1A9OA

Bovine purine nucleoside phosphorylase complexed with phosphate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
289
structure length
289
Chain Sequence
MQNGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDTESQGKANHEEVLEAGKQAAQKLEQFVSLLMASIPVSGHTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calf spleen purine nucleoside phosphorylase complexed with substrates and substrate analogues.
pubmed doi rcsb
molecule tags Pentosyltransferase
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
total genus 90
structure length 289
sequence length 289
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 1998-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1a9oA00
3UAWA 1ULBA 5ETJA 3OZBA 4NY1A 1Y1QA 1LVUA 1ULAA 4GLJA 4M7WA 1B8NA 1RXSA 3FNQA 3MB8A 5C80A 4TS3A 3DJFA 2AI3A 4TTJA 1PK7A 1Z5OA 5B7GA 3OPVA 3P0FA 4EARA 4QEZA 4QFBA 3DDOA 3UAYA 5IU6A 4R2XA 4G8JA 1SQ6A 4TXMA 4U2KA 2A0XA 1YRYE 4WKOA 3F8WA 3OCCA 2OXFA 3UAVA 3OOHA 1ECPA 4TXLA 2OECA 1PWYE 3BSFA 4P54A 3KVRA 4G89A 4DABA 1OUMA 1CG6A 4D9HA 1C3XA 1V41E 1WTAA 5KB3A 3KVYA 4PR3A 1PK9A 4NSNA 3DP9A 5F73A 2AI1A 4BMZA 2QTGA 1JP7A 4D98A 4TTAA 4D8XA 1PKEA 4TXHA 3C74A 1ZOSA 4D8VA 4KN5A 3UAXA 3OZEA 1U1EA 2A8YA 4L0MA 4LNHA 4PNPA 2OC4A 1Y1RA 1Z5NA 2IQ5A 3KU4A 1PW7A 3LA8A 3LGSA 1JDVA 4MCHA 3FUCA 1YBFA 5CXQA 2XRFA 1RSZA 1RT9A 2H8GA 1JDUA 4WKPA 4GLFA 4YMLA 1T0UA 4WKNA 1ODIA 1PR2A 1RCTE 1PR1A 4F3CA 1T8RA 1TCVA 4D8YA 1FXUA 1Z34A 1A9OA 5DK6A 4BMYA 3U40A 3FOWA 1K9SA 4BMXA 1Z37A 1ODJA 1T8YA 4OJTA 4DANA 1TD1A 2QSUA 4YO8A 1SD2A 4L6IA 4I2VA 1SJ9A 1RFGE 5F78A 2P4SA 3E9ZA 1G2OA 1VHWA 5F76A 5F77A 1PR4A 2QDKA 1Z35A 2ISCA 3ONVA 2A0YA 3NBQA 1PR0A 3IOMA 2I4TA 1QE5A 5I3CA 1NW4A 3FAZA 3O6VA 4GMHA 3K8QA 3DF9A 3INYA 3PHCA 4OY3A 3LBAA 1V45E 2I8AA 1A69A 4EB8A 4E1VA 5F7JA 2AC7A 3KVVA 3OZCA 1JDTA 1JE0A 4LKRA 4TTIA 4F2PA 1RYZA 4DA6A 5K1ZA 4H1TA 4DA8A 1LX7A 1PF7E 4LNAA 4DAOA 1Y6RA 3BJEA 3FWPA 4IP0A 1TGVA 5B7PA 1A9TA 2RJ3A 4DA7A 1JDSA 1JYSA 1VMKA 4L5YA 2A0WA 4DARA 1RR6A 1SD1A 5EFOA 4FFSA 4YNBA 3OOEA 1B8OA 1N3IA 2Q7OE 5B7NA 4WKCA 1JDZA 2HSWA 3NM5A 1U1GA 4G41A 4OEHA 1OU4A 4F1WA 2HN9A 3D1VA 4QARA 4ECEA 1RXUA 5B7QA 4X24A 5EUBA 1V2HE 5F7XA 1Q1GA 4BN0A 3UT6A 1A9PA 3KHSA 1NC3A 1Z33A 3UAZA 5CCEA 1K27A 2AI2A 4QAQA 3TL6A 1V48A 3KUKA 5IFKA 3SCZA 5F7ZA 1OTXA 4JWTA 1K3FA 4OF4A 1JPVA 1U1CA 4TXNA 1A9QA 4L5CA 5CYGA 1Y1SA 1ZL2A 1YQQA 3EEIA 4M3NA 4TYMA 1Z38A 1TGYA 3BL6A 1XE3A 1PR6A 4DAEA 1U1FA 3NM4A 5EPUA 1Y6QA 1I80A 4WKBA 4QATA 4MARA 3EMVA 3E9RA 3ENZA 4QASA 3T94A 2PGAA 3PNPA 3P0EA 1U1DA 1PR5A 3NM6B 1Z39A 3QPBA 4F2WA 2BSXA 3ODGA 4M1EA 1A9SA 5CYFA 3OF3A 4RJ2A 1A9RA 3EUFA 3K8OE 5JPCA 2ON6A 4GKAA 1Y1TA 4TS9A 1T8WA 3IEXA 1YR3A 4OGKA 2B94A 3GB9A 4DA0A 3DPSA 4JP5A 1OVGA 1V4NA 1PBNA 3OZDA 1T8SA 1ODLA 1VFNA 3PNSA 5F7OA 3GGSA 4K6OA 4LDNA 1LV8A 5CCDA 5FAKA 3FB1A 4NS1A 2QTTA 4YJKA 1Z36A 3BGSA 3O4VA 4OGLA 4R2WA 4UC0A 4MCIA 2GUWA 2HRDA 1V3QE 2OC9A 1NC1A 4LZWA 1JE1A 2QPLA 3MMSA 3PHBE 3EUEA 5CXSA 4JOSA 1ODKA 1YQUA 4R31A 4F3KA 1RXYA 1M73E 2HWUA 4L5AA 1TCUA 4TXJA 3E0QA 1RXCA 1VHJA 1Z5PA 1CB0A 1OTYA 1OV6A
chains in the Genus database with same CATH superfamily
1DDGA 1PI3A 1OVMA 1B41A 2D0OB 4EELA 4Q1VA 4LXGA 2F8LA 4V03A 4IG9A 2JF0A 2PD4A 4GGMX 3IHTA 4WNIA 3EVTA 5EWLA 1J0XO 2R8YA 4PLHA 2GVNA 4RMGA 5JEEA 5F9FA 5HEKA 2R8PA 4X3CA 2WWHA 4J16A 1J0AA 4P3OA 2B1JA 1JMVA 2Z8ZA 2VWQA 3UJCA 1SC4A 4B4DA 4F11A 1TF2A 1P3JA 1ZH8A 3QLUC 4PRYA 5BOSA 2GA8A 3BRSA 3ER9A 4XPIA 4I1PA 2QTCA 2YYSA 2HD4A 1SCKA 1M7HA 5FDFA 2PPLA 1PWHA 1KHTA 3SHOA 1C3OA 3M4JA 5EJ9A 2H00A 1FXWA 5EWLB 3ZLBA 3ZWVA 3N76A 2GAAA 1J49A 1O94D 4LJ9A 1LF5A 3C3DA 1BFUA 3MJRA 4MW9A 4S12A 5IJ9A 4C5CA 4CQMB 3VTZA 2GAFA 3SAJA 2VJDA 3PI6A 4U9IS 4UZFA 1HZJA 4G8JA 4Y6GB 5FB3A 1WX1A 4ARSA 1YNSA 2CY0A 3LXXA 1H2HA 1VP9A 4CRWB 4KZPA 5DEOA 1U80A 1Z5ZA 1UKBA 5JSKA 3LM8A 4US0R 4E11A 1HNWB 3G79A 1EGHA 1HDGO 1X1TA 2ZDQA 2GN2A 3H7AA 3LBIA 3MAGA 1A9XB 4I6EA 3AHGA 1R4ZA 4E88A 1GZ6A 4EOGA 1JDBC 3G6WA 2HK8A 4B3BA 1DJMA 2PSSA 4BNWA 3NC0C 2E4WA 1HK7A 1SQSA 3R7DA 1YTUA 5BT9A 4EITA 1WNFA 4Q4HB 2D1RA 3EQ9A 3KAQA 4QGGA 1BDMA 1WCV1 1H22A 1ZH6A 3M0EA 4ZCLA 3O3CA 5AW5A 4DA9A 1ECPA 4F3NA 4O2BB 1JFTA 4MIKA 1Y8QA 5JFGA 2COEA 1A8PA 4NMMA 1YJ5A 5AW3A 3HDHA 4DABA 4LHWA 3KZVA 1CDEA 3AETB 3G0IA 4TM7A 2DLCX 3X1KA 3A7EA 3HS3A 5HDBB 3CA8A 5ADHA 1KH3A 1KYXA 4IHJF 3EVCA 4Q1CA 3DVAB 3WWCA 1CUDA 2X8LA 3E15A 3OU7A 1C1DA 1QIIA 3H5WA 4IIJB 4URVR 5EHQA 1PJZA 1TM3E 2H51A 1D0SA 4BP3A 4TTAA 4MW2A 3ZWCA 4EJSA 1DMSA 4B0OA 5AKYA 3EPJA 5F9HA 3A6LA 1D7OA 2HWWA 1A5SB 2BR3A 2RHHA 2ZAGA 4G56A 1FS4A 3AVUA 1E1KA 3FE2A 2XWBF 3A2MA 3FPJA 1WTCA 3PWZA 1D9XA 5AKHA 5IVDA 3T5CA 4HGPA 4D4MA 1M0WA 3S2SA 1FZTA 2BE7A 2OYSA 2IWRA 1E63A 2DM6A 3H2SA 4RA6B 2HF8A 4XDHA 4UU0A 1NWCA 3X1WA 1L8OA 2DUUA 4DIDA 5HJ5A 2OHJA 1Q1QA 3VR3A 1NHGA 1O7JA 4S1NA 3KQHA 2H2DA 2C84A 2RG7A 1KK3A 3EFHA 4RH1A 2ZZKA 4KYTA 3WO0A 3VI4B 2YCBA 3I4CA 3F97A 3GRVA 5GOZA 1N2CA 3R6WA 3IP8A 1TAGA 1PFUA 4V1CI 1Q6YA 3GLIB 5DGCA 1JDUA 1OH8A 4C2UA 4QFDA 1VKJA 3UV3A 1ZIDA 3HCAA 1ZW1A 2DBVO 1T0UA 3HDJA 2CFTA 3I0ZA 4BN4A 1IN7A 1X3LA 