1AAMA

The structural basis for the altered substrate specificity of the r292d active site mutant of aspartate aminotransferase from e. coli
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIDANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the altered substrate specificity of the R292D active site mutant of aspartate aminotransferase from E. coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Aminotransferase
molecule keywords ASPARTATE AMINOTRANSFERASE
total genus 69
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1993-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1aamA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1aamA01
3JWAA 1KKJA 3DXWA 4F5KA 3W1IA 2JJGA 4A6RA 3DR7A 2VYCA 2W8UA 4XK1A 2VMRA 1DTYA 2Z9XA 2W8VA 4XJOA 2OGAA 3GSBA 4J8LA 2DOUA 3QN6A 4HF8A 5BJ3A 2CJHA 1W7NA 4J5UA 5DX5A 2DGMA 2HUIA 1PG8A 3A9ZA 4AZJA 1YJSA 2YCTA 2AY7A 2DGKA 3FKDA 3BC8A 3EI9A 3Q8NA 4UHOA 2Z1ZA 3FSLA 2C44A 2Z1YA 1OHWA 4ZWMA 1D7RA 5JAYA 1BKGA 1IJIA 1DJUA 2ZSLA 4MKJA 3ZRRA 2R2NA 1ECXA 4WXBA 1GC0A 4P3MA 1AJSB 2OKKA 3DZZA 4IW7A 2AY2A 2BKWA 1AAWA 1UU0A 3NUIA 3AELA 1C0NA 1I43A 1FC4A 2ZYJA 2CSTA 3ELPA 2E7JA 1MDZA 1WYUA 4WLJA 4B9BA 3TFUA 1SZKA 2HOYA 3ZZKA 4ZAHA 2GSAA 4PFFA 3KGXA 1TATA 2PO3A 2Z9UA 3FVSA 3HBXA 4RJYA 4KXKA 2VMTA 3WKRA 2C7TA 2FYFA 1FG3A 2WK7A 1IX7A 4F5GA 3LVMA 2ZY5A 1M6SA 2VIAA 3CBFA 3AOWA 4A6TA 2ZP7A 1C7OA 1ARHA 1M0OA 4W8IA 2QLRA 3NU8A 4IY7A 4A72A 2OKJA 2W7DA 3RI6A 4A0GA 2E7IA 3A2BA 4EFFA 3AEPA 3B46A 3WCNA 3BS8A 2Q7WA 2BWOA 3EIAA 1PFFA 5G4JA 1YJZA 3B1EA 4OBVA 2JJHA 5FT4A 4OBUA 3AENB 4R2NA 4F5JA 2CFBA 1CL2A 2EZ2A 4XJMA 1RVUA 1AHGA 4LW4A 3A9XA 5F8VA 1SPAA 3WGCA 2EPJA 4A0RA 4FL0A 3B1CA 2W7HA 2QA3A 2WKAA 1BW0A 2QB3A 5FT8A 3WGBA 1IX8A 1E5FA 5EUEA 2GMSA 1DFOA 3W1HA 1YNUA 5D95A 1WKHA 2CTZA 2D64A 4MQQA 5EUNA 1E5EA 1ASLA 4ZSYA 1TOGA 4MY5A 5G2PA 4E3QA 3GZDC 4BA5A 1AY5A 5M4BA 1LC5A 3FFHA 4PFNA 5TF5A 1U08A 3NNKA 4IX8A 1TOJA 1D2FA 1IAYA 2VIBA 2VMWA 3E2ZA 5F9SA 3FQ7A 3VK2A 2D63A 3TATA 1N8PA 3EI8A 3IHJA 5EAVA 4WYFA 5G4IA 1OXPA 5G2QA 5DJ1A 3I5TA 2FNIA 2FN6A 1GCKA 4W5KA 1YJYA 1WYUB 3K7YA 1ASEA 1V72A 3PDBB 7AATA 2VMXA 4RAEA 2X3LA 4ZSWA 3QI6A 3QPGA 3DODA 5DJ9A 3BN1A 1D7UA 3LG0A 2AY6A 4JF1A 1AKBA 1AMQA 3FVUA 4XAUA 1OHYA 2JGTA 2BI2A 3G8MA 1I29A 4KYOA 1V2FA 3VAXA 5E4ZA 1JS3A 3NDNA 4K2BA 2TPLA 4W1WA 4N0WA 2VMYA 1M7YA 1C7GA 2XH1A 5G0AA 4HVKA 2ZY3A 4M2JA 2W7JA 1C7NA 1TOEA 1VEFA 3TCMA 4EMYA 4TN4A 1LKCA 3QGUA 4ZLVA 2VGWA 3FCRA 3GWPA 3FQ8A 4Q76A 1ZODA 1M0QA 1B5PA 3NYTA 5HXXA 1AMAA 2OGEA 4EB5A 4LNLA 5M4DA 1MLYA 2CB1A 2BYJA 2ZUKA 1W23A 3E9KA 1B9IA 1ZC9A 1LW4A 4RJ0A 1GD9A 2OQXA 2W8JA 1AJRA 2JJFA 2BYLA 2OATA 4CXRA 4A0HA 2AY4A 3NRAA 2W8WA 1AHFA 1ASNA 1ARTA 1LW5A 2YKYA 1ASMA 3B1DA 3BB8A 5C6UA 1J04A 1CQ7A 2YCNA 2R0TA 3NU7A 4WBTA 4U2HA 1EJIA 4ZDPA 4MQPA 3H14A 2ZJGA 4XJPA 3P6KA 2W7MA 2FQ6A 4O6ZA 3EI7A 3ASBA 3WY7A 4ADDA 3COGA 3ELEA 3WKSA 2CY8A 3ECDA 2VMZA 5G09A 3HMUA 1BJNA 4ISYA 2AY3A 2CH2A 2O0RA 2XBNA 3OKSA 1SVVA 4W91A 4ZWVA 3HT4A 3G7QA 3E2ZB 4K2IA 2JJEA 1ELQA 3PIUA 1MGVA 1QJ3A 3BCAA 4WB0A 4WLHA 4BMKA 4M2KA 2D5YA 1PMOA 2VMSA 3AEJC 3WX9A 4IYOA 1JG8A 3HDOA 3WCOA 2X5DA 5I92A 2D66A 3RUYA 1CZCA 2GB3A 3MC6A 2O7CA 1G7XA 1VP4A 4DGTA 1ASBA 4F5LA 4CBRA 1AKCA 4RM1A 4ATPA 1TOKA 4RKCA 5K8BA 1CQ8A 3IF2A 3FZ7A 4WYDA 4JF0A 1MDXA 2BI5A 1ASGA 4A6UA 4EB7A 1S07A 2W7GA 3N0LA 4OYTA 3CQ6A 5M49A 2AEUA 4JEZA 1S0AA 1AJSA 2YHKA 3FZ8A 3JTXA 1KKPA 3LVLB 4ITGA 1LC7A 3KKIA 3MAUA 1RVYA 1YAAA 3P1TA 1KL2A 3JWBA 3TQXA 3MKJA 4XQ2A 4LW2A 5HHYA 4IXZA 3DU4A 1C4KA 1EQBA 1UU1A 2VGVA 5AX8A 1Z7DA 3CQ5A 3FZ6A 3GJUA 3AEJA 4A0FA 4ATQA 1O61A 3FTBA 1AY8A 4WYAA 1XI9A 1T3IA 2DR1A 3FRKA 4DQ6A 3ZZJA 1JS6A 3USFA 1ASDA 4XJLA 3DYDA 3K28A 2HZPA 4TMRA 1BQDA 1YIZA 3D6KA 1BQAA 2VMUA 1C9CA 1V2DA 2BHXA 1AX4A 1B4XA 1H0CA 1QJ5A 3MBBA 1LS3A 3AOVA 4F5FA 2CJDA 4EU1A 5BJ4A 3KGWA 1AMRA 1CL1A 2VLFA 1DJEA 3GBXA 2W7IA 2V0YA 2NMPA 1W7MA 4GE4A 1N31A 4WD2A 4LC3A 1DGEA 4BA4A 5EIGB 2QMAA 3BCBA 1TASA 1SF2A 3CAIA 2VLHA 4PIWA 1OHVA 4JE5A 4W1XA 1H1CA 3AV7A 1S06A 2CH1A 3PPLA 4F5HA 4NOGA 2BWPA 3VOMA 4R5FA 4UOYA 4GE7A 3EZSA 1M4NA 4GSAA 3NYUA 1GEXA 2R5CA 3FDBA 3N75A 3JZLA 2PB2A 4E1OA 1KMKA 1RV3A 1J32A 3PD6B 2CANA 4BHDA 5E5IA 5EUDA 4BQ0A 5EAAA 3F0HA 3PA9A 4AOAA 2ZY2A 2HORA 3EI6A 4K2MA 3E2FA 2HOXA 4U1TA 1BT4A 4ZDOA 3PD6A 3AEMA 3DC1A 1YIYA 3F9TA 3BCXA 4LNMA 4R5ZA 1X28A 4Q31A 4RKDA 1EG5A 3AEOA 1S09A 2YKVA 5LH9A 2W7KA 1M0PA 1QGNA 1WYVB 4I8AA 4UHNA 4WXGA 1N2TA 1O69A 4W1VA 4GE9A 2GMUA 1CS1A 2BI9A 1AIAA 1SZSA 2HP2A 3JW9A 4Y0DA 5IWQA 2Z67A 3AATA 3HL2A 4LNJA 4B98A 1AMSA 1MAPA 2G6WA 4AO9A 4AO4A 3FVXA 1QITA 3NTJA 3ZRQA 2AY1A 4QGRA 2BI3A 1G4XA 3ZRPA 3VK3A 1BJOB 1RV4A 1WYTA 4IYOB 3GZDA 1AHYA 3LY1A 5EQCA 2YKXA 2Z9WA 2BI1A 3MAFB 1XEYA 2C81A 2HUFA 2R5CB 3B8XA 1AIBA 2F8JA 2YKUA 5J8QA 3L8AA 4ZM3A 2VGUA 2BIAA 2JISA 3MAFA 4F5IA 2W8TA 1QZ9A 2FNUA 2YRRA 4E3RA 4OCAA 3FD0A 1UU2A 5LHAA 3ACZA 3QHXA 3QBOA 3E6GA 4N0BA 3BWOA 1FG7A 3KE3A 1GDEA 3LVKA 4WYCA 3BWNC 1GEWA 3DRDA 3NUBA 1O4SA 1DGDA 4UQVA 1AAMA 1ASAA 3E2YA 1Y4IA 4IXSA 1UKJA 1MAQA 1SFFA 2DGLA 3I4JA 2HOZA 3RCHA 3VP6A 2O1BA 2VMPA 3MC6C 4CXQA 1TOIA 3EIBA 3EUCA 3RQ1A 2VMVA 1SZUA 1W3UA 1QISA 2EH6A 3RBFA 1OXOA 3ATHA 3H7FA 4WB0B 2WK8A 3UE8A 4ADCA 1KMJA 4IXOA 3NYSA 2E54A 1KL1A 3FDDA 4ITXA 3WLXA 1M32A 1ELUA 3A8UX 2VMQA 4GEBA 1CZEA 2W7FA 4WXFA 3A9YA 4JEWA 1ZOBA 2HP1A 1ORDA 3K40A 1BJ4A 1I48A 2CINA 1BJOA 1G4VA 1WYTB 1D7SA 2R5EA 3DXVA 4A00A 3MADA 3W1JA 2VGZA 4RITA 4L0OA 1LK9A 2PB0A 2Z20A 2AATA 2DKJA 4Y0IA 2DKBA 4M2MA 2VGSA 2EGYA 1MLZA 3LVJA 1X29A 2ZC0A 3PAAA 4OC9A 3FQAA 1P3WA 1ASFA 2VGTA 2EZ1A 1Z3ZA 1X2AA 3GZCA 2W7EA 1TPLA 3PJ0A 2BIEA 3F6TA 4OTLA 2VMNA 3UAKA 2C0RA 2X8UA 3R9AA 3MEBA 3E77A 3ISLA 3EI5A 4MSOA 4P7YA 4E77A 1AY4A 3R4TA 4OT8A 4ADEA 3ASAA 8AATA 2HUUA 2AY9A 5FT5A 4JEVA 1AHEA 5DB5A 1GC3A 3GR9A 2Z9VA 4F4EA 2AY5A 2D7YA 3I16A 3JU7A 4Q75A 1G7WA 5HDMA 1BS0A 4GDYA 5D5SA 4F5MA 3HQTA 2AY8A 4FFCA 