H8WH 1V3JA 2J4WL 2X40A 3OAZK 1LNUA 2NW3B 2W0PA 1I8IA 3CU1A 1ZHBA 3NOIA 4WHTB 3PWPE 2IBZX 4U7MA 4XMLH 1YPZA 3I2CL 3PWUA 3HC0B 5FYJD 5J13C 1IEAB 5EPMB 2UZXB 5EIIA 1T1XB 3F7YB 4JFXA 1GXEA 1PLGH 3ME0A 4PTUA 3GJFK 3KPMB 2FCBA 2APXA 3V4UH 1PG7X 3QIUA 4DGYL 4OB5H 4QHNB 1OY3B 4X83A 3EGSB 1UM6L 3MQIA 1T0NB 1DBMH 5EORL 3MLZL 4G8GB 2FX7L 1C5DA 2RB8A 2HLFC 2GKIA 2FYYA 3LIZL 1MCQA 2BSRB 4NZJA 1R3HB 4P49A 1A6WL 4N8CH 3BWAB 4F33B 1RZKC 3HPJA 1U8QB 4JGJA 4HIIA 5GS0D 5FGCE 2Y6SD 2F19L 5FKPB 1LP9F 2VOTA 1ORQB 4PJ9A 1SJHA 3BZDA 4ZYKB 5EUOA 3QWQB 2GQHA 1J0ZA 3DSFH 3FO2B 1S9VA 4LGSB 3ARED 1RV6X 1T04A 5I8CB 4YDKL 4MVBA 1YQ2A 3CMGA 1S7RB 3ARBD 1PEZA 4UB0L 2OSLA 4WFHD 3MV8D 4HUUA 1NCAL 3ZYJA 3L3KA 5IVXE 4JKPH 4TNWF 5I1HH 5AWNL 3W0WB 5DRZB 4H1LB 4BZ1H 1YEJH 5EA0H 5T3XL 3HZMA 4R4NC 3UX9B 1YEHL 1NMAH 1KPRB 2AK4E 2IAMB 3CK0H 5J06A 1W0VA 5E8NA 5I1DA 5H35B 2IC2A 2GJ6A 4KUCD 2XTJB 3MRHA 1V7MH 2VLME 3HNVL 5ANMA 4XP6H 2D31B 1TZHA 3WHE0 1OP9A 1F5WA 2BK8A 4POZC 4U1IA 2KZWA 2FRGP 3VFMA 1AO7A 5KVGH 4U3HA 4K8RD 4PGCB 1VESA 1KJ2A 5KSUA 1EJOL 1CXIA 1IGYA 1SYVB 4JN1L 3RHWK 1GHFH 3FONA 3OQ3B 4AEEA 4HUVA 3DUSA 4ZG1A 5CJXC 3ZKND 4U1HA 3QO1B 3DO7B 4O2CB 2BOBA 4HK0A 1KB5A 2EC9T 1HHIB 3SEPA 1ZLSL 2Y06H 3O9WA 2VNCA 5ICYA 1S7WB 2HVJA 3HPLA 1IT9H 3NPSB 1QLRA 4HXBL 4V2BA 2K9UA 3MLUL 3UPAA 1DQLH 4QRSA 4G6MH 2YD8A 3BGAA 2X89D 1DVFA 1CIUA 5DMIH 3TIEB 3ARGD 1QEWB 5C08D 4M8QA 3HA0A 1NBZA 3O3BA 3S5LA 2YRZA 5LCVL 5JOFA 5JLZB 3QDGE 1OT1A 3HN3A 1IGFH 3TVMB 5C6PB 2VR5A 3MV9D 3U4AA 2J6EL 4J3WA 4OJFL 5IB3A 3FQTA 4KDWA 4LLYA 4X5XA 4LAQL 3BP7B 5DSCB 4PS4L 3KPSD 5FDWB 4NQVB 4GRLC 3RVVD 4BUHA 1M1SA 5JMRA 3VD9A 4LVOB 3ULUC 1WC7B 3IU3B 5ACZB 3S88H 5FKAA 1DQQA 1ZV5A 2E9IA 4OFDA 3CCHA 1BD2D 3O6LL 4DGYH 1FFOB 5FUOH 1U8IB 4GQ9H 5DRNA 2OR7A 2JK5A 5EORH 5FIEA 4GKNA 1OSPH 3MLZH 3BKJL 5K9OA 3UZEA 4AY0A 2FX7H 2PO6B 2XN9B 3C60D 3TP4A 4PJDE 3T0EA 5K93A 2V9QA 3D0LB 1WWCA 5ISZA 2CDEA 5C0DA 1A6WH 4OM1L 3U1SH 3IJHB 5KN5B 3TBSA 4PGDA 4LDLB 4I9WE 1DR9A 1CDJA 1J8HB 1MLCA 1NC4A 4WI4A 2F19H 2IALA 3VGDA 1AC6A 2A6IB 3BEWA 4QY8A 4MB4A 5FUCC 5JW3H 5EUOE 4M4PA 3VRJA 4UNVA 4YDKH 1XGTA 3TT1L 1Q0XL 3KGRA 4NKMA 2WW8A 3HUJA 3RGVD 3TBYB 4I48B 1WBXA 4UB0H 4NO2B 5IJVA 3BD5A 1OTUC 2EO1A 1NCAH 4S1SL 3KLDA 2VLKB 3MJ9A 2KQNA 2IH1A 4FQJL 4AYFA 1HK6A 5AWNH 2GSGA 1H5BB 1XF5B 2WIMA 2NY1C 3WIIH 5EG6C 4PIRF 1YEHH 3CX5K 3WL9B 2Y1VA 3RIFF 3WKML 1FLRH 4MGXA 4YAQB 5DJYA 2GJ6E 3HNVH 1S9XA 5ANME 1KUMA 1K2DA 3LEXB 1LDPH 3OAUL 1C16B 4R96B 5HY9B 1A9BA 1JNNH 2QSCL 1RJYA 5EU7C 1RULH 1AO7E 4JM2A 3E2HA 3QG6A 4FQLH 2B1AL 2WP3O 1EJOH 1MI5E 7FABL 1KV3A 3GSXA 2G9HB 3VXOB 2OX5A 5IMOB 1P4BH 3KPTA 2X4PB 2C9AA 5BQ7A 4I0CC 4KWUA 5F1NB 4TUJB 2C3VA 4MZ3A 3VXTB 3F6IA 1FIEA 4WGVB 3OGCA 1S7QA 4JPKL 2DKSA 2A83A 1EMTL 1UB5A 4LLWB 2NY0D 4OM0L 2F9BT 5ID0A 3TO4A 4Z6AT 4FQQB 4JZJC 3MLUH 2R1WB 4Y5VC 3L5WA 2YXMA 3QEGL 5DMYA 4UUJA 5FK9B 4JKLA 4AL8H 3U7YH 4XBEH 1RZKL 1M05A 4MAYC 3D6GA 3RNQB 4ZFOB 4JRYB 2QQNL 1JRHL 1VADB 2J6EH 1LWRA 3QUXB 4OJFH 4KY1L 1NGQH 3VE0A 3IXAB 4QWWC 4LAQH 3ZDZF 1EEZB 3GSRA 4HH8A 4UBDC 3SDXA 