1AA6A

Reduced form of formate dehydrogenase h from e. coli
Total Genus 250
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
250
sequence length
715
structure length
697
Chain Sequence
MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKGYYGWDFINDTQILTPRLKTPMIRRQRGGKLEPVSWDEALNYVAERLSAIKEKYGPDAIQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMSNAINEIDNTDLVFVFGYNPADSHPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDKAFVASRTEGFEEYRKIVEGYTPESVEDITGVSASEIRQAARMYAQAKSAAILWGMGVTQFYQGVETVRSLTSLAMLTGNLGKPHAGVNPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHRAAHGEVRAAYIMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWPCRDTSDADQGTSYLFKEKFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPGYAQINTEDAKRLGIEDEALVWVHSRKGKIITRAQVSDRPNKGAIYMTYQWWPEYKYCAVRVEPIADQRAAEQYVIDEYNKLKTRLREAALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FORMATE DEHYDROGENASE H
publication title Crystal structure of formate dehydrogenase H: catalysis involving Mo, molybdopterin, selenocysteine, and an Fe4S4 cluster.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 250
structure length 697
sequence length 715
ec nomenclature ec 1.17.1.9: Formate dehydrogenase.
pdb deposition date 1997-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00384 Molybdopterin Molybdopterin oxidoreductase
A PF01568 Molydop_binding Molydopterin dinucleotide binding domain
A PF04879 Molybdop_Fe4S4 Molybdopterin oxidoreductase Fe4S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.90 Mainly Beta Single Sheet N-terminal domain of TfIIb ADC-like domains 1aa6A01
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1aa6A04
3.40.50.740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1aa6A02
3.40.228.10 Alpha Beta 3-Layer(aba) Sandwich Dimethylsulfoxide Reductase; domain 2 Dimethylsulfoxide Reductase, domain 2 1aa6A03
1FDOA 4AONB 1H5NA 4AYBA 4CS0A 4KDLA 1TWHA 4AOKB 3QWZA 5FTKA 2NVXA 2PMZA 1Y4ZA 2JIQA 1CZ5A 1PQFA 4RV0A 1G8JA 1PQEA 3QC8A 5B6CA 2VPXA 2NAPA 3DMRA 3ML1A 2B63A 1E18A 5GLFA 3PLXB 3IR5A 2IV2X 4CRYG 2V45A 1QCSA 2DMRA 2JA5A 1Y5IA 3IR6A 2C45A 2JIPA 1SFOA 1AA6A 3GTLA 2E2IA 1KQFA 1E32A 1PYQA 4DMRA 1WLFA 1Y1WA 3CQZA 4KLNA 1CR5A 1PT1A 3CF2A 3O5AA 3IR7A 2E7ZA 1K83A 5DYGA 2VUMA 1E5VA 1UHEA 1EU1A 3TM7B 5FTLA 1SIWA 2R7ZA 4KO8A 2YU9A 1CZ4A 1WCMA 3GTGA 1TWAA 3QQ7A 1DMRA 1YLEA 2V3VA 4GA5A 4C2MA 1I50A 4CRZA 1R27A 1TMOA 3GTQA 3HU2A 1H0HA 1PPYA 2E2HA 5C1BA 2JIMA 2VPWA 4QIWA 3TIWA 4KODA 1KQGA 3GTOA 1S3SA 1FDIA 4AAYA 1TWFA 5T5MD 3QQ8A 2NYAA 3OUGA 3GTKA 5T5ID 1PYUB 5C18A 2EEOB 2JIOA 1PT0A 2PJHB 5EPPA 3HU1A 1R7RA 1I3QA 2JA7A 1UHDA 3HU3A 4KDIA 1DMSA 1OGYA 2KI8A 1VC3B 1E60A 1TWGA 2JIRA 5FTNA 2WAQA 3HKZA 3GTJA 4GA6A 1AW8B 3H0GA 3FKIA 4AZDA 4D7ZB 5FTMA 1IW7D 2NVYA 2JA6A 5FTJA 5DYIA 1PQHA 2VPYA 1R9TA 1TWCA 3GTPA 2VPZA 3GTMA 2WB1A 1QDNA 2IVFA 2Y0SA 1E61A 1G8KA 2R93A 1Q16A 1Y1VA 2R92A
chains in the Genus database with same CATH superfamily
2WVAA 3LCVB 3FUVA 4P4UA 1DWPA 3N07A 4LG1A 4AOKB 2P78A 4TL6A 3KPJA 2PO7A 4RADA 5TIIA 1T9AA 3CCBA 1DO8A 2ISCA 4EG0A 1AKVA 3ISTA 1P0IA 3NHRA 2C2ZA 4F3TA 3RUEA 1P6XA 3OMXA 2PPLA 4HDKA 3W1WA 4UBIA 3WLIA 3KE9A 1SQGA 2P9JA 3ITDA 3UJ9A 4BP1A 4KGZA 4J3NA 4NDNE 4LJAA 3K2QA 3KSZO 3LCMA 1E1CB 1TF2A 1XZMA 2R7NA 4KSYA 3I58A 2ZTHA 1I1NA 2ZYIA 3GA7A 5CFZA 3T1QA 1HF3A 1VSBA 3K1YA 2UZAA 5GONF 2Q0XA 3NIDB 1RVV1 1ZGGA 3DEKA 1XD9A 1DIHA 3SBDA 2FGKA 1OAOA 1DT3A 2IC5A 1EG7A 3T5CA 1JQEA 4QTZA 4OA8A 5JVDB 1Z83A 13PKA 1CZOA 2HRZA 5HDBB 3STUA 1T1RA 1VMKA 4I08A 4OKIA 5FD8A 2KI7B 5FWYB 5CVVA 5C1OA 1CRQA 3C15C 2O8EA 4ZYTA 5JSZA 4GI5A 4PONA 3ECAA 2PZBA 3EVGA 1TW3A 1JG7A 4E51A 3ZK9A 4NPHA 4ZM7A 4J0QA 1OYWA 1RMQA 5FWDA 5C8DA 2PU7A 1Y7TA 1GZ6A 1FP4A 2DU8A 4EWCA 4WJKB 4X3PA 3V9PA 4CF7A 3C1TA 4HZGA 2QW1A 3VYUB 1ZNXA 4M8SA 1A8PA 1GEEA 2HAEA 2Q2WA 1AK2A 2AK3A 3FRHA 4MPJA 4PXYA 4WT7A 1CNFA 1T3LA 3PENA 1XVLA 1KJJA 1VL1A 1CUFA 4NBGA 1RQLA 1P1HA 3R0ZA 4HAOA 1L8QA 1VBKA 2PX8A 4V1CB 5IANA 5BSGA 3CLUD 2FZKA 1XKLA 1QG6A 1SZJG 1NQWA 1N6IA 5JXGA 1XXLA 1VSVA 1FVFA 2JAHA 3SHWA 3JQBC 4D9MA 3TL6A 3FWPA 4M1WA 3ENGA 1FSSA 1TJ4A 2ZI6A 3ZWOA 3GPLA 4G8CA 2JLSA 2AKYA 2HIGA 2HJVA 2XAUA 5K3AA 5K2MA 1JI3A 1CB7A 5LDGA 1B43A 1FDWA 4RVFA 1VQ51 1MG5A 2JI6A 5B4TA 4QJ5A 4MYCA 3X2SA 1U02A 3M0EA 4AMYA 1ACJA 4L9SA 2VYVD 5CYFA 3S2GA 3K30A 3TGWA 3LVRE 3CW2A 3GB9A 1KQPA 3WK7A 1W5BA 3ZCVA 3CCM1 4JLBA 1DQZA 2I65A 4NKRA 1IK6A 1K4YA 1VDMA 2B4TO 3ABQB 4ZOEA 5ALXA 3O92A 1SCNE 3ESZA 3V46A 1HMPA 4PG8A 4Y6OA 1PFVA 3SC2B 2ZR7A 5G2OA 3WGLA 1Y3BE 5DI3A 3ZG6A 3GFFA 2CXSA 3GAZA 2I22A 5FBRB 5I7WA 3Q8LA 2I8CA 4I9NA 3GI1A 4E3ZA 3A6LA 1WJ2A 4MD7A 1KI9A 5IP7I 2GB4A 2VPTA 1LBHA 3CLTD 1TADA 5LNK1 1XPRA 1U2GC 3GNTA 5AKXA 2V7TA 1ZIYA 4RKYA 1LI4A 1AUPA 3L6EA 3N8IA 4DMFA 2JI9A 4O4LB 4DCMA 4CS0A 1GL6A 1OIWA 2QSZA 2BKUA 3WWEA 3TW8A 1RRKA 3T0IA 3SZGA 2Q5EA 1RQXA 4K9KA 4N4AA 1OZGA 2C2YA 2E2HI 1Z4MA 3BL8A 4PRYA 3U17A 1FRNA 3UJCA 1QP0A 4FFPA 3K2BA 2PIAA 3D4PA 4IFBA 1EB8A 3K2EA 1HURA 5B6CA 3R6TA 1KAOA 1ZPDA 3AO0B 2YN0A 5E8JA 3U3ZA 3AJAA 2P68A 1C41A 5FQOA 3S40A 4DRZA 2BGUA 3NWOA 4I2NA 1K6EA 4QLAA 4RTLA 2YJ3A 3N05A 1KR2A 1ZKDA 1FRFS 1NSTA 2HA0A 2PEZA 5GV7A 1IOLA 1WMAA 5IM4F 3DMNA 4JXZA 3LYHA 