1A9UA

The complex structure of the map kinase p38/sb203580
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
351
structure length
351
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAP KINASE P38
publication title Structural basis of inhibitor selectivity in MAP kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 106
structure length 351
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 1998-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1a9uA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1a9uA01
5F1ZA 5IF1A 4DEAA 2ETRA 3IKAA 1LEWA 4IM0A 4QMOA 5EI2A 4GUEA 3DNDA 3KMUA 3PY0A 4BDBA 5KMLA 2BFYA 2CNUA 5EQEA 5FEQA 4HVIA 2W1HA 3UZTA 4YURA 3Q6WA 5IA3A 3DKOA 1BI8A 2WKMA 4PL5A 5HORA 2YEXA 2BPMA 1ERKA 3O17A 5D7VA 4IJ9A 1QMZA 4FTMA 1W7HA 5AUZA 4APPA 2J0KA 4E4LA 5A6NA 2JDOA 3FMEA 3O8UA 2GS6A 3AC8A 4FIJA 5CWZA 5HLWA 3U6IA 1GOLA 4FTNA 1PMEA 5AUWA 1JSUA 4EK3A 2XK8A 4F0IA 2ZV9A 4FEQA 5KNJA 2HWOA 3A4PA 4O0YA 5I9WA 3PY3A 5CXZA 1A06A 1H1RA 3W55A 2QCSA 2JC6A 4NU1A 4O7SA 4RJ5A 1FPUA 5M4CA 3WILA 4BDEA 3FQEA 3PLSA 3WE4A 2B53A 2RIOA 2R3PA 3EQBA 3EKKA 5HBJA 2CNQA 3QD0A 2BDJA 3QRTA 4QP4A 4Y73A 2ZVAA 4M12A 2CLQA 4NW5A 1FBNA 2JDSA 4IX5A 2FA2A 3RK5A 2R9SA 5AIRA 4CNHA 2DWBA 1U54A 3N4VA 3NVMB 4DC2A 3SG9A 3G33A 3Q9ZA 4FT7A 5AV2A 5BYZA 2YM5A 3DAEA 5JKGA 3K3IA 4JDJA 2YERA 4LV5A 2C3KA 5LVLA 4O83A 1NXKA 5ETAA 5KO1A 3CPCA 4MBIA 3DA6A 1O6KA 2A19B 4V05A 4ZIMA 3ZRMA 2VTNA 2IG7A 4V04A 4EOIA 2B9IA 1BUHA 2JIUA 5HTBA 1OUKA 3KKVA 3PSDA 4S34A 3I0QA 4FV0A 4LQMA 2YCQA 4XMOA 4YZBA 2HZ0A 4BB4A 3ORNA 4CQEA 3OY1A 3GNIB 1H8FA 4LGGA 2AC5A 3LFDA 4OTPA 2W1CA 4A9SA 3O23A 4EKLA 1SVEA 5HNBA 4R5SA 3CKWA 3HV6A 5DWRA 4EQMA 2C47A 4FV1A 4BWXA 2QOFA 4NM3A 4ZMEA 4QPSA 3NDMA 2VWVA 3QA8A 3ZS5A 4EJ7A 3DTCA 4TT7A 5K4JA 1SZMA 1U4DA 2YZAA 2WTCA 1OM1A 5CEPA 5EQYA 4JG7A 2RFEA 5HNGA 4ITHA 3NUSA 1YW2A 4XV3A 2C6DA 2R3IA 5H2UA 2VWXA 4L67A 4XX9A 2J5FA 4FV3A 4I6HA 3R7UA 4CFUA 3ORXA 2XVDA 4BIDA 5HCZA 4IJPA 5LVPA 1YXXA 1V0PA 2VUWA 3HRBA 3Q4CA 5I9VA 4MH7A 3SW7A 1O6YA 3REPA 3KK9A 3QWJA 4IM3A 4RWLA 4EK8A 5FEEA 4YZNA 4AZTA 4GV1A 1T45A 4YZDA 5AAEA 5A3XA 3GBZA 3PRIA 3OXZA 4FKOA 2BVAA 2BZIB 3AMYA 2JDVA 2OZOA 3CGFA 4NCTA 4OTHA 3WZKA 4EHVA 5I9YA 1A48A 4IDTA 4GKIA 1IA9A 3E8CA 2VTQA 4JG8A 3UO4A 5BVDA 3NX8A 3ZXTA 2JLDA 3WYXA 4R7IA 3FI4A 2XH5A 4QQCA 4LGDA 5T3QA 2C3JA 1KE5A 4FZAB 4Y72A 4FT5A 3R1QA 5J5SA 4F7JA 2OJIA 4G3GA 4DFLA 1Q24A 3BHHA 4MNEA 3DK6A 4N6ZA 1OB3A 4IWDA 4DGNA 1MQBA 4IEBA 3P86A 5J79A 4RQVA 4YTHA 4C34A 5HHWA 2UW3A 2OJGA 3KF7A 3MH3A 4IAAA 2YIXA 4DTBA 3PLAE 3F69A 2PVKA 4IX3A 2IO6A 4HVDA 5FDPA 4HCTA 3RK9A 3VAPA 4L7SA 3B8QA 3NUPA 4WKQA 4DH7A 4HVSA 2OJFE 2PPQA 2WXVA 4EK4A 5AP6A 3GCUA 1K3AA 2RGPA 2UZWE 2C5NA 4U81A 3NZ0A 2B55A 2XJ2A 3GFEA 4JOAA 4OGRA 3NPCA 3RGFA 4IVAA 4GCJA 3EZRA 2F49A 3EFLA 1CDKA 2ZM4A 4YHFA 4PUZA 3PSBA 5CAQA 1PXNA 2WFYA 4FBXA 4R7BA 4L01A 5ANKA 4ZY5A 3ODZX 2VTHA 4IX6A 4X2FA 4YZ9A 3RKBA 5JGAA 2VO6A 2CJMA 4DEGA 4LOPA 4BWPA 2QI8A 4RWKA 3FWQA 2OXYA 2BDWA 3JVRA 4MBLA 2WMUA 2X8DA 2OU7A 4JBVA 5FBOA 1QPCA 4DEEA 4QP8A 4NWMA 2XNEA 4FTKA 2OJJA 4GEOA 4CXAA 4QPMA 4AU8A 3FLYA 2YDIA 3IW5A 3V5WA 3ZMMA 4EONA 1VEBA 2UVXA 3E93A 3I60A 3FPMA 3PY1A 1OKVA 4ZTSA 3GFWA 4AZVA 3HECA 3FXWA 3IECA 1ZMUA 4FR4A 5KX8A 4HCVA 5DH3A 4F6UA 4GH2A 5BPYA 5JFXA 2B7AA 3GCPA 4C59A 4RFMA 4A4XA 3JYAA 2W0JA 1G3NA 1VYZA 2F57A 4XBRA 3FJQE 2V55A 3HMNA 4TWNA 1OZ1A 3DJ7A 5ETIA 5FD2A 2V22A 4BCFA 3OT3A 3R2BA 4AX8A 3G51A 4OTQA 4O0RA 5ACBC 1YHSA 4GK4A 5T68A 4CTCA 3D2KA 4RVKA 2GNIA 3QZHA 4RX9A 4BCHA 2XK9A 5M55A 4M66A 3LLTA 5BNJA 2JDTA 4C4GA 4RX8A 4U80A 4J53A 2WQMA 3SHEA 3ZLSA 4MXYA 1E9HA 2WU6A 4NUSA 4J7BA 2BRNA 4YJPA 1REJA 3LCTA 4DGMA 3BU6A 4K18A 4I0RA 2PUUA 3LKMA 2PUNA 4I21A 5AP5A 5AP7A 1TQIA 3R1SA 3VW6A 5HEZA 5TOZA 4CLIA 1QPEA 3G0EA 4GS6A 5E1SA 5FG8A 5AADA 5J7BA 4NH1A 5GJGA 5GZ9A 3WZEA 2XKFA 2YLFA 3NNWA 3Q5ZA 4Z55A 2ITPA 3LMHA 2QKWB 4O96A 4QMQA 3UPZA 2CGWA 5EHOA 4EBWA 3DJ5A 4ANMA 4IB3A 2X9FA 3HV4A 3KRJA 3LQ8A 4BCMA 1PJKA 3M42A 3CSVA 5A4EA 3PPJA 4G6NA 3DAJA 3MTLA 3OG7A 3BIZA 1PXJA 5CQUA 5DVRA 1W82A 3GC8A 1OIQA 4FKPA 5CEQA 4D5HA 2ZDUA 4JLCA 1ZMWA 1MRUA 2PYWA 2IVTA 3QTUA 5HU9A 4CCUA 4DHFA 3R6XA 2JKKA 2OWBA 3JVSA 4LL5A 4BI0A 5KBQA 2BFXA 3WF6A 2BRHA 4ZLYA 4CV8A 2ZMDA 3TJCA 3VIDA 4JBPA 4EHZA 2C5XA 4XEYA 3PZHA 1U46A 1Z9XA 3ROYA 3RI1A 5AMNA 5FXQA 2UZOA 3G0FA 3HA6A 2E9VA 2YA9A 1FVTA 2OXXA 3G90X 3K2LA 3QQFA 5DEYA 4QP1A 1J7UA 1IAJA 1W0XC 3Q4UA 3F2AA 3K3JA 3TZ8A 3BPRA 3CY2A 1FGIA 5LVMA 3RAKA 1JWHA 1NA7A 4JR7A 4JRNA 2NO3A 3PZEA 2UW0A 2PVMA 3JS2A 5DN3A 2W1DA 5ANEA 4FV6A 3OCBA 2HELA 3RPOA 2XB7A 3II5A 4ZZOA 3U87A 2QO2A 1H07A 2W1FA 2XEYA 4GJ2A 1YVJA 3UOKA 3D2IA 3I6WA 5CALA 5IG1A 1PMUA 3RWQA 2R0IA 3KC3A 4O7VA 2Z7RA 4EOSA 1DS5A 1JKKA 4HNIA 3DCVA 3C4ZA 5EHLA 2I40A 4ZY6A 4AT5A 3LMIA 4R77A 4UYAA 1JKLA 2JGZA 4KBAA 4BZNA 5AA9A 4EH8A 4L8MA 1PMNA 3LM0A 4I3ZA 4XYFA 3SDJA 5LARA 4FYNA 2QOBA 4TWCA 4YJSA 2FB8A 4YZMA 5GJFA 5HD7A 5HG5A 4EL9A 4EORA 3VS4A 1PY5A 2Z02A 4AZSA 3UNKA 4XG9A 5E8UA 4DGOA 2PMNX 2J51A 5K9IA 3EL8A 4F0GA 3OOMA 3BGQA 3BLHA 5CLPA 5HO8A 