2WJ3A 3NO4A 4WKNA 1EVLA 1EGMB 3W77A 3OFNA 2F67A 1MZVA 1MJ5A 3SG0A 4GAEA 4MVJM 4S35A 2VJBA 2FQ1A 1JZQA 1N2OA 5K20A 3FPKA 4X1KB 1YFLA 4AJPA 2V1UA 3CH4B 3UATA 1YF3A 4YLGA 4KXVA 3MQ2A 4J0EA 1AQIA 4E07A 2FOIA 1DC4A 1RMQA 4GBMA 1RRKA 1A9OA 3TXXA 3MOGA 3U40A 4US2R 3ZWPA 3TAUA 2WJJA 1XZLA 3OBIA 1DQPA 4DDMA 1EMDA 3Q88A 2GZDA 3N2YA 1E5DA 1LQ2A 4RD2A 1ODJA 2CHFA 3HADA 1OBFO 2QL6A 1ZSYA 3BRCA 3KEFA 5KINB 5COQA 5A3JA 4DLLA 1HEUA 2ZQYA 3P9RA 3R6GA 4OFZA 5EIXA 4ALNA 1IZ7A 1DQYA 5FUMA 3OY7A 4H16A 4RXTA 1Q1BA 2GHTA 5I7RA 5LPNA 1UBSB 2HAEA 4JA0A 4K26A 4WSOA 3THOA 5HZMA 3KT3A 4HWGA 4JT2A 5UKDA 2D7JA 1RD4A 3AVYA 1DIHA 3DMPA 3ZZMA 1VB3A 4BVAA 4RHYA 1DGQA 5F78A 1WUIS 2PXHA 3BH7A 2FFHA 5JFOA 1Z63A 2WPDD 2DB3A 3L4SO 1MHTA 1U31A 1XSEA 1NVVR 4HFRA 3GBVA 1A1SA 2DTEA 3L93A 5CTAA 2ZWMA 4HL6A 4C2AA 3HL4A 2X6RA 1FDWA 5JQGA 2N75A 1LY1A 4BNYA 1Z35A 2VJQA 3BGDA 3QU2A 4IIFA 3FF4A 4MB2A 4D9GA 4LTNA 4RANA 5CGZA 4FYYA 2AG1A 3QKIA 4PO1A 3T3HA 1QTIA 2Q3EA 3JQ7A 3OCWA 4RMNA 3QFCA 4K3VA 1YIDA 5KNBA 3ADOA 4B3FX 4HYTA 3GBSA 5FT9A 1EXWA 4HDSB 4HK4A 3I2FA 4ZVSA 1SCUB 1P1BA 2B61A 4IO0A 4NMLA 3Q7IA 5I3CA 1ZESA 2ZB8A 1YB5A 1ESMA 4JOCA 3IOCA 3A1FA 4K9NA 4ZU3A 4J75A 5KOHA 2ZJBA 4TN5A 2ZK7A 5CCBA 1DWPA 1EXMA 5K3FA 3M1AA 1P4RA 4XYMA 3HO1A 1A8UA 4ZCMA 1NURA 2OHGA 2Z2ZA 2VPIA 1L7XA 4FOTA 2CXNA 3UF0A 1C9EA 3K6KA 4C7OB 1NI4B 2P5YA 3AJRA 4MX8A 4TT8A 1GZSA 4FBGA 5KDDA 4O25A 1E6LA 2CLEB 2QU7A 2E6UX 1AQYA 2ZVPX 4RHCA 1E3LA 2RBGA 4LYFA 1NJ5A 1TUGA 2OCYC 1AKRA 2QLBA 5EZ5A 2A35A 2FG7C 4LBYA 1IZ0A 1EUCB 1ZO8A 3CXRA 4D42A 4FWTA 1PD1A 1XTUA 2Y1DA 4P4SA 5HIAA 3AV3A 3RU3A 1RAIA 3CNQS 5EJAA 5JVDF 3PKZA 3UUFA 4KIFA 4QBIA 4S1OA 3UKOA 3JX9A 3RS7A 2IHVA 1P9LA 3WBJA 5LNK6 1QFJA 3DBHB 3MMNA 2AEFA 2VUTA 8OHMA 2HXSA 3PFWO 1EH5A 3SYMA 4TKVB 3CY6A 5FPYA 3TDKA 4J29A 4YP9A 4F5WA 1SVNA 1OLXB 1CS0B 3TJMA 3BICA 4DCOA 3EDRA 2PEYA 4L2IA 5EIHA 1GAJA 1XXHE 1TZBA 3RS3A 3AVTA 2H3HA 1TVKB 5AOVA 4NPHA 2YY7A 1WAMA 2FRDA 2I6GA 4EHAA 5L95A 4HD8A 3LUGA 4P1ZA 1G3RA 5AOCA 2R751 5TXGA 4GKJB 3O8QA 4TVBA 3VGPA 4JOBA 3X1DA 3L18A 4K86A 3WYDA 2FUG1 5B7PA 2R1ZA 3RGWS 1HKUA 2XDAA 3PUVA 4BLVA 5BRJA 1DTEA 2YWHA 1Q7GA 3P52A 1A2BA 3FVVA 1B73A 2V6FA 3EZNA 3OZGA 7ABPA 2ZUUA 1E2PA 5KTTA 1BFDA 1MZPA 1H3NA 2RKBA 3DEYX 3NIBA 5SY4A 4X6LA 4F4JA 3CX6A 3NHBA 1C7IA 5K0LA 1W5EA 5HIJA 2HCTA 4O2AF 4DJFC 1VRWA 2J9GA 2JGDA 3CINA 3R8XA 2AG8A 3VPXA 2OCPA 3ENKA 4R1TA 2CSUA 4MO2A 3B5EA 4UXIA 3ASUA 4B8ZA 4CIBA 4Z6KA 1SQGA 4X1IB 3PQEA 4MVJI 1H1LA 3T9AA 2X8JA 3SKXA 2CFOA 3B82A 1ZIXA 4FMPA 3H9CA 1ODSA 1CJUC 1MV5A 4NBWA 1YCHA 3LWNA 1CZHA 3I2GA 1BXRB 3T5GA 1NXOA 1ZXLA 4J94A 4EG4A 4MZXA 5I6DA 2DR2A 3O2SB 1R64A 2DH5A 4MGKR 1GSIA 1DTWA 1R66A 1ULHA 2ECOA 4EUHA 3I9V6 3TZKA 4RY2A 2PTHA 1ZN7A 1I3LA 4G4SP 2XB6A 1AH2A 5IW8A 3SIWA 1ETHA 2VYVD 2ZJOA 2VRCD 3KFLA 4MVCA 3WMWA 1DIGA 5ICCA 3E3LA 4PC3A 1N5OX 5CNKA 5J4VA 1BKDR 4KO8A 4OKIA 2ZUEA 1TA4A 4IH1A 1T5LA 3LFTA 5M7EA 3QEKA 5A62A 1WQ3A 2I76A 4FHCA 2GD2A 1NYLA 1V48A 2XGMA 3GUYA 3IDSA 1BGXT 2YHIA 4QODA 2VP2A 2JVJA 1JQ3A 3E82A 4RF3A 2NO5A 2Y27A 3DKKA 3DUFB 3REOA 4D8TA 2FFQA 4E09A 2P9YA 4LHZA 1Z8NA 1LZKA 5LFAA 3KYDA 3LPAA 3WLSA 4OF4A 1JILA 1JPVA 1Q0RA 2FLKA 5GGYA 1QX3A 3MG9A 3W5BA 2Y1CA 4ZVVA 2P7IA 1SBCA 1I7DA 2JLVA 4LZOA 3UUWA 2AIRA 2PGXA 3M82A 2RMKA 3F74A 4ZQGA 1ZJJA 4K7JA 1SK8A 4YY3B 4QFCA 2IUSA 2OR3A 2Z1NA 2JFXA 4PHCA 1XZAA 1KI8A 2XWQA 1N9ZA 4MRNA 2I7DA 4B8WA 2H85A 4CEIA 1LBSA 1UM9B 2FVYA 4P81A 2ZWPA 2ZVDA 2ZBGA 1W0JA 1XXLA 4R9NA 5ECYA 3WGLA 3O84A 1I80A 2WQ6A 3CURA 1NATA 5IFLA 2XZLA 1JEDA 3JXEA 5BPHA 4KRFA 2C2BA 3E9RA 3L07A 3WGOA 1PG5A 2ZT7A 3ZCPA 2OZLB 3GARA 4EPVA 4FGLA 2A9JA 2J5XA 4V0MA 3QU9A 3JAKB 1FPQA 1OLXA 5BRNA 2QLMA 2B8WA 3BSSA 1TZCA 3W7VA 4QBFA 5JZVA 3DP7A 1PU2A 2DFVA 3FR7A 2F43B 4L6AA 4Z2AA 5E38A 2B83A 1XPOA 3EPHA 4B4KA 1VLZA 4TMYA 2AZXA 1KXZA 2BSXA 5AHWA 2OXRA 3ICOA 5D84A 1XVUA 4G1EB 4N6GA 1AXRA 3PDCA 5A4KA 5BSVA 4LYYA 4DCUA 2JDID 3BFVA 2PJRA 1SO8A 1XTSA 3ABQB 3HBMA 1TTQB 1T0HB 4F6CA 4ABTA 5JI3E 2EP5A 1FXSA 3K8OE 2EIXA 4RVGA 2PFKA 4E6PA 2H0AA 4JC0A 3WZ2A 3MJVA 4BE9A 1Y1TA 3OOSA 1T8WA 3VH2A 1QU3A 3RSHA 4QAJA 1QTNA 4J0JA 4B46A 3WGUA 5IUJC 2YMMA 1KOGA 4OGKA 3IUNA 1FFDA 1JBKA 4HNQA 1WKBA 1H4TA 5B1SA 1QFZA 3ETEA 3B2EA 2KJQA 2Q1XA 4GSLA 5DW0A 4FYMA 4KVAA 3DAGA 1ZW6A 4RIIA 4LXUA 4P38A 5BR7A 1EQ2A 4BC1A 1ODLA 1T1GA 1OBHA 4ARBA 1R6UA 3SF8A 3RKUA 4GBGA 1FQOA 1YZHA 2GT1A 4HZIA 1TA9A 1P72A 4PO8A 4X92A 1OPXA 1EFVA 4V0SA 1EVIA 2QI9F 3Q87B 1MC1A 4K6OA 1VFPA 4CU2A 4FCWA 4J2HA 4CNQA 1SRQA 2WW8A 1CB7A 2HGZA 4HYYA 3UW3A 1UOQA 4BX3A 3KTAB 2I2BA 1N2JA 3BXZA 1I13A 4MWTA 4EG6A 4MGHA 4R81A 2SKCA 4YJKA 5TT0A 1XQYA 2YXEA 3AUUA 1GEGA 3VSAA 3V4FA 3GF4A 5KWEA 2IYAA 3GFTA 4U9HS 1JIQA 4UASA 3RG8A 5AO9A 2DJIA 1GTZA 2IIBA 4FNOA 2NYVA 5H16A 5JO9A 3RT9A 4L3VA 4OREX 1ORHA 1P39A 2VQ6A 4UXHA 2WHYA 2TRSB 1C1XB 1CUGA 3M83A 3ZBPA 2WTXA 4NV1A 2YJ4A 3IUEA 4FIZA 2BEUA 5HZHA 3GWZA 4JLMA 2LCQA 4ZJZA 7GPBA 1XMIA 1E6KA 3MMSA 2WIAA 3DM5A 1NNI1 3OPXA 4MGZR 3RTDA 1O5TA 2M1ZA 5FLEX 5AJUA 1IULA 3W6ZA 4CEJA 3CPSA 4E4RA 4ND6A 3JR3A 3FJOA 5ALXA 1E94E 3F96A 1JH9A 1BVHA 1YDWA 4V02A 2J85A 