1S7CA 4IOJA 2WE7A 4N5MA 3PQ8A 1II8A 3H6HA 6REQA 1M74A 1Y81A 2XYQA 1U63A 1PG2A 1V48A 1UCFA 2QGFA 1DUSA 1RWXA 2X58A 3H9CA 5AI8A 3UG6A 1R9JA 1CT9A 4ILEA 4QBGB 4JJIA 2FF7A 2FGJA 1AU9A 1Y80A 2QP9X 4MIKA 3WR5A 2ZW9A 4WNIA 3DHNA 4LPSA 1E6WA 4LX0A 3F3YA 3G2QA 4Q02A 1CZ4A 4YV0A 3KAKA 5KOHA 1U0OC 3W5DA 4KQMA 3ZW9A 2ZTSA 3BIWA 4RLQA 4AJ2A 3X2JA 4ETWA 1KWGA 1EWQA 5DRTA 1GCIA 2B8EA 4KSCA 3TLXA 3EFHA 2V8JA 1QUEA 5FP0A 4YPFA 4TYWA 2MYTA 3ETEA 4QJIA 1FPQA 1LBTA 1ZMXA 2PZFA 1V37A 2VJAA 1H94A 2R96A 3ERCA 5KQMA 4DIEA 1U3UA 1Z8DA 2DTXA 2OCIA 1C7ZA 2XGOA 4XJXA 1ZU4A 4EMSA 4FXPA 1KOLA 5BUCA 5HZGA 1T2UA 4X3CA 1GUBA 4D9HA 1CY4A 1IZ8A 1XV5A 2OBYA 4JLPA 2QP3A 1X2EA 1JG3A 1FLNA 3CCV1 1E1RA 1CZKA 3RK4A 2JAPA 2QX8A 2HMTA 1X39A 4DT1A 2GA9A 3HWX1 1L4UA 1QCZA 3CBGA 3QLTA 5LP6C 3LUHA 1YVPA 3CVOA 2ADMA 3EGIA 3PGMA 2YC2C 1TD1A 2PMBA 2RH5A 5AKKA 3WHIA 4AZ0A 4DLNA 3AR6A 1DAMA 4GW3A 5JYBA 4R84A 1L9XA 2D2IA 2Q62A 5H16A 4BASA 3T1YB 4FGKA 3DMPA 2PFKA 4YP0A 2OTL1 1LPSA 1SKAA 2C3MA 4PU0A 4TN5A 3RQIA 1WOYA 3GGSA 5K3FB 1ST3A 1N32B 1O54A 1JMKC 2B1JA 3LQKA 3VZQA 1DCFA 3K6SA 1PZMA 2YWHA 5JHGB 3ONWA 1PJLA 2NO4A 3BMXA 4B6GA 4CT5A 2O8FA 2C4VA 1G8YA 3PWTA 1I36A 3COSA 3K5HA 5EMJA 2CXPA 2RGUA 3RCBA 2FPUA 1E2KA 1XDDA 3MJTA 3ZD6A 3AV3A 1FE8A 1GZVA 1WZCA 2O53A 4FFDA 2V59A 4QU8A 1XDSA 1Y9ZA 3LBNA 2AJCA 1TZMA 1A50B 2FB9A 4K9NA 1IN5A 3RC3A 1T8TA 1YZNA 4GO1A 4RLFA 4QM7A 3RYFB 4OMUA 2FW9A 3NP9A 1RWMA 3W04A 1FXSA 2YFKA 1M6YA 3AIKA 3PYMA 4Z7JA 4ESOA 5JAPA 1WPXA 4YUXA 2FZVA 4ARAA 5IJ9B 5KYYB 2OXCA 3A1NA 4X8MA 3IP7A 4BMYA 5J2UF 3DHYA 2F8TA 1WABA 3ANYB 1JALA 2WE8A 1X92A 2OFOA 4GBMA 2P2YA 3LXUX 3PHIA 5J9FA 2K2QB 5DBFA 1ND5A 1WNFA 1T36A 5A0FA 4NU0A 5LIRA 2IGTA 2VQDA 3L46A 5CHEA 5THQA 2FJPA 4Q1AA 4UFOA 2H1HA 1PJQA 1NDUA 2QTVA 4WVLA 5T6MA 2Z2KA 4YQYA 2YKGA 2B4AA 1PQYA 1Z7GA 1YVDA 2H92A 2IE0A 3ET5A 2Z57A 3FUUA 4YHHB 2P3OA 2Z5LA 4JAVC 2VPXA 1E2JA 4X3OA 4EPWA 1TT7A 4V3BA 2FEKA 2W11A 1BW4A 1R5NA 2RHRA 3DB1A 5DPMA 4WFKA 1C1DA 4Y7NI 4LJ7A 3LUBA 2QXTA 1HEYA 3HSKA 4FLFA 4K8OA 4RY8A 1L7DA 3G9QA 3FTPA 5KNDD 3TKYA 2GAOA 3KOZA 4NAUA 4F2HA 1TXGA 2PL5A 5THKA 1ZFNA 4BJ1A 2H4XA 2QRCB 1MTZA 1AQYA 2IHVA 2JK0A 4Q03A 3IEIA 1N10A 4KN6A 2C3PA 1NM5A 1IJEA 3WKEA 1N7JA 2DLDA 521PA 4YYZA 5IK2D 2WM8A 2XEXA 4RVDA 1P4AA 4ZAGA 2D1YA 4INPA 2CXOA 4JP1A 1J6UA 4ZVMA 5CT5A 3NANA 2EIHA 3NYWA 3OD5A 4U2CA 2ASEA 3EXIA 4HS4A 1M901 4KK4A 5IWAB 3ELUA 1ULUA 1JG2A 5C9ZA 3CZ9A 4HYTA 3QE3A 2C4WA 1R00A 1Q7EA 3DR5A 4IIUA 4MKFA 1PGPA 1H1TA 1RM3A 3LV8A 3RJ9A 4GMXA 2J08A 2VDOB 5JEDA 1JWLA 2B5VA 4ZJYA 4F2PA 3GXBA 4MX8A 2VT3A 3L1JA 1TZ2A 5LP1A 4IUBS 3OZTA 4PFJA 4DL9A 2MSKA 4XLTA 3PB3A 2FU5C 1R9TI 4KGDA 5EIHA 5EERA 2JLUA 3PXDA 2Y0EA 2A9RA 3PNKA 3VJKA 3ZCSA 4ZO7A 2W03A 1TTPB 3EWSA 3QW4B 5I7OA 1O89A 3RS7A 3QEMB 4EB6B 5A02A 5IT4A 2FE1A 4Q3EA 3GCFA 4NFLA 4AJ1A 4Z3OA 1JEQA 1MT0A 3RJZA 3J81k 3MZKB 3T9EA 1SBZA 2QI9C 1PNTA 1MOZA 1VL0A 5GONB 1AQJA 1XF9A 4I81A 1D6NA 1XJQA 5HE9A 4RS4A 2OB1A 1B26A 5EJ7A 1U5BB 3VAYA 1HT2E 1YUKA 4JOBA 1VQ5Z 1NUUA 2EW1A 1JHXA 3Q40A 1ONOA 4HAUA 2D2FA 3ESWA 3M4NA 4HX9A 4HWPA 5FFNA 2H16A 2Q7XA 1DV1A 1RU3A 4FGWA 1IAVA 2I1LA 5D51S 1S8FA 4ZTBA 3T5AA 3SD7A 2J48A 5AW2A 1Y98A 3C6BA 4GVPA 2XMCA 1SXJE 3HN6A 4L72A 1RCTE 3IAEA 3U61B 3CCMZ 1UJMA 3ASVA 1XXHB 3DQPA 1JU3A 3T9FA 2Q5CA 4KOAA 3DO8A 3MUFA 4UHCA 5DP1A 2IHTA 2VPIA 3GDGA 3WLJA 4BDTA 2E2II 3AR9A 5EJ5A 1W36B 2Z1MA 2A14A 1QRSA 2R8RA 1X7WA 3B52X 4IFTA 4O4IF 4P32A 2IELA 1EFVB 3ZE9A 2L2QA 1CEQA 2V4UA 4EIWA 5B7PA 5FR2A 2O0LA 2FDRA 5EZSA 3VU8A 4XD7D 3ZNNA 5LMZA 1YS7A 4CEJA 3PUIA 4AN0A 5GVRA 1UP4A 4LXTA 4AZVA 2RIPA 5HZKA 4EB8A 4JJEA 2Q5LA 3N39C 4JJ8A 1C2YA 2QR1B 1YULA 1IHOA 1N0HA 2XTAA 2ZUWA 2GJ4A 4KRXA 4Y2SA 1Q1EA 1WXEA 3R0QA 1V4NA 4HH0A 4U2EA 1T35A 3GJZA 2FZLA 1ILEA 1AF7A 1BX0A 1GFSA 4WLNA 1JVNA 1YJXA 2NZYA 4N5DA 1L1RA 4HDSA 2WD7B 4P9NA 4RHYA 4XB6B 5TEVA 4FYVA 1XHEA 2HJRA 1A9ZA 2MSCB 3LUAA 4LNAA 3SHTA 2BFPA 1RWKA 3ORQA 4UM9D 4PYOA 4A26A 2P5YA 3EGVA 3GROA 1KVTA 3C3YA 1T2NA 2RHGB 4LJSA 4YWJA 2GWHA 2EC5A 5E6SB 3ECCA 1ZNZA 3FBGA 4AS1A 3NG1A 2FUKA 4NBEA 1QGYA 1CUVA 3IV6A 7REQA 1IUOA 2OENG 1A7KA 3HBJA 3L0PA 5TJ9A 4REQA 4KR9A 4LGMA 3LC1O 4ATNA 2VJDA 3FMPB 3HO8A 5ALVA 1GKLA 3GF4A 5CLHA 1O6CA 3W6PA 1H1LB 3ZLTA 2I91A 1UHEA 1MXFA 2HT6A 1XTJA 2A2ZA 4EBFA 1K3TA 3UC9A 2CMDA 1NJFA 2G17A 3VV3A 4HWSA 4K88A 4Q1CA 1TEZA 1D2RA 1KO4A 5G02A 3SQOA 2FF5A 1VJTA 3HXQA 2VDLB 3MJ4A 1DOHA 2RH4A 2YFHA 3QTLA 2JIDA 3MT0A 4EH1A 3TKLA 3JYPA 4H1VA 4F4DA 3KQLA 2JIMA 2ES4A 1HRKA 2NADA 3CPEA 3N2KB 3OVMA 1CJVC 1ESDA 5TC4A 2AWNA 2VTDA 3BERA 2EWMA 4YRPA 3ICVA 3RNLA 3S99A 5IKEA 2ZFUA 1RAFA 3HLYA 1HZZC 5FUVA 1NP6A 3T8YA 2Z2JA 2FPMA 1N6HA 2F4OA 1UKYA 2BKXA 2W98A 4TTPA 5DLQC 4ZC8A 4D74A 5B7GA 4J1TA 1KWKA 2PA3A 1PT0A 2PRJA 4WZAA 2PWBA 4OHUA 4BFSA 4DEVA 4OLBA 1KI4A 1XRPA 1WPGA 2G5PA 2H00A 5FOUA 3CRMA 5F2OA 4EX7A 1G64A 3PTZA 3WMFA 4QHYA 1LRLA 4AQDA 3NYRA 2YXNA 4A8HA 2OTLZ 1U6IA 2O57A 3GO4A 4CM3A 2J3KA 3SS7X 3OCCA 4D41A 3OX2A 2XDWA 1T2DA 1WO8A 4YECA 4JB0A 4J76A 3GLHB 2EFYA 4TUYB 4X0EA 4AS2A 2WD8A 1REQB 3C3EA 5KWIA 4ZFNA 3LFTA 5HJ2A 3A1EA 2B1GA 4NL4H 3OJXA 4EO7A 3K09C 5AVVA 4E11A 3R3HA 3GEIA 2VC2B 1FNMA 4IP0A 2RC6A 5K0NA 2XWPA 2QXUA 2A6HD 2B0JA 2P0AA 2RAFA 2HJSA 5FI5A 3ZS9A 2CNBA 5E4FA 2BGGA 3O6VA 2YHIA 