1X0MA 4MQRA 5FT6A 4CVQA 1ARSA 3HVYA 3VK4A 2FM1A 4H51A 2QB2A 4CBSA 1GEYA 1V2EA 5EIGA 1B9HA 1GC2A 4MGRA 2BWNA 1CJ0A 2VI9A 1GBNA 3EZ1A 4RIZA 4Y0HA 2D7ZA 1IUGA 1CQ6A 3PGYA 3RBLA 1B8GA 2YCPA 2E7UA 9AATA 1TARA 4MKKA 4WYEA 3M5UA 2VI8A 1OATA 2JG2A 3GETA 1PMMA 2EO5A 4PVFA 3UWCA 3II0A 1S08A 4JEYA 1WSTA 4AZKA 1I41A 4RLGA 3NX3A 3LWSA 2BIGA 3T32A 3LV2A 1DKAA 4ZDLA 1AICA 3HLMA 1DJ9A 1QIRA 4TV7A 2AEVA 4XEWA 2CJGA 2V1PA 1GC4A 3BWNA 2VMOA 2X5FA 1B5OA 1M0NA 2YRIA 4JE5D 2WK9A 1LC8A 3CQ4A 2ZSMA 4KAMA 4ZASA 2RFVA 1AKAA 1ASCA 1YOOA 5M46A 2D61A 1WYVA 1VJOA 2Z61A 3N5MA 4WP0A 4DBCA 1IX6A 1O62A 1WKGA 1ARGA 4ADBA 2ZY4A 4OMAA 1AHXA 1IVRA 3FFRA 3PDXA 1ARIA 2QBTA 5EFSA 2YOBA 1BJWA 3WZFA 4JEXA 4R8DA 3QM2A 4WYGA 4GRXA 1MDOA 3BV0A 3RCHB 3TFTA 4Q6RA 2D65A 3L44A 2W7LA 2GQNA 3AENA 1JF9A 4AH3A 3AEMC 4ZM4A 5E3KA 1D7VA 1IAXA 1W7LA 2ORDA 3OP7A 3PDBA 3G0TA 1IBJA 4UHMA 3DR4A
chains in the Genus database with same CATH superfamily
3JWAA 1KKJA 3DXWA 4F5KA 3W1IA 2JJGA 4A6RA 3DR7A 2G7JA 2VYCA 2W8UA 4XK1A 2VMRA 1DTYA 2Z9XA 2W8VA 4XJOA 3N4RA 2OGAA 3GSBA 4J8LA 2DOUA 3QN6A 4HF8A 5BJ3A 2CJHA 1W7NA 4J5UA 5DX5A 2DGMA 2HUIA 1PG8A 3A9ZA 4AZJA 1YJSA 2YCTA 2AY7A 2DGKA 3FKDA 3BC8A 3EI9A 3Q8NA 4UHOA 2Z1ZA 3FSLA 2C44A 2Z1YA 1OHWA 4ZWMA 1D7RA 5JAYA 1BKGA 1IJIA 1DJUA 2ZSLA 4MKJA 3ZRRA 2R2NA 1ECXA 4WXBA 1GC0A 4P3MA 1AJSB 2OKKA 3DZZA 4IW7A 2AY2A 2BKWA 1AAWA 1UU0A 3NUIA 3AELA 1C0NA 1I43A 1FC4A 2ZYJA 2CSTA 3ELPA 2E7JA 1MDZA 1WYUA 4WLJA 4B9BA 3TFUA 1SZKA 2HOYA 3ZZKA 4ZAHA 2GSAA 4PFFA 3KGXA 1TATA 2PO3A 2Z9UA 3FVSA 3HBXA 4RJYA 4KXKA 2VMTA 3WKRA 2C7TA 2FYFA 1FG3A 2WK7A 1IX7A 4F5GA 3LVMA 2ZY5A 1M6SA 2VIAA 3CBFA 3AOWA 4A6TA 2ZP7A 1C7OA 1ARHA 1M0OA 4W8IA 2QLRA 3NU8A 4IY7A 4A72A 2OKJA 2W7DA 3RI6A 4A0GA 2E7IA 3A2BA 4EFFA 3AEPA 3B46A 3WCNA 3BS8A 2Q7WA 2BWOA 3EIAA 1PFFA 5G4JA 1YJZA 3B1EA 4OBVA 2JJHA 5FT4A 4OBUA 3AENB 4R2NA 4F5JA 2CFBA 1CL2A 2EZ2A 4XJMA 1RVUA 1AHGA 4LW4A 3A9XA 5F8VA 1SPAA 3WGCA 2EYQA 2EPJA 4A0RA 4FL0A 3B1CA 2W7HA 2QA3A 2WKAA 1BW0A 2QB3A 5FT8A 3WGBA 1IX8A 1E5FA 5EUEA 2GMSA 1DFOA 3W1HA 1YNUA 5D95A 1WKHA 2CTZA 2D64A 4MQQA 5EUNA 1E5EA 1ASLA 4ZSYA 1TOGA 4MY5A 5G2PA 4E3QA 3GZDC 4BA5A 1AY5A 5M4BA 1LC5A 3FFHA 4PFNA 5TF5A 1U08A 3NNKA 4IX8A 1TOJA 1D2FA 3H9XA 1IAYA 2VIBA 2VMWA 3E2ZA 5F9SA 3FQ7A 3VK2A 2D63A 3TATA 1N8PA 3EI8A 3IHJA 5EAVA 4WYFA 5G4IA 1OXPA 5G2QA 5DJ1A 3I5TA 2FNIA 2FN6A 1GCKA 4W5KA 1YJYA 1WYUB 3K7YA 1ASEA 1V72A 3PDBB 7AATA 2VMXA 4RAEA 2X3LA 4ZSWA 3QI6A 3QPGA 3DODA 5DJ9A 3BN1A 1D7UA 3LG0A 2AY6A 4JF1A 1AKBA 1AMQA 3FVUA 4XAUA 1OHYA 2JGTA 2BI2A 3G8MA 1I29A 4KYOA 1V2FA 3VAXA 5E4ZA 1JS3A 3NDNA 4K2BA 2TPLA 4W1WA 4N0WA 2VMYA 1M7YA 1C7GA 2XH1A 5G0AA 4HVKA 2ZY3A 4M2JA 2W7JA 1C7NA 1TOEA 1VEFA 3TCMA 4K05A 4EMYA 4TN4A 1LKCA 3QGUA 4ZLVA 2VGWA 3FCRA 3GWPA 3FQ8A 4Q76A 1ZODA 1M0QA 1B5PA 3NYTA 5HXXA 1AMAA 2OGEA 4EB5A 4LNLA 5M4DA 1MLYA 2CB1A 2BYJA 2ZUKA 1W23A 3E9KA 1B9IA 1ZC9A 1LW4A 4RJ0A 1GD9A 2OQXA 2W8JA 2WB6A 1AJRA 2JJFA 2BYLA 2OATA 4CXRA 4A0HA 2AY4A 3NRAA 2QSRA 2W8WA 1AHFA 1ASNA 1ARTA 1LW5A 2YKYA 1ASMA 3B1DA 3BB8A 5C6UA 1J04A 1CQ7A 2YCNA 2R0TA 3NU7A 4WBTA 4U2HA 1EJIA 4ZDPA 4MQPA 3H14A 2ZJGA 4XJPA 3P6KA 2W7MA 2FQ6A 4O6ZA 3EI7A 3ASBA 3WY7A 4ADDA 3COGA 3ELEA 3WKSA 2CY8A 3ECDA 2VMZA 5G09A 3HMUA 1BJNA 4ISYA 2AY3A 2CH2A 2O0RA 2XBNA 3OKSA 1SVVA 4W91A 4ZWVA 3HT4A 3G7QA 3E2ZB 4K2IA 2JJEA 1ELQA 3PIUA 1MGVA 1QJ3A 3BCAA 4WB0A 4WLHA 4BMKA 4M2KA 2D5YA 1PMOA 2VMSA 3AEJC 3WX9A 4IYOA 1JG8A 3HDOA 3WCOA 2X5DA 5I92A 2D66A 3RUYA 1CZCA 2GB3A 3MC6A 2O7CA 1G7XA 1VP4A 4DGTA 1ASBA 4F5LA 4CBRA 1AKCA 4RM1A 4ATPA 1TOKA 4RKCA 5K8BA 1CQ8A 3IF2A 3FZ7A 4WYDA 4JF0A 1MDXA 2BI5A 1ASGA 4A6UA 4EB7A 1S07A 2W7GA 3N0LA 4OYTA 3CQ6A 5M49A 2AEUA 4JEZA 1S0AA 1AJSA 2YHKA 3FZ8A 3JTXA 4H63Q 1KKPA 3LVLB 4ITGA 1LC7A 3KKIA 3MAUA 1RVYA 1YAAA 3P1TA 1KL2A 3JWBA 3TQXA 3MKJA 4XQ2A 4LW2A 5HHYA 4IXZA 3DU4A 1C4KA 1EQBA 1UU1A 2VGVA 5AX8A 1Z7DA 3CQ5A 3FZ6A 3GJUA 3AEJA 4A0FA 4ATQA 1O61A 3FTBA 1AY8A 4WYAA 1XI9A 1T3IA 2DR1A 3FRKA 4DQ6A 3ZZJA 1JS6A 3USFA 1ASDA 4XJLA 3DYDA 3K28A 2HZPA 4TMRA 1BQDA 1YIZA 3D6KA 1BQAA 2VMUA 1C9CA 1V2DA 2BHXA 1AX4A 1B4XA 1H0CA 1QJ5A 3MBBA 1LS3A 3AOVA 4F5FA 2CJDA 4EU1A 5BJ4A 3KGWA 1AMRA 1CL1A 2VLFA 1DJEA 3GBXA 2W7IA 2V0YA 2NMPA 1W7MA 4GE4A 1N31A 4WD2A 4LC3A 1DGEA 4BA4A 5EIGB 2QMAA 3BCBA 1TASA 1SF2A 3CAIA 2VLHA 4PIWA 1OHVA 4JE5A 4W1XA 1H1CA 3AV7A 1S06A 2CH1A 3PPLA 4F5HA 4NOGA 2BWPA 3VOMA 4R5FA 4UOYA 4GE7A 3EZSA 1M4NA 4GSAA 3NYUA 1GEXA 2R5CA 3FDBA 3N75A 3JZLA 2PB2A 4E1OA 1KMKA 1RV3A 1J32A 3PD6B 2CANA 4BHDA 5E5IA 5EUDA 4BQ0A 5EAAA 3F0HA 3PA9A 4AOAA 2ZY2A 2HORA 3EI6A 4K2MA 3E2FA 2HOXA 4U1TA 1BT4A 4ZDOA 3PD6A 3AEMA 3DC1A 1YIYA 3F9TA 3BCXA 4LNMA 4R5ZA 1X28A 4Q31A 4RKDA 1EG5A 3N4XA 3AEOA 1S09A 2YKVA 5LH9A 2W7KA 1M0PA 1QGNA 1WYVB 4I8AA 4UHNA 4WXGA 3N7NA 1N2TA 1O69A 4W1VA 4GE9A 2GMUA 1CS1A 2BI9A 1AIAA 1SZSA 2HP2A 3JW9A 4Y0DA 5IWQA 2Z67A 3AATA 3HL2A 4LNJA 4B98A 1AMSA 1MAPA 2G6WA 4AO9A 5KTBA 4AO4A 3FVXA 1QITA 3NTJA 3ZRQA 2AY1A 4QGRA 2BI3A 1G4XA 3ZRPA 3VK3A 1BJOB 1RV4A 1WYTA 4IYOB 3GZDA 1AHYA 3LY1A 5EQCA 2YKXA 2Z9WA 2BI1A 3MAFB 1XEYA 2C81A 2HUFA 2R5CB 3B8XA 1AIBA 2F8JA 2YKUA 5J8QA 3L8AA 4ZM3A 2VGUA 2BIAA 2JISA 3MAFA 4F5IA 2W8TA 1QZ9A 2FNUA 2YRRA 4E3RA 4OCAA 3FD0A 1UU2A 5LHAA 3ACZA 3QHXA 3QBOA 3E6GA 4N0BA 3BWOA 1FG7A 3KE3A 1GDEA 3LVKA 4WYCA 3BWNC 1GEWA 3DRDA 3NUBA 1O4SA 1DGDA 4UQVA 1AAMA 1ASAA 3E2YA 1Y4IA 4IXSA 1UKJA 1MAQA 1SFFA 2DGLA 3I4JA 2HOZA 3RCHA 3VP6A 2O1BA 2VMPA 3MC6C 4CXQA 1TOIA 3EIBA 3EUCA 2KFPA 3RQ1A 2VMVA 1SZUA 1W3UA 1QISA 2EH6A 3RBFA 1OXOA 3ATHA 3H7FA 4WB0B 2WK8A 3UE8A 4ADCA 1KMJA 4IXOA 3NYSA 2E54A 1KL1A 3FDDA 4ITXA 2FKIA 3WLXA 1M32A 1ELUA 3A8UX 2VMQA 4GEBA 1CZEA 2W7FA 4WXFA 3A9YA 4JEWA 1ZOBA 2HP1A 1ORDA 3K40A 1BJ4A 1I48A 2CINA 1BJOA 1G4VA 1WYTB 1D7SA 2R5EA 3DXVA 4A00A 3MADA 3W1JA 2VGZA 4RITA 4L0OA 1LK9A 2PB0A 2Z20A 2AATA 2DKJA 4Y0IA 2DKBA 4M2MA 2VGSA 2EGYA 1MLZA 3LVJA 1X29A 2ZC0A 3PAAA 4OC9A 3FQAA 1P3WA 1ASFA 2VGTA 