3A8WA 4KBKA 1WBVA 1CMKE 1PKDA 2XNBA 3BRBA 4RIXB 5AR7A 3R7IA 3R1YA 3VBWA 4FF8A 1NY3A 5KHXA 4WIHA 3R01A 4MXCA 2H6DA 4RA5A 4F1TA 3K5VA 4YLKA 3ZTXA 5K4IA 4GT5A 3F82A 4XP2A 3SOAA 3UQGA 1JNKA 4FG9A 4C02A 2C3IB 3ALNA 3BU3A 5HBHA 2QO7A 3EQGA 5J95A 5F94A 3IONA 5E8WA 4ALWA 2V7OA 1K9AA 4YBKA 4JR3A 4C4IA 4CG8A 4XH6A 2OZAA 4QTDA 3UNJA 4C58A 1M7QA 4LRJA 5J9YA 4KINA 3DKGA 3SXFA 3QCSA 1JPAA 3GVUA 4RIYB 3MIYA 2BALA 2GNJA 5H3QA 4AS0A 5HX8A 4OAVB 4AW1A 1NW1A 5A9UA 4I23A 5DRBA 4BDKA 4ORKA 4EOPA 3R8VA 2UW7A 3HGKA 4FSNA 5CU3A 4LG4A 4EKKA 4BCKA 4HNFA 3AC1A 5KHWA 4O0SA 5AUTA 3WYYA 3AC4A 5GZ8A 4BGQA 2G2FA 4L3LA 4LI5A 2WTJA 2CSNA 4NZWB 3VBXA 2GCDA 2C6OA 3DFAA 3BV2A 2UW8A 5M4IA 3O8TA 4AWIA 1PXOA 1WBSA 4FKUA 4U97A 4AAAA 4HGLA 4UMQA 1H1WA 1M14A 1SNXA 2IZSA 5HOAA 3KULB 1H26A 3T3VA 5BUEA 4RJ3A 3UIUA 5E92A 3LFQA 3NUAA 4QP7A 4ERKA 1DAYA 3VQHA 2BMCA 4A06A 5HESA 1CTPE 3C5UA 4MD7E 2OK1A 2R3LA 3PIXA 4KIQA 2ZOQA 3VRYA 3PA4A 4RPVA 5BUJA 1WCCA 2H8HA 5DNRA 3UMXA 4QMLA 4QMYA 3QF9A 4NL0A 2XCHA 4ASZA 4EC8A 3QTZA 5AEPA 1MQ4A 1UNLA 4JVGA 5M08A 5HU3A 2CMWA 4GYIA 1WAKA 4I92A 3NWWA 4IBMA 2WQBA 3NAXA 2CPKE 5E1EA 4MF1A 5CEKA 5IH4A 4KABA 3FEGA 3L9NA 4TYJA 4OTDA 1MRYA 2VTIA 4BRXA 5CU2A 5D41A 5DR9A 2Y6MA 5L8JA 3F6XA 3AQVA 4B8LA 3LQ5A 2PK9A 1J7IA 5F20A 5I9ZA 2ERZE 2BZKB 4W8EA 2BDFA 1DI9A 2XKDA 4YUQA 3DLSA 1AD5A 4R5YA 1M2PA 4WO5A 1G8SA 4EHEA 4WRGA 5IKWA 1H27A 4PV0A 3C4EA 4AGDA 3KU2A 4AA0A 4BDFA 5EYCA 1XH9A 2PZPA 3HKOA 4BDHA 1O6LA 3M2WA 2I0EA 4J96A 4QQTA 5IQIA 3JY9A 3FZRA 1WFCA 4L68A 2ETMA 5C1QB 2QURA 2VTAA 1BMKA 4J97A 5DRDA 2PE2A 3DB8A 1YI4A 3OZ6A 2XYUA 3EZVA 4RWJA 1XO2B 4AP7A 2WMXA 4IB5A 4DFNA 2CKPA 3A7GA 5D9HA 4Z7GA 3TTJA 4N6YA 4O0XA 3EQIA 1YQJA 1ZARA 2XRWA 3HL7A 2VWUA 3LFSA 3S00A 4DAWA 3G15A 1R0PA 3NYNA 3QYWA 4RC4A 4LL0A 3NUUA 4PRJA 5IQEA 4RFYA 2F9GA 2J4ZA 2WZJA 4G3EA 4KIPA 1WVWA 5C8NA 1AGWA 4PP7A 3THBA 4E20A 2W5HA 4O6LA 1H24A 5EK7A 3BWJA 4ANBA 2WTKB 1ZYCA 3OEFX 5DR6A 3RAIA 3EJ1A 3LFNA 3BV3A 3PXRA 3QQJA 4FIIA 2QVSE 4XG2A 4DH1A 3EFJA 4M14A 4D2RA 4M3QA 3DZQA 2CGUA 3NMUF 5L2TA 4V0GA 4A9TA 4H36A 5IMXA 4GSBA 4W4VA 2OIDA 4Z7HA 4I94A 3MPAA 3FMMA 3OVVA 1UU9A 3ET7A 2C1BA 3HNGA 3DS6A 2ZM1A 3CS9A 4XNEA 3FZPA 4ANOA 4EH2A 2ZAZA 5KMIA 2JAVA 3VULA 4AQCA 4U43A 2BCJA 3QYZA 4BZDA 1Y6BA 4YHJA 4PTEA 2RFNA 2X1NA 3QTQA 4FIEA 4EYJA 4MEDA 4QPAA 1G5SA 3OD6X 2HOGA 5CVHA 4YJNA 5EH0A 5A4TA 2O2UA 2QODA 4O7YA 4HGEA 3BEGA 3IG7A 3RZFA 4FI1A 1TVOA 3UPXA 4UMUA 2F7XE 3GU5A 4OTRA 3MVMA 5AR5A 2B4SB 4G6LA 4GK2A 3UIMA 2F7EE 5HNIX 4RSSA 4XG6A 2OFUA 4BI2A 4DEHA 4O0UA 1WVXA 5BUIA 3OWLA 4FV5A 4U0IA 3VUDA 5LMKA 2WB8A 3LFBA 4XV9A 1UU8A 4IFGA 3MY5A 5EI6A 4FOCA 4EUUA 2B9FA 3IOPA 5IQFA 2ITNA 3DFCB 2CCHA 5M4FA 3FLQA 4UWYA 4F9CA 3D5WA 4RFZA 3ORLA 2ZV2A 4PDSA 4ZTHA 5IU2A 1M52A 3CTJA 2ZMCA 3F9NA 2YDJA 4FKRA 5LXMA 5HZNA 2PUIA 3DT1A 2BZHB 3U6HA 2WMVA 4MQ2A 3PP0A 2B52A 4FKQA 5DT4A 3FZSA 1OIYA 4DH3A 3O8PA 5FBNC 2P55A 5E90A 2BHEA 3D5XA 4MXOA 4FA2A 3R8PA 3R9HA 5LWNA 4C4FA 2XNGA 4LYNA 2YCRA 2KTYA 2XA4A 1RW8A 3MH2A 3MV5A 1ZYSA 4O7RA 2GHGA 4U44A 3K5UA 4EOMA 3Q2MA 2O3PA 2OG8A 1E1XA 4ASDA 4ASEA 4WT6A 1DM2A 5IPJA 4IE9A 4GYGA 2JIIA 5AP4A 5HG8A 3QZIA 3KXNA 5ITAA 5LMBA 3Q9YA 3UIBA 3KXZA 1Q8TA 2VAGA 3TT0A 5M4UA 3R30A 4FZFB 3F3VA 3O7LD 3EQHA 5FXRA 4NYEA 4TTHB 2OIQA 3W8LA 3SRVB 3LJ0A 4UB7A 5FP5A 3DK3A 4Z3VA 4BCQA 3EIDA 2VZ6A 3QQUA 4NIFB 2VTRA 4DTKA 5FQDC 1V1KA 2BAKA 3W2PA 4W4YA 5ETFA 3UZRA 3IW6A 4JG6A 4O21A 4QP9A 2XNMA 4DH8A 3NUYA 3KXXA 1XHAA 2XZSA 3QZFA 4ZP5A 4DGLC 1PXLA 4QYYA 3UVQA 4NTSA 4I22A 2EXCX 5I3RA 4RX7A 3L9LA 1UNHA 1WMKA 4J8MA 3W32A 3FQSA 4C0TA 4CKJA 3F61A 2Y0AA 4CFVA 5AA8A 3T9IA 3EFKA 1J1BA 2YHVA 5FDXA 4ZSAA 3RNYA 1XKKA 3G6HA 3H9RA 3R02A 4ZTLA 4F1MA 4AT3A 4F7LA 4CSVA 2SRCA 3Q9WA 4RVMA 4HVHA 4GFMA 3TCPA 1WBPA 4TYIA 3DU8A 2BHHA 3D83A 4FL3A 5ETCA 3UOLA 3R7OA 4YTCA 3R83A 3TKUA 4YO4A 3HV7A 4ZSJA 2DS1A 3QBNA 4FEXA 1PKGA 1PXKA 3F66A 1F5QA 3U9NA 5CTPA 1B39A 3D4QA 2PSQA 3H0YA 3S4QA 4D0XA 2PHKA 3AT4A 4PMMA 5CAVA 4CCBA 4YMJA 3OEZA 4USEA 2V7AA 2G1TA 3S95A 2FSOX 3C4CA 5JRSA 2WD1A 2CLXA 1OIUA 4C36A 5HIEA 3ULIA 4L44A 1ZOGA 3DZOA 3FI3A 4J8NA 4O38A 4YTIA 3R9NA 4ZMFA 4FV2A 2G2HA 3JY0A 4J95A 3VS1A 3DQXA 4CFWA 4N57A 3RPYA 4HPUE 2JBOA 2OSCA 5K3YA 4PTGA 5C9CA 3V5TA 1JKTA 5GNKA 3W16A 4ANLA 4BHZA 4CZUA 4YSJA 5JGBA 2W9FB 4CV9A 3FHRA 3QCYA 1M7NA 4M67A 3NIZA 3R0TA 3Q9XA 1WBTA 4FKLA 1LP4A 4BL1A 3D5VA 4PP9A 3V8WA 3E8DA 4UMTA 4Y83A 2RSVA 4YJTA 5C8MA 2JD5A 4JI9A 4BI1A 3O50A 5ANIA 5HBEA 4V01A 3P08A 3FQHA 4O0VA 3NIEA 2I0YA 4FKIA 2CHLA 4E73A 5L3AA 3ID6C 3GCVA 3Q5IA 4L3PA 3PPKA 1AQ1A 4K77A 3UJGA 4BKJA 1PXPA 3F5PA 4L53A 4TYHB 2WEIA 3FY0A 4R3RA 4UZHA 5B7VA 2ITQA 3ZBFA 4KS8A 5IA5A 4FIFA 3H9FA 5M51A 3LM5A 3O0GA 5KZIA 5I3OA 3MH1A 3T8OA 1APME 2HW6A 2WTKC 5E91A 4G5PA 3ZEPA 1IG1A 2R7BA 4NEUA 2Y9QA 4P5QA 3UG2A 4IWOA 4AGUA 4XHKB 5HQ0A 4KNBA 3GI3A 3QUDA 4UBAA 5HKMA 3HMPA 2NNWB 3RTPA 3W2QA 4NM5A 4UN0C 3TM0A 2C69A 2R4BA 2YIWA 3COHA 1LUFA 4L9IA 4LM5A 5E7RA 4ZY4A 4L42A 4USFA 4MCVA 5AJQA 5BMMA 3V51A 5BYYA 2XK7A 3AT3A 2XMYA 3VC4A 5LVNA 4QMUA 3A4OX 5K0KA 4I20A 2H34A 1B38A 5M56A 2PZYA 