3LHKA 4F7DA 3PGVA 1YQUA 4PTYA 4AKSA 4XJVA 1UWCA 4YGYA 3HKEB 4POOA 2HGSA 1NVGA 3DZHA 3KNZA 3PWTA 4IV8A 2I78A 2RFLA 3ZGXA 1W4LA 3NUQA 3BGOS 3ZLTA 5AW9A 3FBTA 3OO0A 3UT5B 5C4IA 5AW1A 5ELXA 1MQ8B 2H18A 2WEKA 4R0NA 4UBJA 4ZRMA 4BIIA 4BV8A 4E33A 2IIQA 2V7QD 4N03A 3DXYA 1E2MA 5BW6B 3NW9A 2B1QA 4ARZB 1GWNA 2D1FA 4ALIA 4RZ3A 5LR6A 1E3EA 1GG8A 4G1CA 1JQLB 4RH0A 4EA8A 1P1RA 1ULBA 3DMYA 5I7UA 1I51A 3N86A 1EVEA 3PF8A 5IN4A 3IDQA 3N2GA 5HMLA 2NSDA 4DLPA 3BBLA 3A2LA 1CRQA 4RZSA 5GJWC 4BLRA 4EA6A 1A97A 3TPFA 2BV3A 5A06A 4RH3A 1I4EB 3WSWA 1RXSA 3IMEA 5C1BA 3BD7A 3LDAA 3K1YA 1U9IA 1YL5A 4DNQA 1G6OA 1JNXX 4MYDA 1XU9A 3W3AA 4ZOLB 3MILA 4NBRA 2NZXA 2DFNA 5EPEA 2WYOA 1WWKA 4ZGGA 1JJIA 2ZBEA 5G3YA 4Y1RB 5B6PA 1BDBA 3JQAB 3KALA 2OCXA 1TU4A 2UYHA 3CH6A 1CIJA 2FK8A 5ALYA 3S0JA 1AF4A 3W7AA 3I92A 5ALTA 2DZDA 4P83A 3FNHA 4XWAA 3GEGA 5EQTA 3ICQB 4WESA 3LCUA 1R0CA 2CK3A 1CK4A 4J91A 1G21E 2CDAA 3DDOA 4MP6A 4OB8A 1ZJ5A 1OI7A 2ADFA 4Q66C 5AJVB 5EJ6A 3MA0A 5U9CA 2GM3A 4K6HA 3CGGA 2A78A 2JKVA 1SQ6A 2V0GA 1Z62A 3G6KA 3F7TA 1SXJE 1U3TA 4G5SA 3KQSA 4U2KA 4XGRA 5DO9A 2FZEA 5K4HA 1QU2A 4PCAA 5DCWA 5IJ0A 1PEYA 3CUUA 3KBBA 4D9FA 5A5FA 1DLIA 2OG2A 3KOZA 3L1KA 2D1TA 3NT2A 1OFIA 3PIIA 4C0HA 2QN1A 4G23A 2A5LA 1T9ZA 2LIVA 3B9QA 3NTOA 5KSPA 1IB0A 4WESB 4DG8A 3MC1A 4L5JA 1M1UA 5DT2A 3VVMA 4UOZA 3BG5A 1FDOA 1V1JA 1ADYA 3DWFA 3MRTA 1VCIA 3OOHA 4RV9A 4TL9A 4CMIA 2HQSA 2ENWA 3EZGA 2P9JA 4CMKA 3A4MA 1SCNE 2WZBA 4INZA 3GVXA 2AZTA 3H5TA 1FYDA 2XGOA 1EK0A 1D09A 3BAFA 4ML3A 4M9RA 2CCGA 4LK3A 4S1WA 4YUYA 3OE5A 4GT1A 4EVIA 4R2JA 5KB3A 2IBTA 2ORWA 3QNMA 3RU2A 2KLBA 2PK3A 1M0SA 1QNLA 3DOJA 4Z8YA 2JD0A 4IOMA 1JMKC 4HUQB 1BCSA 4G1VA 1IFXA 1PSWA 1SBHA 2IA5A 3ZY2A 3QY0A 5F33A 2WA2A 3O91A 4D8XA 1DJNA 3C74A 3JQQA 3L77A 5A04A 5IANA 2RHRA 4POAA 3OF5A 4JUAA 1PQUA 4HPXB 2FWRA 2JI7A 2WUDA 3ASYA 3B3JA 5CJJA 2GCOB 3A4VA 3C14C 2HJSA 3E53A 3HCBA 4V1CB 1ZR4A 4ITUA 2G40A 3WMGA 5JCJD 4HQKA 3SSAA 3UKDA 1T3GA 1EWTA 4D9JA 4CQMA 2AD5A 4J4TA 4MV7A 3NTVA 4ZQHA 4CLHA 1A3CA 2ODQA 2WUEA 2NYUA 4KQ9A 4UVEA 4JSYA 4ZD6A 3GLHE 4J1QA 1BE6A 3L8EA 2AVNA 1HSZA 4ZI7B 2J45A 3A3KA 4IRMA 1H93A 3E7XA 1R6BX 3HKCB 2O19A 3WFJA 2DWQA 1K08A 3FUCA 3AUFA 1UMCA 5HFJA 4WOCA 1F4LA 3NJ4A 3IJEB 5AVRA 2O8CA 4WCDA 4N8DA 2B1IA 4UUAA 3SICE 2O7SA 4AY3A 2AX3A 3LUPA 4MJ3A 1DRJA 3O8OB 3SJUA 1BMQA 2AR9A 3DXXA 3KZOA 3NX4A 5CITA 2XE4A 1RQRA 4K9QA 2FFAA 4BE7B 1WDKA 5F1OA 4H4DA 1WXWA 1IBCA 2XMBA 3ESYA 1E2EA 3L8DA 1IUNA 5F35A 5FFMA 4ZHQA 1L4GA 3PJGA 2A9QA 3DO8A 3EWSA 3I1IA 1FFGA 3I32A 2BFFB 2G9NA 5BORA 1Q84A 2OG1A 1ORVA 3ZVRA 1GNQA 1RWXA 4MLPA 4Q9DA 2BFWA 4M9SA 4M37A 2FSHA 3EVZA 5HIMA 2O06A 2LDBA 2CC2A 2QTRA 3VYUB 3MELA 4BP9A 4W9MC 5AFSA 5EIWA 3VYRB 3VR1A 5K3EA 2BM1A 3RYHB 3BCHA 5EIEA 1OWPA 5GM1A 5TJ9A 3ZNOA 4QPCA 1W48A 2C9BA 1XQWA 4TS4A 3G89A 1H2WA 4KI7A 4NI5A 6NULA 4Q1AA 4X3PA 4X8HA 4KDFA 4YPOA 2Q5JA 4Z54A 4OOEA 1CY8A 2ZRCA 8MHTA 4MJLA 1WW2A 3GCGA 5IEJA 4D3XA 3HXPA 1SJ9A 3DOUA 4O8ZA 5KNLA 1ULZA 1HFKA 4MV0A 3NNDA 3UJDA 4GQIA 4O4JF 2X9NA 5AK0A 4HLNA 2RH4A 4V0NA 1UJCA 2FKAA 5KQPA 3K32A 5SYAA 3GUUA 1Z29A 2YJTD 3UPTA 5EUCA 5B4TA 2CKDA 3VU9A 3R0XA 1RDFA 2EF0A 4G67A 2DKNA 1T9BA 1ORWA 3V8PA 4DVGA 2FPXA 1NQUA 2ZIUB 2KMLA 2Q5EA 4URZR 4YIKA 3N2GB 4HAVA 3IUBA 1NJ2A 2QMOA 3ONVA 5LXTA 3ET4A 4C43A 2WDZA 4K81B 3N53A 1X8XA 3KZCA 4GYKA 4L2IB 4AZTA 4UTVA 5GINE 1CJBA 3D2CA 1IHXA 2Q1WA 1YZYA 2QW1A 2VL7A 3HNOA 4R7TA 4GPIB 1W34A 4FB5A 4R1LA 2V7EA 3HCEA 3PEWA 4YJ3F 1AKVA 2V6MA 1CQIB 2PSEA 3H84A 5BMVB 1PLJA 3SEQA 2WU0A 3OHSX 3D9QX 3EW9A 3M4ZA 4YMHA 5LDDC 1VP3A 5DHAA 2LPMA 4N12A 3RVLA 4XUEA 4NE7A 2XUHA 1GZ5A 5ALPA 4DT1B 4F72A 3G2PA 2D8MA 1I2DA 2OWEA 1H2AS 5BP7A 2AZ4A 2FR8C 2NXWA 5GADl 4EK9A 4PLFA 3WKEA 2QNBA 4ES6A 3CVWA 3TD2A 4BZWA 2ZSFA 1O6BA 4LZAA 3HHEA 2IS4A 3WWDA 1F0KA 2WSMA 3OTIA 1GRRA 2LR0A 3AKCA 4DMHA 1LDMA 2BHTA 2FPOA 2FCAA 1Y89A 2DQ4A 2YZKA 3ICPA 3IRUA 4W9NA 4C0KA 1EJ0A 4ED9A 5LZ9A 1W87A 3OQ1A 3VC1A 2J3DA 5EI5A 3ONFA 1EESA 1U0FA 3W2EA 4KTTE 4GG1A 1GPKA 1NXWA 2BF4A 4RM3A 5C3MA 3MCAA 2K6GA 4AUKA 1XDSA 3IQEA 1U7ZA 3JW8A 1KYIA 3K0EA 3KBOA 4ZVTA 4EUKA 4N4AA 3V55A 2HQBA 5LP6F 2HMYB 1YAJA 2QUJA 3CLTC 1OI4A 1EE2A 2EG5A 1JJFA 3Q3IA 4Q6WA 5EG5A 1XEWX 3T7DA 3ERCA 1U9ZA 4M0UA 3EH1A 3BTOA 3CJTA 2CZCA 3VVLA 3D64A 1LLDA 2VBIA 1DOZA 1Q14A 1PYDA 1QHSA 1RXEA 1W8IA 3OESA 4IKPA 2V54A 3H0KA 4RV4A 3WGVA 3ESCA 4Y2SA 4NICA 4YAOA 1FEZA 1PNVA 1A96A 2QAGC 4OIFA 2FDRA 1L5LA 4YT8A 2IUYA 3HR4A 3AR7A 1YB1A 4F5ZA 5IVHA 1EFCA 2W2LA 4M55A 2R0QC 3U48A 4D7AA 4D0GA 2IC5A 4DC1A 3IQWA 1A5BB 4IUYA 4EUFA 1U0HC 5KYYA 3DS8A 3SKVA 4H1TA 4EBBA 5IT0A 3E9QA 2V9CA 1XT6A 3DDNA 5G1PA 1KEPA 4DAOA 5TMDA 3M5CA 3HB7A 5CA1A 4TTJA 1TCAA 1V9LA 4DA7A 1P1HA 3KKNA 4V0ME 3S3TA 4EFKA 3AR6A 1I0IA 5EIOA 2YFHA 5GVSA 3O8BA 5BV0A 5H3LA 3AOEC 1QE0A 2P2ZA 4JLJA 4B09A 4DARA 1Y3DE 2ZT8A 4BATA 4YGXB 2RGAA 2JFGA 2YZNA 2KLHA 3RSLA 4AUNA 5A4DA 3IODA 2WMNB 3IT3A 2P5UA 1T43A 2PMDA 3KP1A 4QQKA 3ZWWA 4RHUA 4YCJA 2BJWA 3VKWA 1OREA 3HJGA 5J43A 2LKCA 1QYVA 2NU8A 4HVLA 3AF0A 3CO0S 4AMUA 2ZJ2A 3L41A 1E9RA 2OGSA 4PNEA 2Y0PA 4TYYA 4FHDA 4W63A 2GBLA 2O6HA 3NUGA 4Y2QA 4QNNA 1O3YA 