1AAWA

The structural basis for the altered substrate specificity of the r292d active site mutant of aspartate aminotransferase from e. coli
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
396
structure length
396
Chain Sequence
b'MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title The structural basis for the altered substrate specificity of the R292D active site mutant of aspartate aminotransferase from E. coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Aminotransferase
total genus 122
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1993-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1aawA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1aawA01
3LG0A 3BS8A 1SZSA 3LVMA 4F5HA 3ISLA 4UHOA 1S09A 4KXKA 5EIGA 4OCAA 1N31A 2AY3A 3G8MA 3JU7A 2W7LA 3MAUA 2W8TA 3ZZJA 4ZM4A 3RBLA 1W7LA 1W23A 3DZZA 3FDBA 4B98A 1M0PA 1B9IA 2ZY3A 3EI8A 3KGXA 4ZWMA 3CQ6A 1H0CA 2G6WA 1GEYA 2CINA 3E9KA 1ARSA 2E7IA 3AATA 3FRKA 2CANA 2Z61A 3FQ8A 4RLGA 2VI8A 4EB5A 4IW7A 3CAIA 3WY7A 3ZRPA 2W7GA 3E6GA 3MKJA 1M6SA 3FFRA 1AJSA 4Y0DA 2X3LA 3E2FA 2VMPA 1GC3A 3GZDA 5D5SA 2AATA 2BI1A 2D65A 3ACZA 1BJOB 1X29A 3NTJA 3R4TA 1DJEA 2CJDA 2JJEA 3GETA 4CXQA 2QA3A 1ZC9A 3FTBA 3I5TA 3USFA 3BC8A 4KAMA 4ZSWA 5AX8A 3FQ7A 3ZZKA 2YOBA 1YIYA 1LC7A 3JW9A 3PD6B 3W1IA 3UAKA 3AENB 2EZ1A 3A2BA 4RITA 1S08A 1Z3ZA 2BI3A 2Z9WA 2W7JA 3EUCA 1IAYA 1IUGA 1WKHA 1M4NA 3EIBA 3QN6A 2HOYA 1AHYA 3PAAA 4WYGA 4WYFA 3MBBA 3DXVA 2VGTA 1JG8A 4UOYA 4UHMA 4WB0A 1QJ3A 4A0FA 3RI6A 1WYVA 3NRAA 3E2YA 1LW4A 1M0OA 2EZ2A 4MQPA 3JZLA 2DGMA 5J8QA 4WLJA 4BA5A 4WBTA 3LV2A 4Q6RA 3BN1A 3GJUA 1OXPA 3BV0A 2RFVA 5EIGB 1AHXA 4ZDPA 1O4SA 2X5DA 2ZP7A 3WKRA 4AOAA 1GC4A 1AICA 3H7FA 1MGVA 4JF0A 1LS3A 1TOIA 2HOXA 1GEXA 4E1OA 3NYTA 4IXSA 2AY8A 3OKSA 4LW2A 3AOVA 3WGBA 3FVXA 4KYOA 3A9YA 2ZSMA 1AHFA 1TPLA 3TFUA 1BQAA 5HXXA 2BI2A 3VAXA 5FT6A 2DOUA 2E7UA 4XK1A 4JEWA 1AJSB 1KL2A 1ASBA 1MLYA 1CQ6A 3B46A 3GZCA 1EG5A 2D64A 4XJPA 1FC4A 1UU1A 4A6UA 2HUIA 2GB3A 1D7SA 1BJ4A 2QMAA 2W7HA 4GSAA 1G7XA 3QM2A 2VGSA 2YKYA 1U08A 4MKKA 2VMTA 4N0WA 4R5ZA 4WYEA 4PVFA 4AO9A 4Q75A 1QIRA 3E2ZA 2VIBA 3R9AA 1BKGA 4CVQA 1G4XA 4F5FA 4L0OA 3AEJC 1XEYA 1SZUA 4OMAA 4ATPA 1JS6A 4LW4A 4WB0B 3RQ1A 2HP1A 3NYUA 1TOGA 3AV7A 2WKAA 4WYAA 1WYVB 2BIEA 3K28A 4AH3A 3JWBA 2ZJGA 3LVJA 4OT8A 4F5MA 1GC0A 1YOOA 5E5IA 1I41A 4DQ6A 1CQ7A 1ASFA 2HZPA 1ARIA 3AEJA 3VK2A 2YHKA 2VMNA 4E77A 1CJ0A 1CL1A 1GCKA 2AY2A 4TN4A 1MDZA 1OHYA 3NUBA 9AATA 3NX3A 3GSBA 2D5YA 1CQ8A 1YIZA 2ZUKA 2JJHA 1DTYA 1SVVA 2JISA 2R5CA 3BCAA 5LH9A 4GEBA 2E54A 4R5FA 4WXBA 1GDEA 1MDOA 1YJSA 3QPGA 3DXWA 3RCHA 2PB0A 4F5KA 3NUIA 2CB1A 3LY1A 2BIAA 3G7QA 4MQRA 4JE5A 3TQXA 3WCNA 1CZEA 3EZ1A 1OHWA 3F0HA 2R2NA 4ADBA 1T3IA 2BYLA 2AY9A 3FFHA 3FQAA 2AY5A 3GZDC 4ITXA 2VI9A 3KKIA 5HDMA 2YRRA 2D66A 3GR9A 4EMYA 4O6ZA 3UE8A 1QISA 5G09A 1W3UA 1TOKA 1Z7DA 1PMOA 5BJ4A 1LC5A 7AATA 1PG8A 1B9HA 3FZ6A 3HBXA 2VMXA 4Q76A 4W1XA 2C44A 2CJGA 1AAWA 4RJYA 3AOWA 3W1JA 2BYJA 1LK9A 1B4XA 4P7YA 1WYUA 4UQVA 3B1DA 3I16A 2AEVA 3II0A 2BHXA 4JEYA 5M49A 3WKSA 2W8UA 2W8JA 3B1CA 3CQ5A 3JTXA 4J5UA 4MSOA 4CBRA 4F5LA 4ADEA 4P3MA 4I8AA 1ARHA 3ZRRA 2X5FA 2GQNA 1ASDA 3ELEA 3CQ4A 1DJUA 1AKBA 1AY4A 2OGAA 2FN6A 4RAEA 2D63A 2VMUA 3BWOA 4XQ2A 2W7DA 3K7YA 4XAUA 1EQBA 1GEWA 5EUDA 1ZODA 2VMVA 4WXGA 4IY7A 1AX4A 