3DVAB 1AS3A 3UK7A 4ZDJA 2QN7A 2YYSA 2YZGA 1EXDA 5CVTA 5L3QA 1SFOI 1W0CA 2G83A 2IYZA 2VK1A 2CXNA 3MHPA 4BVJA 2XJ4A 3AF1A 3L7KA 1VE5A 2X13A 3EIWA 3OKFA 4IZ6A 4NCKA 2AV6A 1STOA 2PS3A 5EPEA 2NUAB 4H59A 4CU2A 2DY1A 4F4HA 4Q1DA 3RUHA 4ZU1X 3FOBA 3CCFA 1XMVA 4KBGA 1DWUA 1EVYA 5EXDA 3H83A 1E99A 1DAFA 2QEQA 2HC9A 2YWBA 3QA9A 4LQCA 4IG9A 3N8GA 1NU8A 2WG0A 4W82A 3DDOA 3P5BA 3VR3D 4Q4CA 2KE5A 2VUSA 1VQK1 3BF8A 3R09A 4DMUB 3ZK8A 3QWZA 1IXSB 1RS0A 2R751 2IP1A 2VRWA 3FR8A 1SXQA 2MINA 3GY0A 1QK3A 3C3BA 1MBZA 1VPVA 4OQXA 1UBRS 2F1IA 1CDZA 3E3LA 4URHA 2F1KA 4R9UC 1Z74A 1PNOA 1Z15A 1GAWA 1NXSA 5JISA 2FJ0A 1LK5A 4C6TA 3LCJA 1K9M1 2Y6UA 5IVDA 2HOQA 3BMNA 4AKTA 1TJYA 4GPD1 3ROZA 1F7VA 1HK7A 2JGKA 5FO1A 3GKQA 2J4DA 4IS2A 4S1PA 1W5TA 2Z3ZA 4BXOA 1KGSA 1AUOA 2Q6VA 1THMA 5T3YA 3FX2A 2A59A 3QFFA 1UBSB 3T35A 2BMVA 1ULAA 2DFKB 1V1MA 4HLCA 5T4EA 5CM2M 4WKOA 2R6FA 3FCUB 1WWKA 3LW8A 1RXVA 3RVSA 4AXBA 5THXA 1WHSA 2Q4EA 1UJBA 2O8VA 1UH5A 1P5ZB 3B12A 3LCRA 2LDBA 4QQ8A 5DLYA 4DR1B 5JOQA 5ABPA 3U0VA 4IG4A 2F43B 4DHEA 3B3AA 3TE5B 5BRNA 1CJUC 2RBLA 5LWQA 2XYGA 1J00A 5FOVA 3TQQA 1USPB 2BFDB 1XCPA 1FMJA 2ZEJA 5A5FA 3L04A 4IIHA 3N9IA 1FTNA 4PVCA 5J2UB 3YASA 3KWFA 3KUDA 4J29A 1I32A 1Z4LA 2VO1A 2C3OA 1L5LA 1OCEA 4ZU3A 1FYEA 2MMGA 4KDFA 5LL6f 5BMOA 1T10A 1EAMA 5EUMA 1OGIA 2FPLA 4R1UA 2WG1A 5DYYA 4EYQA 4NHOA 2H08A 1TUBA 5T5ID 1RKQA 4BPBA 3MAGA 1VIMA 4LYFA 1N78A 1JKIA 1YIOA 2XQVA 5ULLA 2E2WA 1NGSA 1LDEA 1CDOA 3A6HA 3CLTC 3C5EA 4JLDA 1ZR2A 4EECA 2QV0A 4YS6A 5H83A 4F5EA 2GPAA 4A3MI 3TEMA 3ZGXA 1MB3A 1GILA 4Z4GA 2CFRA 3WIDA 4EOGA 1V6SA 5FA6A 4Z4HA 4KQEA 3L4SO 1ZAYA 1NBWB 2IXEA 1FRVA 1Y3CE 1M8PA 2RJNA 2A1TR 2HYIC 2Q4BA 2VI5A 3M81A 4YRCA 3G8YA 1HE4A 3VC3A 3A9RA 1KFCB 3PITA 3OCXA 2HI0A 3BRSA 3CMCO 3U4CA 2ABWA 2N47A 5F3RA 4X7RA 3SSNA 1TKCA 4C7KA 4M1KA 1ZOLA 4MW0A 1ZM2A 1IB0A 2WDZA 3R3SA 2GARA 1NYLA 2Y4OA 3OLXA 4PANA 4UBJA 5KYWB 1I2ZA 1RRPA 1PTKA 2V7VA 4B45A 3ROGA 3TRJA 4TL7A 3H8VA 2O59A 1XA4A 3K1AB 4WEQA 5CRIA 2YWGA 5ICGA 2RONA 2Q2OA 3VJRA 4DREA 1AV6A 1OAOC 1IB6A 2XI4A 3LIPA 1IXYA 1P73A 3CCE1 1E3MA 5JJKA 3SYLA 3LHKA 2JGJA 5DNWA 1DCKA 5TJHA 2Z2IA 3TW0A 1RHQA 3LL4A 1CUZA 1ZMRA 4RH1A 2EQ5A 2BUBA 2IUUA 4E07A 5BV2P 3HBAA 3PC2A 1PJTA 2IUTA 2JW5A 4QXQA 1WCYA 3OUTA 5G0TA 1HETA 2C2BA 1QGDA 1NIPA 4GOND 3RS8A 3WB2A 1LBSA 2PSFA 4QJBA 2VNKA 3HU5A 1BS2A 3BFXA 1TVCA 4HZIA 2FFJA 5I9MA 3TIXB 2H8GA 1CY2A 2PVSA 3HG7A 5FYQA 3OHMA 3PQ2A 5AHRA 3ZIDA 4DV4B 2HL6A 5MN6A 3GT3A 5DB4A 1QCCA 3A0RB 4BUJA 2QLJA 4GIBA 1Y1WI 2B63A 2QUBA 1RWVA 4B2YA 4I5IA 1H6CA 3P8ZA 2W6JD 4G56A 3DE2X 4DR4B 4YUYA 1B6TA 3F9RA 5AUOB 3P9YA 4A5SA 4C89A 2BKEA 1RXCA 3QV2A 1M0TA 1NDQA 4FR5A 4MYHA 4RA9A 2HF7A 3NEAA 3ZU5A 4B17A 2IU6A 5ADUS 1Q0PA 5EE9A 4CM4A 2CLDX 4O0LA 2ON6A 3MTQA 1KJNA 1MA0A 2G4CA 4H6VA 3B7WA 5BV0A 3QYPA 2A0FA 1IN8A 4HNHA 4E2YA 4E0BA 4V0NA 2JVJA 2IYTA 4OJTA 3L0DA 4NYJR 5CD1A 3U3KA 1RPAA 2VJYA 3VTAA 1AKEA 1GG9A 5HPYB 1E66A 1PFTA 3RQSA 1NVXQ 5F12A 4Q4AB 1TEHA 3DP7A 4O8CA 3UTCA 1FU4A 3QHAA 4PYMA 4QNNA 2RIRA 4UVHA 4CNQA 3IEPA 1WLYA 3KU4A 1DAIA 4ZKDA 1G8GA 2V6IA 5EJFA 3ZC3A 2VHTA 4JCCA 4HPXB 4YTEA 5CURA 3HQ4O 2FOIA 3BN3A 2D59A 1EI9A 1RM0A 1OTYA 2H7XA 1UJNA 1GL3A 2AMVA 3FTNA 2BDUA 5DE3A 1KF0A 2ORVA 1R4MB 3PD1A 2HDHA 3GQBB 3VC1A 4AY5A 3JPYA 4A3II 1Y9EA 1OV4A 2VJMA 4MUAA 4E21A 5A3RA 1SRRA 3RVMA 3P5JB 2R8EA 3R4CA 2H2WA 5FTWA 3LXXA 4NAHA 1LPAB 2Q50A 2JHFA 5B2FA 5CX1A 3ZS8A 2NU9B 1Y7HA 3KZNA 1U0BB 2EQBA 1UXHA 4U0JA 1ADJA 1SUAA 1EFTA 4RXTA 1HKHA 1SY7A 5BMVA 3JD1A 4LF8B 2ATVA 3GLIE 4QXMA 1MHTA 3Q72A 2E5FA 5TPWB 4HX2A 2Q1WA 2ZRPA 2NUPA 3HKZA 4V2UA 3REQA 4BNWA 2P2CA 3TQRA 4HVTA 3E3NA 1YA4A 2QZJA 2AEFA 5FXMA 4BBRI 4TX1A 3USES 1Q50A 4WHMA 2GPNA 1EIZA 2HU7A 3CFYA 3FYCA 4TNUA 2FPSA 5E95A 4HDNA 3VKWA 2JGRA 4HYQA 2VSFA 1Q77A 2YHBA 4QUEA 4G8DA 1PQHA 3A4YA 4B2LA 2NVTI 4LDJA 4C2BA 1UM9A 1EA5A 1K6XA 4F84A 4IV8A 5EY5B 4DLZA 3I52A 3MTIA 4GXNA 5KHOC 3HC7A 4YAIA 2K5RA 4RVUA 2WPDD 1N34B 1Q6ZA 3RAFC 4EA6A 4NH1C 4D9CA 1VI6A 1SVNA 5AVOA 5BSHA 1BN7A 4J4HA 3WLOA 4C7BA 3JQEA 1V5FA 2R6R1 1VQKZ 1FLDA 3AXSA 3PJEA 3RHZA 2KQAA 2RG7A 3O8OB 4Q3DA 1L5RA 1UEJA 4F2GA 4J75A 3WGZA 5LNK6 5J4KA 5TPZD 2HMWA 3LKVA 1Q821 5E9JA 3W5CA 1M7GA 3QKTA 4CM9A 3NMUF 4COKA 4DW8A 3ZV3A 2DGDA 3BPSA 4D3SA 1RBYA 1R15A 1U65A 7AT1A 3CCU1 1TIKA 2JFNA 3ROEA 3W9UA 3EVCA 1UAGA 1WR8A 1F0KA 1TQDA 2BM1A 2FEWB 3RG8A 1B2LA 3RIXA 1N5RA 3H1FA 3P9CA 3ONFA 4ZYVA 1Y4SA 3UBMA 2CHQA 2LCQA 3J80A 3FDXA 3IO5A 3K96A 3TB4A 5EIBC 2HHCA 5FPTA 4X1OA 1J97A 5KMGA 5FUWA 1LS6A 1GDHA 1PUJA 4DA8A 4NESA 4C78A 5AJVB 3RWMB 1XU4A 4N8EA 4Q05A 1VHLA 1P5HA 4QYSA 2DM6A 2G82A 2NVUA 4MVJI 2HEIA 1V43A 1VCHA 3PX3A 2QEX1 4CLHA 2DR2A 4QHTA 2BRUA 1JFFA 4LJRA 2ZZNA 2W4IA 2YUJA 4D8YA 1ENZA 4GHWA 3P96A 1WCMA 4P3NA 3K9WA 1T6ZA 3A14A 1W85B 4Y6LA 1RXWA 4LISA 4ZOQI 4V03A 5JEEA 5CAEA 1E59A 5JS6A 4ZAYA 1G2PA 3NWBA 1NVVR 2Z5GA 2VQ3A 4DYVA 1W88A 2AHRA 1DHRA 4ARUA 2P30A 3JD4A 1E3JA 2B6NA 2X0JA 4K86A 4EWLA 4EJSB 1X7XA 1COZA 3L93A 2POCA 3TG2A 1DIBA 1NSYA 2R3SA 5CDYA 5KVCA 1IVSA 1H2FA 1VLLA 4C4AA 3IBYA 3KSDO 4RPIA 4DSOA 4HP8A 4CG0A 3MAJA 3QVLA 5TQJA 3ABZA 3IUPA 2CHVA 3IEVA 2Q51A 5DTIA 1VLVA 4BJ6A 3IALA 1ZG3A 1V2HE 1NLUA 3JQGA 1J8FA 1US8A 2R7LA 1H2XA 4LTDA 3F3SA 4KPUB 1GM5A 1TFIA 2WJPA 1EDDA 2HA7A 1UC9A 