2EZ1A 1Z3ZA 1X2AA 3GZCA 2W7EA 1TPLA 3PJ0A 2BIEA 3F6TA 4OTLA 2VMNA 3UAKA 2C0RA 2X8UA 3R9AA 3MEBA 3E77A 3ISLA 3EI5A 4MSOA 4P7YA 4E77A 1AY4A 3R4TA 4OT8A 4ADEA 3ASAA 8AATA 2HUUA 2AY9A 5FT5A 4JEVA 1AHEA 5DB5A 1GC3A 3GR9A 2Z9VA 4F4EA 2AY5A 2D7YA 3I16A 3JU7A 4Q75A 1G7WA 5HDMA 1BS0A 4GDYA 5D5SA 4F5MA 3HQTA 2AY8A 4FFCA 1X0MA 4MQRA 5FT6A 4CVQA 1ARSA 3HVYA 3VK4A 2FM1A 4H51A 2QB2A 4CBSA 1GEYA 1V2EA 5EIGA 1B9HA 1GC2A 4MGRA 2BWNA 1CJ0A 2VI9A 1GBNA 3EZ1A 4RIZA 4Y0HA 2D7ZA 1IUGA 1CQ6A 3PGYA 3RBLA 1B8GA 2YCPA 2E7UA 9AATA 1TARA 4MKKA 4WYEA 3M5UA 2VI8A 1OATA 2JG2A 3GETA 1PMMA 2EO5A 4PVFA 3UWCA 3II0A 1S08A 4JEYA 1WSTA 4AZKA 1I41A 4RLGA 3NX3A 3LWSA 2BIGA 3T32A 3LV2A 1DKAA 4ZDLA 1AICA 3HLMA 1DJ9A 1QIRA 4TV7A 2AEVA 4XEWA 2CJGA 2V1PA 1GC4A 3N4SA 3BWNA 2VMOA 2X5FA 1B5OA 1M0NA 2YRIA 4JE5D 2WK9A 1LC8A 3CQ4A 2ZSMA 4KAMA 4ZASA 2RFVA 1AKAA 1ASCA 1YOOA 5M46A 1KAFA 2D61A 1WYVA 1VJOA 2Z61A 3N5MA 4WP0A 4DBCA 1IX6A 1O62A 1WKGA 1ARGA 4ADBA 2ZY4A 4OMAA 1AHXA 1IVRA 3FFRA 3PDXA 1ARIA 2QBTA 5EFSA 2YOBA 1BJWA 3WZFA 4JEXA 4R8DA 3QM2A 4WYGA 4GRXA 1MDOA 3BV0A 3RCHB 3TFTA 2A1VA 4Q6RA 2D65A 3L44A 2W7LA 2GQNA 3AENA 1JF9A 4AH3A 3AEMC 4ZM4A 5E3KA 1D7VA 1IAXA 1W7LA 2ORDA 3OP7A 3PDBA 3G0TA 1IBJA 4UHMA 3DR4A
chains in the Genus database with same CATH topology
3JWAA 1KKJA 3DXWA 4F5KA 3W1IA 2JJGA 4A6RA 3DR7A 2G7JA 2VYCA 2W8UA 4XK1A 2VMRA 1DTYA 2Z9XA 2W8VA 4XJOA 3N4RA 2OGAA 3GSBA 4J8LA 2DOUA 3QN6A 4HF8A 5BJ3A 2CJHA 1W7NA 4J5UA 5DX5A 2DGMA 2HUIA 1PG8A 3A9ZA 4AZJA 1YJSA 2YCTA 2AY7A 2DGKA 3FKDA 3BC8A 3EI9A 3Q8NA 4UHOA 2Z1ZA 3FSLA 2C44A 2Z1YA 1OHWA 4ZWMA 1D7RA 5JAYA 1BKGA 1IJIA 1DJUA 2ZSLA 4MKJA 3ZRRA 2R2NA 1ECXA 4WXBA 1GC0A 4P3MA 1AJSB 2OKKA 3DZZA 4IW7A 2AY2A 2BKWA 1AAWA 1UU0A 3NUIA 3AELA 1C0NA 1I43A 1FC4A 2ZYJA 2CSTA 3ELPA 2E7JA 1MDZA 1WYUA 4WLJA 4B9BA 3TFUA 1SZKA 2HOYA 3ZZKA 4ZAHA 2GSAA 4PFFA 3KGXA 1TATA 2PO3A 2Z9UA 3FVSA 3HBXA 4RJYA 4KXKA 2VMTA 3WKRA 2C7TA 2FYFA 1FG3A 2WK7A 1IX7A 4F5GA 3LVMA 2ZY5A 1M6SA 2VIAA 3CBFA 3AOWA 4A6TA 2ZP7A 1C7OA 1ARHA 1M0OA 4W8IA 2QLRA 3NU8A 4IY7A 4A72A 2OKJA 2W7DA 3RI6A 4A0GA 2E7IA 3A2BA 4EFFA 3AEPA 3B46A 3WCNA 3BS8A 2Q7WA 2BWOA 3EIAA 1PFFA 5G4JA 1YJZA 3B1EA 4OBVA 2JJHA 5FT4A 4OBUA 3AENB 4R2NA 4F5JA 2CFBA 1CL2A 2EZ2A 4XJMA 1RVUA 1AHGA 4LW4A 3A9XA 5F8VA 1SPAA 3WGCA 2EYQA 2EPJA 4A0RA 4FL0A 3B1CA 2W7HA 2QA3A 2WKAA 1BW0A 2QB3A 5FT8A 3WGBA 1IX8A 1E5FA 5EUEA 2GMSA 1DFOA 3W1HA 1YNUA 5D95A 1WKHA 2CTZA 2D64A 4MQQA 5EUNA 1E5EA 1ASLA 4ZSYA 1TOGA 4MY5A 5G2PA 4E3QA 3GZDC 4BA5A 1AY5A 5M4BA 1LC5A 3FFHA 4PFNA 5TF5A 1U08A 3NNKA 4IX8A 1TOJA 1D2FA 3H9XA 1IAYA 2VIBA 2VMWA 3E2ZA 5F9SA 3FQ7A 3VK2A 2D63A 3TATA 1N8PA 3EI8A 3IHJA 5EAVA 4WYFA 5G4IA 1OXPA 5G2QA 5DJ1A 3I5TA 2FNIA 2FN6A 1GCKA 4W5KA 1YJYA 1WYUB 3K7YA 1ASEA 1V72A 3PDBB 7AATA 2VMXA 4RAEA 2X3LA 4ZSWA 3QI6A 3QPGA 3DODA 5DJ9A 3BN1A 1D7UA 3LG0A 2AY6A 4JF1A 1AKBA 1AMQA 3FVUA 4XAUA 1OHYA 2JGTA 2BI2A 3G8MA 1I29A 4KYOA 1V2FA 3VAXA 5E4ZA 1JS3A 3NDNA 4K2BA 2TPLA 4W1WA 4N0WA 2VMYA 1M7YA 1C7GA 2XH1A 5G0AA 4HVKA 2ZY3A 4M2JA 2W7JA 1C7NA 1TOEA 1VEFA 3TCMA 4K05A 4EMYA 4TN4A 1LKCA 3QGUA 4ZLVA 2VGWA 3FCRA 3GWPA 3FQ8A 4Q76A 1ZODA 1M0QA 1B5PA 3NYTA 5HXXA 1AMAA 2OGEA 4EB5A 4LNLA 5M4DA 1MLYA 2CB1A 2BYJA 2ZUKA 1W23A 3E9KA 1B9IA 1ZC9A 1LW4A 4RJ0A 1GD9A 2OQXA 2W8JA 2WB6A 1AJRA 2JJFA 2BYLA 2OATA 4CXRA 4A0HA 2AY4A 3NRAA 2QSRA 2W8WA 1AHFA 1ASNA 1ARTA 1LW5A 2YKYA 1ASMA 3B1DA 3BB8A 5C6UA 1J04A 1CQ7A 2YCNA 2R0TA 3NU7A 4WBTA 4U2HA 1EJIA 4ZDPA 4MQPA 3H14A 2ZJGA 4XJPA 3P6KA 2W7MA 2FQ6A 4O6ZA 3EI7A 3ASBA 3WY7A 4ADDA 3COGA 3ELEA 3WKSA 2CY8A 3ECDA 2VMZA 5G09A 3HMUA 1BJNA 4ISYA 2AY3A 2CH2A 2O0RA 2XBNA 3OKSA 1SVVA 4W91A 4ZWVA 3HT4A 3G7QA 3E2ZB 4K2IA 2JJEA 1ELQA 3PIUA 1MGVA 1QJ3A 3BCAA 4WB0A 4WLHA 4BMKA 4M2KA 2D5YA 1PMOA 2VMSA 3AEJC 3WX9A 4IYOA 1JG8A 3HDOA 3WCOA 2X5DA 5I92A 2D66A 3RUYA 1CZCA 2GB3A 3MC6A 2O7CA 1G7XA 1VP4A 4DGTA 1ASBA 4F5LA 4CBRA 1AKCA 4RM1A 4ATPA 1TOKA 4RKCA 5K8BA 1CQ8A 3IF2A 3FZ7A 4WYDA 4JF0A 1MDXA 2BI5A 1ASGA 4A6UA 4EB7A 1S07A 2W7GA 3N0LA 4OYTA 3CQ6A 5M49A 2AEUA 4JEZA 1S0AA 1AJSA 2YHKA 3FZ8A 3JTXA 4H63Q 1KKPA 3LVLB 4ITGA 1LC7A 3KKIA 3MAUA 1RVYA 1YAAA 3P1TA 1KL2A 3JWBA 3TQXA 3MKJA 4XQ2A 4LW2A 5HHYA 4IXZA 3DU4A 1C4KA 1EQBA 1UU1A 2VGVA 5AX8A 1Z7DA 3CQ5A 3FZ6A 3GJUA 3AEJA 4A0FA 4ATQA 1O61A 3FTBA 1AY8A 4WYAA 1XI9A 1T3IA 2DR1A 3FRKA 4DQ6A 3ZZJA 1JS6A 3USFA 1ASDA 4XJLA 3DYDA 3K28A 2HZPA 4TMRA 1BQDA 1YIZA 3D6KA 1BQAA 2VMUA 1C9CA 1V2DA 2BHXA 1AX4A 1B4XA 1H0CA 1QJ5A 3MBBA 1LS3A 3AOVA 4F5FA 2CJDA 4EU1A 5BJ4A 3KGWA 1AMRA 1CL1A 2VLFA 1DJEA 3GBXA 2W7IA 2V0YA 2NMPA 1W7MA 4GE4A 1N31A 4WD2A 4LC3A 1DGEA 4BA4A 5EIGB 2QMAA 3BCBA 1TASA 1SF2A 3CAIA 2VLHA 4PIWA 1OHVA 4JE5A 4W1XA 1H1CA 3AV7A 1S06A 2CH1A 3PPLA 4F5HA 4NOGA 2BWPA 3VOMA 4R5FA 4UOYA 4GE7A 3EZSA 1M4NA 4GSAA 3NYUA 1GEXA 2R5CA 3FDBA 3N75A 3JZLA 2PB2A 4E1OA 1KMKA 1RV3A 1J32A 3PD6B 2CANA 4BHDA 5E5IA 5EUDA 4BQ0A 5EAAA 3F0HA 3PA9A 4AOAA 2ZY2A 2HORA 3EI6A 4K2MA 3E2FA 2HOXA 4U1TA 1BT4A 4ZDOA 3PD6A 3AEMA 3DC1A 1YIYA 3F9TA 3BCXA 4LNMA 4R5ZA 1X28A 4Q31A 4RKDA 1EG5A 3N4XA 3AEOA 1S09A 2YKVA 5LH9A 2W7KA 1M0PA 1QGNA 1WYVB 4I8AA 4UHNA 4WXGA 3N7NA 1N2TA 1O69A 4W1VA 4GE9A 2GMUA 1CS1A 2BI9A 1AIAA 1SZSA 2HP2A 3JW9A 4Y0DA 5IWQA 2Z67A 3AATA 3HL2A 4LNJA 4B98A 1AMSA 1MAPA 2G6WA 4AO9A 5KTBA 4AO4A 3FVXA 1QITA 3NTJA 3ZRQA 2AY1A 4QGRA 2BI3A 1G4XA 3ZRPA 3VK3A 1BJOB 1RV4A 1WYTA 4IYOB 3GZDA 1AHYA 3LY1A 5EQCA 2YKXA 2Z9WA 2BI1A 3MAFB 1XEYA 2C81A 2HUFA 2R5CB 3B8XA 1AIBA 2F8JA 2YKUA 5J8QA 3L8AA 4ZM3A 2VGUA 2BIAA 2JISA 3MAFA 4F5IA 2W8TA 1QZ9A 2FNUA 2YRRA 4E3RA 4OCAA 3FD0A 1UU2A 5LHAA 3ACZA 3QHXA 3QBOA 3E6GA 4N0BA 3BWOA 1FG7A 3KE3A 1GDEA 3LVKA 4WYCA 3BWNC 1GEWA 3DRDA 3NUBA 1O4SA 1DGDA 4UQVA 1AAMA 1ASAA 3E2YA 1Y4IA 4IXSA 1UKJA 1MAQA 1SFFA 2DGLA 3I4JA 2HOZA 3RCHA 3VP6A 2O1BA 2VMPA 3MC6C 4CXQA 1TOIA 3EIBA 3EUCA 2KFPA 3RQ1A 2VMVA 1SZUA 1W3UA 1QISA 2EH6A 3RBFA 1OXOA 3ATHA 3H7FA 4WB0B 2WK8A 3UE8A 4ADCA 1KMJA 4IXOA 3NYSA 