3KR3H 1VKXB 1NAMA 2I24N 1P5UA 4FXLA 5EFIA 4UAOB 4G6KL 5GGSA 2P49B 5T3ZD 3O6FD 1T5WA 5DI8A 3MUGB 1LE5B 5JTWA 1FSKB 2ENSA 3ZE1E 1KT2B 4Y2OA 2ZG2A 4P48A 5I74B 3P30L 3BKYL 4WW1A 2EEAA 1CFTB 4XXDB 2FD6H 1OW0A 4HG4K 1QZ1A 1ZKAA 4M9OA 3WE6B 3AAZA 5KS9F 1JGLL 2W9EH 2JCCB 3L5IA 2CR3A 1MI5D 1KB9J 4EI6B 3MCKB 1D5MA 5ISZE 4LFHD 2JB5H 3O8XA 1FG2A 5E4EB 4XMKH 3QAZB 3HLAB 3RWGB 3U2SB 4X6FA 3MRCA 2X4QB 1ZVYA 4ODHL 4MS8D 5FB8A 1CT8B 1KJ3H 3TIDA 1Q0XH 3BN9D 4JM4L 4JQVA 4OQ1A 2BERA 1M71B 2VDMH 3HUJE 3OKNB 1TTUA 4P23D 3JWNC 3MLWL 1DQTA 3K46A 4S1SH 5J89A 4LOUC 5JPNB 4OLEA 3V0VA 1JN6A 2ED9A 1HHKA 1AJ7L 2EYSB 3WXVH 3SCMD 5JIPA 4M03A 2AEPL 3DVNA 4JE4B 3ARUA 4G9FB 3WKMH 3OKMB 2X4NA 4LLUB 1YEFL 3F7QA 4LEXH 3BMVA 2ARJA 2FB4H 3TYFA 5JW4M 2L7JA 4M6AA 4F9LC 3CFCH 2GITA 2VN4A 2IPKB 2ZNWA 2OXGA 3H7BB 1T89C 3ULUL 4A6YB 3MR9A 1FV1A 1U58A 3RWCA 4ZMAT 4GBXD 4TQEL 3OX8A 4GO6B 2B1AH 3HHRB 2VAJA 4JVUA 4ZQKA 4UT9H 1X5GA 2D7NA 4UILH 2V2XB 3MRGB 3C08L 1BIHA 1VGKA 3RTQD 4EI5D 4XHJD 5CEYA 5ADOL 1N59A 4JPKH 3T2PA 3BISA 3KS0J 3IFPA 5F93C 1LE9B 1JK8B 3ARFA 1EMTH 4AM0A 4OCWL 4F3FA 2H3NB 2R1XB 1XFPA 3VWKA 3CIQA 5HGGS 1TNMA 1W2KT 4QCIA 4Z95L 3RWIB 2P48B 2Z0BA 1RZKH 3CSGA 4U1MB 2EDWA 5KOMC 1KCKA 3U30C 4ZUTA 1QSFA 3BESR 2DJSA 3MRNB 3RWDB 3E8UL 4K94L 2WK2A 4KY1H 1TVDA 4R4FL 4BK5A 1AY1L 1ZWIB 5F6IB 3V4PH 1ND0A 4ZDHA 2BRQA 1GAFL 3ZTNL 1TIUA 1B90A 5IBUG 4YPGB 5CD5D 4BFBD 4DCQA 3MLYL 5C0FB 1XGRB 2PXYB 1A9EA 2GCYB 4JHAL 5J6HB 3QFJB 2H26A 2AP2A 5CBAB 2BY0A 3X17A 5ENWB 1GYAA 3STLA 2A0LD 1BX2B 3TNMB 1G7JA 2ENYA 2RIKA 4X7TB 4RNRA 4G8IA 4NO5B 4Z0XA 4JN2A 1KJMA 1JGLH 5D7LA 5IMLB 2NTFB 3IGAB 4Y4KB 1FORL 2ADFH 1RAMA 2A1WH 4EQ3A 5IUSA 2XQBL 3ZE2E 1DBBL 3D39B 5IQ9B 4G42A 4WEBL 3T4YB 4ACPA 4HKBB 1FZKB 4IRSA 5EBGA 2VERN 3L1OH 4OF8A 3WCYA 5GRXG 3MFFB 1WUNT 4LLDB 1H3GA 4ODHH 3MLSL 4LKXA 4JDVB 4OZHF 3QUYA 3WFDH 1FHGA 1JV5B 5E6YA 4RMQA 5DEZA 3ZE0F 3MRDB 3MLWH 3AREC 1U36A 4N5UA 1CXKA 3WUWA 4Y16A 5ICZB 1FAKT 3TPUA 4YHZL 2Z31B 1H15B 2EDNA 2IMNA 4LGRB 1F11B 4HKJA 4IOIB 4QHMB 3G08A 5GRYA 3W9DB 3RDTA 4LQFL 5EBWB 1JGDA 1JHLL 5E7BA 1Z9OA 4N68A 3VU2A 5IQ7L 5JHDA 1IQDA 1ORSA 3C87A 5DK3A 1D6VL 2CRMA 1DTUA 7CGTA 5DFVD 5GS1C 3ULUH 4CN4A 1S9KC 4LSQL 3RWFA 3OKYA 4QRUB 5AZ2H 1KLGB 2DJUA 5A16B 4UNUA 5ID1A 4GRMA 3TN0D 4PR5B 3UZQA 3JBG7 3FOLA 4GW4B 3VWJA 4QHLB 1F4YH 4Z7VA 1DUZA 4LHUB 1GZQB 3C08H 1G7MA 5D8JL 2V7NA 5IVZB 2JELL 4FMKA 3P11L 3HE7D 2GIYA 1ZVSA 1UWGH 5E5RB 5I1JL 1GPOH 5ADOH 5I1LA 1LO0H 1S8DA 1A6UL 4N1EA 4C58B 4OCWH 1DBKL 3HG1E 3GMNB 4HLZH 1EERB 1FYHB 4Z95H 2YOCA 4MJID 3T1FB 3FT2B 1E27A 3HE6A 4KMTL 4BM7A 3MNZB 1AQDA 2XACC 1I4FB 2P24B 4OKDA 3DV6B 3TWCL 3QIBC 1DBAL 3E8UH 3D25A 5ILTL 1S3KL 3MGTA 4YEFA 3QPQD 4XB8A 1AY1H 5D1QA 3OAYH 4P46B 1MJJA 3DRQB 5E94B 2YEZB 2MHAB 3S7GA 5IG7A 3EBAA 1I9JH 1GAFH 1KELH 1U9KA 4DEPC 3P77B 4YHIB 1IGMH 1UB6B 1OP3K 4JFDA 2ADJB 2DLGA 5BXFA 3MLYH 3GRWL 4G59A 3DRTB 3WHXA 4I2XB 4NKQB 1RIVL 3ULVF 4DWHA 1V3LA 3UTTA 3DTXA 2H9GA 4WCYL 5TH2A 3BI9X 1PYWA 4PRPA 3PWNB 3PGFL 5JIIA 1NANH 3CFEA 4HBCH 2ED8A 3KPQA 3ZDXE 4P4RB 1LEIB 1DCLA 1DQML 