3PDBB 4N0BA 1QZ9A 3N75A 2QLRA 5DB5A 3PDXA 1I29A 1TOEA 2ZY4A 3A9XA 2ZYJA 3FKDA 2BWOA 1AMQA 4WP0A 4TMRA 1W7MA 1B8GA 1FG3A 1W7NA 3KE3A 3E77A 4XJOA 5G2QA 2FM1A 3PJ0A 2X8UA 1AIAA 1O61A 5JAYA 4OBVA 2VGZA 1BS0A 2Z20A 5EUNA 1RV4A 2V1PA 2R5EA 4FFCA 1UU2A 3RBFA 1I43A 2VLHA 4W5KA 3NU7A 4ZDOA 5E4ZA 3DU4A 2VIAA 1C7OA 3FVSA 3MAFA 4MQQA 4J8LA 1YJZA 4Q31A 2YKUA 2JGTA 2WK8A 1AHEA 1S06A 4Y0IA 4Y0HA 4A00A 2V0YA 5HHYA 1AMSA 1AMRA 3QI6A 2OGEA 2CY8A 1C9CA 1CZCA 1RV3A 2CJHA 2OKJA 2HUUA 2EH6A 4UHNA 1DJ9A 3B1EA 3TCMA 1E5EA 3VK4A 1YJYA 3ELPA 2AY6A 4WYDA 1LKCA 1UKJA 4ADCA 3L44A 2VMRA 2VMYA 3IF2A 2PB2A 2VMSA 3DRDA 1BJWA 1ZOBA 1RVUA 1KMKA 3HDOA 1DGEA 3HMUA 4M2KA 2BI5A 4TV7A 4ZDLA 1KKJA 3T32A 4A6TA 1AMAA 1AIBA 1LW5A 1D7VA 1FG7A 4JEVA 1JS3A 3OP7A 4ZASA 3B8XA 2NMPA 1AKAA 3TFTA 1V72A 1IX7A 4IYOA 1X28A 1S0AA 3QGUA 1E5FA 5M4BA 1ARTA 3EI5A 3KGWA 2QBTA 2VGVA 2C81A 3EI7A 1KL1A 2BKWA 4OC9A 1IAXA 2C0RA 4XJMA 1ASNA 1AKCA 4QGRA 5TF5A 4F5GA 1ASMA 3FZ7A 1YAAA 3I4JA 3BWNC 4PFFA 2AY4A 2YRIA 2CFBA 3K40A 2PO3A 3UWCA 3BB8A 3VOMA 2W8VA 1D7RA 1G4VA 2YKVA 3BCXA 5M4DA 2W7MA 1IX8A 1WKGA 2OATA 1DFOA 1LC8A 4PIWA 1RVYA 2R0TA 3HQTA 4OTLA 3GWPA 2FNUA 3EZSA 1BQDA 3BWNA 3JWAA 2VMQA 2OQXA 3HL2A 3AEMC 1TOJA 4LNMA 2Z9VA 2VMOA 4K2MA 4AO4A 1TATA 3MAFB 1C4KA 3COGA 1V2EA 3A8UX 2ZSLA 4MKJA 5G4IA 2VMZA 1ASGA 2JJGA 1GC2A 3AEMA 3ZRQA 2GSAA 3WX9A 1MAQA 4IXZA 2VYCA 5G0AA 2QB2A 2VMWA 1ELUA 1C7GA 3TATA 2D7ZA 1SFFA 4RM1A 4F5IA 3WCOA 3FZ8A 4R8DA 2E7JA 2AEUA 1BT4A 2WK9A 2DR1A 3MEBA 5DJ1A 3PGYA 1IBJA 2CH1A 4JEXA 4WYCA 2CH2A 2GMUA 3DR7A 3F9TA 2YCPA 1WYTA 3H14A 1D7UA 3FD0A 4ISYA 1C0NA 3FDDA 3HT4A 4NOGA 3RUYA 1N8PA 2JJFA 4JE5D 5FT4A 5E3KA 4CXRA 1GBNA 3DODA 3ATHA 2JG2A 1PMMA 3MC6C 4CBSA 4EB7A 4IYOB 3DR4A 2YKXA 1GD9A 2AY1A 5EUEA 1VEFA 3MADA 3E2ZB 3PA9A 3EI6A 1QJ5A 3PPLA 2YCNA 3LVKA 4W1WA 2Z1ZA 1M32A 5FT5A 4EFFA 1ECXA 2BI9A 3MC6A 1I48A 2Z9XA 1ELQA 3WGCA 3LVLB 4BMKA 4E3QA 1KMJA 4DGTA 1OXOA 5FT8A 5IWQA 2O1BA 5F8VA 4GRXA 4JF1A 1BW0A 4A0GA 4B9BA 1CS1A 1KKPA 2W7FA 3IHJA 3NDNA 4A6RA 3P1TA 4JEZA 4U1TA 4RKDA 2HP2A 2D61A 3EIAA 3HVYA 4ITGA 1H1CA 3N0LA 4ZM3A 1ORDA 2AY7A 4ADDA 5K8BA 4WXFA 4F5JA 4PFNA 5EQCA 2GMSA 2W7EA 1AJRA 4A0RA 2DGLA 1IVRA 1MDXA 2R5CB 4RJ0A 1OATA 4WLHA 4W8IA 2CSTA 1IX6A 4GE9A 4GDYA 3RCHB 1M0NA 4AZKA 4W91A 5I92A 2W8WA 2DGKA 3ECDA 2F8JA 3VP6A 1AAMA 2W7KA 1ASLA 3HLMA 1AHGA 4MGRA 1QITA 1AY5A 3WLXA 4ATQA 4XEWA 5M46A 5DX5A 1J32A 5EFSA 1XI9A 2BIGA 1S07A 1ASAA 2EPJA 3CBFA 5EAVA 1X0MA 2QB3A 2TPLA 1V2DA 1BJNA 2VGWA 3PIUA 3AEPA 5LHAA 3P6KA 1AY8A 2HUFA 2XH1A 3F6TA 4A0HA 2CTZA 2VLFA 4M2JA 1WYTB 2Z9UA 2D7YA 3EI9A 3L8AA 1VJOA 4K2IA 3G0TA 1DKAA 2HORA 1WYUB 5EAAA 4HVKA 2Z67A 1TARA 1J04A 4ZSYA 4BA4A 3DYDA 2DKBA 1M7YA 4IXOA 3NNKA 1ASCA 2HOZA 1UU0A 3Q8NA 3ASBA 4GE4A 2Z1YA 4MY5A 4F4EA 4RKCA 3N5MA 4AZJA 1B5PA 3FVUA 4HF8A 4OBUA 3FCRA 1O69A 1CL2A 4W1VA 5DJ9A 4FL0A 4E3RA 3NYSA 4ZWVA 2FQ6A 2FNIA 3A9ZA 3FSLA 1YNUA 1VP4A 3M5UA 5G2PA 2YCTA 4A72A 4BQ0A 1EJIA 1C7NA 2W7IA 2EO5A 2EGYA 1M0QA 4ZLVA 8AATA 2BWPA 1MLZA 5D95A 1N2TA 1DGDA 1SPAA 1ASEA 2WK7A 3BCBA 1QGNA 4XJLA 1WSTA 1PFFA 2Q7WA 3AELA 3GBXA 4OYTA 5G4JA 4EU1A 1B5OA 1BJOA 2O7CA 3W1HA 3DC1A 1O62A 3WZFA 2FYFA 4K2BA 1OHVA 2O0RA 1JF9A 2ZY2A 3NU8A 4M2MA 1V2FA 1ARGA 2BWNA 4BHDA 4ZAHA 1D2FA 1X2AA 3D6KA 3PD6A 1SZKA 1IJIA 3AENA 5C6UA 4RIZA 2ZY5A 1TASA 4LNLA 4GE7A 4DBCA 2ORDA 4WD2A 3QHXA 3ASAA 4LNJA 3PDBA 5F9SA 4H51A 4U2HA 2C7TA 3AEOA 2OKKA 4R2NA 3LWSA 1MAPA 1SF2A 1Y4IA 1P3WA 3QBOA 4IX8A 3VK3A 4LC3A 1G7WA 2DKJA 2ZC0A 2XBNA 5BJ3A 2VGUA