4R3CA 1YOLA 3EQFA 4FX3A 4NM0A 2X39A 4QTCA 2EU9A 3QRUA 4U9AA 2IZUA 5AUUA 3LFFA 3OW3A 3GXLA 5FTOA 3BBTB 3ZONA 4CRSA 3DPKA 1UU3A 1QCFA 3TUCA 4EQUA 4U41A 3UOHA 3H10A 2HK5A 2X81A 2J50A 3FC2A 3IDCA 4QTEA 2W1GA 1ZRZA 3V01A 3VUIA 3BCEA 1ATPE 2WTWA 4ACHA 4KSPA 5E8ZA 5HCXA 5C27A 3ZH8A 4AFJA 3BKBA 4ANNA 4USDA 2JIVA 4H1JA 4NJ3A 1P4OA 3KRRA 3RBWA 3UBDA 3EKNA 3SXSA 4D2TA 3LPBA 3IOKA 3WE8A 4FZ7A 3OBJA 3VRZA 1Q4LA 2BIYA 1ZYJA 2GHMA 4I4FA 3V6SA 4M69B 1UA2A 5CU4A 3ZBXA 5E9EA 1Z5MA 3RCJA 1YWNA 2WMTA 4PX6A 3U55A 1OL6A 5AR4A 3MSSA 1GIIA 4FGRA 1OITA 2Y4IC 3WARA 3BYOA 2FVDA 3VN9A 2YISA 1Q97A 4OR5A 5DG5A 3BYMA 4ZLOA 2UZLA 4FTOA 4PQNA 1KE6A 3R8MA 2HW7A 1Q3DA 4ZAUA 5E8SA 4R3PA 4KKHA 2A1AB 1Q8UA 4I93A 3WI6A 4FVPA 4F64A 4ZJJA 4WRSA 4OTFA 4EOKA 4TRLA 3EL7A 4HYUA 3SXRA 2GPHA 1XH7A 2GMXA 4I5PA 4KIKB 3HMMA 5KCVA 4IZ5A 3QXOA 2J9MA 1FVVA 4BDGA 5CU6A 3PFQA 4GT4A 4HYSA 3WIGA 5KKRB 3QZGA 3IGGA 2J90A 3L8XA 4G3CA 4YBJA 2ZJWA 5IA2A 3COKA 4JX7A 3EN7A 4KS7A 3ORIA 3QUEA 4UMPA 2YM7A 3CXWA 3NCZA 3DTWA 3F88A 3I1AA 2J6MA 4BGGA 3BI6A 3LAUA 5AP2A 5HE1A 4EOQA 2OH4A 4BVUA 5IQAA 4BCPA 4BTKA 2QOCA 3Q4ZA 2XKEA 3AGMA 5E8TA 5F95A 4IAKA 4D4VA 4U79A 3ROCA 4FV8A 1KE7A 3R04A 4MD9E 3ENHA 3DLZA 4FSTA 4QMSA 2X6DA 3BBWA 3QHWA 1JOWB 5TO8A 3WIKA 4EH4A 5EFQA 3D7TB 4NFMA 4TNDA 2G2IA 5H9BA 2UW4A 3FMNA 3I7BA 4Q9SA 3P7BA 3F7WA 3V3VA 2FSTX 4MXAA 4E3CA 1MP8A 3O96A 4G3FA 2WNTA 4IAIA 4QNAA 4S32A 2NP8A 2XEZA 2W96B 3BQCA 4AUAA 4RIXA 3T9TA 2IZRA 2X8EA 3FPQA 4AGWA 4QMVA 4GFGA 4K9YA 4WOVA 4AF3A 2YJSA 3R00A 3TUBA 3CLYA 4TKSA 2ETKA 2IW8A 3ANQA 2VTJA 4D9TA 5L2QA 3QC9A 5L6OA 2PVJA 3AD5A 2PE0A 3MIAA 4IW0A 1IEPA 2B0QA 5CF6A 4UV0A 4YO6A 4U45A 4YC8A 4JAIA 2RG5A 3ORPA 2X2LA 5EM7A 1OKYA 2YIRA 3P7AA 3QTRA 4FG7A 1Y6AA 3ACKA 4QMTA 3AMAA 3D94A 2J0LA 3L8PA 5A4CA 4DH5A 4TYGA 5AUYA 1EH4A 5F9EA 2YM3A 4CD0A 2C6MA 4RIOA 2E9OA 2LGCA 4P2KA 1H0WA 3OFMA 3V5JA 2FH9A 3QU0A 1F3MC 3OW4A 3PUPA 4FNZA 1YOMA 4E5BA 3MVHA 1GJOA 3MS9A 2PVFA 2VWBA 3HP5A 2JAMA 3HUBA 2AUHA 3OP5A 3LXKA 3TNQB 3U9CA 4BDJA 3LCDA 1REKA 3W33A 4FOBA 1CM8A 5HICA 1VJYA 3ZXZA 4XG8A 2ERKA 3MH0A 4PDOA 4MBJA 5FWKK 4HVGA 4H3QA 4WUAA 2HAKA 5DIAA 3CD8A 3FXZA 3KULA 5CT7A 2WTDA 4QD6A 3W2CA 2YABA 4X6RA 4YJUA 4BR3A 4CG9A 5HCYA 4JX3A 4U3ZA 2XRUA 3ZM9A 1OKZA 4KKGA 2WMQA 5KMJA 3WF5A 2E2BA 3DK7A 5AP1A 3UC4A 2NPQA 2V0DA 3COMA 3EQDA 2WTIA 3VHKA 3DDQA 2PMIA 3VS6A 2I1MA 3R21A 5IQHA 5LMKC 2R3NA 2X0GA 4IM2A 4MQ1A 4ZJVA 5IH6A 3BELA 1F0QA 2QU6A 3HLLA 4CMOA 2WIPA 2OH0E 3FYJX 4G34A 2FYSA 4O91A 5AX9A 3RNIA 4IVCA 4YGAA 4APCA 2X4FA 5AR3A 3QKLA 3OUKA 2IWIA 4AN2A 3ZUUA 4FTQA 4QP3A 5CYIA 3SAYA 2RL5A 3ZU7A 4BTMA 3LFEA 3POOA 4ZZNA 4EK5A 3HV3A 3IW7A 5E4HA 3PRFA 5J7HA 5AV0A 5A6OA 1Q8YA 3OTVA 2QC6A 3VJNA 3RINA 5JEBA 2VTPA 2B1PA 2YM8A 3IK3A 3NNVA 4K6ZA 2PU8A 3KXGA 4JBQA 1TQPA 4BBFA 1WVYA 2WMBA 1YI6A 3QQHA 4YJRA 3FKOA 4ASXA 4E6DA 3ENMA 1KOBA 1BL7A 3ACJA 5CVGA 3I81A 3GQIA 3C50A 3U4WA 3TZMA 1OUYA 3CEKA 4W9XA 2QHMA 3A2CA 3QALE 3EQCA 4MAOA 2PZ5A 3Q04A 2C4GA 4FTAA 5DR2A 3MFTA 4F08A 3SC1A 2CKEA 3S2PA 3TKIA 2OKRA 3GC9A 2B9JA 4JQ8A 3QQKA 4W4WA 5FEDA 4ZEGA 5TE0A 2C6LA 3FLWA 2Z60A 5A4QA 3KXHA 3POZA 4LRKA 5AV1A 2QD9A 4PNIA 3UODA 4FL1A 3ALOA 4WHZA 4N70A 3A8XA 4X6QC 4OLIA 4FZ6A 4DN5A 5AR8A 3OOGA 1URCA 4FICA 1ZYDA 4CMUA 5JH6A 2W5BA 4QP2A 3MJ1A 4GJ3A 4I24A 5CANA 3GC7A 5J5TA 3BHVA 4LOOA 4PTCA 3DV3A 3EN9A 3PXZA 4OBPA 2GNHA 3NW7A 3ZM4A 3WZDA 3EN6A 2QG7A 3HYHA 4KD1A 3UVRA 5IH5A 5L2SA 4M15A 1CKJA 4QNYA 4I0SA 4YU2A 3KEXA 3VBTA 2Y6OA 1H28A 3F3TA 5EOLA 3JXWA 2XIKA 3VUKA 3MY1A 3IPHA 1FINA 4FNXA 3V5PA 2XNPA 2YFXA 3UP7A 3TZ9A 4NT4A 4BTJA 4EYMA 1GZNA 1XBCA 3FUPA 3FAAA 4FT3A 4DFUA 2QOHA 4D55A 5IMEA 1CKPA 4MD8E 4NKSA 4DFZE 4I6QA 3TV6A 5B2KA 4S2ZA 4XV2A 3KREA 1NVRA 2OBJA 1YXVA 4UY9A 4G9RA 2GNFA 3QD3A 2WMSA 4E93A 4BCJA 1OPKA 1S9IA 4ZTQA 4YLJA 4TY1A 5FTGA 5L2WA 3PXFA 1YDTE 2DUVA 2RFSA 1KSWA 4QMWA 4EH9A 4L3JA 1OPJA 5HGIA 3TIZA 2PWLA 4YC3A 5HE3A 3OCSA 4JXFA 4ACDA 3QTWA 4D0WA 4E4MA 2E9PA 2VTLA 4FTIA 4FSYA 4JIKA 4H3PA 4I5CA 4D2PA 1DI8A 4I4EA 2PZIA 2QOOA 3NS9A 3DBEA 4MXXA 1XH5A 3PJ8A 5EYKA 3UMWA 2GS2A 5CAPA 4S33A 3C5IA 5D1JA 3FHIA 3FC1X 3R63A 4I5HA 4PY1A 4AFEA 2R3JA 3UO5A 3AC5A 4TWPA 3LFAA 3ZC6A 4IAFA 2P0CA 4DGGA 5JZJA 3WOWA 4MF0A 3LVPA 3P79A 2BROA 5FXSA 5H8BA 2OGVA 5IQBA 1DAWA 1GY3A 4FV7A 4XLVA 3FL4A 4B4LA 5D7AA 1KV2A 4ITIA 2CNVA 1P4FA 2X6EA 3M11A 2NRUA 4HYHA 2W5AA 4JL9A 5L4QA 2J5EA 3TXOA 2BRBA 4M7IA 4EH3A 3ERKA 3WBLA 3FI2A 5HVYA 2QKRA 5DFPA 4KWPA 4ALUA 1YDRE 4S30A 1JBPE 5KBRA 3GU4A 4R1VA 2UZDA 2UV2A 2WOUA 3OT8A 5L6PA 1BX6A 1OL7A 2BZJA 2VNYA 2WGJA 1OL5A 4X3FB 3QKMA 4CYJA 4OT6A 4EBVA 1P2AA 2YZLA 3TDVA 3U6JA 2VV9A 3QTIA 4OTIA 4OTGA 4QTBA 4RLKA 4U3YA 5CENA 3SRVA 4C33A 4Q9ZA 5GZAA 3TUDA 2F7ZE 3PG3A 3HZTA 4NIFA 5G1XA 4RIWB 2YIYA 3I4BA 3NYXA 5CSVA 5AWMA 3DB6A 2YAAA 4RG0A 4H58A 1GZ8A 4FEWA 5EDPA 4BCOA 5LJJA 3H9OA 4GK3A 5AM7A 5EI8A 4K33A 4KSQA 4H1MA 2AC3A 1OL1A 4EH7A 4GFOA 4KRCA 4C35A 2XCKA 5BVKA 1RE8A 2PVLA 4IC7A 4RBLA 3GOPA 4Q5HA 3SW4A 1VYWA 3VHEA 1TQMA 3C13A 2IVSA 3ZDIA 3GENA 4TYEA 1PMVA 3E7VA 3QGWA 4FZDB 4X2JA 3KQ7A 4FKTA 3HMOA 5J1WA 2HY81 