1JQJC 3Q7RA 2NACA 1DMRA 1M8PA 2YQ5A 3LPDA 3ZWOA 5J2TB 1W0JD 4Y2VA 4FZ5A 1YJBA 1I1NA 5A0TA 4GF5A 4QARA 4O4HB 4WHMA 2Q0XA 3CH7A 4JC8A 4PLWA 1M2EA 5KOYA 4HNAB 4X44A 2ZB2A 4N47A 3TKLA 1EVKA 3OFSA 4Q7KA 4JL8A 4WDRA 1YL6A 4HH3C 4CMBA 1QVAA 3T52A 3OCYA 2EW2A 4UEWA 5L7TA 3S1AA 1QG6A 4BVJA 1EFHA 3ZV6A 5F7XA 4KMSA 2NPFA 4B3SB 3LX4A 3AFIA 2C83A 1J8DA 1ZMXA 4P4TA 1BE1A 3UAZA 2I2DA 4BIMA 2Q2NA 1IVNA 4JSTA 4BFVA 1O6FA 1YR8A 2GBGA 4KZKA 3CEHA 5J5AA 1R8SA 2G17A 3D4IA 3V7YA 2A84A 4LMRA 4GX5A 4ATNA 1KVRA 4QXOA 3V8QA 4LTDA 4CE6A 2C9YA 1ZRNA 1G8HA 3F78A 4OQ4A 4BGUA 1NXVA 2FHPA 4KYUA 1SXGA 1VSVA 2ZCUA 2ZQZA 1KL7A 5G0TA 3P9SA 5IFKA 1U5CA 1EG7A 1SB9A 5FBVB 4AY5A 3OIGA 1GVNB 1HMPA 2K7ZA 4WDQA 5F7ZA 1DOAA 5LA6B 4BEWA 1MRNA 3E84A 4AZWA 3ZBTA 1ZM9A 3MS2A 5C5CA 2Q5OA 3IPRA 3LDHA 2FAXA 3LX5A 2HOQA 2HWKA 4S3MA 1FTWA 3OEED 4WY2A 4YK7A 5ESXA 1UQRA 4G5YA 4HUJA 4NS4A 3EAGA 1E61A 1X14A 1NVVQ 2C96A 3U4DA 4UM7A 1NQTA 3UKJA 4LNUB 1CVIA 2Z5LA 1XDWA 3IP9A 4IILA 4U8HA 1P4AA 1Q92A 4GDMA 2OTCA 4JN6B 4A9AA 5AM3A 1TT5B 3ZIAA 3I1JA 3PC2A 5C9ZA 1Z8FA 3QLTA 1HSOA 3DVAA 3CH5A 3GRRA 5I01A 4OJMX 3C85A 4C22A 2NZJA 1X7WA 3HY6A 4ZZ1A 1ZCJA 1EFAA 3U2QA 3H9UA 4HRAA 1FP2A 2Y1WA 5KJ1A 1L8XA 4FYHA 2O48X 2R8RA 3IBTA 5DHFA 4C4YA 2JI6A 4B6PA 3PD1A 3D2BA 3JD2A 2CNLA 3LY9A 3OJXA 3Q2KA 5GV8A 1KE2A 1U7HA 3SZRA 1G8MA 4BNHA 1M8GA 3CCFA 4GSYA 1I3MA 5AK6A 3T34A 3HGTA 4BGVA 1FU8A 3KSUA 3C4VA 4WA7A 4WKGA 1ZKMA 3SQOA 2XVMA 2B35A 1O8BA 3NI2A 3P2MA 3GJTA 4F2WA 5EESA 2D0IA 3IEUA 2EFDB 2J07A 2V7BA 2XWSA 4JA2A 3OEEA 1AB6A 2FW1A 5EIBD 2VDNB 2KX7A 2DFPA 1R2QA 1AB5A 1ZINA 3UTDA 2I34A 1ECLA 1KNXA 1O1YA 1W4ZA 1XCBA 2FN9A 1Y7IA 2HEGA 3AI2A 3O4GA 3OE7A 4NFLA 5T7BA 1Z0IA 5JJIA 5ILOA 2XD4A 1QGYA 2X0JA 3DYIA 3BFJA 1EAMA 4PSCA 1ZC3A 2B34A 5KNBH 3KK0A 4LZPA 3ZKAA 4PAOA 1C9NA 4FR5A 3K15A 5EOVA 1J5PA 1P4GA 2PBRA 1N6HA 3HVUA 5E9QA 3Q8LA 1KMQA 4KI0A 1BWSA 4JP5A 1VLMA 3MW8A 1JB1A 2ZUWA 1V4NA 1BQ4A 1WXQA 2ACKA 4IVQA 4HDMA 4R16A 3JZDA 4F1JA 3OQMA 4MXDA 1KDOA 2PMCA 1QK4A 3BEOA 3PC3A 4OHPA 4RZHA 1XTRA 4Y7CA 3TBFA 2GO7A 4RVOA 5F7OA 3HYCA 1ZJZA 2GYWA 3WK9A 3J81k 1T5OA 1ICEA 1M5UA 3LH5A 1AV7A 3QY9A 3O7WA 4DSTA 5BUCA 2M6LA 3R76A 3LLVA 4KIGA 5E2BA 2IZ5A 1JHAA 5CEJA 5LL6P 3K31A 2WJPA 1GDTA 3Q3VA 2XVZA 3E0XA 4LRXA 1CCWA 1ZS9A 3JQCA 3DZGA 1KEWA 4PRLA 1LDGA 3AVWA 1Y37A 1E5VA 3O4VA 4HRVA 1LBIA 2WTMA 5SYNA 3VX4A 1ONPA 3C5EA 5AVVA 1JHUA 1G55A 2H4JA 3GJZA 3IQHX 4MCIA 3JASA 3MD9A 3SX4A 1ULUA 1GR1A 2WFAA 3H2YA 4OHKA 2XMDA 4UVDA 5HK8A 4DKJA 3GELA 3A1TA 2JLWA 1HDXA 1GXSA 3RREA 3QJGA 4NEQA 4DT1A 2IYZA 2XQFA 1G20E 3IJ5A 1ND6A 2CLKB 2YV2A 2PBZA 2EZ4A 3P45A 4MQEB 1W581 4UNRA 1YR7A 2PIDA 3ADPA 3PHBE 4OHXA 2Z56A 3PUZA 2O2XA 1PZHA 4IUDS 5JSHA 4X60A 1UBUS 2FUKA 2WJGA 3SEFA 1H0KA 2PX8A 4ZDWA 4BVBA 4JGBA 4O1MA 2VATA 3PXDA 4M1TA 3K6SB 4F46A 1OJ7A 2EBFX 4G09A 1RI2A 3GGOA 4P0QB 3D8UA 3AUSA 3E05A 1YGPA 1GDDA 4I4CA 5KYWA 1PBTA 2B69A 2PBLA 1PGNA 4QLAA 5CVJA 4GFDA 3LI2A 3IVRA 1OWOA 1SCQA 5C35A 1QS0A 3W2HA 4EI8A 5BUSA 2HWUA 2WSSA 4RPIA 4TLAA 4BBPA 5L51A 1TZ2A 2ES4A 1X0VA 3D0KA 2BHLA 1T25A 2XZOA 4JBHA 2B78A 3WRYC 3CNOA 5HF9A 3TDMA 3AKYA 2OO3A 1W93A 3GPDG 4MW4A 2CUZA 1XCGB 4HEJA 3WP1B 5IDXA 4N0QA 4YP5A 3OZXA 3NWPA 3NDBB 2WAYA 3IAEA 1H8EA 4B75A 3MJDA 3W90A 6LDHA 4NK4A 3BWVA 3EC1A 2A86A 3EC2A 3I0MA 1TM4E 2QTAA 1TCCA 1ZWKA 4BMPB 2H2IA 2IYSA 2ZE5A 1G17A 3YASA 4L4XA 4W5JA 3OX3A 3WDLA 4W82A 1NBEA 3VR4H 3QUCA 1Q7CA 4KDRA 2V5VA 2YFKA 4FJ2A 4EH1A 1TYBE 2J7KA 1FX1A 1RJFA 2QUIA 3K2EA 5FADA 3E9DA 2C59A 2P2YA 1F2TB 4LHVA 5A6SB 3RD5A 4BDSA 5CDHA 2X1LA 3EFOB 3GLHA 2EKLA 5E8RA 2POCA 4D4HA 1HE8B 1LX6A 3EIWA 3MWDA 3AWDA 5H59A 2NZ2A 3WSTA 3BA6A 2YWXA 1XQXA 3LS2A 4JR1A 1FYVA 1ZOLA 4NOLA 1BN6A 2YZGA 3KFVA 3IDAA 2XT9A 3LC0A 3DNFA 1KDVA 3FTPA 4AK9A 4Q4CA 3DBHA 3W2TA 3JRXA 1SXHA 1RFLA 3HYTA 1Q7BA 5B1IA 4JLOA 1H65A 1MU0A 2GD6A 2XRMA 3VR5H 4JQYA 3PC6A 4EPWA 3T0FA 5H1YA 2YWGA 4KO2S 4NYJR 4WVLA 4FFLA 2YKGA 3TSAA 1UDXA 2AJCA 2BH2A 2DULA 5E1DA 1YBVA 2JA2A 4LOHA 1MJHA 3NGXA 4J43A 4D1YA 2GDZA 2C78A 5ARCA 2Q8NA 3L8ZA 1XROA 2WV9A 3K9HA 4PGHA 4PX9A 1ZBDA 2FK7A 1MIOA 2M1XA 1G2IA 2BC9A 4YAWA 2ZRMA 2X2FA 1QIMA 1D0IA 1GL7A 4RF4A 4X54A 1BHO1 2JJ2A 2W37A 4DLWA 1H0SA 2ATIA 4XIIA 1FTSA 4L8WB 5IBCA 4C7JA 3GNQA 4CM5A 5BWCA 3DV9A 1IZYA 2GCOA 4XWTA 1ZUNB 3HRHA 4AN0A 4LI3X 2R6DA 1XU4A 1GTL1 1F9AA 1T3SA 2FQYA 1PN3A 4MW7A 5F73A 5HTKA 3K9CA 4DSOA 3A3NA 2VJMB 3AFNA 4EX6A 5B3KA 4ZJPA 4D98A 2E37A 4P5DA 2XECA 4OQFA 5JNSA 1XKQA 1ZONA 2CE2X 3TCXB 1GA4A 2ZUDA 2PS3A 3WMFA 1PKEA 1KO5A 2NTYC 3AHJA 4HEA6 5ENVA 1JQBA 1X39A 2HLPA 2UZIR 4TTTS 1C9DB 2VDVE 4MQUA 5CLHA 5F2OA 3CX7A 3NHAA 3PUWA 4MUXA 3PG5A 2I1WA 5AW4A 5K0CA 3C3JA 3KDSE 2OA0A 3TUZC 1KVUA 1R0BA 2A8YA 1YS9A 2Q9BA 1YULA 2XVAA 1YVRA 3ISTA 5FBHA 5LIPA 4J0QA 4ZAGA 3THYB 3R6DA 1GGNA 4J0GA 3M34A 4ITRC 4KR9A 4CKXA 1I3CA 2DP4E 2P9EA 2QRMA 5T8KC 4DMUB 3ITKA 4DDHA 2R8BA 3N05A 3AO0B 2P35A 3GVHA 1K8XB 4UBKA 5D7BA 5ESWA 1UPBA 2PX6A 1UBGA 3OLQA 4MUFA 2HU7A 1G41A 2FR8A 4UREA 1HFJA 4NCHA 4QUJA 4P4SB 1V1MB 2VHVA 3KYIB 2D74A 1TJNA 2DFLA 2PWZA 4MHOA 1KDTA 3ABSB 5I4IA 1W36C 3M6UA 3HB4X 3HEMA 1Z8HA 3PBKA 