1SY6H 2X6MA 5D7LE 3RKDD 3EIFA 4R8WL 2NR6D 4WEUD 2XQBH 3UTPE 1DBBH 4WO4A 4WEBH 2XWJB 2RFXA 3VFSB 4Q9QL 2MWCA 3T04D 3NGBC 2KPNA 1G7IB 2WBJA 3U48A 3QDMA 1HHGB 3LQZB 2B1HH 3MLSH 3BAEH 5ALBL 3QWOB 2W0LA 4K7PH 4Z7WF 3BP5A 4DUXA 1J0KA 2EEBA 2J8HA 4Y2DC 1MWAL 1BFVL 2P8PA 3RGVC 1INDL 5BVPL 3GSVA 4KI5E 5D4QA 4XVJL 4CVZA 2CKBA 1H3PH 5INCA 3QXWA 5B38B 4LQFH 1N6UA 3QO0B 4FMFA 3U6RB 4LLVA 1JHLH 1DDHB 2D03H 1ITCA 1I3RB 1C12B 5JHDE 3FB5B 4P9HC 2DBJA 4UDTB 4I18A 4WUUB 3DUHA 1CLCA 4YDIL 2HG5B 2LU4A 4LSQH 5CKGA 5AUMB 4XBPB 2IBBA 3I85A 1IGTA 1IC5L 5CBEB 2QKIB 3ZKQD 3KYKL 3S4SG 3T09A 1D9KA 3MOAH 5E6IB 1U3JA 5IB1B 1QFWI 2HJKA 2BHYA 4Z7VE 5FYJL 5D8JH 2VDPL 5MERB 4HMEA 3P11H 4ZO7A 5FA4B 1A6UH 1KGCE 1FZOA 2FIRT 3JTTA 4U1NA 3TH3T 1FVCB 3KJ4B 3QIUC 2WNGA 3I9GH 1P69B 25C8L 2G2RA 3DPBA 4O58L 3MA7B 4XP9L 1A7OL 2X4RA 2OTUA 4FN0A 3OF6D 4KMTH 5HHNA 2NY0C 1D5BA 1MHPL 1BREA 4URTB 4NCDA 5EH1A 5C6TL 3MROA 2EH7H 3WFHB 2D9CA 2ZOKB 4I0PA 4G8FA 2MCPL 1DBAH 3IJYB 5ILTH 4FG6D 3OJDA 5HPMB 2EDTA 2VKXA 2BOCB 2Q86A 4TSBL 5GS0L 2UWEF 2CD0A 3TJHD 3MREA 4PJ9C 2YMXL 3U9UB 1IFHH 3PWJA 4BUGA 3V8CA 4DUVA 4FTVA 4MVBC 4NQEB 3GRWH 2D2OA 2HRPL 4Z7QE 2BSSA 1OGTA 3LKNA 1RIVH 4ZOCA 3L5JA 3WJJA 4KRMB 3EOAA 3CPLB 2LABA 3G6JE 3UTTE 4R7NB 3AS0A 1NGWA 3TA3D 3RKPA 1OTSD 3PGFH 4XCNA 4NQCB 3HR6A 4JPWL 4KK6D 2X4TB 4AIOA 2NQCA 2IAND 1I1AB 5C0ND 5T1LD 4JDTL 5CWSB 2XQYG 3IAPA 4PRDB 1AD0B 4K9EL 1WVZA 3LOWA 2DQCH 3W9EB 3SGDH 5JDSA 1G7LA 1HQRB 4Q9QH 4K8RL 1ACYH 5EU5B 1KGCD 4ODBD 1K5NB 2P7TA 4PJFA 4Q2ZB 5E1HB 2OP4H 1N0XH 3WIFA 3QDME 4ZUUB 5BRZE 3CSBA 2R9HC 1AGEA 1JF5A 1DQJB 2H2PC 3CZFB 3NPZB 1F90L 3LQAC 3VI4F 4KAQH 3RQ3A 4W6YB 3EYFA 1BFVH 3DVGB 4FXKB 3ABZA 1FZMB 3NFNA 2NY7H 4Z76B 5BVPH 1DVFC 3UTZB 4P23C 1U6AH 4NRYA 4KUZH 1J86A 3VXNB 1QBLL 1KEML 1QSEA 1G7HA 3TBWA 4LQ1A 2CIIA 1XIWB 4F58H 5KG9A 3X13A 5DD5H 1UQSB 4QHKJ 2IPUK 3TT3L 1BFSA 1UVQB 5AD0B 4XPHL 3VFNB 4PRHA 4UQ2B 1BVKB 3AU1B 1A1MB 3PV6A 3QXTA 1IC5H 3KHQA 1AGFB 4WW2A 5T33L 2GT9A 3F8UB 3QNZB 1F4AA 2FDBP 4M3KB 4JG1L 3RWEB 1NCDL 1PKQA 3OJMB 5IBLD 3SDYL 5JW4R 2V7HA 3D69A 3EHBC 4YHMH 4RMTA 2WM0A 2HMIC 4TSCH 4AH2B 3KPPA 3Q6FA 3QJHB 4M7ZB 4QEGA 4G6FD 2QR0A 25C8H 2JJWA 3TO2A 4BSVB 4OGAD 1CYGA 5J12B 1J0HA 1BJ1H 4J4PD 4YO0A 3B3IA 1MHPH 4DKEL 3B5TA 4Z7NE 2H32H 5DDHA 4UQ3A 4XGZB 1N8ZA 4JY4B 4ETQA 1P1ZB 2MCPH 3PWLA 3GMRA 2WIIA 5IBTL 4WFED 3WJLA 5BRZD 1OAKL 2VISB 4TYUA 2NW3A 5BS0D 1KULA 5E9DD 1KPVB 3ZKXC 3L5XH 4FQCL 3H9ZA 4YX2L 3TLRA 5FAAA 5KVDL 3C6LC 3MRJB 2EZ0C 3CSYB 1IEAA 5EPMA 3V52H 5A3ID 1FN4B 1T1XA 3F7YA 1ZA6A 2DI7A 3ARWA 1CDHA 4NCC1 3KPMA 3VGHA 4FTVE 5E2WH 1K8IB 1AE6H 4WEMB 1GIGH 4QHNA 4EVNA 1JGEB 2G60H 3GUTB 4PJAB 3W2DL 5HYFA 4HGWA 4LCYB 5CSZB 3DV4B 1H3TA 5F3BA 4G8GA 2HKFH 2L0DA 1I9RH 4JPWH 1EO5A 1C5CL 4XCFL 3TNNB 2BSRA 4XPFL 3GMPA 4P9HL 1R3HA 4F15C 2E6PA 4PJ5B 1S7UB 3BWAA 4HFUL 4JDTH 4F33A 3M45A 2VLJB 4KV5F 2RGSA 4DN4L 1J8KA 1U8QA 3PDOB 1NAKL 3FO0L 3RA7L 3DGGB 3DLQR 1DANT 1F2XK 4XH2B 5FKPA 3GSQB 1ORQA 2C1OB 4QRPA 2BSTB 4ZYKA 1DLHB 3E2HC 4JM2C 3FO2A 3DYPA 3KJ6H 4KKCD 5CINL 2Y25A 3OAYK 5I8CA 2DM3A 