chains in the Genus database with same CATH superfamily
3LG0A 3BS8A 1SZSA 3LVMA 4F5HA 3ISLA 4UHOA 1S09A 4KXKA 5EIGA 4OCAA 1N31A 2AY3A 3G8MA 3JU7A 2W7LA 3MAUA 2W8TA 3ZZJA 4ZM4A 3RBLA 1W7LA 1W23A 3DZZA 3FDBA 4B98A 1M0PA 1B9IA 2ZY3A 3EI8A 3KGXA 4ZWMA 3CQ6A 1H0CA 2G6WA 1GEYA 2CINA 3E9KA 1ARSA 2E7IA 3AATA 3FRKA 2CANA 2Z61A 3FQ8A 4RLGA 4K05A 2VI8A 4EB5A 4IW7A 3CAIA 3WY7A 3ZRPA 2W7GA 3E6GA 3MKJA 1M6SA 3FFRA 1AJSA 4Y0DA 2X3LA 3E2FA 2VMPA 1GC3A 3GZDA 5D5SA 2AATA 2BI1A 2D65A 3ACZA 1BJOB 1X29A 3NTJA 3R4TA 1DJEA 2CJDA 2JJEA 3GETA 4CXQA 2QA3A 1ZC9A 3FTBA 3I5TA 3USFA 3BC8A 4KAMA 4ZSWA 5AX8A 3FQ7A 3ZZKA 2YOBA 1YIYA 1LC7A 3JW9A 3PD6B 3W1IA 3N7NA 3UAKA 3AENB 2EZ1A 3A2BA 4RITA 1S08A 1Z3ZA 2BI3A 2Z9WA 2W7JA 3EUCA 1IAYA 1IUGA 1WKHA 1M4NA 3EIBA 3QN6A 2HOYA 1AHYA 3PAAA 4WYGA 4WYFA 3MBBA 3DXVA 3N4RA 2VGTA 1JG8A 4UOYA 4UHMA 4WB0A 1QJ3A 4A0FA 3RI6A 1WYVA 3NRAA 3E2YA 1LW4A 1M0OA 2EZ2A 4MQPA 3JZLA 2DGMA 5J8QA 4WLJA 4BA5A 4WBTA 3LV2A 4Q6RA 3BN1A 3GJUA 1OXPA 3BV0A 2RFVA 5EIGB 1AHXA 4ZDPA 1O4SA 2X5DA 2ZP7A 3WKRA 4AOAA 1GC4A 1AICA 3H7FA 1MGVA 4JF0A 1LS3A 1TOIA 2HOXA 1GEXA 4E1OA 3NYTA 4IXSA 2AY8A 3OKSA 2QSRA 4LW2A 3AOVA 3WGBA 3FVXA 4KYOA 3A9YA 2ZSMA 1AHFA 1TPLA 3TFUA 1BQAA 5HXXA 2BI2A 3VAXA 5FT6A 2DOUA 2E7UA 4XK1A 4JEWA 1AJSB 1KL2A 2FKIA 1ASBA 1MLYA 1CQ6A 3B46A 3GZCA 1EG5A 2D64A 4XJPA 1FC4A 1UU1A 4A6UA 2HUIA 2GB3A 1D7SA 1BJ4A 2QMAA 2W7HA 4GSAA 1G7XA 3H9XA 3QM2A 2VGSA 2YKYA 1U08A 4MKKA 2VMTA 4N0WA 4R5ZA 4WYEA 4PVFA 4AO9A 4Q75A 1QIRA 3E2ZA 2VIBA 3R9AA 1BKGA 4CVQA 1G4XA 4F5FA 4L0OA 3AEJC 1XEYA 1SZUA 4OMAA 4ATPA 1JS6A 4LW4A 4WB0B 3RQ1A 2HP1A 3NYUA 1TOGA 3AV7A 2WKAA 4WYAA 1WYVB 2BIEA 3K28A 4AH3A 3JWBA 2ZJGA 3LVJA 4OT8A 4F5MA 1GC0A 1YOOA 5E5IA 1I41A 4DQ6A 1CQ7A 1ASFA 2HZPA 1ARIA 3AEJA 3VK2A 2YHKA 2VMNA 4E77A 1CJ0A 1CL1A 1GCKA 2AY2A 4TN4A 1MDZA 1OHYA 3NUBA 9AATA 3NX3A 3GSBA 2D5YA 1CQ8A 1YIZA 2ZUKA 2JJHA 1DTYA 1SVVA 2JISA 2R5CA 3BCAA 5LH9A 4GEBA 2E54A 4R5FA 4WXBA 1GDEA 1MDOA 1YJSA 3QPGA 3DXWA 3RCHA 2PB0A 4F5KA 3NUIA 2CB1A 3LY1A 2BIAA 3G7QA 4MQRA 4JE5A 3TQXA 3WCNA 1CZEA 3EZ1A 1OHWA 3F0HA 2R2NA 4ADBA 1T3IA 2BYLA 2AY9A 3FFHA 3FQAA 2AY5A 3GZDC 4ITXA 2VI9A 3KKIA 5HDMA 2YRRA 2D66A 3GR9A 4EMYA 4O6ZA 3UE8A 1QISA 5G09A 1W3UA 1TOKA 1Z7DA 1PMOA 5BJ4A 1LC5A 7AATA 1PG8A 1B9HA 3FZ6A 2EYQA 3HBXA 2VMXA 4Q76A 4W1XA 2C44A 2CJGA 1AAWA 4RJYA 3AOWA 3W1JA 2BYJA 1LK9A 1B4XA 4P7YA 1WYUA 4UQVA 3B1DA 3I16A 2AEVA 3II0A 2BHXA 4JEYA 5M49A 3WKSA 2W8UA 2W8JA 3B1CA 3CQ5A 3JTXA 4J5UA 4MSOA 4CBRA 4F5LA 4ADEA 4P3MA 4I8AA 1ARHA 3ZRRA 2X5FA 2GQNA 1ASDA 3ELEA 3CQ4A 1DJUA 1AKBA 1AY4A 2OGAA 2FN6A 4RAEA 2D63A 2VMUA 3BWOA 4XQ2A 2W7DA 3K7YA 4XAUA 2WB6A 1EQBA 1GEWA 5EUDA 1ZODA 2VMVA 4WXGA 4IY7A 1AX4A 3PDBB 4N0BA 1QZ9A 3N75A 2QLRA 5DB5A 3PDXA 1I29A 1TOEA 2ZY4A 3A9XA 2ZYJA 3FKDA 2BWOA 1AMQA 4WP0A 4TMRA 1W7MA 1B8GA 1FG3A 1W7NA 3KE3A 3E77A 4XJOA 5G2QA 2FM1A 3PJ0A 2X8UA 1AIAA 1O61A 5JAYA 4OBVA 2VGZA 1BS0A 2Z20A 5EUNA 1RV4A 2V1PA 2R5EA 4FFCA 1UU2A 3RBFA 1I43A 2VLHA 4W5KA 3NU7A 4ZDOA 5E4ZA 3DU4A 2VIAA 1C7OA 3FVSA 3MAFA 4MQQA 4H63Q 4J8LA 1YJZA 4Q31A 2YKUA 2JGTA 2WK8A 1AHEA 1S06A 4Y0IA 4Y0HA 4A00A 2V0YA 