3Q0TA 2GERA 1RCTE 2RGNA 1PR1A 3ID6C 1L7MA 2R3SA 1M2JA 2B0JA 4I5DA 1T8RA 1E9AA 1MN6A 1X1EA 1CHDA 3GQBA 4P33A 5DASA 4DGQA 3O0TA 4EUEA 4BMSA 4M22A 2WSIA 1YUNA 2MR5A 4RESA 4OI1A 1ES9A 2JGIA 1I94B 1XTVA 2YHSA 3EIEA 1OFUX 2AQIA 3RUAA 1NPYA 3O95A 2Z4RA 3EA0A 1NI4A 4BMYA 1NJ6A 3MM4A 3PHHA 4JMLA 3D8HA 1ZNYA 4GZ3A 3JPYA 5JPIA 1W35A 4CKEA 1Z6GA 4YALA 1K8ZB 3UC5A 5DGTA 1BCRB 1JEEA 4XZ3A 4CF5A 4N5IX 2G71A 4LBZA 2QE7D 4AS2A 4WN3A 3CX4A 1XAHA 1FP1D 4FZRA 4KN8A 2O5EA 2QQGA 2Y8EA 3V6LA 4PNZA 1FP6A 3AFHA 3AL2A 3R8FA 3V1TC 3D4BA 2RE8A 1CBUA 1R0LA 1E20A 1YRWA 1FX0B 1YZNA 2DCUA 4JU9A 3ZXIA 4B5LA 5IF9A 1U2QA 3UV6A 4DVJA 1W1UA 1U8AA 4MYHA 1NUUA 2CV0A 3TAHA 1GQQA 2NM0A 3JVDA 5FQOA 5HKLA 3WMXA 2RHCA 2P4SA 1YNOA 3R5SA 1YS7A 3UFXA 1E2GA 3JYQA 4FI3C 4RORA 1QK5A 4IGFA 4BBZA 3DZKA 1FSFA 3HM2A 4RPJA 3VU9B 1VOTA 3WYCA 3DFIA 4OFWA 4AVYA 2PX3A 5FTLA 2BEWA 1HORA 2WFMA 1DBIA 1KFBB 2SBTA 1N0WA 3PQFA 4LAFA 4PZ9A 2GKOA 4EA7A 4OBWA 5A5VA 1IXRC 1RYEA 3P7MA 3QXSA 3U80A 4EECA 1G5HA 1LJLA 1D07A 2KHZA 5KKAA 2QZ9A 4R05A 4TMFA 3TLYA 1H4SA 4QQNA 4C7KA 1QAQA 3FZNA 4HN9A 3ZTWA 3EDCA 1XFDA 1PT9A 3LVRE 5DNYB 1Z2OX 3H5NA 1DZIA 1IK6A 4XX0B 4F2DA 1ECJA 1R9GA 2HHLA 2I4TA 3TZQA 3VHQA 4WEQA 3UUEA 1UBNA 5ECDA 1WW8A 1XZJA 5C8VA 5BV2P 2VHWA 5C7LO 2ODTX 1JKFA 1OA0A 4Q3BA 3QTBA 3AZOA 3BM5A 5J4HA 3SR4A 3TEFA 3NXSA 4ID9A 1VCOA 3T8YA 3IYLW 1E7RA 3INRA 4I4TF 1GN9A 1OC4A 1NX6A 2C0QA 3WLOA 1Z4QA 2YWCA 4GNKA 2L42A 2X0NA 4JVMA 5JJLA 2HB6A 2V96A 4GPEA 3L6DA 5F52A 2HX1A 2H2HA 3IE2A 4JIGA 1MXFA 2J5KA 1GTJ1 1Z4NA 2GK3A 3BVPA 4A8HA 2YS6A 4LHSA 3LNCA 3R7WB 1M34A 1SVOA 4C89A 1L1RA 1M5TA 2AN5A 4E5PA 5KNCA 4RBNA 4K6KA 4AN4A 1NW9B 3AW9A 5DN6D 5AI4A 1YR9A 4YHHB 3LUKA 2AJ8A 3AG6A 5E9AA 5AJYA 3TPZA 4NCIA 5IEBA 3FN4A 4LRSB 3IB6A 4ZANA 3DFUA 1YHNA 3JV7A 2AOTB 3LIPA 3AJEA 4DMLA 1U2PA 1PT7A 2QTFA 3JAMA 2BT4A 3MTIA 2BFDB 4MI1A 4CM4B 1MGOA 2ENUA 4DQDA 4F2PA 5JDCA 2ADMA 5KUTA 2GRUA 5CA0B 4NYIQ 1JLRA 1EUDB 4IRXA 3K16A 4UTNA 3LPCA 3L1IA 1JFSA 2W2OA 1FU7A 4HMOA 1G66A 4Y0NA 2C2OA 2ZSUA 1B6RA 3TRDA 2CYCA 1YVEI 3UMCA 1XZCA 4QRHA 5HGXA 1QKKA 2AZDA 2R6GA 2PVPA 3G2NA 3SS7X 2OZVA 3VRHA 1KIFA 1J09A 2PKWA 4XH9B 4EPTA 2BFAA 3A1EA 1NNSA 3H4IA 1T5BA 4LDRA 2QLTA 4P31A 1OSNA 3LHSA 3PL1A 3RIYA 3BK1A 4TKMA 2BMFA 5FUBA 1TYZA 3DNMA 2LVBA 2IW1A 4Y98A 5BSGA 3QITA 3FVQA 3IMCA 5KNBD 1GU0A 2MMGA 4D5EA 2DTXA 2QV0A 3O9VA 1K3TA 1PR9A 1Z4KA 4FPXA 4PLVA 4CODB 4M9UA 4M9ZA 1APBA 1KEZA 4ER7A 1G5QA 3EXFB 3W1EA 1XTTA 3GLQA 4IJ5A 4M1MA 1K0FA 1H23A 1RZUA 3CNEA 4QWMA 2LBPA 2KBFA 3NU1A 4GS5A 2PD3A 2FOXA 1US8A 4FCCA 4NHEA 4A4DA 4DC9A 4ZDKA 3M2PA 4FOPA 2XYHA 3RT7A 1GNVA 4RYLA 1IN8A 2X4DA 4JUDX 1N0IA 2IF0A 2C4TA 3L6UA 2AXNA 5EP3A 1T35A 1Q0PA 1HYBA 4MA5A 4QIHA 1ORIA 5G0WA 3MUEA 3T0IA 5BNIA 1XD8A 3NATA 4GR5A 1VSBA 3LG2A 2OAEA 1ATZA 4L57A 1EUQA 1ITZA 4G2TA 2P11A 1N6NA 1ZEJA 2JH8A 4ASUD 2GN8A 1YO6A 1LPNA 2JRCA 3NKLA 4M9QA 1IUPA 2AKAB 5FPHA 4M46A 2EFYA 4YUVA 4BO9A 2IWHA 2A33A 5CCEA 5I48A 2XBLA 3F8TA 4KDCA 4RFLA 4RTRA 5IBRA 4UAGA 2J7PD 5EUMA 4ZVUA 3A27A 3TL6A 3ROXA 3ZLUA 1F6WA 1OAAA 2NU7B 1IQ0A 4DWJA 2I8LA 4CIYA 4RCZA 1SHUX 5BOSB 1D4FA 3FNIA 3N70A 5TEVA 4LF7B 1J7JA 1CDDA 3MFYA 4H2DA 3ZQ4A 3KAJA 3GFQA 2ZTVA 4JY7A 4KSCA 1JHXA 4DLAA 2JGJA 1ADFA 5DX0A 3I2JA 1GRQA 1U1CA 4UCFA 5JAQA 4IOLA 1TC2A 2JG3A 4L5CA 1KDPA 1Y3FE 1Y1SA 3PI7A 3N8HA 3QX7A 4KAJA 2XYPA 4IZHA 4NC9A 1O94C 1GZDA 4OFXA 1NVMB 1LDBA 2ZSHA 1RM4A 1C0KA 2ISSD 1HG1A 1GN8A 1TGYA 4KWTA 4NWIA 3T41A 1DAGA 1P1JA 1FTQA 1EP1B 2X8JB 5DB4A 3T35A 2YNMD 1G19A 4QWWA 4CIAA 4YDHB 4BNDA 1RRPA 3QXXA 3ZQUA 5EXXA 2A94A 5JC1A 4MHSA 4AY2A 3LVFO 5BYKA 5IT4A 2J30A 2Y6UA 4ZVNA 2XWJI 2FE1A 4QSMA 3L8HA 4YP7A 3KD2A 4MINA 3WO1A 4CN9A 2E0IA 2LD4A 5K6RA 3PYLA 3NQ41 2PGAA 4BGDA 3MK31 4J03A 2GCEA 3RPEA 1FFYA 1KHHA 2I80A 3CWZA 5DE3A 1E2KA 1VE9A 2AD1A 3IKMB 2HA5A 1GP2A 2OO5A 3JAKA 5B2EA 2J67A 4KN6A 3SSMA 1DEAA 5FNVB 3VTKA 3D2AA 1KAGA 3KQVA 1G8KA 2XLCA 3RNOA 821PA 2CJFA 3SC2A 5KQSA 5KREA 4PX2A 4Q9NA 2E48A 1XZHA 3OTHA 5H0IA 3IA7A 3L05A 5BYAA 3FYUC 3LHIA 2W2PA 4DCVA 2YVQA 5LZ7A 5HQ3B 1RZRA 2HSJA 3HJHA 4WASA 3T3DA 5GPBA 1PT8A 4ZQEA 1OR8A 1M74A 1W88B 1ZU4A 2ZBQA 1FRFS 2ESRA 2ZSIA 3DBVO 3JQAA 1M2GA 3JZMA 4F4DA 5C8DA 3FMIA 3RTBA 4QOIA 2ZYIA 3FNGA 3PIDA 1ZH4A 5D5HA 4RJTA 1E0SA 3AIOA 2XAAA 3DLIA 3T7EA 3NIWA 4S0XA 4KR0A 4BY9E 1YMVA 2BY4A 2Z04A 1AJEA 5JS2A 4OHMA 4PFJA 1QORA 1T2AA 4OXXA 3E7PA 1WKVA 3FUXA 4XXHA 3C7AA 4X6UA 1GDHA 3PNSA 4QLOA 1D2NA 3G68A 3DUFA 4DW8A 1R12A 5DBOA 5ILQA 2GH1A 1WZ2A 4U6NA 2WM9B 1YTLA 2VXCA 3A58B 3WNVA 5CLGA 1TK3A 3FR8A 1NR1A 5GIPE 1L5QA 4AKHA 1NUTA 3BFXA 5C2JB 3GH1A 3OIYA 2O8EA 2WM3A 1PWXA 3IR6A 4RL6A 2C2XA 2BMEA 2D2VA 3LDGA 3RV3A 4OGLA 5AT1A 3LZDA 2DQKA 2BGLA 2QR2A 3TMYA 4DNFA 1V3TA 1YBAA 5FP0A 1NSTA 3QEJA 3I6ZA 4D3ZA 1V0JA 4MRRA 2XTZA 3I2HA 2HCRA 4Z4CA 3ICWA 3GOHA 4MVJA 1G7SA 2J08A 1UDWA 4Q9LA 2E4UA 1ZIOA 3GA7A 5FBWB 1DKNA 3R6TA 1TJ5A 5BWLA 1SC1A 1FJ2A 1MDBA 3EUEA 3P71T 4GOKA 4R51A 1RWKA 3UICA 2BLLA 3IIKA 1LRLA 1Q1EA 3IUMA 2IOFA 3BWMA 4K88A 1CJSA 3MHTA 3QVUA 4LDJA 5B1EA 1PG0A 1X1QA 5H8WA 3RC7A 1L8LA 3W8FA 2DTDA 3INTA 2Z1MA 3B6MA 4Q3LA 2ZU6A 1YHYA 3P2EA 