3BG1B 1L5HA 3WLPA 3C3AA 2GYYA 3LZCA 3CIFA 4C7JA 4DLBA 3UY4A 4E30A 3AFIA 1C0KA 2I6GA 4B7XA 2DPYA 2EX1A 5BORA 4KEAA 3IUBA 3S28A 4DBZA 3GJXC 1BAPA 3GAMA 1ZD3A 3JAWA 3OQ1A 3ID6C 3CD61 2ATXA 4CMEC 5LDDC 3KEOA 1G5IA 3CXRA 3RR2A 1T5DX 3AUXA 1JDNA 3MXOA 4M9XA 2ZSUA 2YV2A 4QYWA 3VSDA 3AVXA 3SC4A 4JUBA 1XHFA 3AERB 2IBSA 1SCBA 1PJ8A 2KYRA 2EW2A 3O9MA 1V16B 5DGHA 2X8LA 1VJRA 1U7DA 3OQJA 3CCEZ 3ZYCA 3IDOA 1TWCA 3PNOA 2YQ4A 3HCBA 2O2DA 1YL7A 4PHTA 1YZTA 3TSYA 5KAMA 4DY4A 1H66A 5CIWA 4UARA 4MUBA 1NM5C 1MTOA 1HE2A 3AHEA 3GV0A 3JW8A 2N0SA 4KQ6A 2BZ1A 5IG2A 4YIHA 1WRBA 1L4LA 2R5WA 4UXHA 5H5JA 3RUPA 1VPWA 2C5EA 1FFBA 4YV7A 2HFKA 3QPUA 1KZ6A 4CW7A 3AR4A 4RTOA 3WWYA 1XYYA 1FSGA 1XE3A 4I4LA 2CFCA 1XRLA 3EMVA 4EHAA 1T5OA 2EU8A 3BA1A 4LF4B 3IHWA 4X41A 3KAQA 2BUAA 4CM9D 1N7IA 5JH7A 4X20A 2AVNA 3H05A 4J03A 3WHPA 2QNRA 4NTZA 1EP3B 1O4VA 3KLPX 3IIIA 1RLIA 5IYZA 2BP7B 2HMUA 1UPXA 5KYVA 1H2HA 2LKCA 1XCOA 3O1JC 5DXFA 3IKTA 1F8XA 3HY6A 1WQ4A 3S1LA 3IOCA 4BC1A 1TKRA 1NA5A 1J0DA 2WQZA 2Z3VA 3GFQA 3JZAA 4MMXB 5AESA 2PZAA 2BGNA 3ZV5A 2EFHB 4DIFA 5ALTA 1I4DD 5A5EA 3L49A 2F67A 3D59A 2G9NA 2F8LA 2PGLA 1AF4A 1V8BA 3AYXB 2AOTA 4YQZA 3ZWKA 1YJN1 3QQPA 4LVUA 4HDOB 5I01A 4JLNA 2Y1EA 4G5GA 2Y4NA 3GJ0A 4R1LA 4EJ0A 3LUKA 1ODLA 3P9SA 4IO0A 2ZIEA 3IIJA 2QRDB 3SKXA 5HIAA 3HOYI 1RFLA 2BFFB 3OF5A 3N8DA 3QWIA 4BB6A 1LC0A 4OYYA 4PO1A 2RFLA 1WXIA 2FPPA 4WFQA 2G72A 2AE1A 3DF7A 2H1OA 1DINA 1RPTA 3GVIA 3JTMA 1ONSA 4LWQA 3AQIA 3Q12A 2DBRA 3D8UA 3KJHA 3UV3A 2X8JA 2Q5HA 3UIEA 4B3BA 3FOCA 2BE7A 2ID9A 2NTYC 1EK2A 2EWWA 2IJGX 3E18A 3H3FA 4Z49A 3HADA 4B48A 1DIOB 4D8VA 4UBLA 2FZ5A 2ORYA 5EZYF 4B32A 3LK7A 2YVLA 3ZH9B 1RWOA 2P3QA 5DNDA 4BU0A 1BDHA 2CB9A 1RCFA 2WBLC 3HFRA 4PLVA 4MV1A 4IF4A 2A5GA 3A4TA 5D7NA 3HP4A 2VJNA 5CH5A 5DBEX 3LUCA 2NYRA 4U9UA 1NNI1 2CFTA 3FUXA 2DE5A 2A6ED 1QVVA 1SGWA 1NWCA 2ZRIA 2ZRJA 3GEHA 2P6UA 3GZJA 3HJGA 4EHJA 3COJA 3VTFA 5HF9A 4B6SA 2B3DA 3LX5A 4WLEA 3DNFA 1UBFA 1OFUX 1U9CA 3UGQA 4NXNB 1U3CA 3I5UA 2JIRA 5AVSA 3KKLA 4AVYA 1Z01A 4XX2A 4YFVA 1V6CA 2GXAA 2BHRA 1NYRA 1XZNA 1D8AA 3CWZA 4HQ6A 4K6FA 4BGUA 1CF2O 1XZJA 3MTDA 1I5EA 5E1OA 1ZMBA 2LW7A 2OCKA 5DZSA 3ZDFA 5FWNA 2PD6A 4XYGA 1F9EA 3ABIA 3AHIA 4GBED 1LX6A 3B53X 4EABA 4BWGA 5JMWA 4JC8A 4WY2A 4K03A 3I28A 3W3ZB 3ZDAA 2FDXA 4C88A 1X42A 4CKEA 4G84A 1F1BA 2FE4A 2R6AA 1GZSA 1AKWA 3M9WA 5D5QA 3AFNA 4RJ2A 3TLAA 4A0QA 5BV1A 3QGMA 1L1EA 4YY3B 4OHKA 2PNWA 3WO0A 2WHRA 1E9VA 1T9GR 5HQ3B 5I48A 1VRWA 4E6EA 3JSAA 2P3YA 3CEMA 1XAGA 2A0XA 2LTAA 2W2OA 3ZWPA 3B1YA 3LD9A 4NV0A 5HHTA 2VLBA 2Q6TA 2H1RA 3QUBA 1D2NA 4AMUA 4F46A 2YXBA 2GHIA 3CVUA 2WAXA 4QDUA 5AO9A 1HLFA 1PJCA 4PCAA 4R2WA 1P9OA 4WXMA 3CUYA 1NXVA 3G711 1C9MA 1XL1A 3Q8XB 2X0DA 3CCUZ 2HQOA 4ESEA 1VGQA 2GM4A 3IP8A 4F1JA 3PR1A 2QJWA 5DCYA 4D5EA 1TCAA 2BDTA 2GR9A 3FDJA 2OV4A 2DHDA 4KNWA 1RM4A 1J56A 1MIOB 2HKIA 1PR9A 3B6IA 1Z5ZA 3KSBC 3PP8A 5JCOA 4U7DA 2LIYA 4MO2A 2Z56A 2GQ0A 3B78A 3MD9A 1Q92A 4WACA 3CNQS 3JVIA 2BSAA 1D4FA 4JXKA 4LJYA 4BBAA 3G2KA 3BORA 4CTMA 3TB6A 2XKBA 3ANNA 2PMDA 1BWQA 3H5WA 2FI1A 4J1TC 2Q2VA 4LPKA 1TMGE 2P6OA 3IB3A 4UUQA 4CLOB 5ERGB 4JBWA 1Z5GA 2QN2A 4DMRA 5FV7A 5AW1A 3G3EA 1NJ1A 2X9VA 1E0JA 2O8DA 1Z34A 2QEXZ 1HM5A 5JC8A 1D09A 1XA3A 3H11B 4DXDA 1KERA 1ODKA 2I4NA 3EODA 5JFTA 3PJFA 2H4FA 4XWYA 3PFNA 2W6PA 1H4QA 3VSEA 5EIAA 2BM0A 1AMOA 5FAXA 4DCPA 4YPVA 3N2ZB 1VQP1 5K3CA 3QUAA 3QQ7A 2FZWA 3IRUA 3MCUA 1YR3A 2XQJA 3SF8B 3KTFA 3A04A 3L7NA 4K9OA 4Q4LA 5ALRA 4Y2JA 4C7OB 3B5JA 2QMOA 2R6JA 3KB2A 3VVMA 1JI0A 2I6TA 2LGJA 4Z2AA 3CNEA 3M6IA 3L7YA 4M9RA 4ZYXA 2YASA 1W6RA 3I3OA 3VPFA 4J2HA 1T5SA 3RJMA 2HYDA 1Z6PA 5JS1A 2WTUA 4XXHA 4NDAA 1HOTA 4PZPA 1B76A 3DLTA 3BM5A 4QGAA 5D5HA 3FTCA 2WD9A 4LY6A 1QYVA 1W6UA 3TBHA 4XVCA 4YRGA 3AF6A 4ABTA 1CE8A 3BS4A 5BV8A 4GVLA 4CMIB 5P21A 3LC7O 4PZEA 3T1VA 1P0QA 1EX9A 3G9ZA 4YUVA 2X0KA 4QTYA 1H8HD 3CCCA 3EXFA 3IELA 3TWOA 4Z1OA 3NDBB 4A6DA 5F1YA 2YMLA 3COZA 4BRSA 5KYGA 1B41A 2GN1A 1Q1AA 3AYZB 4CKCB 3PLAE 3VR0A 3I92A 4L08A 1NURA 3RRYA 2FVYA 3EUAA 3H1EA 5DJ5A 1P81A 1GGKA 3GGGA 4GNKA 2D06A 4H3VA 3W3AH 3CD6Z 4Q9LA 3WKAA 1OW3B 2C0PA 3OX1A 3NT4A 4S0XA 3E9ZA 4UE3S 3X1KA 1N5LA 4AUNA 3QUSA 1MG0A 4BNMA 1EJ6A 5BQOA 2AI2A 3O73A 2J85A 1PWYE 3ZCXA 3I6BA 1KQOA 1BVHA 3A27A 1NLZA 1XZHA 3S16I 1A9XB 2A92A 2HCBA 2RK3A 3F5DA 3BSYA 1JJ2Y 3KWMA 4NC9A 4G1VA 1FFWA 3GTLI 2JAQA 2NYUA 2YRXA 4N7RA 3CEAA 4YRAA 1ECGA 4KR2A 4J43A 1K9VF 4I3HA 3VZSA 4I66A 3BHIA 4DMMA 2F7SA 1HKUA 4DGQA 1RSZA 4MQ5A 1E7QA 2G0TA 4XIJA 3IT0A 1CSEE 3W7AA 3ROFA 5A5GA 3AFGA 2R92A 2HBQA 4AJOA 1W36D 1W73A 4NJOA 3VDNB 5EMHA 3L8HA 5EMKA 1MFZA 1YAJA 3ZEIA 3NTOA 1YB6A 5D3ZA 3M1IA 3FPBA 1JTFA 5BWLA 5J4VA 2AZ4A 2B4QA 4TKLA 4BUZA 5JBIA 3GCZA 3QYFA 5ILQA 5YASA 1BOFA 3SBEA 1CVLA 2BWJA 2VHUA 3CSUA 3V4SA 2O4CA 4W9MC 4A8JB 2FLKA 4TLBA 1QLHA 3QHPA 2AMYA 1PP4A 3T54A 4IYRA 2PR7A 4BKOA 3CNNA 3MBIA 3PKZA 4H0NA 3JV7A 4JI2B 2IHBA 3HKBA 3K92A 4ZV4A 4YCBA 1YIJ1 1LW7A 2Q07A 1K732 4UHFA 2JLXA 2J8ZA 3WVNA 1HQYE 1C0IA 1TPZA 5DGDA 3RLFA 3VU1A 3KWJA 4DLXA 3P32A 1YZKA 2EYUA 4EX6A 4MHTA 2FWNA 2HW8A 4O0MA 4HWOA 2P79A 1YJAA 1NJ2A 4LGVA 3GPBA 5CYOA 1YJNZ 5I3CA 4ZTUB 3IQGX 1KKLA 1A82A 1KP9A 3Q98A 4LKOA 3LY8A 3B1XA 5E6UA 2H7VA 5IDXA 1DARA 2DFVA 3I12A 4H3HB 4YT8A 3E1GA 2JZNA 2RGAA 4K9RA 1MB9A 1VKNA 3NUGA 