3C4FA 3R2YA 1LPUA 2YDKA 4GIIA 3R7YA 3ZUVA 4IAYA 3KMWA 2YACA 3QRIA 3IW4A 4M84A 5HE0A 3KFAA 4O0TA 3L8SA 3P0MA 4ZTMA 3IQ7A 4D28A 3MB7A 4U8ZA 2R3MA 3O7LB 3KF4A 2IW6A 3BLQA 2KULA 3QAME 3ZLYA 2R7IA 3R7GA 4PWNA 1KE9A 3QLGA 4WD5A 1VZOA 3ITZA 2QG5A 3LE6A 3NGAA 3RZBA 5BYLA 3H3CA 4RJ4A 2V5QA 2RKUA 2QLQA 3MVJA 2YITA 5CF8A 5HX6A 5JN2A 3DGKA 3OS3A 1XQZA 2W7XA 2WQNA 3ZFMA 4AE6A 4OAUC 4BZOA 3G9NA 4C2VA 3RPRA 1R78A 4MWHA 5FUTA 3DBCA 3I79A 3E8NA 5EOBA 4ITJA 5IQGA 2J0MB 4O0WA 3BEAA 3KCFA 1YKRA 4IX4A 4ZTRA 3BZ3A 2VTMA 4D5KA 2A27A 3V8SA 5CF4A 2XBAA 4FTTA 2BUJA 3VS7A 5IISA 2X2MA 3LHJA 5CX9A 3VUMA 1I09A 1XH8A 3P78A 4YJOA 2R3FA 5D11A 5AM6A 4EOLA 3FLZA 1P14A 5EM6A 4B9DA 3WF8A 4QQ5A 4K2RA 2IJMA 2ITTA 2UZTA 2YLEA 3MBLA 4GVJA 5C03A 3L1SA 2ZDTA 4S31A 4F4PA 3JR1A 4FIGA 4WNMA 2QHNA 1JSTA 4C62A 3D7ZA 4UWCA 5JFSA 5LCJA 2WU7A 4NKAA 4TYHA 3HDMA 1X8BA 2P33A 4K11A 3CTHA 2P4IA 3ZZEA 4EK6A 5JQ8A 5BVNA 3PVWA 3CBLA 5K5XA 3FDNA 3RALA 3N9XA 3QRKA 3COIA 4FE2A 4UZDA 1O9UA 3GCSA 2R2PA 5I9UA 4AG8A 3BHUA 4BIEA 3RJCA 2XNNA 5HI2A 4QMMA 5ANOA 5KE0A 4GL9A 1PYXA 1UWHA 2FSLX 3ORZA 3P9JA 3L8VA 3F3WA 1W83A 2GFSA 3ETAA 3F5UA 4LFIA 3CTQA 3FLSA 2PVNA 4FNWA 3BE2A 2BTRA 4YNEA 5LMAA 4O84A 2PMOX 5FRIA 3MI9A 4HGTA 4QMXA 1SVGA 2BTSA 2O65A 3LOKA 3ODYX 4ZJIA 3PA3A 3F5GA 5TF9A 4TPTA 4WG4A 3TACA 4BC6A 3B2WA 1RJBA 3FY2A 2GQGA 4JBOA 5CSWA 3ZZWA 4AOJA 5HD4A 3BYUA 2QR7A 5DLSA 4ACMA 4YTFA 2VWWA 3SG8A 5CXHA 3ZSGA 5DEWA 5CEIA 2XJ0A 1H1PA 4QOXA 4D1ZA 3LQ3A 2UUEA 3OHTA 1Q3WA 1UV5A 3PG1A 3VJOA 4F09A 5J9ZA 5KMKA 1NT2A 3Q3BA 2O5KA 1A9UA 2UW9A 4OTWA 3TNHA 3D5UA 3DAKA 5TR6A 3VUHA 4F0FA 4G1WA 4C4JA 3RMFA 3B2TA 3TNWA 4X0MA 2VN9A 4RC2A 4BCIA 4DINA 3ZCLA 3UQCA 4F9WA 3R9DA 3QD4A 4H39A 2X2KA 3E64A 3LCKA 4F7SA 2BR1A 4R7HA 5CZIA 5C26A 4WNPA 2ZB0A 3NAYA 4O1OA 2R3OA 3QHRA 5CSXA 4WG5A 5E8VA 4WA9A 3A61A 4E5WA 1XBBA 5JGDA 4FKGA 4PL4A 2QO9A 5EM8A 2LAVA 3RPSA 4A9UA 1UWJA 3FMDA 3QQGA 4XP3A 4EC9A 3E62A 4HGSA 4WG3A 3C0IA 3HRFA 3DBFA 2PVHA 4AOTA 2YIQA 4CT2A 4EH6A 2DQ7X 4QQJA 3PVGA 5EW9A 4BBMA 3FLNC 4QYHA 2I0HA 4IWPA 2JFMA 1XR1A 4IZAA 4FK3A 3U4UA 4EI4A 4NFNA 1IR3A 2ZM3A 2XK4A 3DKFA 3V04A 4LUDA 4MXZA 4HJOA 2VO3A 5CZHA 4GG5A 4EHGA 4Y5HA 4DT8A 4C4HA 1ZOHA 3AC3A 2QQ7A 4FTUA 3IGOA 4DCAA 5IUIA 2RFDA 4W4XA 4XCUA 3TNPC 3VUTA 1M2RA 4P5ZA 2JITA 1P5EA 4AACA 3E3PA 2UZVA 4KIKA 3PA5A 2O63A 1Q61A 4FTLA 5AIKA 3NR9A 2G01A 2P2HA 2VD5A 4W9WA 4FKVA 1PF8A 4HCUA 3BYSA 3ZOSA 5AP0A 5C4KA 4GW8A 4JRVA 4U6RA 4G5JA 5EDQA 3B8RA 4X3FC 1YRPA 3Q4TA 3HAVA 3RM7A 5CVFA 5M53A 2BIKB 4CVAA 3Q53A 4FT9A 3F5XA 2XIYA 3HV5A 1GAGA 2PE1A 4OUCA 4TXCA 1Q8ZA 2O0UA 4YNOA 1RQQA 1GIHA 5D12A 3V5LA 2CDZA 2Y8OA 4UXLA 4YJVA 1YI3A 3PSCA 4QRCA 3RWPA 4QMNA 3D7TA 3FL5A 2HY0A 3CJFA 2CKQA 3TG1A 3RAHA 3ZSIA 4KAOA 4OT5A 4PF4A 3E63A 4DLJA 3PIYA 1ZLTA 4CGAA 3MA6A 4FL2A 4BF2A 3W18A 5AAGA 5HLNA 1IA8A 4F1OA 3EMGA 5C4LA 2BILB 2ACXA 4D4SA 4KBCA 2ITWA 4GU6A 5JFVA 4C37A 4A9RA 3W2RA 3QD2B 4L6QA 3R28A 4AW2A 4BYJA 4G16A 3SD0A 2VO0A 4YR8A 3W2OA 2OICA 3VBYA 4TNBA 4CMTA 5CS6A 3FE3A 2GU8A 2WAJA 3PJ2A 3QGYA 4GT3A 2PY3A 4M0ZA 5L6WL 3FI8A 4JDKA 2EB2A 3N4UA 1FMKA 3DKCA 5EDRA 1BYGA 4P7EA 4EEVA 3DY7A 4TN6A 3E7OA 3RAWA 4DFYA 4E26A 4MNFA 3LCSA 4B8MA 2VTOA 4LMNA 5DPVA 5AV4A 3V6RA 4IVDA 4IXPA 3ZLWA 4MYGA 1NVQA 3AC2A 3PTGA 3KL8A 4F63A 1Y91A 3G6GA 4U42A 2QOQA 3L9PA 3R1NA 4ZLZA 2HXQA 2Z7LA 1W8CA 2OF4A 3HA8A 3ZO2A 3QXPA 5IA4A 3OROA 5JT2A 2J7TA 4BYIA 2HZIA 3GOKA 3VBVA 4MTAA 4PPCA 1IAHA 2FSMX 5DHJA 3PPZA 4RX5A 4DFXE 4RA4A 3NVKI 2YJRA 2W1EA 3QFVA 4D9UA 2J0IA 4GIHA 5HG7A 4ARKA 4UWBA 3DXNA 4JDIA 1VR2A 5CNNA 3FMKA 4RLLA 4H3BA 4LMUA 3EN5A 4CFMA 4IAZA 4G2FA 3P4KA 4LUEA 4AA4A 2OI4X 1V0BA 4DFBA 4A4OA 2EB3A 3FSKA 4YPDA 3HUCA 3C0GA 3BHYA 5DI1A 2YM4A 3D9VA 1SVHA 4R6VA 4EZ5A 5IUHA 4RRVA 4JIAA 1KUTA 1J1CA 4Y5QA 3ZRKA 5L8LA 1OL2A 2VRXA 2W06A 4RGJA 4BDAA 5CASA 1ZMVA 2HZ4A 4MX9A 2JEDA 2OF2A 3UOJA 3TL8A 2P2IA 3LXNA 3NW6A 4ZS0A 4ANSA 3F2RA 4DA5A 3KGAA 4CFXA 1H4LA 3UP2A 2JKMA 5K0XA 4CKRA 4L52A 1QL6A 2OIBA 4JAJA 5DT3A 3NNUA 4C61A 5DGZA 3CKXA 3NCGA 4ENXA 1ZZ2A 3OUNB 3GT8A 4Z16A 3EFWA 2IVVA 2W4OA 3CCNA 4X3JA 5B2MA 4M13A 4ZOGA 4YJQA 3FZTA 3ZLXA 5DMZA 5AFVA 2UZEA 4FSWA 3VQUA 3MJ2A 3R71A 1LR4A 3NW5A 3TWJA 5JRQA 3W8QA 3IW8A 4F9BA 4FVRA 3PXQA 4DYMA 4R78A 3ORMA 2B54A 2CN8A 4XOZA 2VNWA 4FTCA 4GRBA 4MKCA 2GHLA 2XIZA 4FVQA 4G6OA 3SQQA 1Y8YA 4KKEA 1SMHA 5JFWA 3MFUA 4FGBA 4E8AA 2VX3A 4H05A 2YWVA 4NSTA 1XH4A 4O7WA 3ANRA 4K8AA 3BWFA 3C51A 3FKLA 3A60A 3HMIA 4WBOA 4AZFA 5HVKA 2IVUA 3Q2JA 4MVFA 2WQEA 4C4EA 3A7JA 3OBGA 4PNKA 2HENA 4DITA 3ZC5A 4DT9A 3GUBA 5B2LA 3KA0A 2YN8A 4F99A 2F4JA 3OC1A 4WSYA 3NLBA 2G9XA 3KVWA 5DOSA 4ZSLA 4BN1A 4X21A 2EXEA 2V62A 1R3CA 1JVPP 1ZY4A 1XBAA 3O2MA 2UVZA 1UU7A 2GS7A 2UZBA 4FSUA 4LV8A 5EW3A 2A4LA 2QNJA 2JKQA 2VWIA 2C30A 4DG3E 3BGPA 2PUPA 4E5AX 3FKNA 3V5QA 2R3RA 3I5ZA 2GDOA 1JQHA 1PXMA 4DG2E 4RVTA 5IQCA 4D1XA 2B9HA 4GVAA 4J98A 5AAFA 4X2KA 2OW3A 3NUXA 3R7VA 3PWYA 1Y57A 4ZSGA 3SA0A 3ULZA 3KN5A 4N0SA 4HOKA 3UZPA 1H01A 3LXLA 2ZV7A 4DLIA 4B6LA 5KMMA 2Y7JA 1KOAA 2E9UA 4BWKA 3CQWA 4C3PA 5JK3A 1LEZA 4YLLA 2UVYA 2C5VA 4F7NA 3A99A 3AD6A 3K54A 