4UHKA 5TSDA 4PQGA 3GJ8A 4FXPA 5L3ZA 4JQOA 4F3KA 1L5HB 1MX3A 3D4LA 3DOCA 5EKDA 3TR0A 3O8NA 2HWYA 3E8SA 1V25A 4GP9A 3LCMA 4HH1A 2FQWA 4AT1A 1ISMA 1D5WA 3KQWA 3BIWA 3F6RA 3NCHA 4XSGA 4RPCA 5K6TA 1AF7A 3LO8A 4RABA 4ER6A 3C6XA 1Q83A 1AZWA 1Z2EA 2AFVA 3DL7A 3HN7A 1IK4A 3OO1A 3TLBA 3F2VA 4IX9A 4KACA 4YQZA 1XU7A 1H3FA 1Z5PA 5JXHA 4C4AA 2SKDA 3CVXA 3T9DA 3P26A 1JG3A 4TMXA 4YLYA 3T7JA 4KH1A 1LD3A 2WTAA 2E85A 3NWJA 5FUXA 3RAFC 2N9UA 3G2IA 4NBKA 3GU3A 3M1IA 3COYA 3NWBA 3TTUA 5HZGA 4NY1A 1Y1QA 4F38A 1KK0A 2JFZA 3MXOA 2P6RA 4RSRA 3EE6A 1WJGA 2JLBA 4FBMA 4G1FA 4INAA 4IIDA 2GR9A 5JDIC 1D2RA 1C80A 2QP9X 1J2RA 1W4AA 1M75A 2XYVA 3FD8A 3OP1A 3ONEA 1XXHB 4G0QA 4LN1A 4TS3A 3UK0A 1ZVVA 1NF3A 3LCRA 2YHIB 4HEQA 5DTIA 1GG5A 4ZZ0A 3WLIA 3GEEA 4L4YA 1LSOA 4ZGBA 1QYDA 2E6KA 4WEOA 5H9VA 3AXSA 1Z5OA 2RAVA 1Z26A 3QHQA 3GLFB 1U6KA 5F1PA 3N2KB 1CLUA 1WLYA 4KFUA 4O2LA 4ZT6A 1UBMS 1K06A 2REBA 3UPUA 4MDHA 4QEZA 3N8DA 4QFBA 1SY7A 3URKA 4LBWA 3VC7A 4BOYA 4RTOA 4XJSA 3C3PA 4LCJA 3K6SA 4A0SA 4QDJA 3QVJA 1T4GA 3JYNA 3F47A 5D85A 3L84A 1VIDA 1E4YA 4NJMA 5JY1A 3KQYA 4JROA 1K7SN 5CBPB 2OO7A 2F43A 3NKFA 3SYNA 5IBPA 3OA2A 2J32A 1RYYA 4EF4A 3BD6A 2PCJA 3LUFA 1HKHA 1PYGA 1QXSA 3OCCA 4ANFA 3IVMA 4E15A 5KCZA 3QLVC 2XODA 3E5RA 4D4GA 2XJ9A 1JEYB 1V37A 3D8BA 4O0LA 3U3ZA 2IZ1A 4OQLA 4BQRA 2H1SA 2D62A 2XGGA 3UK7A 3HLYA 1NMEA 5J23A 1L8QA 2IPAB 2HQOA 1N6LA 5COAA 2FW8A 2JHGA 1B16A 1J4AA 1N9KA 1TT5A 2JEZA 3AQ4A 5B5SA 1LSSA 2O8DB 2ONJA 1C0PA 1L7AA 2NU9A 5E95A 3PXEA 4AYTA 4N3CA 3VC2A 3PX3A 4CI0B 2G5CA 4WCFC 1WY5A 4BVLA 4AG3A 3AR2A 5J5CA 1WNTA 3K0SA 2C7OA 4AECA 2FWJA 2RI0A 3KKMA 3Q5DA 4G81A 1NRIA 5I7HA 1POWA 1R5BA 1E69A 1JDJA 1F51E 2HC9A 1CE8A 3OAAD 4TXHA 4YASA 5IULC 1S8AA 1NTOA 2YOGA 4HRYA 2IS1A 3B85A 2VDUE 5AUOB 4CHGA 1XWIA 4JB2A 1O96A 1SBQA 2WT8A 3DTVB 4Q93A 2IV7A 4KREA 1C3VA 3DKPA 1RP7A 1AHHA 2WMOB 2Y1OA 4LNHA 3TTYA 1L2TA 1A4XA 4KU4A 1UBCA 3WRXA 4IVPA 4DCMA 1JIUA 2XE8A 1NVKA 4M54A 2EJWA 4C4OA 5KWSA 2FE4A 1X94A 2FU5C 1HZZC 1RJWA 1N25A 4LW8A 5U1PA 5ALRA 5T57A 3K9QO 3VYSB 5EHXA 2BH9A 4FFDA 2Q6IA 4MCHA 5IK2A 1DQRA 3ISVA 5U4QA 2FP3A 3A05A 4JR0A 5DNVA 2XQKA 3EIHA 2TS1A 2YJ5A 3KL2A 3OTWA 3A3YA 1C4KA 1JXMA 2ECFA 1G18A 1O08A 1RQNA 1DXYA 1VJ1A 2B0CA 2BBSA 2FZWA 2QGFA 2WSYB 3FNBA 3SXUB 3WA7A 4X20B 3AP1A 5EWMB 3WLAA 4ZEMA 2O1WA 4Q9JA 3U60B 4Q02A 1LB1B 4UEJA 5F21A 3HKCA 3ZE2B 4C4TA 3OPNA 3EW7A 4MUNA 1KTVA 1R74A 2GRJA 3H4TA 4M1SA 1BVYF 4D8YA 3AUTA 2RBEA 1VPWA 3WTBA 1WCXA 4X61A 4J0IA 3NHSA 2J9RA 3F9CA 5D2CA 4BB6A 2C1XA 3FWNA 4L9RA 4H3SA 2QM8A 5ABPA 4D5GA 5IZCC 1DCMA 3IOEA 4OHVA 1K9SA 2FEMA 1BH2A 3M7IA 4YQEA 3IQDB 3T9EA 4DC0A 2R25B 1CZRA 4FW9A 3OECA 3Q7SA 4AZVA 4BDTA 2ZJ8A 1TM5E 5AM5A 1EP2B 2ZTMA 4PXAA 3M4NA 3GDOA 3UEOA 4F21A 2CBGA 4EHBA 1N77A 1YOVA 4QJIA 2AH5A 1BMDA 2CBZA 1QJCA 1ZGBA 1J5XA 2Q49A 2E87A 3K94A 4MI9A 4PG5A 2JIPA 5EKTA 3RC1A 1ST3A 3UMJA 4TKLA 3HJNA 5HJ7A 1LDNA 4PIMA 5EJIA 3DVLA 4CM6A 3IBYA 1RCFA 3JQ8A 5P21A 4DDTA 1ZOOA 2CB0A 2FXIA 1XALA 2OV3A 1JXOA 2P3QA 3GAZA 3T1OA 3T4PA 3ZS8A 4D9IA 5KQMA 4C2BA 1Z8DA 2GX6A 2GZRA 1JFFA 3BF7A 3C45A 1I6MA 7YASA 2HYIC 2V7QA 2IX9A 5DYYA 2NU7A 3HUEA 3TOXA 5JQGB 1H8HD 2CMGA 4RV5A 1RJEA 4B44A 4CM3A 1JJ7A 5HS4A 3SBEA 2ISQA 2IOQA 1M8KA 3OVMA 4GI3A 4TWAA 1X13A 3F5DA 4JLVA 2XKKA 2QRZA 1AK1A 1IMJA 1JG1A 1Z0AA 3FG9A 3HLTA 1Z16A 3W7BA 4DCGA 3I04M 3G85A 4P98A 3QPWA 3ZDAA 1PP4A 1DXQA 1XCMA 1GTRA 2I2WA 2V9PA 4PF1A 4CM9D 1PGQA 4Q9IA 5ELLA 3K0CC 4X97A 1M1NB 3AB3A 5EQFA 1GFWA 2W6JD 3VTFA 4EQ6A 4RLFA 1L9XA 2ZT5A 5THKA 2I7CA 3UO8B 1U9IC 1II0A 1DKUA 3AINA 2G9RA 1TU0A 3BMNB 4Y2JA 3DE6X 2QP3A 4HLUC 4P32A 2IH5A 1T8UA 2G4CA 2IP4A 2R97A 3MINB 3VPBA 5LQAA 1X1DA 3IMFA 1TEVA 3PUYA 5LBIA 3DWGA 5KX5F 2W2LD 3BH6A 4C30A 4RENA 3B7PA 1V11A 3GMTA 2HDWA 3GI1A 3NEAA 4ZPJA 4C0LA 1A69A 3M5PA 4BGEA 4GKVA 3HLKA 2X22A 3KLPX 3BD9A 3PKIA 3T9BA 4EB8A 3PEUA 4Z1OA 3P19A 1JA1A 2B7BA 3GGCA 4WZBE 4NDNE 3O3OB 1RYNA 3Q3GE 1E1LA 3EZ2A 3T1QA 5ICFA 3W34A 1KAEA 1SHTX 1Z4JA 4Z4EA 2G82A 2Y77A 5AQEA 4NULA 1NW7A 4JIMA 5JD4A 1Q57A 1SCUA 3I4LA 3QGMA 5BVGB 1I14A 3UWKA 3JU3A 4MUAA 1UPAA 5KWJA 3PGMA 1Z0UA 4UDYX 3NT5A 1SKQA 2ANBA 4GMKA 4O4LA 4YCDA 4YEDA 2QYTA 4CR8A 3G02A 4ENPA 3PE4A 3LL4A 2W6CX 4AY6A 4K2AA 3AVPA 4MWCA 4IZ6A 3TVYA 3HM9A 2TECE 1HXHA 2GOYA 2VHCA 3BKWA 1CY6A 1ML3A 2V6JA 3QPCA 5DW3A 2P9BA 1E99A 1EUDA 1FRVA 2ZCJA 3C3YA 3N8KA 1H2FA 5IUKC 5T41A 2CLIB 1I6LA 3TSCA 3VOSA 1E9CA 4MLDA 1IY1A 3G2LA 5JC8A 5LQDA 3OM9A 4RPGA 4NL4H 4BYMA 1T26A 3PSHA 3GMSA 2H5LA 3P8ZA 5K01A 4P3NA 5CB4F 3H3XA 1ESDA 1LTHR 2JB9A 5BN4B 4CJXA 2JFWA 2PR7A 1E79A 5JLAA 3KWFA 3PRHA 5TARA 2GN9A 1BS1A 2A0WA 4MW0A 3WE7A 3N87A 3HZHA 4RS3A 3AF2A 2ID4A 1BWQA 2OHHA 1SD1A 3MWLA 2ZLBA 4FFSA 3NBXX 4KHZA 4RIHA 4YNBA 2EX4A 1RIIA 3PKJA 1SUCA 1WIWA 4KV7A 5M34A 1DQZA 3FCXA 2XEDA 3KR1A 1IMOA 1FFBA 1ZNZA 4W1QA 2Z9DA 3HWWA 3GLHB 1LCIA 1T6BY 4DLVA 3A4LA 4G5XA 4UEQA 4NYJQ 2XYQA 4U4AA 4O1HA 2Y4OA 3MJSA 2PSFA 2AK2A 1W25A 1DWOA 4AQ7A 3GHYA 4CI9A 5CFZA 1OAOA 4N5HX 4RY0A 4OU4A 1YXMA 5CDYA 3CO5A 1P3DA 2UUOA 3E9CA 5FI1B 3WAGA 4ZDIA 1NG1A 4BWVA 3S27A 2RGNC 4GC5A 4LF6B 4CEHA 3D5TA 3DMTC 4MA4A 4OMDA 