5HDQL 1VFBB 4OT1L 4PJFE 5DUPH 1S7RA 4B7IA 3L7EB 1CI5A 2K7QA 3UDWA 1KTDB 2Z9TA 2JF1A 1BVLB 5F97E 5HXMA 1I8MA 2FJFB 5DMGC 2JE8A 3KG5A 3W0WA 1NLBH 4H1LA 5DRZA 2NX5B 1YYLL 2P5WB 3TO4C 1BF2A 4K7FB 1OM3H 5T5FH 1KPRA 2X2YA 2IAMA 1D5IL 2ZCHL 3DYMA 2YUZA 1QBLH 5H35A 3ZMRA 5FA3B 1AIFB 1IBGL 3RVWD 2D31A 5FYKD 4HUMB 3OWEA 3VFGL 3NACH 4YHNB 5ITBL 2EECA 3X14B 2WV3A 3LKRB 1OT2A 5SWSE 3C09B 4XP1L 1WTGT 1I85C 4PGCA 2VDNL 3TT3H 4XPHH 4XT1C 3W11D 1T83A 5H37G 1WBZB 4PRHE 1SYVA 2YA0A 4RWYL 5T33H 3V7MA 1VENA 2VZUA 2P44B 3S37H 4O2CA 3LHPH 4JG1H 1HHIA 4GMSL 5I16A 2OXHA 3HI1B 3V6BR 1NCDH 4KQ4H 4MXQA 4U6HB 1PKQE 2AEIT 3O0RH 4NOFA 4NDMB 4HW6A 3TIEA 3PGDB 5JQHC 1QEWA 4NN6B 4U0RC 1AGDB 3QUMB 1BOGA 5GXBB 5CP7B 4PJHB 1OW0C 2VZVA 5DJ8B 2FGWL 3IRZA 4MJ6B 4HBQA 3LRHA 2VC2L 5HYQB 4NKIL 1KN2H 4ERSL 1IE5A 1N5AA 3BP7A 2ARJQ 1NUFA 3WNPA 4PFEA 2BX5A 5DSCA 3O8XC 4OLZL 5KSAB 3EYVB 5IB4B 5FDWA 4NQVA 4HD9A 1UGNA 4YX2H 3IU3A 5ACZA 3AGVA 1MIML 3LQAL 1RHFA 4PJIB 2DQFB 5BW7A 5GZNC 2QSQA 3O45B 3QPQC 1VACB 5F70A 5LG1A 5GHWH 4ZXBB 4JQVC 1CU4L 1FFOA 4LASL 1HXYB 3G6AB 5DD6A 3W2DH 4PRBB 3RY6C 3LPFA 3FB8B 4Q9RL 5CILL 4LLAA 3RL2B 3UTSD 3BGMB 4G8GE 3WUZA 2XN9A 5JNYA 1OWRM 3O11B 1FH5L 3WO4C 4O9HH 5GPRA 2QTEA 3D0LA 5DYOA 4P9HH 4NCC2 1AXSB 4HFUH 1NKRA 4W4OC 4DQOL 4RISH 3IJHA 5KN5A 1NAKH 3FO0H 3FFCB 1J8HA 3RA7H 5C0GB 4J3XA 2A6IA 3U0WH 2VSDA 5IK3B 3MRRB 1EHAA 5CINH 4JR9H 2NY6C 5C7XL 3TBYA 4YDLB 1L7IH 2A74B 4I48A 4AQ1B 5JW4Q 4R9HA 4NO2A 5K59F 4NBZB 4NRXB 3H3PH 2X4UB 2VLKA 1A7NH 3TV3L 1X9QA 4DKFL 3ARFC 4PLNC 1H5BA 1XF5A 1YYLH 3W0WE 1QQDB 2BJML 2D4DA 2BNRA 5IW1B 3VWKC 3WL9A 2ADGB 3O3AB 1F4HA 1GGTA 4JQXA 2ZCHH 2R8SL 3QHTC 4YAQA 5D5ME 2WP3T 1JHKL 2HT3C 1KFAL 3ET9F 2XTJE 3LN5A 4PJ8B 5IHUH 4R96A 1C16A 5ITBH 1FNLA 1INQB 5HY9A 1DL7H 1RZIB 4XP1H 3LPGA 4ZAKD 4BQBA 4N0CA 2F53B 1WFTA 3FTGB 5IMOA 3VXOA 3VXME 3GK8L 4AMKL 4M6OL 2X4PA 4IOFD 4RWYH 1PSKL 3P9WB 3VXTA 3VD7A 1GGUA 1P84K 4X6CF 3RX7A 3TH4T 1IM9D 3LH2L 4GMSH 1DUYB 3MJ9L 4EDWH 4HKXA 3SN6N 3LKPB 5C2BH 1FLTX 4LLWA 4XRCB 4FQQA 2R1WA 4X80L 1QPXA 3QJFB 4Y8DC 2FH8A 1YEIL 1HH6B 4GAGH 5DURB 3L7FB 4V3DB 1G6VK 5J57B 2CGRL 3RNQA 2VXVH 1UENA 3HAEH 1U3HA 1MFNA 4FFWC 2AJ3B 4YC2C 4ZFOA 4JRYA 1PDKA 2FGWH 5INDB 1HSAB 1VADA 3KXFB 3SE8L 3QUXA 2VC2H 1JWSB 3IXAA 4G6AD 1XF1A 1TETH 1EEZA 1F97A 2EE2A 1CE1L 2DQGL 3H9YA 3WXWL 4GRWB 1VKXA 4ZS7H 5CEZE 2PCPB 4GG6E 4FG6C 1MIMH 3LQAH 2XXCB 1JUFB 3IDNB 5AAWA 4J3UA 1R5IA 3MUGA 5C0RL 3QUYC 1LE5A 2AJYH 1KT2A 2J8UE 1SJEB 4PGBB 1Z5LB 4C56B 2CXGA 2DQTH 1KCGC 5E5UB 4D9LL 3T77B 1HZHL 3C2AL 5CILH 2A77L 3FQNB 3DOSA 3VG9B 1CFTA 1FH5H 4XXDA 2C4FT 2XN9E 4KI5C 2C3HA 3WE6A 2WQRA 1L4IA 1CGUA 4IRJD 4S1RH 3NABL 2JCCA 4Y19D 3ROLB 3VXMD 3RDTC 2P8LB 3MCKA 3VRIB 5DHVB 3CMOL 2OBGA 4DQOH 3SKMB 3MOBL 5DMKB 4QOKD 5EZLB 5HHXL 3T0XA 3RUGE 4OF7A 1EGJA 5I9QB 3HLAA 4B50A 3RWGA 4N5ED 1PG7H 1CCZA 2X4QA 4YBHA 1UCTA 4PJGF 4HS3B 5E99L 2JIXB 4WDIB 1T80A 2CLVB 2A6JB 4WWKB 4M7LL 3NIFE 3O2WH 2MQCA 2ERJC 4MJ5B 3VWJC 4V2CB 5DTFB 5D2LB 3BUYA 3B9AA 3OKNA 4KPHL 2HH0L 3BPNB 1CGTA 4HIEA 2BFVL 4MNQD 5JPNA 3TV3H 