1E1DA 3M49A 1P6UA 4J0JA 1U1GA 2DCUA 4FN5A 2I6SA 2O2ZA 4HD8A 1U3FA 4LJLA 4IMPA 2OYSA 1YKSA 2C07A 2CBXA 1JHMA 4Q18A 1NBME 4MROA 3Q11A 1ZINA 2QGZA 1T1EA 4N82A 1ZN8A 2B2XA 4FFBB 4JD5A 4O4JF 3RHSA 3TZCA 3R7WB 1H2WA 1YIT1 3JQAA 4CM1A 3DZ8A 1XVUA 3P0HA 3TBKA 3BILA 4Z0HO 2XW6A 1N1EA 1ST2A 4NJMB 4RF2A 4IKOA 2TMYA 3BBLA 2NZJA 3AY6A 4KKVA 3U9LA 5FHQA 1KI2A 1NV8A 3PQ5A 2QD4A 4B8ZA 1SQFA 5HRAA 1D04A 1E3TA 1XMPA 1GRVA 1U8CB 2W70A 5LFAA 1OTXA 1V7PC 2GKOA 4GYJA 3RKSA 1ONNA 2INGX 4QWMA 2GM5A 1YB7A 1NNLA 2W2MA 4ON9A 5JI3E 5DM2A 2Q3HA 4EW1A 1YJ91 2HIMA 2GO1A 3J7TA 2B7LA 5FTNA 3AOGA 2ZWMA 3PHLA 4HN4B 2GEUA 2WUFA 4X90A 3RSZA 421PA 4X7BA 1OT3A 5DSTA 4GUAA 4JQSA 2RG1A 5DSXA 4D8UA 3HHEA 2B6HA 3LWBA 3NCHA 1KSGA 1ND6A 2B61A 5B3LA 5DYTA 4UOZA 5LD2B 1ZU5A 1SKYB 4AO7A 4QTUB 2PGIA 4QJ4A 2ZUVA 3CW8X 1PQPA 4BNLA 4DUGD 1Z6XA 3L4KA 2GN9A 2C77A 1VI2A 4X8HA 1JIQA 1XLVA 4DRXB 1X7YA 3P2YA 4H17A 4LV6A 4UREA 2CXHA 2VSNA 4R81A 1Q7BA 4J16A 1JFTA 3U9TA 3BH6A 1XOIA 3VZRA 2OQ2A 1R0WA 3FYUB 2CY0A 1SM4A 4R1NA 5CXSA 2KLBA 2EW8A 4IHKA 4WI1A 2JUBA 2PPVA 4BGDA 2ZE7A 2B1QA 1E61A 2GZAA 3CCS1 1DPGA 1EWTA 3N3BC 1JLRA 5D6OA 2AG0A 2NG1A 4OYLA 1DC6A 4BAZA 1EVQA 2WWHA 1K4MA 3AT1A 3EEQA 3HCDA 4V0ME 2BEWB 2WZBA 4LZNA 5EZYB 5H80A 1QIGA 3IESA 4KMRA 4R01A 2JIBA 1XCBA 2VF4X 3HYNA 1CHNA 4B6JA 4A27A 1ZN2A 3THWB 4EG5A 2QJRA 3LECA 5DBGA 1I0IA 3QFTA 4F93B 2J6AA 2PJDA 2J87A 3ACCA 3RHFA 3ABRB 3E5RA 2GJ8A 2QU7A 2ZKLA 3CUVA 4DWOA 2QG9A 2NZ2A 4LRWA 3RK1A 3WLTA 4EF4A 4IDQA 4ZD6A 4F3CA 1OX4B 4RSHA 3UWKA 2IX9A 5IUNC 4PRZA 3WLLA 3K72B 1NN3A 1SWWA 3ON5A 4Q3CA 2BTQA 3PC7A 4QTTA 1SUSA 3VC2A 3R75A 2EYQA 1CULC 2ZYRA 1JQJC 4LY3A 4H7PA 3QTTA 4LIPD 2OZLB 1NUQA 4AG6A 1OBHA 2XYRA 2F1JA 1V1JA 2XJ9A 2I0FA 1F2UA 1JAXA 1N2CB 3VI4B 2XTMA 1KS2A 3JD3A 3N58A 4F2WA 1R6AA 3E22A 1BA3A 5JATA 3MCAA 1NBAA 1OXMA 3HR7A 3KTAA 4WERA 1S8AA 3PFIA 3ZHBA 1JAZA 1ODTC 5DM70 1H1DA 4A3EI 2C83A 4J0DA 3DWIA 2XB9A 4N8DA 4GKKB 1K08A 2LCFA 1DOAA 1XVIA 2CMHA 4FSDA 1ZD5A 4NBTA 4C4RA 2CSXA 2ODWA 3T15A 2WV9A 2IP2A 2Z6VA 1ZI8A 2QZ9A 5CTJA 3RGWS 5HE8A 3IKLA 3INGA 4G2NA 5FEMA 3CJQA 2V3CC 1E4OA 2Q45A 2H9IA 3REFA 1JXOA 5K8JB 3W8DA 4A0SA 3BD8A 1ZUNB 2ZK7A 4OKNA 3S8MA 5JCPA 5LSAA 4R8SA 4D4IA 4N3AA 5CB4F 2JLRA 3CLKA 2UZ4A 2BV3A 4QD3A 3QBTA 2VT7A 4IOMA 1TM3E 5K3BA 3HXLA 1G60A 5ALFA 4B74A 1A4XA 1Z4PX 2EKDA 4YUAA 3EOZA 3TEJA 1FL9A 3EDYA 4DXHA 2B7CA 1RHUA 4LV8B 1GZ5A 3JD0A 1I2BA 4C7XA 4UQLA 2WA1A 5LXTA 3K0AA 1XHLA 1BCRA 3KQQA 4L2IA 3LLSA 4WOJA 4TVKA 4XUDA 3WB9A 4EGCB 4F56A 2XGSA 4KYUA 5AIBA 3S1MI 1GGMA 1YDGA 4GPAA 2DQYA 5A05A 1R12A 3HJNA 2QG6A 1L8OA 3OMWA 2XEDA 3QMVA 4TYQA 3U80A 3C16C 4A10A 1B6RA 2FSSA 4IVNA 3VKFA 2QT0A 1NP3A 1PHPA 1E0DA 3B9RA 5IDYA 1K7YA 4J90A 3VPSA 3L8DA 1EK5A 3NIGB 1A9RA 4C0KA 3EGEA 1Y1RA 3TQOA 1QC5A 4MV9A 5IVHA 3DBRA 3U0BA 1YRBA 3BMCA 6AT1A 3VMGA 3GOHA 2Y1LA 4I9UA 3T5DA 4IFIA 1O97C 3GP3A 3MCTA 4D45A 5A7FA 1N9ZA 3W79A 1EVZA 1BRTA 4XUEA 5T64A 1NC1A 2D74A 2Q28A 2VDMB 3FMVA 1D03A 2BRUC 2QJFA 4OQDA 5ALMA 3FOWA 3IAAA 1CUUA 4KMSA 4XCXA 3D1LA 3OZEA 1DKRA 5L40A 1Y8QB 4IZHA 3KR1A 2G4VA 1IL0A 2NZUG 1ZX1A 4G0XA 3F6CA 3UFXA 5K6RA 2GCIA 1L7QA 1QCYA 4L0QA 2ZB4A 2HF9A 1CZRA 2GBGA 2I2WA 2JCXA 3E0XA 3O8NA 1ODCA 2VJPA 5H70A 4FS3A 3I64A 3X1DA 4IKEA 4RD1A 2EGHA 5EE5B 2XCRB 5C3EI 1SK9A 2A3RA 1FVHA 1DQRA 4J9VA 4N9WA 3S7ZA 4A9AA 1UFKA 1SUIA 1WZNA 4OO3A 3JQRA 3RG2A 1YIJZ 2LUOA 2RBGA 5T3UA 1OXBB 5ESDA 3WGJA 1RQNA 4MVWA 3Q5GA 1QYRA 1T9ZA 2GFIA 2I33A 3HPRA 2MIIA 5FLEX 4B33A 1MJGM 5FUXA 3GUCA 3HCRA 1DAHA 3UUWA 4GLBA 2DFPA 1Q861 1NIJA 3AEXA 4CKXA 3INNA 1WOMA 1R74A 4GXRA 2RKOA 3FI0A 1H6AA 3AZPA 4EKGA 1OFIA 2R7ZA 1QTIA 3GRPA 2VN8A 1C29B 3F5MA 3INRA 1T4CB 4TS9A 3A1TA 4MIYA 1KHTA 1C8VB 4AW9A 1KYQA 1Y7IA 1YDWA 2EJWA 3PUHA 1QIKA 4UD2A 1X86B 2KS6A 2AN4A 5JCJA 3WA6A 4JQCA 3PDJA 3HKEA 1GVNB 1JIVA 5CDFE 4M7RA 3G6E1 1I94B 1FRZA 3SM3A 1Q0HA 5BOVA 2G0NA 1YQWA 1X3ZA 1PWEA 1ZD9A 1YITZ 3CF0A 2FEOA 5G0SA 2D54A 1Q1QA 3SXUB 1KE2A 5A2Qb 1N5JA 1P3JA 2DBVO 2DQKA 4N0MA 4BV8A 4E4TA 4O63O 1KPHA 4BPRA 1HTTA 2RH8A 2PDAA 2RGGA 1X1RA 4MGIR 4KR3A 4QQKA 4W7IA 3GGCA 5LYYA 3N53A 3L7LA 4LC9A 4OKSA 1EUZA 2Y93A 3CM0A 3L7AA 4CLRA 2PYDA 4RESA 3ZKAA 4WE3A 5G4LA 2ZYDA 3C6XA 3D8SA 3WRYA 3REGA 1OSNA 1CR6A 1MJNA 4BMSA 3M9LA 4UFNA 4HNGA 3VHXA 3O1HB 3VMMA 1I2AA 3C2QA 1YJ9Z 5ENZA 3G0IA 4HWKA 5BN5A 5CLFA 1WAMA 2IHNA 4PAQA 3DLCA 1KC1A 4PM4A 5JPIA 4B0OA 2RMKA 4E3WA 1MVLA 2IW3A 4MCJA 2YVKA 3JQ8A 5FOQA 1AW8B 3GEDA 1KDYA 3HRIA 2FRVA 1T3SA 1CUXA 1X7DA 1ZA1A 4POAA 3KUXA 2A9FA 4ZCIA 3SFZA 1SC3A 5KVQA 5E2BA 4ZOLA 3OU7A 1GAJA 3SBXA 4D7ZB 3B51X 1RC1A 3ICOA 3JQPA 1E1LA 3SU8A 2OT3B 5HRCA 4IHAA 4G5OA 3R3YA 3VAAA 3PEWA 4X54A 2P35A 5D01A 5B3AA 4C3ZA 2MR5A 4PLWA 3D8NA 2R2GA 5KSPA 3VSBA 1LB1B 1RAHA 1DKUA 2P90A 5AJYA 2QQ5A 3ZGLA 3CCSZ 4O02B 5CFPA 1I1QB 3AP2A 1WVMA 3S2IA 2KSQA 4UOQA 5FBVB 3WKDA 4MEAA 3JY6A 2YU9I 3B9PA 3ZWCA 5EQTA 3BQNB 3GCGA 3AETA 2GN6A 5L6LB 2OILA 2YJGA 1PQUA 2A0YA 2WWVD 4LHXA 1S7MA 1CR4A 1Z5NA 2FW7A 4OHXA 1W4ZA 2E21A 3VM6A 3W9YA 2JIQA 4JH0A 3FNGA 1U0NA 1Y9JA 4K2HA 3OQIA 4L8WB 1BEEA 4BLUA 1Z0JA 4FYYA 3G4S1 3T9AA 2PH3A 4RSRA 3RI3A 3RAPR 1EG2A 1CIJA 5M5BA 5TS3A 4P84A 3TQTA 3I61A 1AD2A 1KEUA 1UK8A 3PIRA 2HTFA 5D1OA 1SBNE 3DV2A 4MDHA 5L95A 3IBTA 2PX2A 2X5OA 2AQIA 2PZLA 2QXYA 