5HHYA 1AMSA 1AMRA 3QI6A 2OGEA 2CY8A 1C9CA 1CZCA 1RV3A 2CJHA 2OKJA 2HUUA 2EH6A 4UHNA 1DJ9A 3B1EA 3TCMA 1E5EA 3VK4A 1YJYA 3ELPA 2AY6A 4WYDA 1LKCA 1UKJA 4ADCA 3L44A 2VMRA 2VMYA 3IF2A 2PB2A 1KAFA 2VMSA 3DRDA 1BJWA 1ZOBA 1RVUA 1KMKA 3HDOA 1DGEA 3HMUA 4M2KA 2BI5A 4TV7A 4ZDLA 1KKJA 3T32A 4A6TA 1AMAA 1AIBA 1LW5A 1D7VA 1FG7A 4JEVA 1JS3A 3OP7A 4ZASA 3B8XA 2NMPA 1AKAA 3TFTA 1V72A 1IX7A 4IYOA 1X28A 1S0AA 3QGUA 1E5FA 5M4BA 1ARTA 3EI5A 3KGWA 2QBTA 2VGVA 2C81A 3EI7A 1KL1A 2BKWA 4OC9A 1IAXA 2C0RA 4XJMA 1ASNA 1AKCA 4QGRA 5TF5A 4F5GA 1ASMA 3FZ7A 1YAAA 3I4JA 3BWNC 4PFFA 2AY4A 2YRIA 2CFBA 3K40A 2PO3A 3UWCA 3BB8A 3VOMA 2W8VA 1D7RA 1G4VA 2YKVA 3BCXA 5M4DA 2W7MA 1IX8A 1WKGA 2OATA 1DFOA 1LC8A 4PIWA 1RVYA 2R0TA 3HQTA 4OTLA 3GWPA 2FNUA 3EZSA 1BQDA 3BWNA 3JWAA 2VMQA 2OQXA 3HL2A 3AEMC 1TOJA 4LNMA 2Z9VA 2A1VA 2VMOA 4K2MA 4AO4A 1TATA 3MAFB 1C4KA 3COGA 1V2EA 3A8UX 2ZSLA 4MKJA 5G4IA 2VMZA 1ASGA 2JJGA 1GC2A 3AEMA 3ZRQA 2GSAA 3WX9A 1MAQA 4IXZA 2VYCA 5G0AA 2QB2A 2VMWA 1ELUA 5KTBA 1C7GA 3TATA 2D7ZA 1SFFA 4RM1A 4F5IA 3WCOA 3FZ8A 4R8DA 2E7JA 2AEUA 1BT4A 2WK9A 2DR1A 3MEBA 5DJ1A 3PGYA 1IBJA 2CH1A 4JEXA 4WYCA 2CH2A 2GMUA 3DR7A 3F9TA 2YCPA 1WYTA 3H14A 1D7UA 3FD0A 4ISYA 1C0NA 3FDDA 3HT4A 4NOGA 3RUYA 1N8PA 2JJFA 4JE5D 5FT4A 5E3KA 4CXRA 1GBNA 3DODA 3ATHA 2JG2A 1PMMA 3MC6C 4CBSA 4EB7A 4IYOB 3DR4A 2YKXA 1GD9A 2AY1A 5EUEA 1VEFA 3MADA 3E2ZB 3PA9A 3EI6A 1QJ5A 3PPLA 2YCNA 3LVKA 4W1WA 2Z1ZA 1M32A 5FT5A 4EFFA 1ECXA 2BI9A 3MC6A 1I48A 2Z9XA 1ELQA 3WGCA 3LVLB 4BMKA 4E3QA 1KMJA 4DGTA 1OXOA 5FT8A 5IWQA 2O1BA 5F8VA 4GRXA 4JF1A 1BW0A 4A0GA 4B9BA 1CS1A 1KKPA 2W7FA 3IHJA 3NDNA 4A6RA 3P1TA 4JEZA 4U1TA 4RKDA 2HP2A 2D61A 3EIAA 3HVYA 4ITGA 1H1CA 3N0LA 4ZM3A 1ORDA 2AY7A 4ADDA 5K8BA 4WXFA 4F5JA 4PFNA 5EQCA 2GMSA 2W7EA 1AJRA 4A0RA 2DGLA 1IVRA 1MDXA 2R5CB 4RJ0A 1OATA 4WLHA 4W8IA 2CSTA 1IX6A 3N4SA 4GE9A 4GDYA 3RCHB 1M0NA 4AZKA 4W91A 5I92A 2W8WA 2DGKA 3ECDA 2F8JA 3VP6A 1AAMA 2W7KA 1ASLA 3HLMA 1AHGA 4MGRA 1QITA 1AY5A 3WLXA 4ATQA 4XEWA 5M46A 5DX5A 1J32A 5EFSA 1XI9A 2BIGA 1S07A 1ASAA 2EPJA 3CBFA 5EAVA 1X0MA 2QB3A 2TPLA 1V2DA 1BJNA 2VGWA 3PIUA 3AEPA 5LHAA 3N4XA 3P6KA 1AY8A 2HUFA 2XH1A 3F6TA 4A0HA 2CTZA 2VLFA 4M2JA 1WYTB 2Z9UA 2D7YA 3EI9A 3L8AA 1VJOA 4K2IA 3G0TA 1DKAA 2HORA 1WYUB 5EAAA 4HVKA 2G7JA 2Z67A 1TARA 1J04A 4ZSYA 4BA4A 3DYDA 2DKBA 1M7YA 4IXOA 3NNKA 1ASCA 2HOZA 1UU0A 3Q8NA 3ASBA 4GE4A 2Z1YA 4MY5A 4F4EA 4RKCA 3N5MA 4AZJA 1B5PA 3FVUA 4HF8A 4OBUA 3FCRA 1O69A 1CL2A 4W1VA 5DJ9A 4FL0A 4E3RA 3NYSA 4ZWVA 2FQ6A 2FNIA 3A9ZA 2KFPA 3FSLA 1YNUA 1VP4A 3M5UA 5G2PA 2YCTA 4A72A 4BQ0A 1EJIA 1C7NA 2W7IA 2EO5A 2EGYA 1M0QA 4ZLVA 8AATA 2BWPA 1MLZA 5D95A 1N2TA 1DGDA 1SPAA 1ASEA 2WK7A 3BCBA 1QGNA 4XJLA 1WSTA 1PFFA 2Q7WA 3AELA 3GBXA 4OYTA 5G4JA 4EU1A 1B5OA 1BJOA 2O7CA 3W1HA 3DC1A 1O62A 3WZFA 2FYFA 4K2BA 1OHVA 2O0RA 1JF9A 2ZY2A 3NU8A 4M2MA 1V2FA 1ARGA 2BWNA 4BHDA 4ZAHA 1D2FA 1X2AA 3D6KA 3PD6A 1SZKA 1IJIA 3AENA 5C6UA 4RIZA 2ZY5A 1TASA 4LNLA 4GE7A 4DBCA 2ORDA 4WD2A 3QHXA 3ASAA 4LNJA 3PDBA 5F9SA 4H51A 4U2HA 2C7TA 3AEOA 2OKKA 4R2NA 3LWSA 1MAPA 1SF2A 1Y4IA 1P3WA 3QBOA 4IX8A 3VK3A 4LC3A 1G7WA 2DKJA 2ZC0A 2XBNA 5BJ3A 2VGUA
chains in the Genus database with same CATH topology