2E54A 1KL1A 3FDDA 4ITXA 2FKIA 3WLXA 1M32A 1ELUA 3A8UX 2VMQA 4GEBA 1CZEA 2W7FA 4WXFA 3A9YA 4JEWA 1ZOBA 2HP1A 1ORDA 3K40A 1BJ4A 1I48A 2CINA 1BJOA 1G4VA 1WYTB 1D7SA 2R5EA 3DXVA 4A00A 3MADA 3W1JA 2VGZA 4RITA 4L0OA 1LK9A 2PB0A 2Z20A 2AATA 2DKJA 4Y0IA 2DKBA 4M2MA 2VGSA 2EGYA 1MLZA 3LVJA 1X29A 2ZC0A 3PAAA 4OC9A 3FQAA 1P3WA 1ASFA 2VGTA 2EZ1A 1Z3ZA 1X2AA 3GZCA 2W7EA 1TPLA 3PJ0A 2BIEA 3F6TA 4OTLA 2VMNA 3UAKA 2C0RA 2X8UA 3R9AA 3MEBA 3E77A 3ISLA 3EI5A 4MSOA 4P7YA 4E77A 1AY4A 3R4TA 4OT8A 4ADEA 3ASAA 8AATA 2HUUA 2AY9A 5FT5A 4JEVA 1AHEA 5DB5A 1GC3A 3GR9A 2Z9VA 4F4EA 2AY5A 2D7YA 3I16A 3JU7A 4Q75A 1G7WA 5HDMA 1BS0A 4GDYA 5D5SA 4F5MA 3HQTA 2AY8A 4FFCA 1X0MA 4MQRA 5FT6A 4CVQA 1ARSA 3HVYA 3VK4A 2FM1A 4H51A 2QB2A 4CBSA 1GEYA 1V2EA 5EIGA 1B9HA 1GC2A 4MGRA 2BWNA 1CJ0A 2VI9A 1GBNA 3EZ1A 4RIZA 4Y0HA 2D7ZA 1IUGA 1CQ6A 3PGYA 3RBLA 1B8GA 2YCPA 2E7UA 9AATA 1TARA 4MKKA 4WYEA 3M5UA 2VI8A 1OATA 2JG2A 3GETA 1PMMA 2EO5A 4PVFA 3UWCA 3II0A 1S08A 4JEYA 1WSTA 4AZKA 1I41A 4RLGA 3NX3A 3LWSA 2BIGA 3T32A 3LV2A 1DKAA 4ZDLA 1AICA 3HLMA 1DJ9A 1QIRA 4TV7A 2AEVA 4XEWA 2CJGA 2V1PA 1GC4A 3N4SA 3BWNA 2VMOA 2X5FA 1B5OA 1M0NA 2YRIA 4JE5D 2WK9A 1LC8A 3CQ4A 2ZSMA 4KAMA 4ZASA 2RFVA 1AKAA 1ASCA 1YOOA 5M46A 2D61A 1WYVA 1VJOA 2Z61A 3N5MA 4WP0A 4DBCA 1IX6A 1O62A 1WKGA 1ARGA 4ADBA 2ZY4A 4OMAA 1AHXA 1IVRA 3FFRA 3PDXA 1ARIA 2QBTA 5EFSA 2YOBA 1BJWA 3WZFA 4JEXA 4R8DA 3QM2A 4WYGA 4GRXA 1MDOA 3BV0A 3RCHB 3TFTA 2A1VA 4Q6RA 2D65A 3L44A 2W7LA 2GQNA 3AENA 1JF9A 4AH3A 3AEMC 4ZM4A 5E3KA 1D7VA 1IAXA 1W7LA 2ORDA 3OP7A 3PDBA 3G0TA 1IBJA 4UHMA 3DR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JWA A;  1KKJ A;  3DXW A;  4F5K A;  3W1I A;  2JJG A;  4A6R A;  3DR7 A;  2VYC A;  2W8U A;  4XK1 A;  2VMR A;  1DTY A;  2Z9X A;  2W8V A;  4XJO A;  2OGA A;  3GSB A;  4J8L A;  2DOU A;  3QN6 A;  4HF8 A;  5BJ3 A;  2CJH A;  1W7N A;  4J5U A;  5DX5 A;  2DGM A;  2HUI A;  1PG8 A;  3A9Z A;  4AZJ A;  1YJS A;  2YCT A;  2AY7 A;  2DGK A;  3FKD A;  3BC8 A;  3EI9 A;  3Q8N A;  4UHO A;  2Z1Z A;  3FSL A;  2C44 A;  2Z1Y A;  1OHW A;  4ZWM A;  1D7R A;  5JAY A;  1BKG A;  1IJI A;  1DJU A;  2ZSL A;  4MKJ A;  3ZRR A;  2R2N A;  1ECX A;  4WXB A;  1GC0 A;  4P3M A;  1AJS B;  2OKK A;  3DZZ A;  4IW7 A;  2AY2 A;  2BKW A;  1AAW A;  1UU0 A;  3NUI A;  3AEL A;  1C0N A;  1I43 A;  1FC4 A;  2ZYJ A;  2CST A;  3ELP A;  2E7J A;  1MDZ A;  1WYU A;  4WLJ A;  4B9B A;  3TFU A;  1SZK A;  2HOY A;  3ZZK A;  4ZAH A;  2GSA A;  4PFF A;  3KGX A;  1TAT A;  2PO3 A;  2Z9U A;  3FVS A;  3HBX A;  4RJY A;  4KXK A;  2VMT A;  3WKR A;  2C7T A;  2FYF A;  1FG3 A;  2WK7 A;  1IX7 A;  4F5G A;  3LVM A;  2ZY5 A;  1M6S A;  2VIA A;  3CBF A;  3AOW A;  4A6T A;  2ZP7 A;  1C7O A;  1ARH A;  1M0O A;  4W8I A;  2QLR A;  3NU8 A;  4IY7 A;  4A72 A;  2OKJ A;  2W7D A;  3RI6 A;  4A0G A;  2E7I A;  3A2B A;  4EFF A;  3AEP A;  3B46 A;  3WCN A;  3BS8 A;  2Q7W A;  2BWO A;  3EIA A;  1PFF A;  5G4J A;  1YJZ A;  3B1E A;  4OBV A;  2JJH A;  5FT4 A;  4OBU A;  3AEN B;  4R2N A;  4F5J A;  2CFB A;  1CL2 A;  2EZ2 A;  4XJM A;  1RVU A;  1AHG A;  4LW4 A;  3A9X A;  5F8V A;  1SPA A;  3WGC A;  2EPJ A;  4A0R A;  4FL0 A;  3B1C A;  2W7H A;  2QA3 A;  2WKA A;  1BW0 A;  2QB3 A;  5FT8 A;  3WGB A;  1IX8 A;  1E5F A;  5EUE A;  2GMS A;  1DFO A;  3W1H A;  1YNU A;  5D95 A;  1WKH A;  2CTZ A;  2D64 A;  4MQQ A;  5EUN A;  1E5E A;  1ASL A;  4ZSY A;  1TOG A;  4MY5 A;  5G2P A;  4E3Q A;  3GZD C;  4BA5 A;  1AY5 A;  5M4B A;  1LC5 A;  3FFH A;  4PFN A;  5TF5 A;  1U08 A;  3NNK A;  4IX8 A;  1TOJ A;  1D2F A;  1IAY A;  2VIB A;  2VMW A;  3E2Z A;  5F9S A;  3FQ7 A;  3VK2 A;  2D63 A;  3TAT A;  1N8P A;  3EI8 A;  3IHJ A;  5EAV A;  4WYF A;  5G4I A;  1OXP A;  5G2Q A;  5DJ1 A;  3I5T A;  2FNI A;  2FN6 A;  1GCK A;  4W5K A;  1YJY A;  1WYU B;  3K7Y A;  1ASE A;  1V72 A;  3PDB B;  7AAT A;  2VMX A;  4RAE A;  2X3L A;  4ZSW A;  3QI6 A;  3QPG A;  3DOD A;  5DJ9 A;  3BN1 A;  1D7U A;  3LG0 A;  2AY6 A;  4JF1 A;  1AKB A;  1AMQ A;  3FVU A;  4XAU A;  1OHY A;  2JGT A;  2BI2 A;  3G8M A;  1I29 A;  4KYO A;  1V2F A;  3VAX A;  5E4Z A;  1JS3 A;  3NDN A;  4K2B A;  2TPL A;  4W1W A;  4N0W A;  2VMY A;  1M7Y A;  1C7G A;  2XH1 A;  5G0A A;  4HVK A;  2ZY3 A;  4M2J A;  2W7J A;  1C7N A;  1TOE A;  1VEF A;  3TCM A;  4EMY A;  4TN4 A;  1LKC A;  3QGU A;  4ZLV A;  2VGW A;  3FCR A;  3GWP A;  3FQ8 A;  4Q76 A;  1ZOD A;  1M0Q A;  1B5P A;  3NYT A;  5HXX A;  1AMA A;  2OGE A;  4EB5 A;  4LNL A;  5M4D A;  1MLY A;  2CB1 A;  2BYJ A;  2ZUK A;  1W23 A;  3E9K A;  1B9I A;  1ZC9 A;  1LW4 A;  4RJ0 A;  1GD9 A;  2OQX A;  2W8J A;  1AJR A;  2JJF A;  2BYL A;  2OAT A;  4CXR A;  4A0H A;  2AY4 A;  3NRA A;  2W8W A;  1AHF A;  1ASN A;  1ART A;  1LW5 A;  2YKY A;  1ASM A;  3B1D A;  3BB8 A;  5C6U A;  1J04 A;  1CQ7 A;  2YCN A;  2R0T A;  3NU7 A;  4WBT A;  4U2H A;  1EJI A;  4ZDP A;  4MQP A;  3H14 A;  2ZJG A;  4XJP A;  3P6K A;  2W7M A;  2FQ6 A;  4O6Z A;  3EI7 A;  3ASB A;  3WY7 A;  4ADD A;  3COG A;  3ELE A;  3WKS A;  2CY8 A;  3ECD A;  2VMZ A;  5G09 A;  3HMU A;  1BJN A;  4ISY A;  2AY3 A;  2CH2 A;  2O0R A;  2XBN A;  3OKS A;  1SVV A;  4W91 A;  4ZWV A;  3HT4 A;  3G7Q A;  3E2Z B;  4K2I A;  2JJE A;  1ELQ A;  3PIU A;  1MGV A;  1QJ3 A;  3BCA A;  4WB0 A;  4WLH A;  4BMK A;  4M2K A;  2D5Y A;  1PMO A;  2VMS A;  3AEJ C;  3WX9 A;  4IYO A;  1JG8 A;  3HDO A;  3WCO A;  2X5D A;  5I92 A;  2D66 A;  3RUY A;  1CZC A;  2GB3 A;  3MC6 A;  2O7C A;  1G7X A;  1VP4 A;  4DGT A;  1ASB A;  4F5L A;  4CBR A;  1AKC A;  4RM1 A;  4ATP A;  1TOK A;  4RKC A;  5K8B A;  1CQ8 A;  3IF2 A;  3FZ7 A;  4WYD A;  4JF0 A;  1MDX A;  2BI5 A;  1ASG A;  4A6U A;  4EB7 A;  1S07 A;  2W7G A;  3N0L A;  4OYT A;  3CQ6 A;  5M49 A;  2AEU A;  4JEZ A;  1S0A A;  1AJS A;  2YHK A;  3FZ8 A;  3JTX A;  1KKP A;  3LVL B;  4ITG A;  1LC7 A;  3KKI A;  3MAU A;  1RVY A;  1YAA A;  3P1T A;  1KL2 A;  3JWB A;  3TQX A;  3MKJ A;  4XQ2 A;  4LW2 A;  5HHY A;  4IXZ A;  3DU4 A;  1C4K A;  1EQB A;  