4RFOL 3FT4B 1NH6A 2VLKE 4DKFH 1P9MA 3V6FA 2IG2L 3V2AR 4N1CA 3TVMD 3WNNA 2NZIA 4G9FA 1FPTL 4LHJB 3OKMA 3V7AG 4H0IA 4LLUA 3CC5B 3TFKD 2VDQH 1JCKA 4YLQT 5IFHL 5CEZD 4HUKB 4JRWA 4FFYL 2IPKA 1ITBB 3H7BA 4A6YA 2FLRT 4HWNA 5D1QC 4HAGA 4RRPA 3UJIL 1VB9A 3GK8H 4JY5L 1CQYA 3OKLB 1RUAL 2V2XA 3MRGA 4DAGL 3RZCB 2ZPKL 1OARL 5DS8B 3QNYA 4RGNB 1VFOA 4KTYA 4ODWB 4L4JA 3MJ9H 4OFYD 1JK8A 1LE9A 2FJHB 4P3CH 4XC3L 3MFGB 3IVKB 4OZIF 2H3NA 2CUIA 4ELME 1G0YR 3DX6B 2R1XA 2EDXA 4X80H 2PW2B 3JV5A 1EO7A 1YEIH 3RWIA 4AEIH 4I5BB 4P5TB 3JV4B 5I1EL 2F15A 5EULV 1ULVA 4ZPTB 4JRYE 2NY4C 1B0RB 3C2SA 3MRNA 3RWDA 3QI9B 1LO2L 3CLEL 1QSZA 3FO1B 4PRAB 4XNQB 1MCPH 1HIML 4WV1B 2R4SL 1ZWIA 1T66D 4HDIA 4M8VA 5I1AB 2FGZA 3UPRB 3A6CL 2LTQC 4EKXA 1CE1H 3B9EA 3WXWH 1CL7H 3U36B 2GK2A 1JNHB 5EO9B 2WBJC 4QRRB 4YPGA 3CXDH 4TTDD 2R56L 4U7KA 3VDCA 1IL1B 5C0FA 2DWDB 4V1DB 2PXYA 5I66B 1MQKL 5J8OA 5HVFB 2LQRA 2GCYA 2EIEA 1PAMA 2AERT 2ZUSA 5J6HA 3QFJA 5CKAA 2X9XA 5CBAA 5D7KE 4U1GB 5ENWA 3IAGC 3S8WA 5EIVA 4OCYH 2FR4B 4OSUL 3C2AH 1BX2A 3FJTA 5J3HC 3TNMA 4I4WB 2A77H 2QEJA 3SDCD 3KNBB 4JKWA 3HRZB 2AJXL 4X7TA 1FFNB 4PV8B 3D2UD 4NO5A 3RBGA 1B6DA 4K3JH 4KMLB 5D7IB 5IMLA 2NTFA 3IGAA 4Y4KA 2JCCE 3U0TB 5C71A 3CMOH 2HT4D 5TPWH 4TULL 1EAJA 2FSEB 3MOBH 3D39A 5IQ9A 2CO7B 3T4YA 5KW9L 5HHXH 4D2NA 4MA1C 2YSSA 4HKBA 3HC4L 4IOSD 1RZJC 1FZKA 4I18C 1NAMH 1F4XL 3MFFA 5E99H 5DC9B 4LLDA 3BQUB 5BMFL 4JDVA 4M7LH 5FGSA 4JO1L 2B2XH 1D9KC 2ATPB 4KKAD 5TE6L 1JV5A 4IRZL 4KPHH 1MJUL 2Z93A 2DICA 1BEYH 3MRDA 3THMH 5MEND 1Q8MA 1OGAB 4M7LT 2VXTL 1ZXQA 4XNYL 4RFOH 5ICZA 3GSNL 5DRXA 2OYPA 2IG2H 1CICD 1H15A 4XPBL 3HMXA 1F11A 4IOIA 4QHMA 3W9DA 3D48R 4U1JA 1CDGA 4WJ5B 4KRPD 5EBWA 3S9DB 4F37K 1QACA 4MQXD 5IFHH 1QRND 2CDFB 4I0PC 3FOMB 2YD6A 1R24B 1EFQA 4OKVB 3K4AA 5DA4A 1KLGA 4RQQB 2DMKA 4RMSA 4TVPE 2OQJB 5A16A 4UMGA 3BZEB 3HMWH 4PR5A 5HGDA 3GSUB 4JY5H 4GW4A 1MWAB 4X9IA 1Q72L 2BSED 3KPOB 4QHLA 1RUAH 4LHUA 4ZD3H 4YBQC 2ZPKH 1X5KA 5IVZA 1OARH 4NO0B 4X6DB 3QDJD 5F8RC 1GH7A 5F1SA 3S36L 4OZFB 2ZUTA 5GGVL 3EW3B 3JSSA 1JNLL 4BK4A 2IF7A 1T1WB 3N1GC 1Q9KB 3WMSA 3CNKA 1CF8L 1RZFL 3FCTB 4LF3B 4QYOB 1OPGH 4FQXB 5CSGA 3FT2A 3T1FA 4PJCF 3MNZA 5BV7C 5I1EH 4R2GC 1FAIL 1X5HA 4XP5L 1I4FA 3AM8A 5A2FA 2OTPA 2P24A 4GG8B 2FECL 4NFCA 1CXHA 1LO2H 3CLEH 5IB5B 3CSPA 5IFJB 3I75B 4DKDC 1CS6A 2R4SH 4P46A 1YEKL 3DRQA 3GNML 2YEZA 2MHAA 5EO1B 5E08L 2E7BA 5KANG 5IEHB 2A9NL 4TUKH 1I8LA 4FFVD 1CDYA 1IAKB 5L9DH 1FNSL 4YHIA 1UB6A 4N0UE 5AYUL 4MDJB 3V8OA 3B43A 2ADJA 4K71B 1EZVX 3DRTA 3HS0B 5I0ZA 4I2XA 2XG5A 1MQKH 4JFQA 4QXWA 1FC2D 3RAJL 3QFJE 3PWNA 4ZFFB 5JZ7D 4OSUH 4YR6B 4MNHB 4PJBB 5I73B 3R8BB 5DVOA 2DI9A 4P4RA 1LEIA 3O6ML 1EHXA 1Q9LB 4X6CA 1DJSA 1T0MB 4AT6A 3CLFH 5CLWA 1MHHB 2EDOA 1WAAE 3NCJL 5KW9H 2XNAB 2ZUYA 3D39E 1BOYA 3ARTA 3VFSA 3AY4A 1F4XH 4E0RB 3ARBB 3LQZA 1I3UA 1DE4B 3MV8B 4XHQA 3B8YA 1KLUB 5DXWA 4WW2C 3P3YA 3X3GH 4RA3A 1FNGA 1RIUL 3QWOA 1JNJA 4JO1H 3GI8L 4L5FL 3QQNA 4OFKA 3GMOB 5TE6H 4BZYA 2VDLL 1FL3B 1MCRA 5ALCL 4F7EB 4L4TB 4NSKB 4CAGA 3FMGL 4LSRH 2B20A 1E4XH 2Z91B 3GSNH 3B5HA 1YQVL 1BBDL 1KIPA 