3LG0A 3BS8A 1SZSA 3LVMA 4F5HA 3ISLA 4UHOA 1S09A 4KXKA 5EIGA 4OCAA 1N31A 2AY3A 3G8MA 3JU7A 2W7LA 3MAUA 2W8TA 3ZZJA 4ZM4A 3RBLA 1W7LA 1W23A 3DZZA 3FDBA 4B98A 1M0PA 1B9IA 2ZY3A 3EI8A 3KGXA 4ZWMA 3CQ6A 1H0CA 2G6WA 1GEYA 2CINA 3E9KA 1ARSA 2E7IA 3AATA 3FRKA 2CANA 2Z61A 3FQ8A 4RLGA 4K05A 2VI8A 4EB5A 4IW7A 3CAIA 3WY7A 3ZRPA 2W7GA 3E6GA 3MKJA 1M6SA 3FFRA 1AJSA 4Y0DA 2X3LA 3E2FA 2VMPA 1GC3A 3GZDA 5D5SA 2AATA 2BI1A 2D65A 3ACZA 1BJOB 1X29A 3NTJA 3R4TA 1DJEA 2CJDA 2JJEA 3GETA 4CXQA 2QA3A 1ZC9A 3FTBA 3I5TA 3USFA 3BC8A 4KAMA 4ZSWA 5AX8A 3FQ7A 3ZZKA 2YOBA 1YIYA 1LC7A 3JW9A 3PD6B 3W1IA 3N7NA 3UAKA 3AENB 2EZ1A 3A2BA 4RITA 1S08A 1Z3ZA 2BI3A 2Z9WA 2W7JA 3EUCA 1IAYA 1IUGA 1WKHA 1M4NA 3EIBA 3QN6A 2HOYA 1AHYA 3PAAA 4WYGA 4WYFA 3MBBA 3DXVA 3N4RA 2VGTA 1JG8A 4UOYA 4UHMA 4WB0A 1QJ3A 4A0FA 3RI6A 1WYVA 3NRAA 3E2YA 1LW4A 1M0OA 2EZ2A 4MQPA 3JZLA 2DGMA 5J8QA 4WLJA 4BA5A 4WBTA 3LV2A 4Q6RA 3BN1A 3GJUA 1OXPA 3BV0A 2RFVA 5EIGB 1AHXA 4ZDPA 1O4SA 2X5DA 2ZP7A 3WKRA 4AOAA 1GC4A 1AICA 3H7FA 1MGVA 4JF0A 1LS3A 1TOIA 2HOXA 1GEXA 4E1OA 3NYTA 4IXSA 2AY8A 3OKSA 2QSRA 4LW2A 3AOVA 3WGBA 3FVXA 4KYOA 3A9YA 2ZSMA 1AHFA 1TPLA 3TFUA 1BQAA 5HXXA 2BI2A 3VAXA 5FT6A 2DOUA 2E7UA 4XK1A 4JEWA 1AJSB 1KL2A 2FKIA 1ASBA 1MLYA 1CQ6A 3B46A 3GZCA 1EG5A 2D64A 4XJPA 1FC4A 1UU1A 4A6UA 2HUIA 2GB3A 1D7SA 1BJ4A 2QMAA 2W7HA 4GSAA 1G7XA 3H9XA 3QM2A 2VGSA 2YKYA 1U08A 4MKKA 2VMTA 4N0WA 4R5ZA 4WYEA 4PVFA 4AO9A 4Q75A 1QIRA 3E2ZA 2VIBA 3R9AA 1BKGA 4CVQA 1G4XA 4F5FA 4L0OA 3AEJC 1XEYA 1SZUA 4OMAA 4ATPA 1JS6A 4LW4A 4WB0B 3RQ1A 2HP1A 3NYUA 1TOGA 3AV7A 2WKAA 4WYAA 1WYVB 2BIEA 3K28A 4AH3A 3JWBA 2ZJGA 3LVJA 4OT8A 4F5MA 1GC0A 1YOOA 5E5IA 1I41A 4DQ6A 1CQ7A 1ASFA 2HZPA 1ARIA 3AEJA 3VK2A 2YHKA 2VMNA 4E77A 1CJ0A 1CL1A 1GCKA 2AY2A 4TN4A 1MDZA 1OHYA 3NUBA 9AATA 3NX3A 3GSBA 2D5YA 1CQ8A 1YIZA 2ZUKA 2JJHA 1DTYA 1SVVA 2JISA 2R5CA 3BCAA 5LH9A 4GEBA 2E54A 4R5FA 4WXBA 1GDEA 1MDOA 1YJSA 3QPGA 3DXWA 3RCHA 2PB0A 4F5KA 3NUIA 2CB1A 3LY1A 2BIAA 3G7QA 4MQRA 4JE5A 3TQXA 3WCNA 1CZEA 3EZ1A 1OHWA 3F0HA 2R2NA 4ADBA 1T3IA 2BYLA 2AY9A 3FFHA 3FQAA 2AY5A 3GZDC 4ITXA 2VI9A 3KKIA 5HDMA 2YRRA 2D66A 3GR9A 4EMYA 4O6ZA 3UE8A 1QISA 5G09A 1W3UA 1TOKA 1Z7DA 1PMOA 5BJ4A 1LC5A 7AATA 1PG8A 1B9HA 3FZ6A 2EYQA 3HBXA 2VMXA 4Q76A 4W1XA 2C44A 2CJGA 1AAWA 4RJYA 3AOWA 3W1JA 2BYJA 1LK9A 1B4XA 4P7YA 1WYUA 4UQVA 3B1DA 3I16A 2AEVA 3II0A 2BHXA 4JEYA 5M49A 3WKSA 2W8UA 2W8JA 3B1CA 3CQ5A 3JTXA 4J5UA 4MSOA 4CBRA 4F5LA 4ADEA 4P3MA 4I8AA 1ARHA 3ZRRA 2X5FA 2GQNA 1ASDA 3ELEA 3CQ4A 1DJUA 1AKBA 1AY4A 2OGAA 2FN6A 4RAEA 2D63A 2VMUA 3BWOA 4XQ2A 2W7DA 3K7YA 4XAUA 2WB6A 1EQBA 1GEWA 5EUDA 1ZODA 2VMVA 4WXGA 4IY7A 1AX4A 3PDBB 4N0BA 1QZ9A 3N75A 2QLRA 5DB5A 3PDXA 1I29A 1TOEA 2ZY4A 3A9XA 2ZYJA 3FKDA 2BWOA 1AMQA 4WP0A 4TMRA 1W7MA 1B8GA 1FG3A 1W7NA 3KE3A 3E77A 4XJOA 5G2QA 2FM1A 3PJ0A 2X8UA 1AIAA 1O61A 5JAYA 4OBVA 2VGZA 1BS0A 2Z20A 5EUNA 1RV4A 2V1PA 2R5EA 4FFCA 1UU2A 3RBFA 1I43A 2VLHA 4W5KA 3NU7A 4ZDOA 5E4ZA 3DU4A 2VIAA 1C7OA 3FVSA 3MAFA 4MQQA 4H63Q 4J8LA 1YJZA 4Q31A 2YKUA 2JGTA 2WK8A 1AHEA 1S06A 4Y0IA 4Y0HA 4A00A 2V0YA 5HHYA 1AMSA 1AMRA 3QI6A 2OGEA 2CY8A 1C9CA 1CZCA 1RV3A 2CJHA 2OKJA 2HUUA 2EH6A 4UHNA 1DJ9A 3B1EA 3TCMA 1E5EA 3VK4A 1YJYA 3ELPA 2AY6A 4WYDA 1LKCA 1UKJA 4ADCA 3L44A 2VMRA 2VMYA 3IF2A 2PB2A 2VMSA 3DRDA 1BJWA 1ZOBA 1RVUA 1KMKA 3HDOA 1DGEA 3HMUA 4M2KA 2BI5A 4TV7A 4ZDLA 1KKJA 3T32A 4A6TA 1AMAA 1AIBA 1LW5A 1D7VA 1FG7A 4JEVA 1JS3A 3OP7A 4ZASA 3B8XA 2NMPA 1AKAA 