2PYIA 3EZ9A 2J0UA 1GU1A 2JJ8A 5EEHA 4XD2A 5EWJB 4Q9KA 2DLNA 4B3MB 3ZJ5A 1OI3A 1G2QA 4IWXA 1C9DB 1N6LA 1WVGA 4O2BA 2R6CA 5HUJA 1OASA 4AFNA 3IGFA 5D1PA 1JDTA 2W2TA 3WMWA 2WWYA 1FNDA 2J7PA 2ZU6A 3IPCA 2OGTA 2UVPB 3PL1A 2WF9A 1CEXA 2QLTA 2VAWA 3QZUA 3VTZA 4AT1A 2HADA 4QU9A 2IT1A 4UUPA 6ABPA 1GQRA 1AQLA 2JJ1D 2AJTA 3L92A 4GI7A 2AEMA 4JJ4A 4K9QA 3CPJB 1RJFA 5B4VA 4HGYA 2R44A 4HDRA 2QA5A 2ZI5A 3PR3A 5HK8A 1RYMA 3KKNA 1SXJA 4YC7A 4R69A 3JRNA 1VHJA 3X1WA 3ZWBA 3V4LA 4ENSA 1E2BA 5GLYA 2BM8A 4WZZA 3RWBA 3TTSA 1PSWA 3AUSA 4ND6A 1IBLB 4LOLA 3NHYA 3LHSA 3U56A 4GKAA 4BLSA 1BG6A 2AEJA 1P77A 2CMGA 2XUQA 1N8R2 2ZI4A 3PGA1 4HDAA 3ZIUA 2R4TA 3LQYA 5CLQA 4WA8A 4EA9A 4F1WA 4ND4A 3MJCA 1C7EA 2GH1A 3OQNA 4HQNA 5K51A 1DAEA 1ODSA 3VOAA 3ORSA 4F2DA 1XRRA 1WTAA 2X2FA 4OG2A 1MMFB 1AK1A 2ZIXA 3WK9A 2X5JO 4D4JA 2BFOA 4I1VA 4KDIA 3D2AA 3W4KA 3GHHA 4TTSA 4NE7A 4B84A 4U63A 4D82A 3OLVA 4UEKA 4OBBA 1N0WA 4F60A 3BMQB 3BXHA 1C9YA 3F7MA 4OP1A 2XUDA 1EK0A 4PX2A 2ESRA 5CCBA 2WMOB 4Q16A 3WMEA 2FPOA 2FWJA 1U3DA 1K75A 3NFYA 3DV0B 2CLFB 4HWRA 4BNDB 3TPFA 3ZKWA 5TQ0A 1G4HA 3EVBA 5LMNB 1MO6A 4QOHA 5T4HA 4KR6A 1A71A 4C22A 5JCOC 5F7OA 1L5MA 1OHHA 2GRAA 4RHCA 1A1SA 4CPDA 3JCZA 2GBLA 2OUKA 1N77A 5FR1A 1YXMA 1X6VA 2V4MA 1JBKA 3HYCA 2XE7A 1WB6A 1AIPA 5NULA 2GVNA 3FKJA 4DA7A 5H4GA 4BQPA 4MQLA 5I7EA 1G8AA 4GF5A 2Q1UA 4KFRA 1N2XA 4I1UA 4WPGA 4DILA 5CG2A 1G5HA 3OPNA 4LN1A 5IAEA 2PXCA 1R6TA 4QOIA 2D0DA 5I4BA 1ZHOA 2IH5A 1WVIA 3QOYA 1MOPA 1JLMA 5AHOA 5J5CA 4N6NA 2E18A 4YAGA 3S0JA 2FW8A 4M1TA 1NF9A 5IPFA 1M8KA 5CB4B 4X6AI 1I50I 2ALJA 3OX4A 3RROA 2PUDA 5JSUA 3RIYA 4DG8A 2PBFA 4KHZA 2NO0A 2WKSA 3LUGA 5EKSA 4EUEA 2XBMA 5FI3A 3RUFA 1SCUB 2PLAA 5A2Qf 1FF9A 1LVUA 2JEOA 2XRFA 3NGMA 2WYIA 4KWIA 1Q21A 3UYKA 4NCJA 4E13A 1KMHA 1S2DA 3L7MA 2C4MA 1NI5A 2IPNA 4M89A 3W5AA 3G6WA 1JN0A 2VJLA 4Y1GA 3DTVA 5ALWA 1TW2A 1UFOA 4MQBA 4IMIB 3T5MA 5JD5A 3G8DA 3DEJA 3BEOA 5A4FS 1N75A 2QUIA 1R2QA 3OEWA 4C2UA 3FYTA 1YS4A 2AW3A 4UM8B 1SEPA 1HNNA 3AEUB 1J22A 1TYEB 3OIDA 4TV9F 1PZEA 4XM2A 5KJCA 2GPBA 3FBTA 2XGMA 2VJCA 3SHVA 1J25A 2G1JA 2E2JI 1E5DA 2MU1A 5JNWA 2UUAB 2GEVA 1JEAA 3AG6A 3ZEAA 3BT7A 3AVWA 2RBEA 1EZ1A 1DKLA 2QD5A 1XSEA 3B36A 4Z9YA 4BJHB 3ETLA 2J32A 3EULA 2M1XA 4WN9B 1EX7A 3P0RA 2O8CB 1BVRA 3WBFA 4BC0A 1TMKA 4HXEB 2FPXA 5IKOA 3G6EZ 1EVEA 5LZ9A 1JBQA 3DL7A 3PDWA 1H0HA 3N2IA 3QVWA 3UK0A 3MCWA 4C2AA 1AB5A 5EIFA 4M9QA 4HVCA 3U44B 1C8KA 1R6XA 4V24A 3AY0A 4U7GA 4GECA 2IYOA 3WGHA 4P22A 4KDCA 3C4JA 4DDUA 3AL0C 3EISA 4OA5A 4B3TB 2FRDC 1VG0B 2E0IA 4LOHA 4YMVA 4KAFA 5CJJA 2CXRA 4QBKA 1M2GA 5BWMA 1AHHA 4MH0R 4QASA 1QIEA 3GCDA 3QF4B 1C8BA 5IVKA 4FNOA 5B1DA 4HAIA 2GUWA 1NFQA 4EHLA 4ANFA 1VHWA 3H17A 2FX5A 1C1XB 3DMGA 1XMXA 1FFYA 3FPAA 1QFJA 1Z47A 3D3NA 3NFRA 5L8VA 4JLWA 4OLAA 4M49A 2ZAEB 4NULA 5I9IA 3AGPA 1USGA 4Y6QA 3IO3A 5EPUA 3MT8A 1IPHA 1AGNA 1O7JA 3BCRA 4URYR 1MAHA 1RCUA 1TB4A 3K0FB 4GA6A 3HGTA 5DCUA 3OQBA 2OZKA 2WPNA 2BFCA 1X1BA 1JQBA 1PGOA 3OP1A 3R7NA 3FCEA 3PFCA 1VQ91 1LGYA 4Q12A 3OZAA 1YR8A 2O2IA 4IO1A 4YN3A 1QP7A 3TEFA 2F3TA 3WGTA 5BQ5A 1P2GA 2VDVE 3NETA 3X2GA 1OHHD 3CPWZ 1SHTX 4FE3A 3T95A 2MTBA 3H0EA 4YDHB 3U4DA 1KIMA 4I6GA 3EIUA 4MR8A 3DL2A 1DXYA 3ZD7A 2G77B 2X76A 2NMVA 3CTMA 1VQ6Z 4I7EA 1QH1A 3UAGA 3K1ZA 4BQNA 2IVFA 1UWCA 3IXQA 4OUKX 3VV2A 3SE0A 1DCMA 1KQSZ 4MD8A 3O84A 4ZU6X 1JJVA 2I7VA 4LAFA 4DJFC 3NHSA 4X1YB 3B2NA 1BD3A 1KFKB 2HXSA 3THXA 2XB8A 2ZIVB 2QPLA 3PGVA 4Q4HB 3P9XA 3EMKA 3T6KA 2PZMA 1NONA 1VZ3A 1JWHC 2JD0A 2Q2NA 2PK7A 1BXGB 2VIIA 4P1ZA 5DIFA 2FP4B 1A1VA 1GUAA 4TYPA 2Q9CA 3DA8A 4YCSA 1F4PA 1XNJA 2VYNA 1D2MA 3H8WA 3OPYB 4KSBA 5E2AA 5KWVA 3I30X 4AUEA 2II6A 3C6YA 4HNTA 5IN4A 2ZT5A 1AZLA 2BH9A 2FCAA 4AD8A 2QHXA 4Q6BA 5F77A 1WMBA 2CWDA 4D96A 5BYJA 1H8EA 3T5PA 4RD2A 1K8A2 4QT0A 3SXJA 1R0XA 1UBLS 2PZ8A 3EY9A 5ISMA 1NT4A 3CH5A 3LQFA 3GT4A 1RFGE 2JCSA 3VYTB 4ECAA 1MH1A 4M1ZA 5U4QA 3VNQA 4X1IB 3CW9A 3N8KA 3A6KA 3RRZA 1WKBA 3KNZA 4CV3A 5LJLA 2YXLA 3UJHA 5IJXA 4IIGA 4HAWA 3GG9A 2Q3MA 3KYBA 4YJGA 4UZSA 1TWAA 2W2KB 3RS5A 5LU9A 3HWWA 3I53A 1XZEA 4LE2A 3LHIA 3N70A 2HZ7A 4EYOA 4JP8A 3IAM6 2A1IA 3DG9A 2BAGA 2EFGA 4U2FA 4DUYB 5CLGA 3ZGVA 2Q3CA 4F4FA 2C54A 4NCAA 2ZQYA 3ETJA 2XDYA 4OI1A 1AGPA 2W8BA 2YHAA 1E64A 3LQRA 1UWVA 2O2SA 2YIJA 4BIIA 1AE1A 3FHLA 3OG9A 5AK6A 3K9BA 2VQEB 4K28A 4QVIA 3FTEA 5GZ6A 3X2EA 4P0PB 4HADA 1NZJA 4DV3B 3AJDA 3H19A 2J3MA 2PJJA 1D9XA 5KOJA 3O7WA 1E5LA 1J8QA 1VE1A 2WJIA 1Z68A 4R5HA 1WX1A 2G08A 3ED1A 4UMEA 4DQ0A 5DCLA 5E0OA 1PJRA 3N6XA 1KY2A 4LTNA 4R68A 5CJ2A 4YRNA 1LCIA 1VLHA 4H16A 4AYWA 5FNVF 2VNHA 4DJDC 3BG0B 4P4NA 4Z53A 1V95A 1Q3HA 5A3VA 3STYA 4CGZA 3GCXA 4EI2A 1VC3B 2RHWA 4XX1A 4WV3A 1P9RA 3PQCA 1GRCA 1O5OA 1Z7EA 1UBMS 4M76B 2QTZA 1XQ6A 2WY2D 1T4GA 1XI2A 4G07A 4BB9A 1QPBA 3FNFA 1LWOA 2D5AA 1W19A 3H1TA 5JJCA 4Y9SA 5G53C 4WESA 1MOQA 4J4TA 3HOWI 1ORTA 2I5PO 2WU0A 2XADA 4NJEA 2DUMA 2ERCA 2PT9A 1V35A 4RF4A 2MT9A 1SVUA 3NEJA 3NUQA 3HCNA 5D3MA 1PWXA 2AG6A 1P7VA 4K9LA 4RDIA 5DEIA 3AONB 3PR2B 3HO6A 3BFJA 4JUFA 3LY5A 1WMFA 4YPOA 4BX0A 3KV1A 3MFQA 4NBFA 4NYMR 1KFBB 3EXHA 4OHZA 2V8OA 3OCYA 1D5CA 4HDCA 4YCAA 3T12A 4C1BA 2UXDB 2IOFK 3IUJA 4IHQA 4JELA 1MW9X 1RWQA 3OE4A 4RMNA 5LA6B 1CUCA 1Q1BA 3DHVA 3H3VJ 4L5BA 4HQOA 1QQAA 4GR5A 2P69A 1RJGA 4C05A 1P5JA 3MGAA 3EVAA 4I5GA 