1NANI 1JPFB 1A7PL 2HFTA 2NXYC 4XPBH 1QOKA 3EDEA 4WIQA 3F6LA 5B38A 3VH8G 4KK8D 3QO0A 1DDHA 1I3RA 2YHGA 5IR1B 1C12A 3FB5A 4HZAA 4UDTA 4YGAB 1B0GB 5C0IB 4WUUA 4NWUL 4M7KL 2HG5A 5F71A 4RAVB 3WJLC 3RVXC 3UJTL 1SM3L 5AUMA 4XBPA 4QNPE 4ODUB 4M5ZL 5CBEA 2QKIA 2AXFB 5JHLL 4BFIB 12E8L 2F58L 2MKLC 5KVFH 5E6IA 2N56A 4X5WB 1G9NC 4KFZC 5DK0A 4OI8A 5HI4D 2AQ1A 5MERA 2FJGB 3ZLQC 5FA4A 4X7CC 5J7CC 1FVCA 1LEKB 2EKSB 2Z35B 2HFFB 1J0JA 3ARGB 5GGVH 5C08B 5HGAB 5D7JA 3GEWB 2NY3D 1HH9A 1RZ8B 3MA7A 4K23L 1DP0A 3G5ZB 2E3VA 4DW2H 3MV9B 3KWWA 4XP5H 3WFHA 5GGQL 2ZOKA 2W60B 1ZSDB 3BP4B 1RZJL 4NHCH 3IJYA 2GY7B 3KPSB 5L6YL 3E3QA 3NIDF 5HPMA 2P47B 2DQDL 2Q3AA 4S1QL 2BOCA 3VA2C 4YXKL 1YEKH 3GNMH 4EN3D 5E08H 2A9NH 1NKOA 3A6OA 3U9UA 2EO9A 1FNSH 1ETZB 3FFDB 5AYUH 2XZAL 1BD2B 3IDIB 1NFDB 4NQEA 4KHTH 3FB6B 4C4KO 4O02L 1P2CB 5DD3L 2Z31D 3UDWC 4ZUVB 3CPLA 1U8KB 3I50L 3C60B 3BE1L 4GAFB 5C0BD 4R7NA 3RAJH 5CHNB 1F3RB 5JDJA 1X5YA 4NQCA 43C9B 1OHQA 2HFGH 4BYHA 4TN9A 2X4TA 3FHAA 3HCVB 1P5VA 1I1AA 2ESVB 4C59B 2VLRD 1AR1D 2IAMC 3SKNB 2BVPB 1EBAA 1A5FL 4RAHA 2OZ4L 2XTJC 1F4WL 1MRCH 5IMKB 3TBVB 4PRDA 1AD0A 1I7TB 5FYKL 2IEPA 3W9EA 3NCJH 2X41A 5J1SC 5IIEB 5EU5A 4L3CB 3K80A 5EZJB 2YWZA 1K5NA 4BQ6A 1T83C 4PP1D 5I30L 1U92B 4Q2ZA 5CFHA 4H25B 3T65A 2YN3A 3ULUF 2LVCA 1FE8L 3DNKA 4CJ0A 4ODXB 3MJ7B 4ZUUA 3RI5K 1DQJA 3CZFA 3MNWB 4L5FH 4POYA 4Q7DA 3B9DA 2V2WB 3R06A 4W4NA 4JPIB 5ALCH 3DVGA 4MXQC 4FXKA 3NPSC 1T0PB 4PJEB 5ICXB 5SX5H 3EDFA 1FZMA 5BV7L 1YQVH 4MAUH 3E6HB 3TPKA 4XI5C 3UTZA 4N90E 2FL5B 4OV5B 5F9WB 1A7PH 3LEVH 3VXNA 4FP8L 3KPLB 4LPUA 3WNOA 4JPVL 1VFAB 1XIWA 3V9FA 1NEZG 3HZVB 1NCCL 4X8XA 1CTNA 3G04A 4UV7H 3G6DH 3ELAT 5HI5D 3TVMC 5HTSA 3SGDI 4Y89A 5AD0A 1KXTB 4G7YL 3VFNA 3V0WL 4M7KH 1BVKA 4UQ2A 4WUUE 3AU1A 1ZLUH 4NZUL 2O93L 1AGFA 1YDPB 3QNZA 12E8H 2F58H 3BOVA 4LVOC 3QUZD 2ZUXA 4HJ0C 3RWEA 5BW7C 1IC4H 1MPAL 1DSFH 3ZT6A 4MB5A 4AH2A 3PP3K 5DF0A 2YD2A 3QJHA 3UJJH 4E42B 4BSVA 1TVHB 1N7ML 4K23H 5D2NB 2CKBH 4POUB 2PO6C 5TF1L 3OGOE 1JZ7A 3QB7C 4XGZA 2BVUA 1P1ZA 1RZJH 2I60L 4WI8A 4RZCB 5L6YH 1S78C 2VISA 4S1QH 3E3QE 1EK3A 5L8JB 4YXKH 1C1EL 3L3JB 1LMKA 4L4VD 3NTCL 4Z0BH 3O6FB 3MRJA 4LSPL 3CSYA 1HE7A 4UTBL 4OD2B 5FO7B 1FN4A 3SDDA 2DM2A 3UBXI 3TBTB 2XZAH 3NBNA 3MRPA 1HINH 2F5AL 1NMCB 3ZDYE 4ONHB 1K8IA 4NQEE 1BJ8A 2PKDA 5F7LB 4TVSa 5DD3H 4JGUA 3GUTA 4PJAA 1MY5A 4Y0GA 5EC1B 4LCYA 5CSZA 2BXYA 2VXQL 3DV4A 3ROOB 2GJJA 1BGXH 2AJUL 3O2VL 1T4KB 1H5BC 4IBLT 4YHOL 2J6EA 4P4KD 4U4BA 4NQCE 5F3HB 3TNNA 4U1SA 4MD0B 3BHBB 1S7UA 4JQXC 3OL2A 2WWMD 2VLJA 3PDOA 5I2IB 2B5IB 3NVQA 3DGGA 3OJ2C 1JPGA 3PDDA 4XH2A 5T1KB 2C1OA 3GSQA 3OR7B 2BSTA 1C5BL 1DLHA 2FEDC 2VYRE 3BKCL 1G9NL 5F7HA 1BFTA 4PRID 5DEFB 1WIUA 4WNQB 3FRPG 3O4LE 3P4NB 5JR1H 4HHAB 3L7EA 4P23B 1H3WM 1WQVT 1NDMB 5M95B 4WHYH 1I3GH 1KTDA 1IAOB 4IDJL 1BVLA 2MJWA 3JXAA 4CNIB 1KC5L 4X9BA 4Z5RB 4CMHB 1MF2H 2NX5A 3SCMB 2P5WA 3KPNB 4GKZB 3VFOB 4D0DB 4K7FA 4P5KB 5BV7H 3GKWH 3F5WB 2FBJL 3K8MA 1HEZA 3DX9B 1AP2B 4UZGA 5FA3A 1AIFA 1FZJB 1XGPB 4XPGL 1FQ9C 1M7DB 5DHXB 2E27H 4N8VG 1NCCH 4YHNA 3X14A 3LKRA 1EUUA 1BVZA 