3TFTA 1V72A 1IX7A 4IYOA 1X28A 1S0AA 3QGUA 1E5FA 5M4BA 1ARTA 3EI5A 3KGWA 2QBTA 2VGVA 2C81A 3EI7A 1KL1A 2BKWA 4OC9A 1IAXA 2C0RA 4XJMA 1ASNA 1AKCA 4QGRA 5TF5A 4F5GA 1ASMA 3FZ7A 1YAAA 3I4JA 3BWNC 4PFFA 2AY4A 2YRIA 2CFBA 3K40A 2PO3A 3UWCA 3BB8A 3VOMA 2W8VA 1D7RA 1G4VA 2YKVA 3BCXA 5M4DA 2W7MA 1IX8A 1WKGA 2OATA 1DFOA 1LC8A 4PIWA 1RVYA 2R0TA 3HQTA 4OTLA 3GWPA 2FNUA 3EZSA 1BQDA 3BWNA 3JWAA 2VMQA 2OQXA 3HL2A 3AEMC 1TOJA 4LNMA 2Z9VA 2A1VA 2VMOA 4K2MA 4AO4A 1TATA 3MAFB 1C4KA 3COGA 1V2EA 3A8UX 2ZSLA 4MKJA 5G4IA 2VMZA 1ASGA 2JJGA 1GC2A 3AEMA 3ZRQA 2GSAA 3WX9A 1MAQA 4IXZA 2VYCA 5G0AA 2QB2A 2VMWA 1ELUA 5KTBA 1C7GA 3TATA 2D7ZA 1SFFA 4RM1A 4F5IA 3WCOA 3FZ8A 4R8DA 2E7JA 2AEUA 1BT4A 2WK9A 2DR1A 3MEBA 5DJ1A 3PGYA 1IBJA 2CH1A 4JEXA 4WYCA 2CH2A 2GMUA 3DR7A 3F9TA 2YCPA 1WYTA 3H14A 1D7UA 3FD0A 4ISYA 1C0NA 3FDDA 3HT4A 4NOGA 3RUYA 1N8PA 2JJFA 4JE5D 5FT4A 5E3KA 4CXRA 1GBNA 3DODA 3ATHA 2JG2A 1PMMA 3MC6C 4CBSA 4EB7A 4IYOB 3DR4A 2YKXA 1GD9A 2AY1A 5EUEA 1VEFA 3MADA 3E2ZB 3PA9A 3EI6A 1QJ5A 3PPLA 2YCNA 3LVKA 4W1WA 2Z1ZA 1M32A 5FT5A 4EFFA 1ECXA 2BI9A 3MC6A 1I48A 2Z9XA 1ELQA 3WGCA 3LVLB 4BMKA 4E3QA 1KMJA 4DGTA 1OXOA 5FT8A 5IWQA 2O1BA 5F8VA 4GRXA 4JF1A 1BW0A 4A0GA 4B9BA 1CS1A 1KKPA 2W7FA 3IHJA 3NDNA 4A6RA 3P1TA 4JEZA 4U1TA 4RKDA 2HP2A 2D61A 3EIAA 3HVYA 4ITGA 1H1CA 3N0LA 4ZM3A 1ORDA 2AY7A 4ADDA 5K8BA 4WXFA 4F5JA 4PFNA 5EQCA 2GMSA 2W7EA 1AJRA 4A0RA 2DGLA 1IVRA 1MDXA 2R5CB 4RJ0A 1OATA 4WLHA 4W8IA 2CSTA 1IX6A 3N4SA 4GE9A 4GDYA 3RCHB 1M0NA 4AZKA 4W91A 5I92A 2W8WA 2DGKA 3ECDA 2F8JA 3VP6A 1AAMA 2W7KA 1ASLA 3HLMA 1AHGA 4MGRA 1QITA 1AY5A 3WLXA 4ATQA 4XEWA 5M46A 5DX5A 1J32A 5EFSA 1XI9A 2BIGA 1S07A 1ASAA 2EPJA 3CBFA 5EAVA 1X0MA 2QB3A 2TPLA 1V2DA 1BJNA 2VGWA 3PIUA 3AEPA 5LHAA 3N4XA 3P6KA 1AY8A 2HUFA 2XH1A 3F6TA 4A0HA 2CTZA 2VLFA 4M2JA 1WYTB 2Z9UA 2D7YA 3EI9A 3L8AA 1VJOA 4K2IA 3G0TA 1DKAA 2HORA 1WYUB 5EAAA 4HVKA 2G7JA 2Z67A 1TARA 1J04A 4ZSYA 4BA4A 3DYDA 2DKBA 1M7YA 4IXOA 3NNKA 1ASCA 2HOZA 1UU0A 3Q8NA 3ASBA 4GE4A 2Z1YA 4MY5A 4F4EA 4RKCA 3N5MA 4AZJA 1B5PA 3FVUA 4HF8A 4OBUA 3FCRA 1O69A 1CL2A 4W1VA 5DJ9A 4FL0A 4E3RA 3NYSA 4ZWVA 2FQ6A 2FNIA 3A9ZA 2KFPA 3FSLA 1YNUA 1VP4A 3M5UA 5G2PA 2YCTA 4A72A 4BQ0A 1EJIA 1C7NA 2W7IA 2EO5A 2EGYA 1M0QA 4ZLVA 8AATA 2BWPA 1MLZA 5D95A 1N2TA 1DGDA 1SPAA 1ASEA 2WK7A 3BCBA 1QGNA 4XJLA 1WSTA 1PFFA 2Q7WA 3AELA 3GBXA 4OYTA 5G4JA 4EU1A 1B5OA 1BJOA 2O7CA 3W1HA 3DC1A 1O62A 3WZFA 2FYFA 4K2BA 1OHVA 2O0RA 1JF9A 2ZY2A 3NU8A 4M2MA 1V2FA 1ARGA 2BWNA 4BHDA 4ZAHA 1D2FA 1X2AA 3D6KA 3PD6A 1SZKA 1IJIA 3AENA 5C6UA 4RIZA 2ZY5A 1TASA 4LNLA 4GE7A 4DBCA 2ORDA 4WD2A 3QHXA 3ASAA 4LNJA 3PDBA 5F9SA 4H51A 4U2HA 2C7TA 3AEOA 2OKKA 4R2NA 3LWSA 1MAPA 1SF2A 1Y4IA 1P3WA 3QBOA 4IX8A 3VK3A 4LC3A 1G7WA 2DKJA 2ZC0A 2XBNA 5BJ3A 2VGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LG0 A;  3BS8 A;  1SZS A;  3LVM A;  4F5H A;  3ISL A;  4UHO A;  1S09 A;  4KXK A;  5EIG A;  4OCA A;  1N31 A;  2AY3 A;  3G8M A;  3JU7 A;  2W7L A;  3MAU A;  2W8T A;  3ZZJ A;  4ZM4 A;  3RBL A;  1W7L A;  1W23 A;  3DZZ A;  3FDB A;  4B98 A;  1M0P A;  1B9I A;  2ZY3 A;  3EI8 A;  3KGX A;  4ZWM A;  3CQ6 A;  1H0C A;  2G6W A;  1GEY A;  2CIN A;  3E9K A;  1ARS A;  2E7I A;  3AAT A;  3FRK A;  2CAN A;  2Z61 A;  3FQ8 A;  4RLG A;  2VI8 A;  4EB5 A;  4IW7 A;  3CAI A;  3WY7 A;  3ZRP A;  2W7G A;  3E6G A;  