3ZCRA 1VQL1 3NTQA 3KIHA 2UZ1B 5DX8A 1R0RE 5A9SB 2YVQA 1A5ZA 2NVXA 1QGOA 4G5YA 3THYA 3KEMA 3S1AA 3CO0S 6ADHA 4FCCA 3KQUA 3FCXA 2WKWA 4A8PA 3FSRA 1N3IA 2H3EA 3KPWA 2QM8A 4XEHA 3ZD9A 4A8JA 2QN6A 3KOWA 3SE7A 3S5UA 3GTKI 3SMVA 5AT1A 1M1NB 1DV2A 4YB8A 4DV1B 4WFJA 1OPRA 2W4MA 1FTWA 2QW0X 1OY1A 3O93A 3W5HA 4L7QA 1PT9A 4MWTA 3VGPA 3VI3B 3BXXA 3K9HA 1V11A 3EUWA 3LSTA 3ZXUB 3T1TA 1Z8NA 5EKXA 3E70C 1XELA 4EG7A 1DRUA 1ULHA 2QP4A 3F96A 3ZQUA 1MX3A 3QEKA 1G55A 4PQGA 1TMYA 3DUFA 4E46A 3AVPA 1QE3A 1KZ4A 5IVIA 3KG2A 4DSUA 2G06A 2QSJA 2R1UA 1ZC4A 4R2JA 2HSZA 3HGMA 4Q00A 1XD2B 1JU4A 4I6EA 3KQHA 3ZDCA 5CFOA 1EK6A 1TYCA 2ZUTA 3GDWA 1SUFA 3CF4A 4N39A 3GLIA 1LPBB 2LEXA 2DUWA 1JDVA 1GKYA 1NNSA 2ODPA 3B1VA 4A93I 1R50A 1YVRA 2YTZA 3FKII 1NW4A 3E81A 5H81A 3UYLA 1LW6E 3KP1A 3H5IA 3Q2OA 4MHSA 3GNQA 2TSYB 3KX2A 3KHSA 4NEQA 2OO7A 1F38A 1AQ6A 4KPYA 2PXXA 3KXPA 3T9CA 1DKOA 4V2IA 5JNVA 1KNXA 2FG5A 2C5HA 3QE9Y 4LYJA 2V5VA 4ENWA 4TWAA 4X00A 2HRCA 5TRTA 1IIBA 3UOGA 3OOJA 3F6SA 4OGLA 2HMAA 5IJWA 3ROPA 1PG5A 3FPJA 1NXQA 4EG1A 3WA7A 3BK2A 1IEQA 4QUHA 1B73A 721PA 4S1WA 3I2FA 3C48A 3ES9A 1D8TA 2C7RA 1QIHA 1YR6A 5C8ZA 2P4SA 2VWPA 2GASA 3RFVA 3DDHA 1HE8B 3HJHA 1DXQA 4JI8B 1QZXA 4WCFB 2ZJ7A 3VJMA 1PUIA 2FPIB 4EW2A 3U13A 3UA3A 2E4XA 1G4AE 2NYVA 4JEHA 4N76A 3WWPA 4TV9B 3S81A 2HR1A 2XH8A 1N2HA 1PT6A 2ZVJA 5HKLA 2B7BA 1E1CA 2QL7A 3SIXA 2O50A 4XH9B 3DEIA 2VAMA 4ZKEA 3T7CA 3WLQA 4Q9DA 3UXMA 3D64A 2E82A 1VQ9Z 3GFPA 3CLRC 2PX6A 2Q8PA 1J5PA 1N2EA 5F5NA 3G2HA 5GVSA 3SYTA 5G1PA 2IDKA 4OU4A 5FFFA 3CWCA 3IFSA 1GUZA 2A35A 2A86A 5E7QA 1KEPA 3QG1A 4NK5A 5E2IA 1NW5A 1PDVA 4AULA 4MAMA 5EJ2A 5C80A 5FWYA 5KSYA 5JY1A 1WCXA 2GZ1A 4XQGA 3T3IA 4BVAA 3ODGA 1GPJA 3S70A 4MW4A 4D46A 5M2QA 3VR4H 3LP5A 3EK2A 3PBKA 3D6VA 4OCZA 3TLGA 3NJRA 2ECFA 4HGNA 5KNBA 1A3CA 1O6ZA 3EW7A 2FRXA 1IEVA 4CEJB 4FZ5A 2EWVA 4Z3KA 1JIUA 4WKPA 2IPMA 3U31A 5KBYA 1V5WA 3EZNA 1K92A 3KL4A 4J0EA 4JVNA 4XR4A 5BN4A 1XJWA 4KIFA 4LW8A 3L02A 3AB8A 4IS3A 3C7DB 2QRKA 1D07A 1Y8AA 3K8QA 3ZWWA 2ZJAA 2ZVPX 5BVGB 3THOA 1NL3A 4D7AA 1YCDA 2ZSJA 1Q84A 4MS4A 4B4DA 2IYPA 2R87A 3DPSA 3DE5X 4YMLA 5HOEA 3OMLA 2HDOA 3ZHZA 2R48A 5A7HA 4MICA 2AIRA 1KZ9A 5H02A 5DT9A 1DP4A 4AICA 3D7MA 3O03A 1JXAA 5LP6F 1G2IA 3ND8A 1HXHA 3FBWA 2NX2A 4HRYA 2DWQA 2JRCA 3LHDA 4JLAA 4KX3A 4EPXA 3LPCA 1OROA 1X74A 3ZR4B 4W8GA 2FDCA 1XP5A 1L0BA 1MUUA 2X7JA 2Q8NA 1OX5A 2Q4TA 5F98A 2J9YB 4FWTA 3EGDA 4UU0A 5K8UA 1V7CA 3WRYC 2O2JA 4M99A 3V8BA 4B43A 3EPHA 3Q88A 3U39A 1A72A 2ZE6A 4D3XA 1C30B 2RHBA 3I8OA 2ZRQA 4LSGA 2FHSA 3ZOZA 4BWYA 1E7RA 3E0QA 3FCAA 5LB4A 4XQEA 4KB5A 2NPFA 4KQKA 5GY7A 1XYGA 1ZD1A 3SYKA 1IYZA 1IWPB 1HC7A 1U0JA 1KE1A 5DBHX 4CQJA 3AG5A 2EG5A 4BNKA 1PZHA 1MP0A 3HL0A 4JEUA 3KTOA 4W5JA 4RGYA 1U94A 4FN4A 1ATIA 1DQNA 5CTAA 2NVYI 1MNQA 3SC2A 2ZJYA 1EUQA 4KODA 1FP1D 1LUAA 3NHWA 4ZVSA 4LFCB 4JC4A 1CJSA 3CME1 4FERA 1Z22A 2LR0A 1BWRA 4J3JA 1IOVA 2Q0QA 3WYFA 1OBCA 1NR5A 2BJWA 1CJTC 3FI9A 1F8GA 4MVXA 4QZVA 1QFXA 4ZCQA 4JI6B 5L7WA 4I36A 2K2WA 2P1RA 1DNPA 2F62A 2Z0MA 1KO5A 5GWXA 3SJZA 3RYFA 1EQAA 4BZZA 5K8TA 3KQNA 3VKUA 4GWGA 5IN5A 1ID8A 4G09A 5KWEA 5FCDA 2YY5A 5A04A 2QD1A 3Q3CA 4LOKA 3MWYW 4HTFA 4WLUA 4MR9A 1GKKA 4A2PA 1M902 4JL6A 2OVFA 1T3HA 2OCXA 2ERYA 4MKRA 3GLRA 4R4JA 4EPRA 4TVOA 1ZGAA 1F14A 2BFNA 2E4WA 1JQLB 3MERA 4RF3A 1C1YA 3TRKA 3DTYA 2P2LA 2RGBA 3EGXA 5C8VA 1Y6GA 2VHCA 2P9HA 3FNRA 4QU5A 1C4KA 2FEMA 3HA3A 3RVBA 4Q0MA 4BVBA 2HRBA 5LZ2A 2G1UA 2C59A 2WIJA 2PVPA 2ZS9A 4IIJA 3UGTA 3FOFC 1TLFA 2D2XA 3A3NA 3KYDB 3LOUA 4OJQA 5DWDA 4EZEA 4KQGA 2UU9B 1H6DA 5EHXA 2PL3A 4LY0A 2YNMA 2EP8A 4N7JA 4RV4A 4FEAA 4CL2A 1GGHA 2QYSA 2XQGA 3AIIA 3FM9A 2E9HA 1OA0A 4D97A 5ELXA 4AZTA 1UXOA 1DU4A 2QSUA 4MONA 1Q0TA 4MLCA 1SUWA 1L9KA 1HDZA 4LHZA 3C8HA 1MT3A 4D56A 2C7OA 2DKOA 4JBGA 4TLLB 5I9SA 1BW9A 5K3OA 4FHFA 3R7SA 4MA0A 3OFKA 3BZBA 1YA8A 1E77A 4BBJA 4X9XA 2CK3A 3IX7A 3L7DA 2ZM5A 4XZ3A 2AJLI 4FHDA 1L3IA 4MVJE 5KO2A 4X6LA 3BRQA 1EHIA 5TQ2B 5E3IA 3KPYA 1YK1A 3G1WA 4L50A 1SXJC 1ZY2A 2MDTA 5FNVB 5EKUA 3ROXA 1G21B 1RJ9B 3FVRA 1CF9A 3K70D 3USCS 4M1YA 3OIGA 4ZEWA 2W6ZA 1T9CA 3GJ6A 1EJBA 1M6EX 1Z08A 2DPHA 2NQ8A 3FCYA 4HB0A 4NENB 3W3AD 3PLXB 1BJTA 2PL1A 4P86A 4TKMA 3DMDA 4IV0A 3CGWA 4IOKA 1M1YB 2QI9F 1T2CA 3I04A 3UWSA 4EELA 2QVCA 1G8MA 3L9WA 4H15A 4L15A 3LTEA 4ND8A 4B7ZA 5BRJA 1E0SA 5JTUA 1T5BA 1RLUA 3UJNA 4OQZA 2JA7I 1XAJA 4XYMA 3W06A 5C46F 4QA9A 2DULA 1U9ZA 4HG2A 1JIKA 1UMBB 4G89A 4FS8A 2YHSA 4ZVOA 5K3FA 2RI0A 1J2YA 2P75A 1TQ8A 1NY6A 4IXTA 1QFZA 1ORWA 3MT7A 1P45A 2P65A 4BX9A 2HHHB 1W4BA 1NJI1 4AO8A 3HB0A 4NU6A 4R83A 3MPOA 4AWXA 4I0WB 2BFAA 3PHJA 3DO6A 2F55A 1U8FO 1GR1A 3ZLVA 3MBKA 5FWAA 4DQKA 4EPYA 1Z6YA 4X93A 4H0FA 2LZ0A 3KB6A 1CR0A 1GEGA 1NTOA 1PPYA 2J9RA 2VEOA 3L7OA 4KZKA 3FROA 1N36B 4YUWA 2VA9A 1ENOA 4EMUA 1JWBB 5IAGA 3WFIA 2GCOA 5HOQA 4XDGA 1PT8A 1X15A 3HYRA 4CCSA 1KQNA 4BNHA 1EFDN 1GZ7A 2GLXA 3AINA 3GTMI 2OD2A 1ZH1A 3DCIA 3OY2A 4IR7A 5J47A 1WMSA 4O2AF 5LZ5A 1TF7A 2PFSA 3BSSA 3CRW1 1NKVA 4A3JI 2WAMA 3OX3A 1RKXA 1TX4B 3HUFA 2OTJ1 1AV7A 5EGNA 1Z8FA 3TLEA 5KC9A 1YMVA 1LXCA 4P4TA 1FFHA 4TSRA 4L8GA 3RTAA 1BDIA 3DE3X 3IIEA 2QAGC 3EAGA 4M0CA 3H5TA 4C08A 1VQN1 1VHDA 3CMAZ 1DJPA 1XMJA 2OD9A 3CRZA 4HNAA 4W5QA 2VATA 5A9TA 4GPZA 3WWDA 2EBUA 2GJ9A 3HXPA 3IIMA 4PIMA 2HU8A 