4GBXB 2EYTB 3QUXC 4G7YH 5AZEL 3NCCB 1WBZA 4PRPD 3O81A 1NGPL 4RBPH 4D8PA 3VXRD 1LGVA 4MQXC 3RTQB 4JJHA 5EN2B 2G75B 4EI5B 1R3IL 1XGYH 4UAOC 5FCSH 2ITDB 2VB5A 4I3RL 3QCTH 4JLRB 3GGWB 2X1WL 3DXAD 1MPAH 4U6HA 5T3XE 3SY0B 3ARSA 2J5LB 4LLMA 1FSKC 4NDMA 3VD3A 4YHPB 5I74C 3QIWD 1U3YA 1ZOXA 2O5ZL 5B22A 3TEUA 1N7MH 1AGDA 1LQSR 3K0WA 4E9LA 1OSZB 4K2UL 1K3IA 5CP7A 1QVOB 4PJHA 2HTKD 5DJ8A 1CN4A 4HF5H 4KGLA 4X7SH 1RK0A 2NYYC 3VGGA 4J12A 3ES6B 3MLVL 3VXPB 2VITB 4MJ6A 3C5JB 5IT2L 5LBSL 1L0XA 3O4LD 1YUHA 1A3RL 2SEBB 3V4VL 1HCVA 5KSAA 3EYVA 5E4EC 5IB4A 4TNVK 1A7BA 5JORB 3GBLA 5B4MC 3QAZC 5E2VL 2A9ML 1LK3L 4JY6B 4TTGA 3VI3E 2JB6B 5CJBA 4BKLB 4UTBH 4PJIA 2DQFA 3O45A 1VACA 3H42H 4E5XB 2F5AH 4ZXBA 3SKOB 4HPOL 1PY9A 4GMTH 2CK2A 3V6ZB 4KK5C 3SOBH 3ARDD 4PRBA 5ERWB 1K4DB 1YMME 4A2LA 3WBDA 1AI1H 3RL2A 3BGMA 1GSMA 2AQ3A 3O11A 4NC2B 3CDGB 4XWGH 3AMKA 1P9MC 1YC7A 4YHOH 2R15A 1A7RH 3GSWB 4NIKB 2FHFA 2ICES 3LCYA 1J1PH 4NJ9L 4NHUA 5D1ZD 3N1FC 1AXSA 4PJ5E 4ZTOL 5BOPA 2VLJE 1P6AB 4L3ED 1E4WL 2V5SA 3PP4L 5C0GA 5CEZL 5EIQA 2OCFD 4M62L 2NZ9D 4AG4L 1C5BH 3MRRA 3BKCH 1G9NH 3NFSH 2Y36H 3NCBB 5CZXD 4AIZB 2R2HB 4KJPD 4M1CC 3NA4A 2CDGB 3QEHB 5F96L 2A74A 5JA9A 1IGCH 2DLHA 4NRXA 4IDJH 4JCMA 3G5XB 2X4UA 2W0FB 5IKCA 1KC5H 4NKDB 1RVFH 4OLXL 3MCLH 5FV2A 1YNKL 2NX5E 2P5WE 5IW1A 4E41E 4KMQA 5TE7H 2E6QA 5HHOB 2ADGA 4QRQB 3O3AA 1UT9A 3IDXL 1K9TA 3RU8L 3IJSB 1DN0B 5CJOH 4XPGH 4LSTL 4PJ8A 5IGXL 2YPVL 2ITCA 1F6LL 1INQA 1RZIA 3QXDB 1R3KB 3TN0B 3AVEA 1JHTB 2F53A 5E8EB 2HJLB 3FTGA 5AZEH 3D5OF 5F6IC 2QQKH 4RGOL 2OJZL 3HE7B 1R3IH 5ESQB 5FYLD 5DUBB 1YMMD 4I3RH 1DUYA 4G6JL 5FM4A 5FXCH 1FVDB 2KUTA 3FZUC 5K9JL 2PXYC 1GJIA 1RMFH 4LSVL 2QQQA 1YEDB 3L3DB 3QJFA 4N1HB 5DC0A 4MJIB 5HI4C 3SQOL 2JJTA 4L29B 3ARXA 4MXWH 2O5ZH 3L7FA 1A6TB 5SX5K 1NBVL 2M2DA 3WFBL 1N5YL 1KSRA 2PYED 5FGRA 3ZE0E 1FO0B 2AJ3A 4PJHE 1HSAA 1WWWX 3KXFA 3U83A 2OR9L 5LBSH 2YPLA 4NQDD 1JWSA 4Y4KC 4TRPL 3HNTL 1BFOB 1LILA 1L9NA 4G5ZL 1A3RH 2GTZB 1VEOA 3BIKA 5L2JA 4ZUSB 5KVEH 5E2VH 5HI3D 2PCPA 3U7WL 3ZTJG 1ZLUK 3DIFB 5FEBA 3BFOA 1QFHA 4FNLL 1JUFA 3IDNA 2CH8A 3O3EA 3WO4B 4PJIE 3Q5YA 4JFHE 4JEGB 5E8PA 1MY7A 3F7VB 4LSSL 2YD9A 4E41D 1NEZB 5GQBA 1SJEA 4PGBA 1Z5LA 3VJ6B 4C56A 1T1ZB 2IADB 3BDYH 4F7MB 5D70L 4C57C 1TJGL 4D0CA 2I9LB 3T77A 1RU9H 3FQNA 2I9TB 2IFFH 5AAMA 5TFSH 1KNOB 1Z0MA 2Z31C 3LEYL 3WNLA 3SO3B 1OAXL 4U6YB 4NJ9H 4CDGC 4XPTL 5EOCL 3VXSA 3ROLA 2P8LA 4JANB 3VRIA 2W07A 1DEDA 5DHVA 3UTQB 3SKMA 5EB9A 4ZTOH 1A4JB 1MCHA 5EZLA 5D93B 1TJIL 3FFCE 5CEZH 3SKUD 2P43B 3ECBB 2QSVA 3VW3H 5F7WC 2JIXA 4P0DA 1OLLA 2CLVA 4HPYL 2A6JA 4WWKA 2IQAB 3UBXG 1MCIA 4HWZB 1CD9B 3EZ8A 3MACL 5GRJL 3FHQA 5DTFA 5D2LA 1TTGA 1TXKA 3KPRD 4HIHB 3S98A 3MYJB 2V9TA 4PP1C 3NCEB 2D7QA 5IVXF 5B39G 1MJ8H 1YNKH 3IDJB 5L88L 3ORJA 2WQ8A 3O3UN 3IDXH 4MLSA 3UP1A 4O5LL 1FBIH 3RU8H 3CC5A 2JTDA 4F7CB 5DJ0A 1TMCB 4DN3L 4MQTB 4H88L 4R26H 3QT2A 3FL7A 5IGXH 3AM8C 1N6QH 4PJXB 3JUYA 5IF0B 1IC7L 2X9WA 4LVEA 43CAB 3BZ4A 5E2UL 5LKNA 1D5XB 2F53E 3ALPA 4P46C 1TCRB 2MFNA 3CFDB 3DETD 5AG8A 4RGOH 2VMFA 3F62A 1FNFA 3OKLA 2EIBA 4LPYA 5C0CD 