2WIHA 3LJ2A 3ORTA 4CZTA 5HTIA 3FYKX 4BCGA 3R9OA 3OMVA 3QCQA 3UC3A 1W98A 3OCTA 4JQ7A 4FNYA 1H08A 4NM7A 4IADA 3RM6A 3CIKA 4IZ7A 3O71A 3MTFA 4IQ6A 5A46A 1PW2A 2EVAA 2W4JA 3ZO1A 3EN4A 2F2CB 4YPSA 1GIJA 5M07A 3VO3A 1BI7A 4FODA 4FV4A 4NW6A 4RT7A 2WHBA 4CRLA 2X8IA 1R39A 4OBOA 4R8QA 2CCIA 5FM3A 4EH5A 4ZK5A 4RIYA 4ALVA 3GP0A 4GUBA 5M44A 2C6EA 3TDWA 1YHWA 2PMLX 3EWHA 2WELA 2GFCA 2WMWA 1UVRA 2C6TA 3MFSA 1ZOEA 4E4NA 3AG9A 3MYGA 4J99A 4B99A 5J87A 3LLAA 1B6CB 2CGVA 3R73A 4I6FA 5JQ5A 3LIJA 3TEIA 4O82A 4BGHA 4UALA 4QMZA 5DBXA 2R3KA 4I0TA 5BVEA 4ACGA 4BIBA 4IB0A 4AZEA 5M57A 4C7TA 3TI1A 1U54B 4HYIA 2C5OA 4L45A 4AW0A 2O64A 2PVRA 3OTUA 3UGCA 4TWOA 2GQRA 1Q8WA 2PULA 2XIXA 1Z57A 3BU5A 5I4NA 3T3UA 4M8TA 5IEVA 3ZRLA 1OPLA 1U59A 4FKJA 4XLIA 2Z8CA 3V8TA 4EZ3A 5CAOA 4FKWA 3G5DA 4Y85A 3UNZA 1M2QA 1PHKA 2XYNA 3BE9A 4IACA 4L43A 3PP1A 3WF7A 5J1VA 4ZS4A 1L3RE 5HLPA 2OJ9A 4O86A 4I41A 4FK6A 2HCKA 3VUGA 2ZV8A 4Z9LA 1OIRA 3A7HA 3DNEA 5CSHA 4D2WA 2GTMA 3A7IA 2ZYBA 5KZ0A 4C38A 4KB8A 4U40A 4RWIA 2JDRA 1IASA 1YXUA 5AUVA 3OF0A 5A14A 3EYHA 5ACKA 4AN9A 4C2WA 3AMBA 3D14A 2XUUA 3PYYA 4X3FA 4CFNA 5BX0A 3AXWA 5DE2A 4E6AA 4OBQA 2GQSA 4XUFA 3SGCA 4MHAA 1ZWSA 1R1WA 5CF5A 5CEMA 3I5NA 1URWA 5FM2A 1OI9A 3W2SA 4BDDA 3PXKA 4RIWA 3QRJA 4CKIA 4G3DA 4C3RA 4A4LA 2ITZA 2H96A 3TTIA 3DDPA 2PL0A 5EM5A 1FVRA 4LGHA 1NVSA 2XK3A 4JS8A 3OCGA 3TV4A 1Q62A 2WPAA 4RQKA 2ZB1A 5H8GA 2BRGA 5CAUA 4ZZMA 4FEUA 3TNIA 4FSMA 2ITVA 1ZAOA 2ONLC 2UW5A 2XM8A 3CY3A 3KCKA 1PYEA 3ZUTA 3EHAA 3EYGA 3WZUA 4GMYA 3ZO4A 4XRLA 1WZYA 3W1FA 4FTJA 2X4ZA 5C01A 2XP2A 4DF3A 1ZY5A 3UQFA 1JSVA 3CE3A 3PE2A 4PMSA 2Z7SA 4AW5A 1U5RA 3CPBA 3GCQA 3ZFYA 5CQWA 2C0OA 3E5AA 4QTAA 2G15A 5B0XA 4QYGA 3E8EA 2YAKA 1U5QA 3UYTA 1T46A 2WMAA 3MW1A 4F9YA 3BQRA 3CJGA 3QCXA 2BRMA 4M0YA 4NTTA 4FV9A 4IC8A 4I5MA 4MNEB 4EWHA 2GNGA 3MPMA 2NRYA 4BHNA 3VWAA 4NK9A 4ONAA 4EOJA 4CTBA 4E6CA 3CD3A 2R3QA 1ZZLA 2W1ZA 2VTSA 2Q0BA 1KE8A 2R5TA 2HIWA 3UTOA 2XS0A 2IW9A 4Q5EA 4WUNA 5KUPA 4KRDA 1HCKA 3KRXA 3A7FA 5M09A 3CGOA 4XS2A 4XBUA 4RJ7A 4BDCA 5EHYA 2XNOA 3HX4A 3MN3A 4FKSA 2W9ZB 4RMZA 4FSRA 5HE2A 4DEDA 4HZSA 5GINE 2I0VA 2I6LA 3FV8A 4F9AA 5LQFA 2BKKA 2Z2WA 5HVJA 4HZRA 3TN8A 3OWJA 1XWSA 4O6EA 4EOOA 2YWPA 4O81A 4PPBA 4D58A 4JQEA 5AUXA 1PRYA 4CEGA 3QX4A 2VX0A 5BVOA 2A0CX 4O7ZA 2WQOA 5J8IA 1E1VA 3E87A 3GC0A 3C1XA 2R0UA 5HTCA 5GIOE 5KKRC 3WZJA 1YXTA 1K2PA 3ZHPC 2XKCA 4YHTA 4IZYA 3LJ1A 5C8KA 5HO7A 3GEQA 2ITUA 3AT2A 2W17A 4J71A 4E6QA 5JMSA 2BKZA 2W4KA 3SV0A 2C5YA 3LW0A 3TV7A 3QX2A 3KMMA 4JT3A 1Q41A 2FUMA 4KA3A 1OKWA 3GGFA 1FMOE 1RDQE 4FTRA 4WNOA 5CT0A 4QO9A 4AE9A 4BKYA 5FP6A 4IIRA 4KUJA 4J1RA 1J7LA 2H9VA 4D2VA 3FZOA 4FSZA 4K1BA 1YWVA 3QC4A 4WBBB 4XP0A 2C0TA 2C0IA 3LFCA 5BVFA 5EKNA 2X7GA 4F65A 1XH6A 3HP2A 3UG1A 4O2ZA 3P5KA 3R8ZA 5I5ZA 1CSNA 2UZUE 3F2NA 2QU5A 4AZWA 4DEBA 4F70A 2VWYA 1J3HA 2QONA 4DTAA 2VGPA 4G31A 1YHVA 3KK8A 4EWQA 3UDBA 2Q83A 3C4XA 2C1AA 4DCEA 3FMJA 4P4CA 3KVXA 3U54A 3PIZA 5D10A 2W05A 1W84A 3ZSHA 1YWRA 5GIPE 5A54A 1Q99A 2RG6A 3EB0A 3QA0A 3CR0A 3TKHA 4UYNA 3UO6A 4ANQA 3H30A 3MESA 4E7WA 3MGYA 4B7TA 5ICPA 3E3BX 3ZYAA 2EUFB 5DYJA 2J2IB 5GHVA 4M97A 4BCNA 2ITYA 4EZ7A 2HZNA 5AV3A 4IB1A 5L8KA 5FLFA 4L00A 3ZO3A 4BBEA 4EUTA 3I7CA 4TW9A 5DT0A 3SLSA 3QL8A 4XOYA 5CEOA 5CSPA 4OW8A 4ERWA 3N4TA 3PDTA 1KWPA 2QOLA 1G8AA 3O51A 5AP3A 4UMRA 4ACCA 4G9CA 3DXPA 1JAMA 3PVUA 4PPAA 4CZYB 3BLRA 3VF8A 3IDBA 4IDVA 4F6SA 5IQDA 1ZYLA 2QLUA 2X9EA 1GNGA 4KIOA 4D4RA 2J0JA 4WNKA 3QUPA 3R22A 5ANDA 3RHXA 3MFRA 2VWZA 1L8TA 5LCKA 2R3HA 5JZNA 3LZBA 2BAJA 3P7CA 1BLXA 3C7QA 3BX5A 2XK6A 3HRCA 2CKOA 3PJCA 4BFMA 2OLCA 2JKOA 3EQRA 1JKSA 4L7FA 1H00A 3VW8A 3E88A 3HVCA 1UKIA 3A62A 2QOKA 2BAQA 4LRMA 1MRVA 3QKKA 5DA3A 2UZNA 4MWIA 4E1ZA 4O7NA 3RPVA 3RCDA 4M68A 1QPDA 2OFVA 2X7OA 4A07A 4PMPA 4RVLA 3F7ZA 4J52A 2PZRA 3VS5A 2ITOA 5CU0A 4JDHA 2Z7QA 3PVBA 4CFFA 2Y4PA 2XBJA 2UW6A 4YZCA 2AYPA 1YXSA 4UX9A 1FOTA 3GU8A 3CQUA 4N4SA 3SVVA 4XJ0A 4K0YA 3Q6UA 5ANGA 5IEYA 2GTNA 5CI7A 5FGKA 1OVEA 3S3IA 1IRKA 2C3LA 5HIDA 4GG7A 4BICA 3PXYA 2Q0NA 2RF9A 4EQCA 2IPXA 4F6WA 5AX3A 1ND4A 4FG8A 1STCE 2HXLA 4O2PA 3PWDA 4HW7A 1YOJA 2FGIA 4AN3A 4BDIA 3C4WA 3D15A 3NYVA 4E4XA 3D0EA 4X7QA 3GU7A 3E92A 3UVPA 2IZTA 3ATTA 4AA5A 1SNUA 2F2UA 4IANA 3G9LX 4HPTE 4D2SA 3MDYA 4FT0A 5TKDA 3VNTA 3ATSA 4II5A 3LXPA 2X7FA 3MB6A 2VU3A 2PVYA 4C3FA 2VO7A 5IZFA 3DOGA 3GQLA 1HCLA 3LMGA 4IH8A 4P90A 4A9YA 4LOQA 2PTKA 5CI6A 3RP9A 4DBNA 4QP6A 4CT1A 2YCFA 5IDPA 4Q2AA 4QT1A 4ID7A 4NCTC 4R1YA 3ZDUA 4DE4A 1YDSE 2HYYA 4A7CA 1QPJA 5A4LA 5KMNA 4C57A 3S0OA 1OBDA 3N51A 3OXIA 1R0EA 2OXDA 3C0HA 2R64A 3VS0A 3G2FA 5CY3A 5T6KA 5KMOA 2A2AA 4AT4A 1OECA 1SM2A 3ZFXA 2WTVA 2O8YA 2VTTA 4IVBA 2QR8A 3OY3A 4L46A 4QYEA 3KXMA 2HWPA 1WBWA 5IA1A 4PDYA 5IEXA 4I1ZA 3HEGA 4ZSEA 3P23A 3U51A 2OZAB 1HOWA 3BYVA 3MWUA 4FIHA 4RZVA 2CN5A 3Q52A 5K5NA 5J9LA 3I0OA 3PJ1A 4X2NA 4Y46A 2WO6A 3DQWA 5HO6A 4RC3A 3ZEWA 3MY0A 3CC6A 3IDPA 3OWKA 4UXQA 3UYSA 2W99B 3W10A 4QYFA 3RK7A 3AGLA 3PJ3A 4XRJA 2GNLA 5EYDA 2ONLA 4O22A 4W8DA 3NEWA 4FYOA 4XG4A 2WMRA 2CGXA 4DG0E 4CLJA 1XJDA 4G17A 4RZWA 1GZOA 4GU9A 4WSQA 3KRWA 1H0VA 