4EG5A 3GZ4A 1H5UA 2JLCA 1NYQA 1P9WA 2NX2A 1ESZA 2YV3A 3U39A 1S7GA 2NPOA 5TY0A 2ECKA 2YVKA 2DPYA 4BNZA 5JSZB 3K5WA 3KHSA 3H42B 3EMKA 3KSMA 2ODNA 4ERXA 2HHAA 2WWFA 4HH0A 1NL3A 1OGYA 1RXIA 4JYPA 1GKIA 3HKBA 1ST2A 1NV8A 4KUGA 2X5NA 1W5AA 5CB0A 1NP7A 4QAQA 4BECA 4FQ7A 1S1CA 4AS3A 3BCUA 4G86A 3ZDBA 3D0QA 1P7YA 4LF9B 2ZZMA 1GAQA 3KT8A 3Q72A 2TMKA 4IV5A 1FY2A 1P5FA 3CF4A 1WXDA 3G0DA 1JKJA 1L3CA 1MEJA 2I2CA 2P0EA 4HNTA 1L7DA 3ONNA 1QRTA 1D1SA 4I5GA 5TPWA 1DG9A 5DM2A 1YQWA 5EEGA 4PZZA 5CYGA 5JWHA 4JP8A 1L0BA 4LBVA 4B6FA 5L53A 4O08A 3DFMA 1GAEO 3G2QA 4BQIA 1QZUA 1J24A 4KCGA 1B4DA 2AQKA 3D4NA 5KMGB 3IE1A 1K7EB 1EJBA 2B2XA 4K1XA 5D3ZA 4GOOD 2IZZA 1N2HA 4XAQA 4RVHA 4QGBA 3JD4A 3F1LA 5EPUA 1JH8A 3EEFA 4OQYA 1VDZA 2BHSA 2O52A 2N1BA 4ND8B 1XVLA 1Z75A 3NJ8A 1NTRA 2OCIA 4HJRA 3W8RA 3MWGA 3JQGB 4KAAA 2XB2A 2P9FA 3HDQA 1RHJA 3AKDA 5FWXB 3WISA 1KDRA 3QKRA 1R6XA 5JQGF 2FLVA 2BL4A 4LRYA 2Q4OA 5FA8A 3QTTA 3GAMA 3AB8A 4BKRA 1E9FA 1XKLA 4U6SA 3TFOA 5TPWB 2VZEA 1J1ZA 1TU3A 5EZYA 4P2BA 1MORA 1QHYA 1VPVA 1E2HA 1VJDA 2XIQA 1N1MA 4ITVA 4Q1DA 9ABPA 3FTEA 3G2OA 1VMIA 1JIKA 2JFOA 4GUDA 4AAYA 2R1UA 3G1WA 5AVJA 3IEMA 1AKNA 1BKSB 1TLLA 1IJFA 3OM0A 4MIYA 4DRXB 3KSRA 2VP6A 3DBLB 4YV7A 2AEJA 4L8LA 1F1BA 3CFYA 2BGRA 2GCGA 1A9RA 3VMMA 2W2NA 1RE0A 2P8SA 2QUAA 2YWRA 3KV3O 4HS4A 5E4JA 1PUJA 5KVAA 4L15A 3RS9A 5DNUA 2V0NA 4NQRA 2O8VA 1BXKA 1YU6A 3NV7A 4Y7DA 1JEJA 4YRCA 1LK7A 3GPBA 4RTJA 1EX9A 1FDIA 1E1NA 1SUPA 3A25A 3GN2A 3H2KA 4IM7A 3DOIA 2Q6OA 2DPGA 5JCOA 4BNNA 2IEIA 2B94A 5FFNA 4V1CA 3GB9A 1FVOA 1U5BB 1PAUA 4D56A 4BTEA 4QG7A 3DPSA 3VDMA 1PZXA 1X1SA 2OB2A 3PSAA 3SIRA 3VPHA 3WGMA 4JBYA 2O1EA 2C7GA 3H9QA 4B3MB 2Z5GA 2E9SA 4JLDA 3PWKA 1OZGA 4EVSA 3WNQA 4IJMA 4ZYWA 3ROZA 1UT8A 5GZ1A 3EK2A 5JOQA 5JAPA 2IY7A 3CWCA 4L6CA 4MV9A 1AUOA 3K09C 4RKRA 4S1PA 4FFMA 3WLLA 3KUDA 1W49A 4DGSA 1L7RA 3BDIA 1E2NA 1SOVA 3T06B 1L5GB 4DMRA 1KO7A 2AJLI 3SI7A 5M3BA 5LYJA 3PDIA 3G0OA 1H8HA 2MIIA 3GJXC 4J4BA 1NUHA 4KKVA 4G0XA 2A30A 2ERCA 1FDSA 4DMGA 1K3UB 3FSEA 5LKRA 1K4YA 3N2IA 3MGCA 4MP3A 1DRUA 3D7SA 4RUKA 1NVBA 2FX3A 1V3QE 1RJDA 4C1BA 4NENA 2ADOA 3EZ9A 4EY8A 5FHRA 3IAS6 2WD8A 4CIWA 1DKLA 4ZMBA 1RMYA 1L5VA 3KZKA 1YRBA 4LY0A 4QBHA 1JE1A 2K2WA 4BUCA 2BRUC 4G97A 1W0CA 4I1VA 4DEVA 3LT5A 3IC5A 1XZGA 1BHSA 4II3A 4DS3A 3V3TA 4C2TA 3BXGA 4UHEA 2W8BB 5EJGA 2P3OA 5K0TA 4MTCA 2ZEJA 1SUBA 1YZKA 3LDFA 4BNJA 4OP2A 4B5KA 5KX5B 3FNRA 3TNFA 4PSAA 4HAYA 3QBEA 2VSNA 4NZPA 3FHJA 3DT8A 1V8FA 2YUTA 2ZRBA 3HGQA 3LLUA 4O0MA 4ZREA 3DTYA 3GDGA 4CLRB 3I64A 1QH1B 1T29A 4MO9A 2WU4A 1AO0A 4Z4QA 1GL6A 1FJGB 5BR1A 4J7XA 3PCRB 4YAFA 3RR2A 4ZYYA 4UFOA 4FE3A 4H08A 3VR6A 2Z6UA 3EWAA 2XRZA 1S8FA 2CVOA 3ON5A 4WECA 1NKSA 2L69A 2ZYSA 4JJGA 5A4AA 3C70A 4FZJA 1CJCA 1OTYA 1Y9ZA 3BTVA 1ABBA 1RACA 1KMCA 3P0JA 4DLUA 3K53A 4PGAA 4QQRA 2IV3A 5F2KA 4DLNA 2X9VA 4DDVA 1MX9A 3A7DA 4ZU6X 5LWHA 2WIKA 1LZLA 1JSLA 4OYLA 1C3JA 1HQDA 1JL3A 2Q4TA 1R27A 2G63A 3EXAA 1T5DX 2WAOA 3EZXA 3GFRA 3L8YA 1NW5A 2F9FA 4H17A 5FPQA 5JBIA 1RHRA 2OCKA 1NFQA 1FP7A 1ZHOA 2PH7A 1QMPA 3QUAA 2MDTA 3W6NA 2DSTA 2XUKA 3AEQA 4GO1A 4D45A 5A4JA 1G16A 1O0SA 2C54A 3H0CA 3NR2A 2PQ2A 4ODIA 3TZ6A 3GFSA 4EAQA 1FNSA 5KYKA 2XNSA 4JLUA 3WK4A 1J2YA 2G09A 4KWIA 4OXKA 3ZTTA 2D0PB 5AWFC 4OA8A 2NZUG 2YYAA 1VXRA 3THSA 1LRJA 2LCFA 2YRFA 3TLGB 3SHVA 2VSFA 3MJHA 4IKEA 4JENA 5DGIA 4OHUA 3OFND 4PZEA 5ALZA 2VCHA 4NJMB 3HKDB 3TLEA 2A0XA 1X7YB 2IE8A 2GBCA 2G08A 2J5BA 3MD0A 4Q47A 1UBEA 2EEZA 3ZE1B 4YV0A 2V4ZA 1YCDA 3IJRA 2WJZB 3LFHA 1ZLXA 3UWPA 2GYVA 4GU5A 3FYHA 3FYSA 1E3WA 2A1UA 2PX0A 2VRNA 1HQKA 2H1HA 2VRBA 3OJOA 4XB2A 4UJ3A 5DI9A 5CEEA 5AI9A 4NCKA 4D41A 5KPJA 1I10A 1SXIA 4QVGA 1I9CA 2OXFA 4AI6A 2CD7A 5REQB 1T5SA 1EDZA 1OXVA 5ARBA 4XQCA 3PJRA 2LKDA 3PJDA 1KI2A 2Z3VA 1WF3A 1PT6A 4UMFA 4IDNA 4PANA 3CIOA 5NLLA 5K0GA 5LQCA 1WTAA 1N5LA 4HS9A 2AN1A 5DVZA 4Q1EA 3ZE6A 4OHOA 4RTPA 1MOZA 3EQ8A 3O4HA 3U1TA 4MYUA 5BQXA 2IBMA 5JRJA 4WOKA 2HA3A 3UCXA 1GSHA 2AI1A 3DMRA 4BB9A 4BV3A 4XIYA 3U1VA 2VDLB 2R8EA 5KEIA 1TVMA 2G7MC 1PIWA 3NV9A 5C4MA 3WLQA 2MTBA 3BFPA 5ALSA 2AS0A 4B48A 4D9CA 1KJJA 1RYBA 2QRQA 4TYNA 2FEWB 3AK4A 4GYJA 1GVHA 2W22A 2Z3WA 1RWVA 2II6A 2ZB7A 1DZ3A 2QRJA 4KYIB 4DCCA 3AP2A 4YTEA 1USKA 1GLGA 1JF8A 1EK6A 5ER6A 4C9BA 5KBYA 1B6GA 4AKTA 4EY4A 1W4BA 2DYKA 3GCXA 1SU7A 4TTVA 1A7KA 4EI7A 4BZPA 2XZDA 4BVKA 4M9XA 4FDUA 4KBYA 2ASEA 1Y1PA 1Z18A 2C3YA 2J31A 2J5QA 3JARB 4IEFB 3FTFA 3H2ZA 1RVDA 2EKQA 2HNAA 4UNPA 1EAYA 1RAEA 1Y33E 3A6JA 5BMVF 1XJ5A 4LOLA 1W7AA 4OI2A 5B6IA 5JTTA 2A9PA 3RVNA 1IRIA 1Y34E 5DTMA 3NANA 5GP1A 4E08A 4JT9A 4RTMA 4K8RB 1BW9B 1UMDA 2BGJA 1CQJA 2XT6A 4KO4S 4B2YA 3FPCA 4MUYA 4WZBA 3M1YA 3SR0A 3DO6A 4GLFA 3LQ4A 2EP7A 4QTXA 4XQ0A 1R7RA 2I3BA 5YASA 2RI6A 3GGPA 5C7IO 1KO4A 4NJEB 1L9KA 1YQEA 3RF7A 2WQ7A 3EGXB 4F3CA 1Q11A 3K05A 2CL7X 4O2BF 4E2ZA 1CUVA 4D0SA 5DM70 4CZ2A 2XDQB 4PBRA 2PLRA 4JJAA 1CKEA 2PUJA 3OEWA 3WDMA 4B9AA 1I5EA 2C5SA 1SURA 5CA0A 3T4UA 5IXJA 1USWA 2EIHA 1PWZA 2FGKA 1BMTA 2G36A 4RQAA 2YFQA 4DIMA 1X92A 4PONA 5IP5A 1JEQB 4CQMD 3RK1A 2FSFA 3GRZA 2EWMA 2RBKA 3I9MA 1O6CA 3AFOA 3IILA 3CHYA 3MGAA 5H81A 4B2PA 2V7PA 4MWDA 