1UU1 A;  2VGV A;  5AX8 A;  1Z7D A;  3CQ5 A;  3FZ6 A;  3GJU A;  3AEJ A;  4A0F A;  4ATQ A;  1O61 A;  3FTB A;  1AY8 A;  4WYA A;  1XI9 A;  1T3I A;  2DR1 A;  3FRK A;  4DQ6 A;  3ZZJ A;  1JS6 A;  3USF A;  1ASD A;  4XJL A;  3DYD A;  3K28 A;  2HZP A;  4TMR A;  1BQD A;  1YIZ A;  3D6K A;  1BQA A;  2VMU A;  1C9C A;  1V2D A;  2BHX A;  1AX4 A;  1B4X A;  1H0C A;  1QJ5 A;  3MBB A;  1LS3 A;  3AOV A;  4F5F A;  2CJD A;  4EU1 A;  5BJ4 A;  3KGW A;  1AMR A;  1CL1 A;  2VLF A;  1DJE A;  3GBX A;  2W7I A;  2V0Y A;  2NMP A;  1W7M A;  4GE4 A;  1N31 A;  4WD2 A;  4LC3 A;  1DGE A;  4BA4 A;  5EIG B;  2QMA A;  3BCB A;  1TAS A;  1SF2 A;  3CAI A;  2VLH A;  4PIW A;  1OHV A;  4JE5 A;  4W1X A;  1H1C A;  3AV7 A;  1S06 A;  2CH1 A;  3PPL A;  4F5H A;  4NOG A;  2BWP A;  3VOM A;  4R5F A;  4UOY A;  4GE7 A;  3EZS A;  1M4N A;  4GSA A;  3NYU A;  1GEX A;  2R5C A;  3FDB A;  3N75 A;  3JZL A;  2PB2 A;  4E1O A;  1KMK A;  1RV3 A;  1J32 A;  3PD6 B;  2CAN A;  4BHD A;  5E5I A;  5EUD A;  4BQ0 A;  5EAA A;  3F0H A;  3PA9 A;  4AOA A;  2ZY2 A;  2HOR A;  3EI6 A;  4K2M A;  3E2F A;  2HOX A;  4U1T A;  1BT4 A;  4ZDO A;  3PD6 A;  3AEM A;  3DC1 A;  1YIY A;  3F9T A;  3BCX A;  4LNM A;  4R5Z A;  1X28 A;  4Q31 A;  4RKD A;  1EG5 A;  3AEO A;  1S09 A;  2YKV A;  5LH9 A;  2W7K A;  1M0P A;  1QGN A;  1WYV B;  4I8A A;  4UHN A;  4WXG A;  1N2T A;  1O69 A;  4W1V A;  4GE9 A;  2GMU A;  1CS1 A;  2BI9 A;  1AIA A;  1SZS A;  2HP2 A;  3JW9 A;  4Y0D A;  5IWQ A;  2Z67 A;  3AAT A;  3HL2 A;  4LNJ A;  4B98 A;  1AMS A;  1MAP A;  2G6W A;  4AO9 A;  4AO4 A;  3FVX A;  1QIT A;  3NTJ A;  3ZRQ A;  2AY1 A;  4QGR A;  2BI3 A;  1G4X A;  3ZRP A;  3VK3 A;  1BJO B;  1RV4 A;  1WYT A;  4IYO B;  3GZD A;  1AHY A;  3LY1 A;  5EQC A;  2YKX A;  2Z9W A;  2BI1 A;  3MAF B;  1XEY A;  2C81 A;  2HUF A;  2R5C B;  3B8X A;  1AIB A;  2F8J A;  2YKU A;  5J8Q A;  3L8A A;  4ZM3 A;  2VGU A;  2BIA A;  2JIS A;  3MAF A;  4F5I A;  2W8T A;  1QZ9 A;  2FNU A;  2YRR A;  4E3R A;  4OCA A;  3FD0 A;  1UU2 A;  5LHA A;  3ACZ A;  3QHX A;  3QBO A;  3E6G A;  4N0B A;  3BWO A;  1FG7 A;  3KE3 A;  1GDE A;  3LVK A;  4WYC A;  3BWN C;  1GEW A;  3DRD A;  3NUB A;  1O4S A;  1DGD A;  4UQV A;  1AAM A;  1ASA A;  3E2Y A;  1Y4I A;  4IXS A;  1UKJ A;  1MAQ A;  1SFF A;  2DGL A;  3I4J A;  2HOZ A;  3RCH A;  3VP6 A;  2O1B A;  2VMP A;  3MC6 C;  4CXQ A;  1TOI A;  3EIB A;  3EUC A;  3RQ1 A;  2VMV A;  1SZU A;  1W3U A;  1QIS A;  2EH6 A;  3RBF A;  1OXO A;  3ATH A;  3H7F A;  4WB0 B;  2WK8 A;  3UE8 A;  4ADC A;  1KMJ A;  4IXO A;  3NYS A;  2E54 A;  1KL1 A;  3FDD A;  4ITX A;  3WLX A;  1M32 A;  1ELU A;  3A8U X;  2VMQ A;  4GEB A;  1CZE A;  2W7F A;  4WXF A;  3A9Y A;  4JEW A;  1ZOB A;  2HP1 A;  1ORD A;  3K40 A;  1BJ4 A;  1I48 A;  2CIN A;  1BJO A;  1G4V A;  1WYT B;  1D7S A;  2R5E A;  3DXV A;  4A00 A;  3MAD A;  3W1J A;  2VGZ A;  4RIT A;  4L0O A;  1LK9 A;  2PB0 A;  2Z20 A;  2AAT A;  2DKJ A;  4Y0I A;  2DKB A;  4M2M A;  2VGS A;  2EGY A;  1MLZ A;  3LVJ A;  1X29 A;  2ZC0 A;  3PAA A;  4OC9 A;  3FQA A;  1P3W A;  1ASF A;  2VGT A;  2EZ1 A;  1Z3Z A;  1X2A A;  3GZC A;  2W7E A;  1TPL A;  3PJ0 A;  2BIE A;  3F6T A;  4OTL A;  2VMN A;  3UAK A;  2C0R A;  2X8U A;  3R9A A;  3MEB A;  3E77 A;  3ISL A;  3EI5 A;  4MSO A;  4P7Y A;  4E77 A;  1AY4 A;  3R4T A;  4OT8 A;  4ADE A;  3ASA A;  8AAT A;  2HUU A;  2AY9 A;  5FT5 A;  4JEV A;  1AHE A;  5DB5 A;  1GC3 A;  3GR9 A;  2Z9V A;  4F4E A;  2AY5 A;  2D7Y A;  3I16 A;  3JU7 A;  4Q75 A;  1G7W A;  5HDM A;  1BS0 A;  4GDY A;  5D5S A;  4F5M A;  3HQT A;  2AY8 A;  4FFC A;  1X0M A;  4MQR A;  5FT6 A;  4CVQ A;  1ARS A;  3HVY A;  3VK4 A;  2FM1 A;  4H51 A;  2QB2 A;  4CBS A;  1GEY A;  1V2E A;  5EIG A;  1B9H A;  1GC2 A;  4MGR A;  2BWN A;  1CJ0 A;  2VI9 A;  1GBN A;  3EZ1 A;  4RIZ A;  4Y0H A;  2D7Z A;  1IUG A;  1CQ6 A;  3PGY A;  3RBL A;  1B8G A;  2YCP A;  2E7U A;  9AAT A;  1TAR A;  4MKK A;  4WYE A;  3M5U A;  2VI8 A;  1OAT A;  2JG2 A;  3GET A;  1PMM A;  2EO5 A;  4PVF A;  3UWC A;  3II0 A;  1S08 A;  4JEY A;  1WST A;  4AZK A;  1I41 A;  4RLG A;  3NX3 A;  3LWS A;  2BIG A;  3T32 A;  3LV2 A;  1DKA A;  4ZDL A;  1AIC A;  3HLM A;  1DJ9 A;  1QIR A;  4TV7 A;  2AEV A;  4XEW A;  2CJG A;  2V1P A;  1GC4 A;  3BWN A;  2VMO A;  2X5F A;  1B5O A;  1M0N A;  2YRI A;  4JE5 D;  2WK9 A;  1LC8 A;  3CQ4 A;  2ZSM A;  4KAM A;  4ZAS A;  2RFV A;  1AKA A;  1ASC A;  1YOO A;  5M46 A;  2D61 A;  1WYV A;  1VJO A;  2Z61 A;  3N5M A;  4WP0 A;  4DBC A;  1IX6 A;  1O62 A;  1WKG A;  1ARG A;  4ADB A;  2ZY4 A;  4OMA A;  1AHX A;  1IVR A;  3FFR A;  3PDX A;  1ARI A;  2QBT A;  5EFS A;  2YOB A;  1BJW A;  3WZF A;  4JEX A;  4R8D A;  3QM2 A;  4WYG A;  4GRX A;  1MDO A;  3BV0 A;  3RCH B;  3TFT A;  4Q6R A;  2D65 A;  3L44 A;  2W7L A;  2GQN A;  3AEN A;  1JF9 A;  4AH3 A;  3AEM C;  4ZM4 A;  5E3K A;  1D7V A;  1IAX A;  1W7L A;  2ORD A;  3OP7 A;  3PDB A;  3G0T A;  1IBJ A;  4UHM A;  3DR4 A; 
#chains in the Genus database with same CATH topology
 3JWA A;  1KKJ A;  3DXW A;  4F5K A;  3W1I A;  2JJG A;  4A6R A;  3DR7 A;  2G7J A;  2VYC A;  2W8U A;  4XK1 A;  2VMR A;  1DTY A;  2Z9X A;  2W8V A;  4XJO A;  3N4R A;  2OGA A;  3GSB A;  4J8L A;  2DOU A;  3QN6 A;  4HF8 A;  5BJ3 A;  2CJH A;  1W7N A;  4J5U A;  5DX5 A;  2DGM A;  2HUI A;  1PG8 A;  3A9Z A;  4AZJ A;  1YJS A;  2YCT A;  2AY7 A;  2DGK A;  3FKD A;  3BC8 A;  3EI9 A;  3Q8N A;  4UHO A;  2Z1Z A;  3FSL A;  2C44 A;  2Z1Y A;  1OHW A;  4ZWM A;  1D7R A;  5JAY A;  1BKG A;  1IJI A;  1DJU A;  2ZSL A;  4MKJ A;  3ZRR A;  2R2N A;  1ECX A;  4WXB A;  1GC0 A;  4P3M A;  1AJS B;  2OKK A;  3DZZ A;  4IW7 A;  2AY2 A;  2BKW A;  1AAW A;  1UU0 A;  3NUI A;  3AEL A;  1C0N A;  1I43 A;  1FC4 A;  2ZYJ A;  2CST A;  3ELP A;  2E7J A;  1MDZ A;  1WYU A;  4WLJ A;  4B9B A;  3TFU A;  1SZK A;  2HOY A;  3ZZK A;  4ZAH A;  2GSA A;  4PFF A;  3KGX A;  1TAT A;  2PO3 A;  2Z9U A;  3FVS A;  3HBX A;  4RJY A;  4KXK A;  2VMT A;  3WKR A;  2C7T A;  2FYF A;  1FG3 A;  