3TJDA 4PDPA 4FMQA 2Y4IB 4AGCA 5BQ0A 2GSFA 3GB2A 3FXXA 3C9WA 3PE1A 3QTXA 3FMLA 4PMTA 4FSQA 4XV1A 3DJ6A 4IHPA 4EJNA 2C6IA 2JFLA 5I9XA 5IDNA 3HAMA 2JBPA 1KV1A 3Q60A 3MA3A 2ITXA 4BTFA 5CNOA 5LOHA 4X2GA 3Q96A 2VX1A 3NUNA 3DXQA 3BHTA 4QMPA 4Y8DA 4D4YA 1MUOA 4YP8A 4XG3A 1H1SA 4RJ8A 5E8YA 3KRLA 4DEIA 3CQEA 2VGOA 1WBOA 4FUXA 5G6VA 5JSMA 3VS2A 3WF9A 4TZRA 4M69A 3UE4A 1BKXA 3I6UA 1S9JA 2C6KA 1UNGA 4ZTNA 5HG9A 2EWAA 3FMHA 3TZ7A 4C8BA 1Q5KA 3OXTA 5EYMA 3RVGA 5HIBA 4O7TA 2OO8X 3JUHA 5LVOA 2QOIA 4CQGA 2XIRA 3F3ZA 2REIA 3SOCA 3LCOA 5BMSA 4D1SA 3Q32A 4YC6A 5I0BA 4XG7A 1FQ1B 3F3UA 4FUYA 3QQLA 5F4NA 5FTQA 4B0GA 2IN6A 3QLFA 2YM6A 1TKIA 3NNXA 3EOCA 4U5JA 3KN6A 5L2IA 4O1PA 4ZXTA 4CYIA 3L9MA 1SYKA 5EKOA 5ANJA 2I7QA 4FEVA 1M17A 1FGKA 1CKIA 1GZKA 3H0ZA 3MVLA 1OGUA 3VF9A 3S1HA 4U7ZA 1PXIA 4NJDA 4BY9E 4IFCA 3KB7A 3AD4A 3ELJA 4IMYA 3R8UA 3P1AA 4FC0A 3EQPA 4TL0A 4BKZA 2R3GA 1JLUE 2WOTA 3VVHA 5M06A 3DBQA 1I44A 2WEVA 1H1QA 3M1SA 4O7LA 3NRMA 5GJDA 3U8WA 3R9RA 3MPTA 5EG3A 2XF0A 2W1IA 1Y8GA 2ESMA 5IUGA 3QTSA 1WBNA 3SX9A 1UKHA 5BVWA 3R7EA 2FO0A 5EW8A 2XM9A 4RJ6A 4AOIA 3IS5A 1J91A 5AR2A 1H25A 3BGZA 1ZXEA 3EH9A 3UIXA 5IA0A 5LWMA 4UEUA 3H4JA 4GKHA 3DBDA 4IWQA 2C68A 3JPVA 3GU6A 1V0OA 5TT7A 2P3GX 3FSFA 4MK0A 3IO7A 1OBGA 3SKCA 5EQPA 2YCSA 3NYOA 4PL3A 1OMWA 3QWKA 3TIYA 3VBQA 1BL6A 5H8EA 2EXMA 3R8LA 4V0GB 4ENYA 4Y95A 3OWPA 2DYLA 4I6BA 3CP9A 4JNWA 3FZ1A 3AOXA 3VS3A 2E9NA 3FBVA 3HDNA 4JJRA 4O27B 4YSMA 4AXAA 3ORKA 2XJ1A 3KY2A 4DBXA 3RHKA 3NSZA 5E8XA
chains in the Genus database with same CATH superfamily
5F1ZA 5IF1A 4DEAA 2ETRA 3IKAA 1LEWA 4IM0A 4QMOA 5EI2A 4GUEA 3DNDA 3KMUA 3PY0A 4BDBA 5KMLA 2BFYA 2CNUA 5EQEA 5FEQA 4HVIA 2W1HA 3UZTA 4YURA 3Q6WA 5IA3A 3DKOA 1BI8A 2WKMA 4PL5A 5HORA 2YEXA 2BPMA 1ERKA 3O17A 5D7VA 4IJ9A 1QMZA 4FTMA 1W7HA 5AUZA 4APPA 2J0KA 4E4LA 5A6NA 2JDOA 3FMEA 3O8UA 2GS6A 3AC8A 4FIJA 5CWZA 5HLWA 3U6IA 1GOLA 4FTNA 1PMEA 5AUWA 1JSUA 4EK3A 2XK8A 4F0IA 2ZV9A 4FEQA 5KNJA 2HWOA 3A4PA 4O0YA 5I9WA 3PY3A 5CXZA 1A06A 1H1RA 3W55A 2QCSA 2JC6A 4NU1A 4O7SA 4RJ5A 1FPUA 5M4CA 4DT8A 3WILA 4BDEA 3FQEA 3PLSA 3W0SA 3WE4A 2B53A 2RIOA 2R3PA 3EQBA 3EKKA 5HBJA 1XMMA 2CNQA 4QDVA 3QD0A 2BDJA 3QRTA 4QP4A 4Y73A 2ZVAA 4M12A 2CLQA 4NW5A 1FBNA 2JDSA 4IX5A 3AKLA 2FA2A 3RK5A 2R9SA 5AIRA 4CNHA 2DWBA 1U54A 3N4VA 3NVMB 4DC2A 3SG9A 3G33A 3Q9ZA 4FT7A 5AV2A 5BYZA 2YM5A 3DAEA 5JKGA 3K3IA 4JDJA 2YERA 4LV5A 2C3KA 5LVLA 4O83A 1NXKA 5ETAA 5KO1A 3CPCA 4MBIA 3DA6A 1O6KA 2A19B 4V05A 4ZIMA 3ZRMA 2VTNA 2IG7A 4V04A 4EOIA 2B9IA 1BUHA 2JIUA 5HTBA 1OUKA 3KKVA 3PSDA 4S34A 3I0QA 4FV0A 4LQMA 2YCQA 4XMOA 4YZBA 2HZ0A 4BB4A 3ORNA 4CQEA 3OY1A 3GNIB 4DHZA 1H8FA 4LGGA 2AC5A 3LFDA 4OTPA 2W1CA 4A9SA 3O23A 4EKLA 1SVEA 5HNBA 4R5SA 3CKWA 2XAMA 3HV6A 5DWRA 4EQMA 2C47A 4AXFA 4FV1A 4BWXA 2QOFA 4NM3A 4ZMEA 4QPSA 3NDMA 2VWVA 3QA8A 3ZS5A 4EJ7A 3DTCA 4TT7A 5K4JA 1SZMA 1U4DA 2YZAA 2WTCA 1OM1A 5CEPA 5EQYA 4JG7A 2RFEA 5HNGA 4ITHA 3NUSA 1YW2A 4XV3A 2C6DA 2R3IA 5H2UA 2VWXA 4L67A 4XX9A 2J5FA 4FV3A 4I6HA 3R7UA 4CFUA 3ORXA 2XVDA 4BIDA 5HCZA 4IJPA 5LVPA 1YXXA 1V0PA 2VUWA 3HRBA 3Q4CA 5I9VA 4MH7A 3SW7A 1O6YA 3REPA 3KK9A 3QWJA 4IM3A 4RWLA 4EK8A 5FEEA 4YZNA 4AZTA 4GV1A 1T45A 4YZDA 5AAEA 5A3XA 3GBZA 3PRIA 3OXZA 4FKOA 2BVAA 2BZIB 3AMYA 2JDVA 2OZOA 3CGFA 4NCTA 4OTHA 3WZKA 4EHVA 5I9YA 1A48A 4IDTA 4GKIA 1IA9A 3E8CA 2VTQA 4JG8A 3UO4A 5BVDA 3NX8A 3ZXTA 2JLDA 3WYXA 4R7IA 3FI4A 2XH5A 4QQCA 4LGDA 5T3QA 2C3JA 1KE5A 4FZAB 4Y72A 4FT5A 3R1QA 5J5SA 4F7JA 2OJIA 4G3GA 4DFLA 1Q24A 3BHHA 4MNEA 3DK6A 4N6ZA 1OB3A 4IWDA 4DGNA 1MQBA 4IEBA 3P86A 5J79A 4RQVA 4YTHA 4C34A 5HHWA 2UW3A 2OJGA 3KF7A 3MH3A 4IAAA 2YIXA 4DTBA 3PLAE 3F69A 2PVKA 4IX3A 2IO6A 4HVDA 5FDPA 4HCTA 3RK9A 3VAPA 4L7SA 3B8QA 3NUPA 4WKQA 4DH7A 4HVSA 2OJFE 2PPQA 2WXVA 4EK4A 5AP6A 3GCUA 1K3AA 2RGPA 2UZWE 2C5NA 4U81A 3NZ0A 2B55A 2XJ2A 3GFEA 4JOAA 4OGRA 3NPCA 3RGFA 4IVAA 4GCJA 3EZRA 2F49A 3EFLA 1CDKA 2ZM4A 4YHFA 4PUZA 3PSBA 5CAQA 1PXNA 2WFYA 4FBXA 4R7BA 4L01A 5ANKA 4ZY5A 3ODZX 2VTHA 4IX6A 4X2FA 4YZ9A 3RKBA 5JGAA 2VO6A 2CJMA 4DEGA 4LOPA 4BWPA 2QI8A 4RWKA 3FWQA 2OXYA 2BDWA 3JVRA 4MBLA 2WMUA 2X8DA 2OU7A 4JBVA 5FBOA 1QPCA 4DEEA 4QP8A 4NWMA 3AKKA 2XNEA 4FTKA 2OJJA 4GEOA 4CXAA 4QPMA 4AU8A 3FLYA 2YDIA 3IW5A 3V5WA 3ZMMA 4EONA 1VEBA 2UVXA 3E93A 3I60A 3FPMA 3PY1A 1OKVA 4ZTSA 3GFWA 4AZVA 3HECA 3FXWA 3IECA 1ZMUA 4FR4A 5KX8A 4HCVA 5DH3A 4F6UA 4GH2A 5BPYA 5JFXA 2B7AA 3GCPA 4C59A 4RFMA 4A4XA 3JYAA 2W0JA 1G3NA 1VYZA 2F57A 4XBRA 3FJQE 2V55A 3HMNA 4TWNA 1OZ1A 4QDEA 3DJ7A 5ETIA 5FD2A 2V22A 4BCFA 3OT3A 3R2BA 4AX8A 3G51A 4OTQA 4O0RA 5ACBC 1YHSA 4GK4A 5T68A 4CTCA 3D2KA 4RVKA 2GNIA 3QZHA 4RX9A 4BCHA 2XK9A 5M55A 4M66A 3LLTA 5BNJA 2JDTA 4C4GA 4RX8A 4U80A 4J53A 2WQMA 3SHEA 3ZLSA 4MXYA 1E9HA 2WU6A 4NUSA 4J7BA 2BRNA 4YJPA 2XARA 1REJA 3LCTA 1ST0A 4DGMA 3BU6A 4K18A 4I0RA 2PUUA 3LKMA 2PUNA 4I21A 5AP5A 5AP7A 1TQIA 3R1SA 3VW6A 5HEZA 5TOZA 4CLIA 1QPEA 3G0EA 4GS6A 5E1SA 5FG8A 5AADA 5J7BA 4NH1A 5GJGA 5GZ9A 3WZEA 2XKFA 2YLFA 3NNWA 3Q5ZA 4Z55A 2ITPA 3LMHA 2QKWB 4O96A 2XANA 4QMQA 3UPZA 2CGWA 5EHOA 4EBWA 3DJ5A 4ANMA 4IB3A 2X9FA 3HV4A 3KRJA 3LQ8A 