3R3XA 3TZHA 5B6IA 4IQGA 2OE2A 1MKYA 3C5VA 3DDUA 4RY2A 4GP6A 1FX0A 1NOIA 4IUYA 2IS1A 2QROA 1S3FA 2EDAA 1ZM4A 2WEKA 4B6PA 1E3EA 4GEGA 4N54A 3T5TA 3ENKA 2QRUA 3Q3IA 3ZDYB 2XUFA 1P4HA 5U4XA 4RY9A 3LBHA 5AI4A 4ZHSA 4DQXA 5JPCA 1SU7A 1ZGBA 1RXUA 1VKHA 1I6WA 5JYEA 1ULSA 1KEEB 2Q41A 1M7HA 3ENNA 3C4VA 4NNOA 5CVEA 2QYTA 1OF1A 5H59A 3ILXA 2DWOA 1JLLA 2GGSA 2RARA 4P0QB 5HVNA 2CHUA 2MWMA 4FYXA 3V6MA 4OBXA 1CQJB 3E6AA 2GPYA 5ARDA 3VHQA 4IYJA 1PVDA 1T3ZA 2BSQA 3WDMA 3DE6X 4LGYA 4RA6B 1V3QE 4KQCA 3QITA 4PLFA 5F64A 3FSGD 2ZRLA 4I3GA 2E5WA 1HMYA 3F6BX 2JPDA 4CEHA 1QFSA 1B00A 1JS1X 3BB4A 3AF4A 5I9BA 3VR2A 3Q1KA 3MTJA 5D86A 3IAHA 1NJSA 2GPTA 4OJKA 3CWQA 1G7TA 4ZCRA 3K9QO 5EMLA 1C50A 2JL1A 2X5NA 4DMHA 4F4IA 3GMTA 2UXBB 5ECDA 3X2HA 1YS1X 3NDIA 2BONA 4YIKA 2HV8A 2FMFA 5HF8A 1FYWA 1NF2A 3RSSA 3ZZNA 1M9NA 2WK1A 5BWCA 2CDCA 1EBBA 1P7YA 5HZHA 3NHLA 3L5OA 4KO4S 4JB8A 4R3WA 4ZJZA 2GFHA 2OWDA 3QEMA 4EFNA 4LUCA 4LXQA 4NQRA 1BMDA 3VNBA 4ARCA 3MIZA 1HYEA 3AZQA 1NOJA 4PWZA 3SJAA 4DADA 5CA0F 5AVYA 1I3QI 2XAAA 3V7FA 4EY5A 5B7QA 4C1NA 4CIXA 4FYJA 4P98A 2QA41 1A88A 1GV1A 5A4MS 1MNAA 2GM9A 5GONA 5HSGA 2PNFA 4TTAA 4CCYB 1E32A 2IYAA 2AB0A 2JANA 1DRVA 1ZXBA 2ZRGA 3DKRA 4CM8A 4PV7A 1B7GO 1DQYA 3H42B 2PUBA 4CEIA 2E7ZA 1S4MA 2V6JA 3O4JA 3BIOA 2A69D 1NVWQ 3DKKA 2G1KA 3N7TA 4FC7A 1WPQA 2GPSA 3CPHA 5H68A 5KC8A 2I3ZA 1V96A 4OH1A 1KC81 1XVTA 2AOXA 2UVQA 4JITA 4KACA 2IGBA 4WWHA 3RNOA 1YHYA 4DCGA 2ANCA 5JADA 2VP3A 4UUMA 1K9M2 1HEUA 1P3DA 2X5KO 3VZCA 4I5FA 1AVTA 3J80b 3ASUA 1BU8A 3OEHA 3GEGA 1YQGA 3CMEZ 3CEJA 4AI6A 4H0CA 2NXNA 2HU2A 3Q3EA 4EJ2A 1G98A 4OEHA 4RGVA 4RZ3A 4E1AA 3BREA 1EFVA 1SA0A 2IY8A 4YJDA 1PZFA 3GVXA 4NSNA 4TT3A 4ETIA 1Z3IX 3U16A 4MCAA 3AEKB 2YICA 5BUZA 3EZXA 5E38A 2C9CA 4U8GA 3A06A 3SSMA 2QRNA 3HEBA 2XMGA 5LP6B 5KVVA 3OIUA 4GWKA 3RBZA 2G9ZA 1P4GA 1F1JA 2Z6AA 1UT8A 4Y2RA 2F17A 3TINA 1E7WA 5I5GA 4MV6A 2XD4A 3TRDA 1GV0A 1X94A 3WKCA 5JUWA 3M9XA 2PZGA 2FW0A 3SQXA 5J3JA 5AN9F 1QG0A 2YFQA 2CVHA 2VCHA 2GESA 5AR1A 4DZZA 2WD7A 3AL3A 4F7WA 2VF2A 2XA9A 4LHSA 4YQFA 5AVQA 1L5FA 3QVGA 1DSSG 4TN1A 4DKJA 1TI7A 1HFJA 1Q1ZA 1VMIA 2WC1A 5L3ZA 3WL8A 3X2MA 4AZDA 2R6HA 5E6SA 1GJRA 1RDFA 3ILHA 3SFTA 1CUSA 5CA1F 1L7BA 2JIZD 3LUDA 3PZRA 1JA1A 1S5PA 4EUSA 3PLRA 4IM7A 2J3HA 2QPTA 3T38A 1FLAA 4TLDA 4I4TA 2N42A 3QVUA 4H7EA 4I9HA 1BKDR 3Q7EA 4D42A 5KTKA 3OW2Y 1QHSA 1XQYA 4PYLA 2C29D 1ETHA 3NW9A 4ALJA 1OPXA 1ZI9A 3SJUA 4D3FA 4FSXA 4RCVA 1O9HA 1QU3A 1M6VB 5FWXB 2HA6A 3ZU2A 1KMCA 1FNBA 1KZYC 1W5AA 1RR6A 3EHEA 3MAAC 3W7VA 4QKQA 4X66B 4D99A 1SAYA 1Y4DE 3UMFA 4G41A 1TT5A 4DR5B 3MJRA 4G9BA 2FSUA 2GBIA 4Q3BA 5LQAA 3VQTA 2VTBB 3QUTA 3F97A 3GRVA 3MB5A 1ZW1A 1P7ZA 4JHLA 1UDCA 3R5SA 4OQEA 3O8CA 1ZKMA 4HNQA 1JDBC 1S3GA 3N2KA 3H5VA 3UOWA 3VR2D 4EEZA 2IV3A 3G82C 3OCJA 4W7HA 5BWNA 1X7ZB 1XB2A 3CZ4A 2IF0A 2Q5OA 4FXOA 4TSFD 2VDJA 3EEDA 4LK2A 4XIFA 3HFJA 1EEXB 1NBMA 8LDHA 4G4SP 3OFSA 3Q0IA 3DE0X 3H87A 1JJ7A 2B69A 5NLLA 4D79A 5TXGA 3LBYA 1NMYA 2UUOA 4ZAWA 3WGKA 2J5RA 4URZR 1JEYB 5C53B 3WZLA 3KHKA 4PX9A 9LDBA 1T6XA 4ER7A 2PI8A 4OF4A 2WVGA 2YHUA 2JA5A 1ZR4A 2WUGA 3DMHA 5BUSA 3V9AA 3F7OA 3LC2O 4LRYA 5IS2A 1Y7LA 3LPNA 4K6MA 1W2BZ 3QKWA 1C3EA 1ZNWA 2NSDA 3ODPA 3PUJA 4OPMA 4TUYA 4BO9A 2YWXA 1XPJA 1I9GA 3HUTA 1E3SA 1AHNA 3GFGA 2B98A 2QMEA 3LF2A 1ZGCA 1SVKA 2OHFA 2WIDA 3OD1A 1G17A 2ZTLA 4F11A 2ZTUA 4PHGA 3TLJA 3TXXA 2ATIA 1TVKB 2HBZA 3ZXIA 4FDVA 2XMZA 4ND2A 1EINA 2VZLA 1K7XB 4N40A 4A6PA 1T1GA 3B9QA 4MPDA 1RXYA 4F6LA 1A77A 4NCHA 2CNLA 1TAHA 1EGAA 2RAUA 4LI0A 5C7IO 3AHHA 2JLBA 4UBNA 4L95C 1QVWA 2QN9A 5LOVA 3URMA 1WDTA 1DTWB 4KFUA 4YDRA 1G7CA 1GPH1 3HMKA 4HATA 3OO1A 2AUNA 1T5IA 4F1KA 2CJXA 1UFRA 1HG0A 1F8YA 3ETHA 1TFUA 3EXHC 1Q83A 4JVLA 1XT6A 3CRQA 5GJBA 4CQLB 2AJ8A 3TR6A 2CXTA 3Q5EA 5FYDA 1GNLA 1HFWA 2FN4A 2VJQA 1B8OA 3HDHA 3MWGA 3PNBA 1BEUB 3E5HA 3B38A 1KJIA 2LNDA 3LT2A 4LQ4A 1FQJA 3WLSA 1VIYA 1P0CA 1RLMA 4KQ2A 2G7MC 1D2HA 1MABA 1PJ4A 2I4IA 1Z4NA 1UOPA 5IRCD 4C0AC 2AD1A 2FN8A 2GXUA 1W4RA 4QUAA 4XB1A 3PSAA 4J2OA 3F3PC 1VQNZ 1ZJJA 4B3CA 5K7SA 2KI8A 5FBZA 4CJXA 2B9EA 1MFPA 4C0WA 2D4HA 1THTA 1U5AA 2AXQA 2QTMA 2C7QA 2A5FA 4RFSB 5KYXA 4Q48A 4RF5A 2WAQA 4ZVNA 2ZJ3A 4PGGA 5G4KB 5M29A 3OQOA 4JP2A 1AXEA 4IFEA 4CDRA 1L8AA 3OT5A 4A8JC 3WGGA 1VQ71 1YNJD 4IQFA 3NBFA 2NVWA 2ZU0C 3KJGA 3TZKA 1WB4A 5F52A 1J49A 3CRVA 3DDWA 4BLPA 1O5IA 5LN1A 2EJCA 1Y34E 4FBLA 4MVCA 2ZYGA 4ZOCA 3ZHRA 2ZUEA 3GZ4A 3MLBA 3ACDA 3U49A 3D81A 1IZ7A 5BP7A 3IL2A 1JSRA 4KAJA 2HJWA 1L1FA 2C99A 4Y7CA 3GTPA 2X40A 3O83A 1NVVQ 3ZI7A 1QVRA 4WJZA 3IPAA 2OSVA 5K4AA 2WF7A 2VSXA 3I4MI 2WHQA 4Q01A 4RWEA 4HRVA 4ML3A 3BKWA 2F43A 3RS4A 2Z09A 1KP2A 2GN2A 2K3RA 2UUCB 5E8RA 4O2AB 1USPA 4JI1B 1K2WA 5CNIA 1A8IA 4IIDA 2GNPA 4TPKA 1LDBA 4JB3A 3MWKA 4BKRA 2IPAB 2R5FA 2XUOA 4ALNA 3PQEA 4BNVA 1LH0A 3W78A 5HKKA 4BNTA 3OSZA 4AMZA 5JLJA 4BE4A 4M0DA 2C8VA 5I8WA 1NV9A 1GA1A 2CVPA 4L9RA 4L57A 1PV2A 1XZKA 4B3HA 4WEOA 5JPDA 1QH9A 3QF7A 4FKBA 3LZ6A 5L53A 1SC4A 4RNCA 3PUXA 2HK8A 2QDXA 4G63A 4TV8A 1ECBA 8MHTA 1GUDA 3I55Z 5K99A 2O2XA 1TZBA 2Q6KA 5B2ZA 3CR8A 1MORA 4FNGA 1OZAA 1CZNA 1LJ8A 3FSJX 1CNMA 1IU9A 3G2JA 1W94A 2C2HA 4LX8A 3CQZA 4KLNA 1Z28A 2GDZA 2OCLA 4J0GA 3UCFA 4ID3A 4MIEA 4DNQA 2IQ5A 5JRDS 2JGDA 4AX8A 4DLAA 2X0IA 2QMQA 3SLGA 4MWCA 1SIWA 1Q822 4U7JA 1TZK