2WK7 A;  1IX7 A;  4F5G A;  3LVM A;  2ZY5 A;  1M6S A;  2VIA A;  3CBF A;  3AOW A;  4A6T A;  2ZP7 A;  1C7O A;  1ARH A;  1M0O A;  4W8I A;  2QLR A;  3NU8 A;  4IY7 A;  4A72 A;  2OKJ A;  2W7D A;  3RI6 A;  4A0G A;  2E7I A;  3A2B A;  4EFF A;  3AEP A;  3B46 A;  3WCN A;  3BS8 A;  2Q7W A;  2BWO A;  3EIA A;  1PFF A;  5G4J A;  1YJZ A;  3B1E A;  4OBV A;  2JJH A;  5FT4 A;  4OBU A;  3AEN B;  4R2N A;  4F5J A;  2CFB A;  1CL2 A;  2EZ2 A;  4XJM A;  1RVU A;  1AHG A;  4LW4 A;  3A9X A;  5F8V A;  1SPA A;  3WGC A;  2EYQ A;  2EPJ A;  4A0R A;  4FL0 A;  3B1C A;  2W7H A;  2QA3 A;  2WKA A;  1BW0 A;  2QB3 A;  5FT8 A;  3WGB A;  1IX8 A;  1E5F A;  5EUE A;  2GMS A;  1DFO A;  3W1H A;  1YNU A;  5D95 A;  1WKH A;  2CTZ A;  2D64 A;  4MQQ A;  5EUN A;  1E5E A;  1ASL A;  4ZSY A;  1TOG A;  4MY5 A;  5G2P A;  4E3Q A;  3GZD C;  4BA5 A;  1AY5 A;  5M4B A;  1LC5 A;  3FFH A;  4PFN A;  5TF5 A;  1U08 A;  3NNK A;  4IX8 A;  1TOJ A;  1D2F A;  3H9X A;  1IAY A;  2VIB A;  2VMW A;  3E2Z A;  5F9S A;  3FQ7 A;  3VK2 A;  2D63 A;  3TAT A;  1N8P A;  3EI8 A;  3IHJ A;  5EAV A;  4WYF A;  5G4I A;  1OXP A;  5G2Q A;  5DJ1 A;  3I5T A;  2FNI A;  2FN6 A;  1GCK A;  4W5K A;  1YJY A;  1WYU B;  3K7Y A;  1ASE A;  1V72 A;  3PDB B;  7AAT A;  2VMX A;  4RAE A;  2X3L A;  4ZSW A;  3QI6 A;  3QPG A;  3DOD A;  5DJ9 A;  3BN1 A;  1D7U A;  3LG0 A;  2AY6 A;  4JF1 A;  1AKB A;  1AMQ A;  3FVU A;  4XAU A;  1OHY A;  2JGT A;  2BI2 A;  3G8M A;  1I29 A;  4KYO A;  1V2F A;  3VAX A;  5E4Z A;  1JS3 A;  3NDN A;  4K2B A;  2TPL A;  4W1W A;  4N0W A;  2VMY A;  1M7Y A;  1C7G A;  2XH1 A;  5G0A A;  4HVK A;  2ZY3 A;  4M2J A;  2W7J A;  1C7N A;  1TOE A;  1VEF A;  3TCM A;  4K05 A;  4EMY A;  4TN4 A;  1LKC A;  3QGU A;  4ZLV A;  2VGW A;  3FCR A;  3GWP A;  3FQ8 A;  4Q76 A;  1ZOD A;  1M0Q A;  1B5P A;  3NYT A;  5HXX A;  1AMA A;  2OGE A;  4EB5 A;  4LNL A;  5M4D A;  1MLY A;  2CB1 A;  2BYJ A;  2ZUK A;  1W23 A;  3E9K A;  1B9I A;  1ZC9 A;  1LW4 A;  4RJ0 A;  1GD9 A;  2OQX A;  2W8J A;  2WB6 A;  1AJR A;  2JJF A;  2BYL A;  2OAT A;  4CXR A;  4A0H A;  2AY4 A;  3NRA A;  2QSR A;  2W8W A;  1AHF A;  1ASN A;  1ART A;  1LW5 A;  2YKY A;  1ASM A;  3B1D A;  3BB8 A;  5C6U A;  1J04 A;  1CQ7 A;  2YCN A;  2R0T A;  3NU7 A;  4WBT A;  4U2H A;  1EJI A;  4ZDP A;  4MQP A;  3H14 A;  2ZJG A;  4XJP A;  3P6K A;  2W7M A;  2FQ6 A;  4O6Z A;  3EI7 A;  3ASB A;  3WY7 A;  4ADD A;  3COG A;  3ELE A;  3WKS A;  2CY8 A;  3ECD A;  2VMZ A;  5G09 A;  3HMU A;  1BJN A;  4ISY A;  2AY3 A;  2CH2 A;  2O0R A;  2XBN A;  3OKS A;  1SVV A;  4W91 A;  4ZWV A;  3HT4 A;  3G7Q A;  3E2Z B;  4K2I A;  2JJE A;  1ELQ A;  3PIU A;  1MGV A;  1QJ3 A;  3BCA A;  4WB0 A;  4WLH A;  4BMK A;  4M2K A;  2D5Y A;  1PMO A;  2VMS A;  3AEJ C;  3WX9 A;  4IYO A;  1JG8 A;  3HDO A;  3WCO A;  2X5D A;  5I92 A;  2D66 A;  3RUY A;  1CZC A;  2GB3 A;  3MC6 A;  2O7C A;  1G7X A;  1VP4 A;  4DGT A;  1ASB A;  4F5L A;  4CBR A;  1AKC A;  4RM1 A;  4ATP A;  1TOK A;  4RKC A;  5K8B A;  1CQ8 A;  3IF2 A;  3FZ7 A;  4WYD A;  4JF0 A;  1MDX A;  2BI5 A;  1ASG A;  4A6U A;  4EB7 A;  1S07 A;  2W7G A;  3N0L A;  4OYT A;  3CQ6 A;  5M49 A;  2AEU A;  4JEZ A;  1S0A A;  1AJS A;  2YHK A;  3FZ8 A;  3JTX A;  4H63 Q;  1KKP A;  3LVL B;  4ITG A;  1LC7 A;  3KKI A;  3MAU A;  1RVY A;  1YAA A;  3P1T A;  1KL2 A;  3JWB A;  3TQX A;  3MKJ A;  4XQ2 A;  4LW2 A;  5HHY A;  4IXZ A;  3DU4 A;  1C4K A;  1EQB A;  1UU1 A;  2VGV A;  5AX8 A;  1Z7D A;  3CQ5 A;  3FZ6 A;  3GJU A;  3AEJ A;  4A0F A;  4ATQ A;  1O61 A;  3FTB A;  1AY8 A;  4WYA A;  1XI9 A;  1T3I A;  2DR1 A;  3FRK A;  4DQ6 A;  3ZZJ A;  1JS6 A;  3USF A;  1ASD A;  4XJL A;  3DYD A;  3K28 A;  2HZP A;  4TMR A;  1BQD A;  1YIZ A;  3D6K A;  1BQA A;  2VMU A;  1C9C A;  1V2D A;  2BHX A;  1AX4 A;  1B4X A;  1H0C A;  1QJ5 A;  3MBB A;  1LS3 A;  3AOV A;  4F5F A;  2CJD A;  4EU1 A;  5BJ4 A;  3KGW A;  1AMR A;  1CL1 A;  2VLF A;  1DJE A;  3GBX A;  2W7I A;  2V0Y A;  2NMP A;  1W7M A;  4GE4 A;  1N31 A;  4WD2 A;  4LC3 A;  1DGE A;  4BA4 A;  5EIG B;  2QMA A;  3BCB A;  1TAS A;  1SF2 A;  3CAI A;  2VLH A;  4PIW A;  1OHV A;  4JE5 A;  4W1X A;  1H1C A;  3AV7 A;  1S06 A;  2CH1 A;  3PPL A;  4F5H A;  4NOG A;  2BWP A;  3VOM A;  4R5F A;  4UOY A;  4GE7 A;  3EZS A;  1M4N A;  4GSA A;  3NYU A;  1GEX A;  2R5C A;  3FDB A;  3N75 A;  3JZL A;  2PB2 A;  4E1O A;  1KMK A;  1RV3 A;  1J32 A;  3PD6 B;  2CAN A;  4BHD A;  5E5I A;  5EUD A;  4BQ0 A;  5EAA A;  3F0H A;  3PA9 A;  4AOA A;  2ZY2 A;  2HOR A;  3EI6 A;  4K2M A;  3E2F A;  2HOX A;  4U1T A;  1BT4 A;  4ZDO A;  3PD6 A;  3AEM A;  3DC1 A;  1YIY A;  3F9T A;  3BCX A;  4LNM A;  4R5Z A;  1X28 A;  4Q31 A;  4RKD A;  1EG5 A;  3N4X A;  3AEO A;  1S09 A;  2YKV A;  5LH9 A;  2W7K A;  1M0P A;  1QGN A;  1WYV B;  4I8A A;  4UHN A;  4WXG A;  3N7N A;  1N2T A;  1O69 A;  4W1V A;  4GE9 A;  2GMU A;  1CS1 A;  2BI9 A;  1AIA A;  1SZS A;  2HP2 A;  3JW9 A;  4Y0D A;  5IWQ A;  2Z67 A;  3AAT A;  3HL2 A;  4LNJ A;  4B98 A;  1AMS A;  1MAP A;  2G6W A;  4AO9 A;  5KTB A;  4AO4 A;  3FVX A;  1QIT A;  3NTJ A;  3ZRQ A;  2AY1 A;  4QGR A;  2BI3 A;  1G4X A;  3ZRP A;  3VK3 A;  1BJO B;  1RV4 A;  1WYT A;  4IYO B;  3GZD A;  1AHY A;  3LY1 A;  5EQC A;  2YKX A;  2Z9W A;  2BI1 A;  3MAF B;  1XEY A;  2C81 A;  2HUF A;  2R5C B;  3B8X A;  1AIB A;  2F8J A;  2YKU A;  5J8Q A;  3L8A A;  4ZM3 A;  2VGU A;  2BIA A;  2JIS A;  3MAF A;  4F5I A;  2W8T A;  1QZ9 A;  2FNU A;  2YRR A;  4E3R A;  4OCA A;  3FD0 A;  1UU2 A;  5LHA A;  3ACZ A;  3QHX A;  3QBO A;  3E6G A;  4N0B A;  3BWO A;  1FG7 A;  3KE3 A;  1GDE A;  3LVK A;  4WYC A;  3BWN C;  1GEW A;  3DRD A;  3NUB A;  1O4S A;  1DGD A;  4UQV A;  1AAM A;  1ASA A;  3E2Y A;  1Y4I A;  4IXS A;  1UKJ A;  1MAQ A;  1SFF A;  2DGL A;  3I4J A;  2HOZ A;  3RCH A;  3VP6 A;  2O1B A;  2VMP A;  3MC6 C;  4CXQ A;  1TOI A;  3EIB A;  3EUC A;  2KFP A;  3RQ1 A;  2VMV A;  1SZU A;  1W3U A;  1QIS A;  2EH6 A;  3RBF A;  1OXO A;  3ATH A;  3H7F A;  4WB0 B;  2WK8 A;  3UE8 A;  