4BCMA 1PJKA 3M42A 3CSVA 5A4EA 3PPJA 4G6NA 3DAJA 3MTLA 3OG7A 3BIZA 1PXJA 5CQUA 5DVRA 1W82A 3GC8A 1OIQA 4FKPA 5CEQA 4D5HA 2ZDUA 4JLCA 1ZMWA 1MRUA 2PYWA 2IVTA 3QTUA 5HU9A 4CCUA 4DHFA 3R6XA 2JKKA 2OWBA 3JVSA 4LL5A 4BI0A 5KBQA 2BFXA 3WF6A 2BRHA 4ZLYA 4CV8A 2ZMDA 3TJCA 3VIDA 4JBPA 4EHZA 2C5XA 4XEYA 3PZHA 1U46A 1Z9XA 3ROYA 3RI1A 5AMNA 5FXQA 2UZOA 3G0FA 3HA6A 2E9VA 2YA9A 1FVTA 2OXXA 3G90X 3K2LA 3QQFA 5DEYA 4QP1A 1J7UA 1IAJA 1W0XC 3Q4UA 3F2AA 3K3JA 3TZ8A 3BPRA 3CY2A 1FGIA 5LVMA 3RAKA 1JWHA 1NA7A 4JR7A 4JRNA 2NO3A 3PZEA 2UW0A 2PVMA 3JS2A 5DN3A 2W1DA 5ANEA 4FV6A 3OCBA 2HELA 3RPOA 2XB7A 3II5A 4ZZOA 3U87A 2QO2A 1H07A 2W1FA 2XEYA 4GJ2A 1YVJA 3UOKA 3D2IA 3I6WA 5CALA 2X0QA 1PMUA 5IG1A 3RWQA 3TMOA 2R0IA 3KC3A 4O7VA 2Z7RA 4EOSA 1DS5A 1JKKA 4HNIA 3DCVA 3C4ZA 5EHLA 2I40A 4ZY6A 4AT5A 3LMIA 4R77A 4UYAA 1JKLA 2JGZA 4KBAA 4BZNA 5AA9A 4EH8A 4L8MA 1PMNA 3LM0A 4I3ZA 4XYFA 3SDJA 1OGYA 5LARA 4FYNA 2QOBA 4TWCA 4YJSA 2FB8A 4YZMA 5GJFA 5HD7A 5HG5A 4EL9A 4EORA 3VS4A 1PY5A 2Z02A 4AZSA 3UNKA 4XG9A 5E8UA 4DGOA 2PMNX 2J51A 5K9IA 3EL8A 4F0GA 3OOMA 3BGQA 3BLHA 5CLPA 5HO8A 3A8WA 4KBKA 1WBVA 1CMKE 1PKDA 2XNBA 3BRBA 4RIXB 5AR7A 3R7IA 3R1YA 3VBWA 4FF8A 3BL9A 1NY3A 5KHXA 4WIHA 4AAYA 3R01A 4MXCA 2H6DA 4RA5A 4F1TA 3K5VA 4YLKA 3ZTXA 5K4IA 4GT5A 3F82A 4XP2A 3SOAA 3UQGA 1JNKA 4FG9A 4C02A 2C3IB 3ALNA 3BU3A 5HBHA 2QO7A 3EQGA 5J95A 3W0MA 5F94A 3IONA 5E8WA 4ALWA 2V7OA 1K9AA 4YBKA 4JR3A 4C4IA 4CG8A 4XH6A 2OZAA 4QTDA 3UNJA 4C58A 1M7QA 4LRJA 5J9YA 4KINA 3DKGA 3SXFA 3QCSA 1JPAA 3GVUA 4RIYB 3MIYA 2BALA 2GNJA 5H3QA 4AS0A 5HX8A 4OAVB 4AW1A 1NW1A 5A9UA 4I23A 5DRBA 4BDKA 4ORKA 4EOPA 3R8VA 2UW7A 3HGKA 4FSNA 5CU3A 4LG4A 4EKKA 4BCKA 4HNFA 3AC1A 5KHWA 4O0SA 5AUTA 3WYYA 3AC4A 5GZ8A 4BGQA 2G2FA 4L3LA 4LI5A 2WTJA 2CSNA 4NZWB 3VBXA 2GCDA 2C6OA 3DFAA 3BV2A 2UW8A 5M4IA 3O8TA 4AWIA 1PXOA 1WBSA 4FKUA 4U97A 4AAAA 4HGLA 4UMQA 1H1WA 1M14A 1SNXA 2IZSA 5HOAA 3KULB 1H26A 3T3VA 5BUEA 4RJ3A 3UIUA 5E92A 3LFQA 3NUAA 4QP7A 4ERKA 1DAYA 3VQHA 2BMCA 4A06A 5HESA 1CTPE 3C5UA 4MD7E 2OK1A 2R3LA 3PIXA 4KIQA 2ZOQA 3VRYA 3PA4A 4RPVA 5BUJA 1WCCA 2H8HA 5DNRA 3UMXA 4QMLA 4QMYA 3QF9A 4NL0A 4FJVA 2XCHA 4ASZA 4EC8A 3QTZA 5AEPA 1MQ4A 1UNLA 4JVGA 5M08A 5HU3A 2CMWA 4GYIA 1WAKA 4I92A 3NWWA 4IBMA 2WQBA 3NAXA 2CPKE 5E1EA 4MF1A 5CEKA 5IH4A 4KABA 3FEGA 3L9NA 4TYJA 4OTDA 1MRYA 2VTIA 4BRXA 5CU2A 5D41A 5DR9A 2Y6MA 5L8JA 3F6XA 3AQVA 4B8LA 3LQ5A 2PK9A 1J7IA 5F20A 5I9ZA 2ERZE 2BZKB 4W8EA 2BDFA 1DI9A 2XKDA 4YUQA 1W2CA 3DLSA 1AD5A 4R5YA 1M2PA 4WO5A 1G8SA 4EHEA 4WRGA 5IKWA 1H27A 4PV0A 3C4EA 4AGDA 3KU2A 4AA0A 4BDFA 5EYCA 1XH9A 2PZPA 3HKOA 4BDHA 1O6LA 3M2WA 2I0EA 4J96A 4QQTA 5IQIA 3JY9A 3FZRA 1WFCA 4L68A 2ETMA 5C1QB 2QURA 2VTAA 1BMKA 4J97A 5DRDA 2PE2A 3DB8A 1YI4A 3OZ6A 2XYUA 3EZVA 4RWJA 1XO2B 4AP7A 2WMXA 4IB5A 4DFNA 2CKPA 3A7GA 5D9HA 4Z7GA 5BV3A 3TTJA 4N6YA 4O0XA 3EQIA 3KIOC 1YQJA 1ZARA 2XRWA 3HL7A 2VWUA 3LFSA 3S00A 4DAWA 3G15A 1R0PA 3NYNA 3QYWA 4RC4A 4LL0A 3NUUA 4PRJA 5IQEA 4RFYA 2F9GA 2J4ZA 2WZJA 4G3EA 4KIPA 1WVWA 5C8NA 1AGWA 4PP7A 3THBA 4E20A 2W5HA 4O6LA 1H24A 5EK7A 3BWJA 4ANBA 2WTKB 1ZYCA 3OEFX 5DR6A 3RAIA 3EJ1A 3LFNA 3BV3A 3PXRA 3QQJA 4FIIA 2QVSE 4XG2A 4DH1A 3EFJA 4M14A 4D2RA 4M3QA 3DZQA 2CGUA 3NMUF 5L2TA 4V0GA 4A9TA 4H36A 5IMXA 4GSBA 4W4VA 2OIDA 4Z7HA 4I94A 3MPAA 3FMMA 3OVVA 1UU9A 3ET7A 2C1BA 3HNGA 3DS6A 2ZM1A 3CS9A 4XNEA 3FZPA 4ANOA 4EH2A 2ZAZA 5KMIA 2JAVA 3VULA 4AQCA 3W0OA 4U43A 2BCJA 3QYZA 4BZDA 1Y6BA 4YHJA 4PTEA 2RFNA 2X1NA 3QTQA 4FIEA 4EYJA 4MEDA 4QPAA 1G5SA 3OD6X 2HOGA 5CVHA 4YJNA 5EH0A 5A4TA 2O2UA 2QODA 4O7YA 4HGEA 3BEGA 3IG7A 3RZFA 4FI1A 1TVOA 3UPXA 4UMUA 2F7XE 3GU5A 4OTRA 3MVMA 5AR5A 2B4SB 4G6LA 4GK2A 3UIMA 2F7EE 5HNIX 4AXDA 4RSSA 4XG6A 2OFUA 4BI2A 4DEHA 4O0UA 1WVXA 5BUIA 3OWLA 4FV5A 4U0IA 3VUDA 5LMKA 2WB8A 3LFBA 4XV9A 1UU8A 4IFGA 3MY5A 5EI6A 4FOCA 4EUUA 2B9FA 3IOPA 5IQFA 2ITNA 3DFCB 2CCHA 5M4FA 3FLQA 4UWYA 4F9CA 3D5WA 4RFZA 3ORLA 2ZV2A 4PDSA 4ZTHA 5IU2A 1M52A 3CTJA 2ZMCA 3F9NA 2YDJA 4FKRA 5LXMA 5HZNA 2PUIA 3DT1A 2BZHB 3U6HA 4F78A 2WMVA 4MQ2A 3PP0A 2B52A 4FKQA 5DT4A 3FZSA 1OIYA 4DH3A 3O8PA 5FBNC 2P55A 5E90A 2BHEA 3D5XA 4MXOA 4FA2A 2XALA 3R8PA 3R9HA 5LWNA 4C4FA 2XNGA 4LYNA 2YCRA 2KTYA 2XA4A 1RW8A 3MH2A 3MV5A 1ZYSA 4O7RA 2GHGA 4U44A 3K5UA 4EOMA 3Q2MA 2O3PA 2OG8A 1E1XA 4ASDA 4ASEA 4WT6A 1DM2A 5IPJA 4IE9A 4GYGA 2JIIA 5AP4A 5HG8A 3QZIA 3KXNA 5ITAA 5LMBA 3Q9YA 3UIBA 3KXZA 1Q8TA 2VAGA 3TT0A 5M4UA 3R30A 4FZFB 3F3VA 3O7LD 3EQHA 5FXRA 4NYEA 4TTHB 2OIQA 3W8LA 3SRVB 3LJ0A 4UB7A 5FP5A 3DK3A 4Z3VA 4BCQA 3EIDA 2VZ6A 3QQUA 4NIFB 2VTRA 4DTKA 5FQDC 1V1KA 2BAKA 3W2PA 4W4YA 5ETFA 3UZRA 3IW6A 4JG6A 4O21A 4QP9A 2XNMA 4DH8A 3NUYA 3KXXA 1XHAA 2XZSA 3QZFA 4ZP5A 4DGLC 1PXLA 4QYYA 3UVQA 4NTSA 4I22A 2AQXA 2EXCX 2XAOA 5I3RA 4RX7A 3L9LA 1UNHA 1WMKA 4J8MA 3W32A 3FQSA 4C0TA 4CKJA 3F61A 2Y0AA 4CFVA 5AA8A 3T9IA 3EFKA 1J1BA 2YHVA 5FDXA 4LDTA 3VONA 4ZSAA 3RNYA 1XKKA 3G6HA 3H9RA 3R02A 4ZTLA 4F1MA 4AT3A 4F7LA 4CSVA 2SRCA 3Q9WA 4RVMA 4HVHA 4GFMA 3TCPA 1WBPA 4TYIA 3DU8A 2BHHA 3D83A 4FL3A 5ETCA 3UOLA 3R7OA 4YTCA 3R83A 3TKUA 4YO4A 3HV7A 4ZSJA 2DS1A 3QBNA 4FRFA 4FEXA 