1MCLA 2GW5A 1QBMH 2Q7YB 3VCLB 3RZCA 4MSWB 4KTEL 5HYIA 1L0YA 3INUL 1B4JL 2AJVL 4PRNB 5DS8A 1RUKL 5IB2B 4ODWA 5L7XH 3C8KB 4YC2B 1AC0A 2FJHA 1E28B 5L0QC 1QPPA 5TQ2L 5K9JH 3QXAB 3IVKA 4CBPA 3DX6A 2VZTA 2APTA 2NXZD 4F8QA 2PW2A 3SQOH 5JQ6L 1KIUA 2UZYB 3B9KD 1JGVH 4QRPD 4WFGE 5HHMD 4I5BA 1JJUA 4P5TA 2QV2A 2DTSA 3JV4A 4MB3A 4Z7WE 4R90H 3GZKA 5DJDB 3MTRA 3WFBH 4FXGB 3KYMB 4YGVA 4XTRC 3Q5TA 4ALAH 3ZSTA 5DR5L 4M43H 2VXSL 1A6ZB 2R29L 1B0RA 2CO6B 3FO1A 4PRAA 2HRLA 2OR9H 3BPOB 3FO9B 3KXFE 4WV1A 3HNTH 5SWZD 3D1MC 1UEMA 1NUNB 1JF1B 2XPGB 1EHLL 5I1AA 3UPRA 3BXNB 1I9EA 3LZFL 4GRWE 3AY4C 5EO9A 4F7PA 3U7WH 4QRRA 3PUCA 1P4IL 4LEOB 1UA6L 4FNLH 4GSDL 2XYCA 1IL1A 4RBPK 2DL9A 5GRUH 2DWDA 4V1DA 4RX4A 3WSQH 2X1PA 5I66A 3BGFB 1FRGL 1Q94B 1CBVH 3TA3B 4MA8L 4N8VB 3ULVD 3OAZH 1NCWL 3WEXB 4GXVH 5BZDB 2FR4A 4LU5L 4HJGB 2IANB 5IOPB 4I4WA 1LK2B 2HT2D 5DVMA 3HRZA 5T1LB 3M1BB 2DBLH 4AEFA 1WJ3A 1NCBL 1FFNA 4PV8A 3MRLB 2A73B 3ESUF 4PJDF 2X10A 5LJYH 3FQWB 3ZZ1A 3DHJA 5D7IA 4KXZH 3CX2A 5EOCH 5SX4H 3U0TA 1TQCB 4ZS6D 1BP3B 3RX8A 4XX1E 4C54A 3PG2A 1TZIB 4X9FA 3AS3A 1ZS8B 1CGVA 3QPXL 5DUMH 5C70A 1MIEL 2KKQA 3GRWA 4FRWA 4XPAH 1CL7I 1RJZA 5DT1L 3BQUA 2VL5B 4YUEH 2YKLH 4M9PA 4PJ7B 4N9OB 5EUOF 1RIHH 2YZ8A 4OQTL 3CX5J 3HI6L 3PDGA 3QQ9C 2ATPA 4P5MB 5E6IC 4M6ML 1CVSC 5GGTL 2MKWA 5D2LE 1OGAA 2UWEE 3T2QA 1FL5B 5GSVA 1CFNB 4NFDA 3B6SA 4LLQB 1CGWA 1NLDH 3LRSB 1RJCA 3KJ4C 3DUUB 1T89A 3H6JA 5DQ9B 5KAQF 2DLIA 3EFDL 4O5LH 3U9PL 4WJ5A 4DN3H 3BYTA 4CVUA 2CDFA 5I1GL 1PY4A 3FOMA 5IHZA 1R24A 2HA1A 1IC7H 3MZGB 4OCSH 4B53A 5LGJB 1BM3L 5TE4L 4CADB 3GKZA 4NJAL 3E3QC 4RQQA 1MCOH 2OQJA 4L9LB 3BZEA 1TCMA 3GSUA 3EYSL 1L6ZA 5IEKA 4S11A 1MWAA 1B2WH 5DJZB 2P46B 3KPOA 3T0WA 2QHRL 3Q2CA 1HNGA 4KTEH 2NMSA 3INUH 5F9JB 4NO0A 5E8DH 4RGNE 4W70A 4APQD 3ZHKA 3IU4L 3QRGH 4PPTA 4OZFA 1MVFA 4G6FB 4OFPA 5IWLA 3RNKB 3I02B 1T1WA 4YE4L 1YJDC 5I17B 1EVUA 1Q9KA 3FCTA 4LF3A 4CU7A 4KQ3L 4QYOA 3NIGE 4FQXA 5GISH 4BA8A 3RP1A 2Z8VC 2LTQB 3F58L 3C5ZD 2DLFH 3GBNH 5BCAA 3EYQD 1I1AC 3UYOD 4K3HA 4ONFL 5DR5H 2R29H 1CD1B 3VA6A 5BRZB 1JI2A 4KKLD 3TC9A 5BS0B 5IB5A 4A6YH 5IFJA 3I75A 5E9DB 1FNEB 1X3DA 4TVPH 4Q0XH 1A2YB 1F3JB 3P0YL 2HTKC 5EO1A 3VRLE 3M07A 2W59A 3VXUE 4Q97A 3LS4L 4LHQB 1IAKA 2XXMB 4MDJA 1EEYB 1D7FA 4JREC 4NT6B 4HG4J 1UA6H 4FOMA 3RPKA 3HS0A 4IIQB 3R4DA 3ZYOA 4V1DE 5CGYD 1FRGH 3UPCA 1P53A 2NLJB 3ZE1F 3IETB 4LBEB 2H32A 4ZFFA 4HAFA 4ZNCD 1FGNL 4IJ3B 5J0BA 2QADD 4M1DH 4YR6A 2AJSH 1OB1A 4MNHA 4PJBA 3W81A 1NCBH 2C1PB 3MBXL 3CFKB 3T3ME 3PL6D 1Q9LA 4H20H 5A2JH 1XIWC 1S9WB 1JWMB 1HKFA 4NUJB 2DQUL 1MHHA 2XNAA 4OUOA 1I7RB 3SDAB 3AREA 3MUY1 5C0EB 2I26N 4RGND 5EOQL 2FWOB 2QQLL 3HR5B 4E0RA 3ARBA 5DT1H 1DE4A 1I7ZB 3MV8A 1KLUA 3EJYC 1UJ3B 4KJWD 4OQTH 3HI6H 1WCBB 2CK0L 4Y4FD 3GMOA 5D7SH 5KAQG 3HUJF 5FOBB 4QXTB 5CEXB 4Y4HD 4PD4K 4PB0L 2P5ED 1OGAE 1SHMA 4XZUB 4Z8FL 3MGOB 4RDQF 5I19H 3V5KB 1SVCP 3F65A 3CXHK 1JPFA 4M7ZC 5DMJB 3QI9D 2EDQA 5J12C 5C9JB 1L7TL 1VEMA 3EFDH 1YY9C 2Z8SA 3VXUD 3QISA 1GOFA 5IR1A 5C0IA 3ERYA 1B0GA 2X4OB 4LSUL 4OTXL 4P9ML 1MQ8A 1PX3A 3HFMH 4OGXH 1BM3H 5TE4H 2K7PA