4ADC A;  1KMJ A;  4IXO A;  3NYS A;  2E54 A;  1KL1 A;  3FDD A;  4ITX A;  2FKI A;  3WLX A;  1M32 A;  1ELU A;  3A8U X;  2VMQ A;  4GEB A;  1CZE A;  2W7F A;  4WXF A;  3A9Y A;  4JEW A;  1ZOB A;  2HP1 A;  1ORD A;  3K40 A;  1BJ4 A;  1I48 A;  2CIN A;  1BJO A;  1G4V A;  1WYT B;  1D7S A;  2R5E A;  3DXV A;  4A00 A;  3MAD A;  3W1J A;  2VGZ A;  4RIT A;  4L0O A;  1LK9 A;  2PB0 A;  2Z20 A;  2AAT A;  2DKJ A;  4Y0I A;  2DKB A;  4M2M A;  2VGS A;  2EGY A;  1MLZ A;  3LVJ A;  1X29 A;  2ZC0 A;  3PAA A;  4OC9 A;  3FQA A;  1P3W A;  1ASF A;  2VGT A;  2EZ1 A;  1Z3Z A;  1X2A A;  3GZC A;  2W7E A;  1TPL A;  3PJ0 A;  2BIE A;  3F6T A;  4OTL A;  2VMN A;  3UAK A;  2C0R A;  2X8U A;  3R9A A;  3MEB A;  3E77 A;  3ISL A;  3EI5 A;  4MSO A;  4P7Y A;  4E77 A;  1AY4 A;  3R4T A;  4OT8 A;  4ADE A;  3ASA A;  8AAT A;  2HUU A;  2AY9 A;  5FT5 A;  4JEV A;  1AHE A;  5DB5 A;  1GC3 A;  3GR9 A;  2Z9V A;  4F4E A;  2AY5 A;  2D7Y A;  3I16 A;  3JU7 A;  4Q75 A;  1G7W A;  5HDM A;  1BS0 A;  4GDY A;  5D5S A;  4F5M A;  3HQT A;  2AY8 A;  4FFC A;  1X0M A;  4MQR A;  5FT6 A;  4CVQ A;  1ARS A;  3HVY A;  3VK4 A;  2FM1 A;  4H51 A;  2QB2 A;  4CBS A;  1GEY A;  1V2E A;  5EIG A;  1B9H A;  1GC2 A;  4MGR A;  2BWN A;  1CJ0 A;  2VI9 A;  1GBN A;  3EZ1 A;  4RIZ A;  4Y0H A;  2D7Z A;  1IUG A;  1CQ6 A;  3PGY A;  3RBL A;  1B8G A;  2YCP A;  2E7U A;  9AAT A;  1TAR A;  4MKK A;  4WYE A;  3M5U A;  2VI8 A;  1OAT A;  2JG2 A;  3GET A;  1PMM A;  2EO5 A;  4PVF A;  3UWC A;  3II0 A;  1S08 A;  4JEY A;  1WST A;  4AZK A;  1I41 A;  4RLG A;  3NX3 A;  3LWS A;  2BIG A;  3T32 A;  3LV2 A;  1DKA A;  4ZDL A;  1AIC A;  3HLM A;  1DJ9 A;  1QIR A;  4TV7 A;  2AEV A;  4XEW A;  2CJG A;  2V1P A;  1GC4 A;  3N4S A;  3BWN A;  2VMO A;  2X5F A;  1B5O A;  1M0N A;  2YRI A;  4JE5 D;  2WK9 A;  1LC8 A;  3CQ4 A;  2ZSM A;  4KAM A;  4ZAS A;  2RFV A;  1AKA A;  1ASC A;  1YOO A;  5M46 A;  1KAF A;  2D61 A;  1WYV A;  1VJO A;  2Z61 A;  3N5M A;  4WP0 A;  4DBC A;  1IX6 A;  1O62 A;  1WKG A;  1ARG A;  4ADB A;  2ZY4 A;  4OMA A;  1AHX A;  1IVR A;  3FFR A;  3PDX A;  1ARI A;  2QBT A;  5EFS A;  2YOB A;  1BJW A;  3WZF A;  4JEX A;  4R8D A;  3QM2 A;  4WYG A;  4GRX A;  1MDO A;  3BV0 A;  3RCH B;  3TFT A;  2A1V A;  4Q6R A;  2D65 A;  3L44 A;  2W7L A;  2GQN A;  3AEN A;  1JF9 A;  4AH3 A;  3AEM C;  4ZM4 A;  5E3K A;  1D7V A;  1IAX A;  1W7L A;  2ORD A;  3OP7 A;  3PDB A;  3G0T A;  1IBJ A;  4UHM A;  3DR4 A; 
#chains in the Genus database with same CATH homology
 3JWA A;  1KKJ A;  3DXW A;  4F5K A;  3W1I A;  2JJG A;  4A6R A;  3DR7 A;  2G7J A;  2VYC A;  2W8U A;  4XK1 A;  2VMR A;  1DTY A;  2Z9X A;  2W8V A;  4XJO A;  3N4R A;  2OGA A;  3GSB A;  4J8L A;  2DOU A;  3QN6 A;  4HF8 A;  5BJ3 A;  2CJH A;  1W7N A;  4J5U A;  5DX5 A;  2DGM A;  2HUI A;  1PG8 A;  3A9Z A;  4AZJ A;  1YJS A;  2YCT A;  2AY7 A;  2DGK A;  3FKD A;  3BC8 A;  3EI9 A;  3Q8N A;  4UHO A;  2Z1Z A;  3FSL A;  2C44 A;  2Z1Y A;  1OHW A;  4ZWM A;  1D7R A;  5JAY A;  1BKG A;  1IJI A;  1DJU A;  2ZSL A;  4MKJ A;  3ZRR A;  2R2N A;  1ECX A;  4WXB A;  1GC0 A;  4P3M A;  1AJS B;  2OKK A;  3DZZ A;  4IW7 A;  2AY2 A;  2BKW A;  1AAW A;  1UU0 A;  3NUI A;  3AEL A;  1C0N A;  1I43 A;  1FC4 A;  2ZYJ A;  2CST A;  3ELP A;  2E7J A;  1MDZ A;  1WYU A;  4WLJ A;  4B9B A;  3TFU A;  1SZK A;  2HOY A;  3ZZK A;  4ZAH A;  2GSA A;  4PFF A;  3KGX A;  1TAT A;  2PO3 A;  2Z9U A;  3FVS A;  3HBX A;  4RJY A;  4KXK A;  2VMT A;  3WKR A;  2C7T A;  2FYF A;  1FG3 A;  2WK7 A;  1IX7 A;  4F5G A;  3LVM A;  2ZY5 A;  1M6S A;  2VIA A;  3CBF A;  3AOW A;  4A6T A;  2ZP7 A;  1C7O A;  1ARH A;  1M0O A;  4W8I A;  2QLR A;  3NU8 A;  4IY7 A;  4A72 A;  2OKJ A;  2W7D A;  3RI6 A;  4A0G A;  2E7I A;  3A2B A;  4EFF A;  3AEP A;  3B46 A;  3WCN A;  3BS8 A;  2Q7W A;  2BWO A;  3EIA A;  1PFF A;  5G4J A;  1YJZ A;  3B1E A;  4OBV A;  2JJH A;  5FT4 A;  4OBU A;  3AEN B;  4R2N A;  4F5J A;  2CFB A;  1CL2 A;  2EZ2 A;  4XJM A;  1RVU A;  1AHG A;  4LW4 A;  3A9X A;  5F8V A;  1SPA A;  3WGC A;  2EYQ A;  2EPJ A;  4A0R A;  4FL0 A;  3B1C A;  2W7H A;  2QA3 A;  2WKA A;  1BW0 A;  2QB3 A;  5FT8 A;  3WGB A;  1IX8 A;  1E5F A;  5EUE A;  2GMS A;  1DFO A;  3W1H A;  1YNU A;  5D95 A;  1WKH A;  2CTZ A;  2D64 A;  4MQQ A;  5EUN A;  1E5E A;  1ASL A;  4ZSY A;  1TOG A;  4MY5 A;  5G2P A;  4E3Q A;  3GZD C;  4BA5 A;  1AY5 A;  5M4B A;  1LC5 A;  3FFH A;  4PFN A;  5TF5 A;  1U08 A;  3NNK A;  4IX8 A;  1TOJ A;  1D2F A;  3H9X A;  1IAY A;  2VIB A;  2VMW A;  3E2Z A;  5F9S A;  3FQ7 A;  3VK2 A;  2D63 A;  3TAT A;  1N8P A;  3EI8 A;  3IHJ A;  5EAV A;  4WYF A;  5G4I A;  1OXP A;  5G2Q A;  5DJ1 A;  3I5T A;  2FNI A;  2FN6 A;  1GCK A;  4W5K A;  1YJY A;  1WYU B;  3K7Y A;  1ASE A;  1V72 A;  3PDB B;  7AAT A;  2VMX A;  4RAE A;  2X3L A;  4ZSW A;  3QI6 A;  3QPG A;  3DOD A;  5DJ9 A;  3BN1 A;  1D7U A;  3LG0 A;  2AY6 A;  4JF1 A;  1AKB A;  1AMQ A;  3FVU A;  4XAU A;  1OHY A;  2JGT A;  2BI2 A;  3G8M A;  1I29 A;  4KYO A;  1V2F A;  3VAX A;  5E4Z A;  1JS3 A;  3NDN A;  4K2B A;  2TPL A;  4W1W A;  4N0W A;  2VMY A;  1M7Y A;  1C7G A;  2XH1 A;  5G0A A;  4HVK A;  2ZY3 A;  4M2J A;  2W7J A;  1C7N A;  1TOE A;  1VEF A;  3TCM A;  4K05 A;  4EMY A;  4TN4 A;  1LKC A;  3QGU A;  4ZLV A;  2VGW A;  3FCR A;  3GWP A;  3FQ8 A;  4Q76 A;  1ZOD A;  1M0Q A;  1B5P A;  3NYT A;  5HXX A;  1AMA A;  2OGE A;  4EB5 A;  4LNL A;  5M4D A;  1MLY A;  2CB1 A;  2BYJ A;  2ZUK A;  1W23 A;  3E9K A;  1B9I A;  1ZC9 A;  1LW4 A;  4RJ0 A;  1GD9 A;  2OQX A;  2W8J A;  2WB6 A;  1AJR A;  2JJF A;  2BYL A;  2OAT A;  4CXR A;  4A0H A;  2AY4 A;  3NRA A;  2QSR A;  2W8W A;  1AHF A;  1ASN A;  1ART A;  1LW5 A;  2YKY A;  1ASM A;  3B1D A;  3BB8 A;  5C6U A;  1J04 A;  1CQ7 A;  2YCN A;  2R0T A;  3NU7 A;  4WBT A;  4U2H A;  1EJI A;  4ZDP A;  4MQP A;  3H14 A;  2ZJG A;  4XJP A;  3P6K A;  2W7M A;  2FQ6 A;  4O6Z A;  3EI7 A;  3ASB A;  3WY7 A;  4ADD A;  3COG A;  3ELE A;  3WKS A;  2CY8 A;  3ECD A;  2VMZ A;  5G09 A;  3HMU A;  1BJN