1PKGA 1PXKA 3F66A 1F5QA 3U9NA 5CTPA 1B39A 3D4QA 2PSQA 3H0YA 3S4QA 4D0XA 2PHKA 3AT4A 4PMMA 3AKJA 5CAVA 4CCBA 4YMJA 3OEZA 4USEA 2V7AA 2G1TA 3S95A 2FSOX 3C4CA 5JRSA 2WD1A 2CLXA 1OIUA 4C36A 5HIEA 3ULIA 4L44A 1ZOGA 3DZOA 3FI3A 4J8NA 4O38A 4YTIA 3R9NA 4ZMFA 4FV2A 2G2HA 3JY0A 4J95A 3VS1A 3DQXA 4CFWA 4N57A 3RPYA 4HPUE 2JBOA 2OSCA 5K3YA 4PTGA 5C9CA 3V5TA 1JKTA 5GNKA 3W16A 4ANLA 4BHZA 4CZUA 4YSJA 5JGBA 2W9FB 4CV9A 3FHRA 3QCYA 1M7NA 4M67A 3NIZA 3R0TA 3Q9XA 1WBTA 4FKLA 1LP4A 4BL1A 3D5VA 4PP9A 3V8WA 3E8DA 4UMTA 4Y83A 2RSVA 4YJTA 5C8MA 2JD5A 4JI9A 4BI1A 3O50A 5ANIA 5HBEA 4V01A 3P08A 3FQHA 4O0VA 3NIEA 2I0YA 4FKIA 2CHLA 4E73A 5L3AA 3ID6C 3GCVA 3Q5IA 4L3PA 3PPKA 1AQ1A 4K77A 3UJGA 4BKJA 1PXPA 3F5PA 4L53A 4TYHB 2WEIA 3FY0A 4R3RA 4UZHA 5B7VA 2ITQA 3ZBFA 4KS8A 5IA5A 4FIFA 3H9FA 5M51A 3LM5A 3O0GA 5KZIA 5I3OA 3MH1A 3T8OA 1APME 2HW6A 2WTKC 5E91A 4G5PA 3ZEPA 1IG1A 2R7BA 4NEUA 2Y9QA 4P5QA 3UG2A 4IWOA 4AGUA 4XHKB 5HQ0A 4KNBA 3GI3A 3QUDA 4UBAA 5HKMA 3HMPA 2NNWB 3RTPA 3W2QA 4NM5A 4UN0C 3TM0A 2C69A 2R4BA 2YIWA 3COHA 1LUFA 4L9IA 4LM5A 5E7RA 4ZY4A 4L42A 4USFA 4MCVA 5AJQA 5BMMA 3V51A 5BYYA 2XK7A 3AT3A 2XMYA 3VC4A 5LVNA 4QMUA 3A4OX 5K0KA 4I20A 2H34A 1B38A 5M56A 2PZYA 3BL7A 4R3CA 1YOLA 3EQFA 4FX3A 4NM0A 2X39A 4QTCA 2EU9A 3QRUA 4U9AA 2IZUA 5AUUA 3LFFA 3OW3A 3GXLA 5FTOA 3BBTB 3ZONA 4CRSA 3DPKA 1UU3A 1QCFA 3TUCA 4EQUA 4U41A 3UOHA 3H10A 2HK5A 2X81A 2J50A 3FC2A 3IDCA 4QTEA 2W1GA 1ZRZA 3V01A 3VUIA 3BCEA 1ATPE 2WTWA 4ACHA 4KSPA 5E8ZA 5HCXA 5C27A 3ZH8A 4AFJA 3BKBA 4ANNA 4USDA 2JIVA 4H1JA 4NJ3A 1P4OA 3KRRA 3RBWA 3UBDA 3EKNA 3UDSA 3SXSA 4D2TA 3LPBA 3IOKA 3WE8A 4FZ7A 3OBJA 3VRZA 1Q4LA 2BIYA 1ZYJA 2GHMA 4I4FA 3V6SA 4M69B 1UA2A 5CU4A 3ZBXA 5E9EA 1Z5MA 3RCJA 1YWNA 2WMTA 4PX6A 3U55A 1OL6A 5AR4A 3MSSA 1GIIA 4FGRA 1OITA 2Y4IC 3UDTA 3WARA 3BYOA 2FVDA 2IEWA 3VN9A 2YISA 1Q97A 4OR5A 5DG5A 3BYMA 4ZLOA 2UZLA 4FTOA 4PQNA 1KE6A 3R8MA 2HW7A 1Q3DA 4ZAUA 5E8SA 4LV7A 4R3PA 4KKHA 2A1AB 1Q8UA 4I93A 3WI6A 4FVPA 4F64A 4ZJJA 4WRSA 4OTFA 4EOKA 4TRLA 3EL7A 4HYUA 3SXRA 2GPHA 1XH7A 2GMXA 4I5PA 4KIKB 3HMMA 5KCVA 4IZ5A 3QXOA 2J9MA 1FVVA 4BDGA 5CU6A 3PFQA 4GT4A 4HYSA 3WIGA 5KKRB 3QZGA 3IGGA 2J90A 3L8XA 4G3CA 4YBJA 2ZJWA 5IA2A 3COKA 4JX7A 3EN7A 4KS7A 3ORIA 3QUEA 4UMPA 3W0RA 2YM7A 3CXWA 3NCZA 3DTWA 3F88A 3I1AA 2J6MA 4BGGA 3BI6A 3LAUA 5AP2A 5HE1A 4EOQA 2OH4A 4BVUA 5IQAA 4BCPA 4BTKA 2QOCA 3Q4ZA 2XKEA 3AGMA 5E8TA 5F95A 4IAKA 4D4VA 4U79A 3ROCA 4FV8A 1KE7A 3R04A 2A98A 4MD9E 3ENHA 3DLZA 4FSTA 4QMSA 2X6DA 3BBWA 3QHWA 1JOWB 5TO8A 3WIKA 4EH4A 5EFQA 3D7TB 4NFMA 4TNDA 4QEBA 2G2IA 5H9BA 2UW4A 3FMNA 3I7BA 4Q9SA 3P7BA 3F7WA 3V3VA 2FSTX 4MXAA 4E3CA 1MP8A 3O96A 4G3FA 2WNTA 4IAIA 4QNAA 4S32A 2NP8A 2XEZA 2W96B 3BQCA 4AUAA 4RIXA 3T9TA 2IZRA 2X8EA 3FPQA 4AGWA 3W0NA 4O4BB 4QMVA 4GFGA 4K9YA 4WOVA 4AF3A 2YJSA 3R00A 3TUBA 3CLYA 4TKSA 2ETKA 2IW8A 3ANQA 2VTJA 4D9TA 5L2QA 3QC9A 5L6OA 2PVJA 3AD5A 2PE0A 3MIAA 4IW0A 1IEPA 2B0QA 5CF6A 4UV0A 4YO6A 4U45A 4YC8A 4JAIA 2RG5A 3ORPA 2X2LA 5EM7A 1OKYA 2YIRA 3P7AA 3QTRA 4FG7A 1Y6AA 3ACKA 4QMTA 3AMAA 3D94A 2J0LA 3L8PA 5A4CA 4DH5A 4TYGA 5AUYA 3ML1A 1EH4A 5F9EA 2YM3A 4CD0A 2C6MA 4RIOA 2E9OA 2LGCA 4P2KA 1H0WA 3OFMA 3V5JA 2FH9A 3QU0A 1F3MC 3OW4A 3PUPA 4FNZA 1YOMA 4E5BA 3MVHA 1GJOA 3MS9A 2PVFA 2VWBA 3HP5A 2JAMA 3HUBA 2AUHA 3OP5A 3LXKA 3TNQB 3U9CA 4BDJA 3LCDA 1REKA 3W33A 4FOBA 1CM8A 5HICA 1VJYA 3ZXZA 4XG8A 2ERKA 3MH0A 3P5JC 4PDOA 4MBJA 5FWKK 4HVGA 4H3QA 4WUAA 2HAKA 5DIAA 3CD8A 3FXZA 3KULA 5CT7A 2WTDA 4QD6A 3W2CA 2YABA 4X6RA 1TZDA 4YJUA 4BR3A 4CG9A 5HCYA 4JX3A 4U3ZA 2XRUA 3ZM9A 1OKZA 4KKGA 2WMQA 5KMJA 3WF5A 2E2BA 3DK7A 5AP1A 3UC4A 2NPQA 2V0DA 3COMA 3EQDA 2WTIA 3VHKA 3DDQA 2PMIA 3VS6A 2I1MA 3R21A 5IQHA 5LMKC 2R3NA 2X0GA 4IM2A 4MQ1A 4ZJVA 5IH6A 3BELA 1F0QA 2QU6A 3HLLA 4CMOA 2WIPA 2OH0E 3FYJX 4G34A 2FYSA 4O91A 5AX9A 3RNIA 4IVCA 4YGAA 4APCA 2X4FA 5AR3A 3QKLA 3OUKA 2IWIA 4AN2A 3ZUUA 4FTQA 4QP3A 5CYIA 3SAYA 2RL5A 3ZU7A 4BTMA 3LFEA 3POOA 4ZZNA 4EK5A 3HV3A 3IW7A 5E4HA 3PRFA 5J7HA 5AV0A 5A6OA 1Q8YA 3OTVA 2QC6A 3VJNA 3RINA 5JEBA 2VTPA 2B1PA 2YM8A 3IK3A 3NNVA 4K6ZA 2PU8A 3KXGA 4JBQA 1TQPA 4BBFA 1WVYA 2WMBA 1YI6A 3QQHA 4YJRA 3FKOA 4ASXA 4E6DA 3ENMA 1KOBA 1BL7A 3ACJA 5CVGA 3I81A 3GQIA 3C50A 3U4WA 3TZMA 1OUYA 3CEKA 4W9XA 2QHMA 3A2CA 3QALE 3EQCA 4MAOA 2PZ5A 3Q04A 2C4GA 4FTAA 5DR2A 3MFTA 4F08A 4JMQA 3SC1A 2CKEA 3S2PA 3TKIA 2OKRA 3GC9A 2B9JA 4JQ8A 3QQKA 4W4WA 5FEDA 4ZEGA 5TE0A 2C6LA 3FLWA 2Z60A 5A4QA 3KXHA 3POZA 4LRKA 5AV1A 2QD9A 4PNIA 3UODA 4FL1A 3ALOA 4WHZA 4N70A 3A8XA 4X6QC 4OLIA 4FZ6A 4DN5A 5AR8A 3OOGA 1URCA 4FICA 1ZYDA 4CMUA 5JH6A 2W5BA 4QP2A 3MJ1A 4GJ3A 4I24A 5CANA 3GC7A 5J5TA 3BHVA 4LOOA 4PTCA 3DV3A 3EN9A 3PXZA 4OBPA 2GNHA 3NW7A 3ZM4A 3WZDA 3EN6A 2QG7A 3HYHA 4KD1A 3UVRA 5IH5A 5L2SA 4M15A 1CKJA 4QNYA 4I0SA 4YU2A 3KEXA 3VBTA 2Y6OA 1H28A 3F3TA 5EOLA 3JXWA 2XIKA 3VUKA 3MY1A 3IPHA 1FINA 4FNXA 4DDIA 3V5PA 2XNPA 2YFXA 3UP7A 3TZ9A 4NT4A 4BTJA 4EYMA 1GZNA 1XBCA 3FUPA 3FAAA 4FT3A 4DFUA 2QOHA 4D55A 5IMEA 1CKPA 4MD8E 4NKSA 4DFZE 4I6QA 3TV6A 5B2KA 4S2ZA 4XV2A 3KREA 1NVRA 2OBJA 1YXVA 4UY9A 4G9RA 2GNFA 3QD3A 2WMSA 4E93A 4BCJA