4U7WA 1JR3E 3NOQA 1T2CA 1RE1A 1Z4MA 3GR6A 3ETCA 3F71A 1TO1E 1CF4A 2GK7A 2Q5FA 5HILA 1N6IA 3IP6A 4N49A 5BXYA 4PYRA 4JJIA 4EABA 4DWVA 2DQYA 2P41A 5IAKA 3RRMA 1GR0A 1NSFA 2YHBA 4JELA 2O0LA 5DP2A 4Z49A 1C1HA 1BDIA 1NNLA 2PUBA 4U6QA 1ZD5A 1G0OA 4I1OA 2NNLD 2KWIA 5F77A 4YAJA 4DLRA 1F2VA 4I9GA 2PJZA 1U3GA 2CXQA 3CJQA 3OT1A 4H60A 3FWHA 1M72A 1MKYA 3DAOA 1T8PA 2O4CA 2NVOA 3FPBA 4KO3S 5G3ZA 3ZE0B 2ISCA 4MUMA 4C0SA 2A9OA 5KU7A 3EOBI 3W8NA 1N7GA 1YASA 3CSDA 3VOBA 1BGWA 3E8XA 3H5OA 3C7CB 1PQPA 4NESA 4RL4A 4TZTA 1GV0A 1G59A 3RK0A 4TTSA 4TN1A 1TLFA 3JR7A 3R7BA 4JBGA 3MAJA 3NRJA 1N7JA 1H42A 4A6DA 5HHTA 3HV2A 2VZ8A 4H7JA 1YRLA 2EKZA 2CXSA 2FEXA 3KTFA 2Q1TA 4NENB 1LW7A 2ZT6A 2Z2JA 1NM5C 4CIDA 1Y48E 3OQHA 3QA3E 2FSSA 2EJUA 2AMVA 2UXCB 5KC9A 1EX7A 4HMQA 1UC4B 4UOEA 1MX5A 3O8CA 3T61A 1ZRSA 4ZK6A 1MIOB 1U7XA 3GNSA 3MUOA 2OCAA 2PT6A 3LNTA 4EQZA 3NVDA 1JA0A 2JGDB 5K6AA 3C3EA 1Z0FA 4BP1A 3FMFA 1SA0A 2X7JA 3GPCA 2DETA 2NP7A 2H4WA 1XRJA 2HBRA 1ORRA 1B76A 1PYOA 2CJWB 5A7HA 4BKPA 5AQ1A 4OAOA 4CKYA 3RHFA 1E58A 2QR3A 4QYWA 1ZU5A 4IJ6A 5E1BA 5LLDA 3W4JA 3QFTA 4TL6A 2NNWB 1FFXB 3W9SA 4CCWA 5DIZA 4XVQA 4ECAA 1VL0A 2IYQA 4N6OA 1AUQA 5A3SA 1RKUA 3IBCA 1ELOA 1LH0A 3IESA 1L5YA 1TFUA 3H2GA 5DEIA 3JQFC 1UCFA 1ZM7A 1XRLA 2EP8A 5JDCC 4NCXA 4Z9BA 1M6NA 1J2EA 2WHQA 3C8UA 5CNIA 1TMOA 1W85B 4D02A 4B4VA 3OKCA 1QQAA 7MHTA 4P82A 1UKYA 1LPMA 3QKSA 1PEAA 1A4IA 3JVEA 3M9WA 4GH5A 3TE6A 2C99A 3NHYA 2QRGA 1CRWG 2JFHA 2RD2A 3P2IA 5JYCA 1N32B 1XC7A 3V46A 4NQZA 4F5DA 5J1SB 3FPLA 4PEVA 3IS3A 2VBCA 3FMPB 3DL2A 2PR2A 4I50A 1KC3A 1QIGA 2VZ9A 4S1VA 3RRZA 3F6YA 3P9NA 5CU7A 3X2SA 4E2YA 4DSUA 4F2GA 1NW6A 1FUUA 1F2UB 3AZQA 5GY7A 5IAAA 4LYJA 4DUPA 3GW8A 1N2GA 3QM1A 4WGGA 2YC4C 3FRJA 4XGKA 4RADA 1FFHA 3F5MA 1NN0A 2Q1YA 5EGSA 1B8OA 1N3IA 2FZ4A 2XD9A 4IIJA 1N92A 3LKDA 1D0VA 7REQA 1ZAKA 3H5LA 3JWJA 4IIJF 1B15A 4OXIA 1KYZA 1PL0A 3IVXA 2GNAA 3GFOA 2I6SA 4K6GA 3HCCA 3K5HA 1MUUA 3WRVA 1VSTA 2P40A 4BNDB 5ADVA 2J1LA 2UXBB 5C81A 4DREA 1OU4A 2EZ8A 2GTIA 2OGZA 3VFDA 4QOHA 4C0JA 2HN9A 3A6KA 4B4OA 1XNQB 5DNEA 4EKNB 1U02A 1SH7A 1PTJC 3OM8A 2C7RA 2NQTA 1QAOA 4OB7A 3ZVKA 1UZUA 5H5JA 2JS7A 1JR6A 1SD5A 1DU4A 3C8HA 1XDBA 4N7MA 2IPNA 2HY7A 3WVNA 1HA3A 1Q1NA 4H7HA 4RVDA 5BN1A 3AVXA 5T4HA 5B6JA 1BD3A 5JD6A 1N6OA 1FSGA 2JRLA 4YT5A 3EXIA 4I99A 1R8YA 2Q4EA 4LHYA 1RWOA 3DBIA 3UYLA 3GCZA 1L4YA 5A4MS 1DAKA 5JBNA 2VUSA 4JCCA 5LBTA 2NWQA 1D2CA 4JVNA 1IU9A 5FRDA 4D0NA 1PS8A 2JAPA 2AI2A 3KC2A 3FYTA 1L1EA 1YU9A 3QVVA 5G0VA 2BMWA 4Y30A 3GRAA 3SQLA 1K5DA 2GA9A 2B36A 3N5KA 1MR3F 4NU8X 3IV6A 1U8YA 2Q4RA 5U4XA 2AOTA 3QVTA 2B82A 3PJEA 2NUTB 2PRJA 2NUAA 5DFAA 1NQWA 3KEGA 4A8JA 3B2QA 1L5RA 2GDJA 2EARA 1OTXA 3I23A 1L7PA 1T2VA 4RKEA 3VZDA 3X2EA 5K8TA 1ODFA 4HSGA 2PZEA 2WNSA 2H5IA 3GZNA 3AX6A 3I5YA 1L7OA 1X7DA 1PFQA 2HR1A 2HWXA 3KV1A 4PS1A 3ER8A 3UGKA 1GKLA 1DEHA 4EJFA 3UXMA 1T3HA 1U3VA 1Z38A 2X2EA 3NONA 1ZX1A 1M2FA 2EJTA 4KWEA 2P4HX 2RGRA 4ARCA 1A2KC 3DMNA 4WI1A 4M1KA 5BMOA 1ZOIA 4AJ9A 3RHZA 3ETJA 3WLNA 3LC7O 3OTGA 2O8FB 3LRPA 1R3DA 2CDCA 3H5VA 3HI6A 4B4UA 4J7AA 5K45A 3DAYA 4X93A 4DYVA 1XV5A 2QN2A 4NBVA 3ECSA 3EJWA 4DLXA 2DXIA 4M8NE 4GM1A 4C6TB 4F93B 4QGHA 4H77A 3EDQA 1ZA1A 3SLRA 4LWZA 2FN8A 4NP6A 1ECFA 1VPLA 3C98A 3I6BA 4H3HB 5J4LA 3ZK7A 3WGIA 1T4DA 4LHXA 1AGXA 1ZN9A 3TB6A 3IHKA 8GPBA 5K0BA 2NQ8A 1M34E 1QANA 1UINA 1YWGO 3U37A 1L4HA 2O14A 3AEUB 3HN2A 3EZYA 4TL8A 3GEPA 2VPXA 5CGQB 4E5NA 1UOOA 5K51A 5FIUA 4G1UC 3IPAA 3ZWBA 1JR2A 4UBLA 2IYWA 4IMPA 1O77A 3AWIA 2ZSEA 2O2CA 3GUHA 4LRTB 5CFQA 3D6AA 1JIVA 1JVNA 5IRCD 1GPYA 1QCDA 1EM6A 4I81A 4OK5A 1U7UA 1N5KA 1C7QA 2FV8A 1RRFA 2N42A 1P5HA 4TZKA 4N65A 1NLYA 4AX4A 4JX9A 5EQDA 4WK2B 2XUFA 5JLJA 1PDVA 2FP4A 3EISA 4LS3A 5G4LA 3ROPA 3OCXA 1GGHA 4M1OA 4ZAXA 2QP4A 4E0BA 4YCCA 2PUWA 1XG5A 4P9NA 3LK7A 4PICA 3DOFA 1OVGA 3DQPA 3OZUA 3QPUA 3CZQA 4IKOA 5DX8A 4C0QC 3IURA 4CM7A 4TZ0A 2VHTA 3WWEA 4PGFA 2XITA 2ZOSA 1J00A 1UDCA 2D5LA 3DOEA 3NOXA 3E35A 4HATA 1FNCA 2F00A 4L02A 1GZ7A 4Q4AB 4W8OA 1D2GA 3OURA 3TMKA 1HDEA 1EXNA 1UQUA 2HJRA 2J0UA 3OZVA 4OQMA 4B32A 2HRQA 3ZI7A 2FCRA 4FMCB 4OXRA 2QF7A 4BKOA 2QG6A 3V5NA 4PX5A 1EB9A 3FUVA 4HO1X 1G38A 4R4JA 2RH5A 1CQWA 4ZT5A 4X7RA 3QYPA 2AV6A 3P32A 1ZH0A 3PLRA 4E31A 2Z57A 1OBVA 1TZMA 5K3OA 1Z7YA 5I9IA 2J6BA 3EUWA 3HFSA 3HA3A 3D3KA 3L8CA 2UVPA 1YH3A 1SUIA 2O8NA 2CHGA 1BWRA 1I8TA 2RB5A 3ZDXB 1KMHB 1V7QA 1RM3A 2J09A 5JYDA 5K0JA 5CAEB 1RNLA 4PW0A 3A8TA 1TPYA 2WWRA 4R2LA 5L9AA 5G1OA 3P9QA 4I7EA 1E1YA 1JHOA 5EXPA 1V5WA 3OZSA 2XTAA 3I09A 2FQXA 3S2EA 4RSGA 1JKMA 5CX4A 1M1NA 5A4FS 3ZDEA 2JFNA 5CXSA 2V5UA 5HPYB 2IDJA 3U3XA 1M54A 3DE4X 3N2EA 4KGDA 3TOVA 4JOSA 2K4MA 3ZBUA 4H4CA 1IATA 1Z7GA 4M21A 5FPTA 2R96A 1Y42X 2DHCA 3GLTA 3Q4GA 1ISHA 3W2GA 3GX1A 1X19A 3IB3A 4GIBA 4BLTA 4MR9A 1FTYA 3TQQA 4RSMA 4ND5A 3HKBB 1WPGA 1WZCA 4FR2A 5JRZA 5KHLB 1KZ9A 1QRSA 1JHDA 1P0MA 2I33A 5CT4A 2HLDD 4ND7A 4UPEA 5LLTA 3K70D 1C4XA 1VHJA 2XMGA 3VYWA 4H1WA 3KUUA 5G41A 1OZHA 2OXTA 2YDYA 2OORC 3PFNA 4MVYA 2B4YA 4W5QA 4EHKA 1HYGA 3O4JA 3Q41A 5IC6A 2FSPA 3EGOA 3QEAZ 1VJRA 1G42A 3C5VA 3PT5A 4IHKA 2IS2A 3F8SA 3HZRA 4R1QA 1CJVC 3WOHA 1X7XB 1A7AA