A;  4ISY A;  2AY3 A;  2CH2 A;  2O0R A;  2XBN A;  3OKS A;  1SVV A;  4W91 A;  4ZWV A;  3HT4 A;  3G7Q A;  3E2Z B;  4K2I A;  2JJE A;  1ELQ A;  3PIU A;  1MGV A;  1QJ3 A;  3BCA A;  4WB0 A;  4WLH A;  4BMK A;  4M2K A;  2D5Y A;  1PMO A;  2VMS A;  3AEJ C;  3WX9 A;  4IYO A;  1JG8 A;  3HDO A;  3WCO A;  2X5D A;  5I92 A;  2D66 A;  3RUY A;  1CZC A;  2GB3 A;  3MC6 A;  2O7C A;  1G7X A;  1VP4 A;  4DGT A;  1ASB A;  4F5L A;  4CBR A;  1AKC A;  4RM1 A;  4ATP A;  1TOK A;  4RKC A;  5K8B A;  1CQ8 A;  3IF2 A;  3FZ7 A;  4WYD A;  4JF0 A;  1MDX A;  2BI5 A;  1ASG A;  4A6U A;  4EB7 A;  1S07 A;  2W7G A;  3N0L A;  4OYT A;  3CQ6 A;  5M49 A;  2AEU A;  4JEZ A;  1S0A A;  1AJS A;  2YHK A;  3FZ8 A;  3JTX A;  4H63 Q;  1KKP A;  3LVL B;  4ITG A;  1LC7 A;  3KKI A;  3MAU A;  1RVY A;  1YAA A;  3P1T A;  1KL2 A;  3JWB A;  3TQX A;  3MKJ A;  4XQ2 A;  4LW2 A;  5HHY A;  4IXZ A;  3DU4 A;  1C4K A;  1EQB A;  1UU1 A;  2VGV A;  5AX8 A;  1Z7D A;  3CQ5 A;  3FZ6 A;  3GJU A;  3AEJ A;  4A0F A;  4ATQ A;  1O61 A;  3FTB A;  1AY8 A;  4WYA A;  1XI9 A;  1T3I A;  2DR1 A;  3FRK A;  4DQ6 A;  3ZZJ A;  1JS6 A;  3USF A;  1ASD A;  4XJL A;  3DYD A;  3K28 A;  2HZP A;  4TMR A;  1BQD A;  1YIZ A;  3D6K A;  1BQA A;  2VMU A;  1C9C A;  1V2D A;  2BHX A;  1AX4 A;  1B4X A;  1H0C A;  1QJ5 A;  3MBB A;  1LS3 A;  3AOV A;  4F5F A;  2CJD A;  4EU1 A;  5BJ4 A;  3KGW A;  1AMR A;  1CL1 A;  2VLF A;  1DJE A;  3GBX A;  2W7I A;  2V0Y A;  2NMP A;  1W7M A;  4GE4 A;  1N31 A;  4WD2 A;  4LC3 A;  1DGE A;  4BA4 A;  5EIG B;  2QMA A;  3BCB A;  1TAS A;  1SF2 A;  3CAI A;  2VLH A;  4PIW A;  1OHV A;  4JE5 A;  4W1X A;  1H1C A;  3AV7 A;  1S06 A;  2CH1 A;  3PPL A;  4F5H A;  4NOG A;  2BWP A;  3VOM A;  4R5F A;  4UOY A;  4GE7 A;  3EZS A;  1M4N A;  4GSA A;  3NYU A;  1GEX A;  2R5C A;  3FDB A;  3N75 A;  3JZL A;  2PB2 A;  4E1O A;  1KMK A;  1RV3 A;  1J32 A;  3PD6 B;  2CAN A;  4BHD A;  5E5I A;  5EUD A;  4BQ0 A;  5EAA A;  3F0H A;  3PA9 A;  4AOA A;  2ZY2 A;  2HOR A;  3EI6 A;  4K2M A;  3E2F A;  2HOX A;  4U1T A;  1BT4 A;  4ZDO A;  3PD6 A;  3AEM A;  3DC1 A;  1YIY A;  3F9T A;  3BCX A;  4LNM A;  4R5Z A;  1X28 A;  4Q31 A;  4RKD A;  1EG5 A;  3N4X A;  3AEO A;  1S09 A;  2YKV A;  5LH9 A;  2W7K A;  1M0P A;  1QGN A;  1WYV B;  4I8A A;  4UHN A;  4WXG A;  3N7N A;  1N2T A;  1O69 A;  4W1V A;  4GE9 A;  2GMU A;  1CS1 A;  2BI9 A;  1AIA A;  1SZS A;  2HP2 A;  3JW9 A;  4Y0D A;  5IWQ A;  2Z67 A;  3AAT A;  3HL2 A;  4LNJ A;  4B98 A;  1AMS A;  1MAP A;  2G6W A;  4AO9 A;  5KTB A;  4AO4 A;  3FVX A;  1QIT A;  3NTJ A;  3ZRQ A;  2AY1 A;  4QGR A;  2BI3 A;  1G4X A;  3ZRP A;  3VK3 A;  1BJO B;  1RV4 A;  1WYT A;  4IYO B;  3GZD A;  1AHY A;  3LY1 A;  5EQC A;  2YKX A;  2Z9W A;  2BI1 A;  3MAF B;  1XEY A;  2C81 A;  2HUF A;  2R5C B;  3B8X A;  1AIB A;  2F8J A;  2YKU A;  5J8Q A;  3L8A A;  4ZM3 A;  2VGU A;  2BIA A;  2JIS A;  3MAF A;  4F5I A;  2W8T A;  1QZ9 A;  2FNU A;  2YRR A;  4E3R A;  4OCA A;  3FD0 A;  1UU2 A;  5LHA A;  3ACZ A;  3QHX A;  3QBO A;  3E6G A;  4N0B A;  3BWO A;  1FG7 A;  3KE3 A;  1GDE A;  3LVK A;  4WYC A;  3BWN C;  1GEW A;  3DRD A;  3NUB A;  1O4S A;  1DGD A;  4UQV A;  1AAM A;  1ASA A;  3E2Y A;  1Y4I A;  4IXS A;  1UKJ A;  1MAQ A;  1SFF A;  2DGL A;  3I4J A;  2HOZ A;  3RCH A;  3VP6 A;  2O1B A;  2VMP A;  3MC6 C;  4CXQ A;  1TOI A;  3EIB A;  3EUC A;  2KFP A;  3RQ1 A;  2VMV A;  1SZU A;  1W3U A;  1QIS A;  2EH6 A;  3RBF A;  1OXO A;  3ATH A;  3H7F A;  4WB0 B;  2WK8 A;  3UE8 A;  4ADC A;  1KMJ A;  4IXO A;  3NYS A;  2E54 A;  1KL1 A;  3FDD A;  4ITX A;  2FKI A;  3WLX A;  1M32 A;  1ELU A;  3A8U X;  2VMQ A;  4GEB A;  1CZE A;  2W7F A;  4WXF A;  3A9Y A;  4JEW A;  1ZOB A;  2HP1 A;  1ORD A;  3K40 A;  1BJ4 A;  1I48 A;  2CIN A;  1BJO A;  1G4V A;  1WYT B;  1D7S A;  2R5E A;  3DXV A;  4A00 A;  3MAD A;  3W1J A;  2VGZ A;  4RIT A;  4L0O A;  1LK9 A;  2PB0 A;  2Z20 A;  2AAT A;  2DKJ A;  4Y0I A;  2DKB A;  4M2M A;  2VGS A;  2EGY A;  1MLZ A;  3LVJ A;  1X29 A;  2ZC0 A;  3PAA A;  4OC9 A;  3FQA A;  1P3W A;  1ASF A;  2VGT A;  2EZ1 A;  1Z3Z A;  1X2A A;  3GZC A;  2W7E A;  1TPL A;  3PJ0 A;  2BIE A;  3F6T A;  4OTL A;  2VMN A;  3UAK A;  2C0R A;  2X8U A;  3R9A A;  3MEB A;  3E77 A;  3ISL A;  3EI5 A;  4MSO A;  4P7Y A;  4E77 A;  1AY4 A;  3R4T A;  4OT8 A;  4ADE A;  3ASA A;  8AAT A;  2HUU A;  2AY9 A;  5FT5 A;  4JEV A;  1AHE A;  5DB5 A;  1GC3 A;  3GR9 A;  2Z9V A;  4F4E A;  2AY5 A;  2D7Y A;  3I16 A;  3JU7 A;  4Q75 A;  1G7W A;  5HDM A;  1BS0 A;  4GDY A;  5D5S A;  4F5M A;  3HQT A;  2AY8 A;  4FFC A;  1X0M A;  4MQR A;  5FT6 A;  4CVQ A;  1ARS A;  3HVY A;  3VK4 A;  2FM1 A;  4H51 A;  2QB2 A;  4CBS A;  1GEY A;  1V2E A;  5EIG A;  1B9H A;  1GC2 A;  4MGR A;  2BWN A;  1CJ0 A;  2VI9 A;  1GBN A;  3EZ1 A;  4RIZ A;  4Y0H A;  2D7Z A;  1IUG A;  1CQ6 A;  3PGY A;  3RBL A;  1B8G A;  2YCP A;  2E7U A;  9AAT A;  1TAR A;  4MKK A;  4WYE A;  3M5U A;  2VI8 A;  1OAT A;  2JG2 A;  3GET A;  1PMM A;  2EO5 A;  4PVF A;  3UWC A;  3II0 A;  1S08 A;  4JEY A;  1WST A;  4AZK A;  1I41 A;  4RLG A;  3NX3 A;  3LWS A;  2BIG A;  3T32 A;  3LV2 A;  1DKA A;  4ZDL A;  1AIC A;  3HLM A;  1DJ9 A;  1QIR A;  4TV7 A;  2AEV A;  4XEW A;  2CJG A;  2V1P A;  1GC4 A;  3N4S A;  3BWN A;  2VMO A;  2X5F A;  1B5O A;  1M0N A;  2YRI A;  4JE5 D;  2WK9 A;  1LC8 A;  3CQ4 A;  2ZSM A;  4KAM A;  4ZAS A;  2RFV A;  1AKA A;  1ASC A;  1YOO A;  5M46 A;  2D61 A;  1WYV A;  1VJO A;  2Z61 A;  3N5M A;  4WP0 A;  4DBC A;  1IX6 A;  1O62 A;  1WKG A;  1ARG A;  4ADB A;  2ZY4 A;  4OMA A;  1AHX A;  1IVR A;  3FFR A;  3PDX A;  1ARI A;  2QBT A;  5EFS A;  2YOB A;  1BJW A;  3WZF A;  4JEX A;  4R8D A;  3QM2 A;  4WYG A;  4GRX A;  1MDO A;  3BV0 A;  3RCH B;  3TFT A;  2A1V A;  4Q6R A;  2D65 A;  3L44 A;  2W7L A;  2GQN A;  3AEN A;  1JF9 A;  4AH3 A;  3AEM C;  4ZM4 A;  5E3K A;  1D7V A;  1IAX A;  1W7L A;  2ORD A;  3OP7 A;  3PDB A;  3G0T A;  1IBJ A;  4UHM A;  3DR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...