3MKJ A;  1M6S A;  3FFR A;  1AJS A;  4Y0D A;  2X3L A;  3E2F A;  2VMP A;  1GC3 A;  3GZD A;  5D5S A;  2AAT A;  2BI1 A;  2D65 A;  3ACZ A;  1BJO B;  1X29 A;  3NTJ A;  3R4T A;  1DJE A;  2CJD A;  2JJE A;  3GET A;  4CXQ A;  2QA3 A;  1ZC9 A;  3FTB A;  3I5T A;  3USF A;  3BC8 A;  4KAM A;  4ZSW A;  5AX8 A;  3FQ7 A;  3ZZK A;  2YOB A;  1YIY A;  1LC7 A;  3JW9 A;  3PD6 B;  3W1I A;  3UAK A;  3AEN B;  2EZ1 A;  3A2B A;  4RIT A;  1S08 A;  1Z3Z A;  2BI3 A;  2Z9W A;  2W7J A;  3EUC A;  1IAY A;  1IUG A;  1WKH A;  1M4N A;  3EIB A;  3QN6 A;  2HOY A;  1AHY A;  3PAA A;  4WYG A;  4WYF A;  3MBB A;  3DXV A;  2VGT A;  1JG8 A;  4UOY A;  4UHM A;  4WB0 A;  1QJ3 A;  4A0F A;  3RI6 A;  1WYV A;  3NRA A;  3E2Y A;  1LW4 A;  1M0O A;  2EZ2 A;  4MQP A;  3JZL A;  2DGM A;  5J8Q A;  4WLJ A;  4BA5 A;  4WBT A;  3LV2 A;  4Q6R A;  3BN1 A;  3GJU A;  1OXP A;  3BV0 A;  2RFV A;  5EIG B;  1AHX A;  4ZDP A;  1O4S A;  2X5D A;  2ZP7 A;  3WKR A;  4AOA A;  1GC4 A;  1AIC A;  3H7F A;  1MGV A;  4JF0 A;  1LS3 A;  1TOI A;  2HOX A;  1GEX A;  4E1O A;  3NYT A;  4IXS A;  2AY8 A;  3OKS A;  4LW2 A;  3AOV A;  3WGB A;  3FVX A;  4KYO A;  3A9Y A;  2ZSM A;  1AHF A;  1TPL A;  3TFU A;  1BQA A;  5HXX A;  2BI2 A;  3VAX A;  5FT6 A;  2DOU A;  2E7U A;  4XK1 A;  4JEW A;  1AJS B;  1KL2 A;  1ASB A;  1MLY A;  1CQ6 A;  3B46 A;  3GZC A;  1EG5 A;  2D64 A;  4XJP A;  1FC4 A;  1UU1 A;  4A6U A;  2HUI A;  2GB3 A;  1D7S A;  1BJ4 A;  2QMA A;  2W7H A;  4GSA A;  1G7X A;  3QM2 A;  2VGS A;  2YKY A;  1U08 A;  4MKK A;  2VMT A;  4N0W A;  4R5Z A;  4WYE A;  4PVF A;  4AO9 A;  4Q75 A;  1QIR A;  3E2Z A;  2VIB A;  3R9A A;  1BKG A;  4CVQ A;  1G4X A;  4F5F A;  4L0O A;  3AEJ C;  1XEY A;  1SZU A;  4OMA A;  4ATP A;  1JS6 A;  4LW4 A;  4WB0 B;  3RQ1 A;  2HP1 A;  3NYU A;  1TOG A;  3AV7 A;  2WKA A;  4WYA A;  1WYV B;  2BIE A;  3K28 A;  4AH3 A;  3JWB A;  2ZJG A;  3LVJ A;  4OT8 A;  4F5M A;  1GC0 A;  1YOO A;  5E5I A;  1I41 A;  4DQ6 A;  1CQ7 A;  1ASF A;  2HZP A;  1ARI A;  3AEJ A;  3VK2 A;  2YHK A;  2VMN A;  4E77 A;  1CJ0 A;  1CL1 A;  1GCK A;  2AY2 A;  4TN4 A;  1MDZ A;  1OHY A;  3NUB A;  9AAT A;  3NX3 A;  3GSB A;  2D5Y A;  1CQ8 A;  1YIZ A;  2ZUK A;  2JJH A;  1DTY A;  1SVV A;  2JIS A;  2R5C A;  3BCA A;  5LH9 A;  4GEB A;  2E54 A;  4R5F A;  4WXB A;  1GDE A;  1MDO A;  1YJS A;  3QPG A;  3DXW A;  3RCH A;  2PB0 A;  4F5K A;  3NUI A;  2CB1 A;  3LY1 A;  2BIA A;  3G7Q A;  4MQR A;  4JE5 A;  3TQX A;  3WCN A;  1CZE A;  3EZ1 A;  1OHW A;  3F0H A;  2R2N A;  4ADB A;  1T3I A;  2BYL A;  2AY9 A;  3FFH A;  3FQA A;  2AY5 A;  3GZD C;  4ITX A;  2VI9 A;  3KKI A;  5HDM A;  2YRR A;  2D66 A;  3GR9 A;  4EMY A;  4O6Z A;  3UE8 A;  1QIS A;  5G09 A;  1W3U A;  1TOK A;  1Z7D A;  1PMO A;  5BJ4 A;  1LC5 A;  7AAT A;  1PG8 A;  1B9H A;  3FZ6 A;  3HBX A;  2VMX A;  4Q76 A;  4W1X A;  2C44 A;  2CJG A;  1AAW A;  4RJY A;  3AOW A;  3W1J A;  2BYJ A;  1LK9 A;  1B4X A;  4P7Y A;  1WYU A;  4UQV A;  3B1D A;  3I16 A;  2AEV A;  3II0 A;  2BHX A;  4JEY A;  5M49 A;  3WKS A;  2W8U A;  2W8J A;  3B1C A;  3CQ5 A;  3JTX A;  4J5U A;  4MSO A;  4CBR A;  4F5L A;  4ADE A;  4P3M A;  4I8A A;  1ARH A;  3ZRR A;  2X5F A;  2GQN A;  1ASD A;  3ELE A;  3CQ4 A;  1DJU A;  1AKB A;  1AY4 A;  2OGA A;  2FN6 A;  4RAE A;  2D63 A;  2VMU A;  3BWO A;  4XQ2 A;  2W7D A;  3K7Y A;  4XAU A;  1EQB A;  1GEW A;  5EUD A;  1ZOD A;  2VMV A;  4WXG A;  4IY7 A;  1AX4 A;  3PDB B;  4N0B A;  1QZ9 A;  3N75 A;  2QLR A;  5DB5 A;  3PDX A;  1I29 A;  1TOE A;  2ZY4 A;  3A9X A;  2ZYJ A;  3FKD A;  2BWO A;  1AMQ A;  4WP0 A;  4TMR A;  1W7M A;  1B8G A;  1FG3 A;  1W7N A;  3KE3 A;  3E77 A;  4XJO A;  5G2Q A;  2FM1 A;  3PJ0 A;  2X8U A;  1AIA A;  1O61 A;  5JAY A;  4OBV A;  2VGZ A;  1BS0 A;  2Z20 A;  5EUN A;  1RV4 A;  2V1P A;  2R5E A;  4FFC A;  1UU2 A;  3RBF A;  1I43 A;  2VLH A;  4W5K A;  3NU7 A;  4ZDO A;  5E4Z A;  3DU4 A;  2VIA A;  1C7O A;  3FVS A;  3MAF A;  4MQQ A;  4J8L A;  1YJZ A;  4Q31 A;  2YKU A;  2JGT A;  2WK8 A;  1AHE A;  1S06 A;  4Y0I A;  4Y0H A;  4A00 A;  2V0Y A;  5HHY A;  1AMS A;  1AMR A;  3QI6 A;  2OGE A;  2CY8 A;  1C9C A;  1CZC A;  1RV3 A;  2CJH A;  2OKJ A;  2HUU A;  2EH6 A;  4UHN A;  1DJ9 A;  3B1E A;  3TCM A;  1E5E A;  3VK4 A;  1YJY A;  3ELP A;  2AY6 A;  4WYD A;  1LKC A;  1UKJ A;  4ADC A;  3L44 A;  2VMR A;  2VMY A;  3IF2 A;  2PB2 A;  2VMS A;  3DRD A;  1BJW A;  1ZOB A;  1RVU A;  1KMK A;  3HDO A;  1DGE A;  3HMU A;  4M2K A;  2BI5 A;  4TV7 A;  4ZDL A;  1KKJ A;  3T32 A;  4A6T A;  1AMA A;  1AIB A;  1LW5 A;  1D7V A;  1FG7 A;  4JEV A;  1JS3 A;  3OP7 A;  4ZAS A;  3B8X A;  2NMP A;  1AKA A;  3TFT A;  1V72 A;  1IX7 A;  4IYO A;  1X28 A;  1S0A A;  3QGU A;  1E5F A;  5M4B A;  1ART A;  3EI5 A;  3KGW A;  2QBT A;  2VGV A;  2C81 A;  3EI7 A;  1KL1 A;  2BKW A;  4OC9 A;  1IAX A;  2C0R A;  4XJM A;  1ASN A;  1AKC A;  4QGR A;  5TF5 A;  4F5G A;  1ASM A;  3FZ7 A;  1YAA A;  3I4J A;  3BWN C;  4PFF A;  2AY4 A;  2YRI A;  2CFB A;  3K40 A;  2PO3 A;  3UWC A;  3BB8 A;  3VOM A;  2W8V A;  1D7R A;  1G4V A;  2YKV A;  3BCX A;  5M4D A;  2W7M A;  1IX8 A;  1WKG A;  2OAT A;  1DFO A;  1LC8 A;  4PIW A;  1RVY A;  2R0T A;  3HQT A;  4OTL A;  3GWP A;  2FNU A;  3EZS A;  1BQD A;  3BWN A;  3JWA A;  2VMQ A;  2OQX A;  3HL2 A;  3AEM C;  1TOJ A;  4LNM A;  2Z9V A;  2VMO A;  4K2M A;  4AO4 A;  1TAT A;  3MAF B;  1C4K A;  3COG A;  1V2E A;  3A8U X;  2ZSL A;  4MKJ A;  5G4I A;  2VMZ A;  1ASG A;  2JJG A;  1GC2 A;  3AEM A;  3ZRQ A;  2GSA A;  3WX9 A;  1MAQ A;  4IXZ A;  2VYC A;  5G0A A;  2QB2 A;  2VMW A;  1ELU A;  1C7G A;  3TAT A;  2D7Z A;  1SFF A;  4RM1 A;  4F5I A;  3WCO A;  3FZ8 A;  4R8D A;  2E7J A;  2AEU A;  1BT4 A;  2WK9 A;  2DR1 A;  3MEB A;  5DJ1 A;  3PGY A;  1IBJ A;  2CH1 A;  4JEX A;  4WYC A;  2CH2 A;  2GMU A;  3DR7 A;  3F9T A;  2YCP A;  1WYT A;  3H14 A;  1D7U A;  3FD0 A;  4ISY A;  1C0N A;  3FDD A;  3HT4 A;  4NOG A;  3RUY A;  1N8P A;  2JJF A;  4JE5 D;  5FT4 A;  5E3K A;  4CXR A;  1GBN A;  3DOD A;  3ATH A;  2JG2 A;  1PMM A;  3MC6 C;  4CBS A;  4EB7 A;  4IYO B;  3DR4 A;  2YKX A;  1GD9 A;  2AY1 A;  5EUE A;  1VEF A;  3MAD A;  3E2Z B;  3PA9 A;  3EI6 A;  1QJ5 A;  3PPL A;  2YCN A;  3LVK A;  4W1W A;  2Z1Z A;  1M32 A;  5FT5 A;  4EFF A;  1ECX A;  2BI9 A;  3MC6 A;  1I48 A;  2Z9X A;  1ELQ A;  3WGC A;  3LVL B;  4BMK A;  4E3Q A;  1KMJ A;  4DGT A;  1OXO A;  5FT8 A;  5IWQ A;  2O1B A;  5F8V A;  4GRX A;  4JF1 A;  1BW0 A;  4A0G A;  4B9B A;  1CS1 A;  1KKP A;  2W7F A;  3IHJ A;  3NDN A;  4A6R A;  3P1T A;  4JEZ A;  4U1T A;  4RKD A;  2HP2 A;  2D61 A;  3EIA A;  3HVY A;  4ITG A;  1H1C A;  3N0L A;  4ZM3 A;  1ORD A;  2AY7 A;  4ADD A;  5K8B A;  4WXF A;  4F5J A;  4PFN A;  5EQC A;  2GMS A;  2W7E A;  1AJR A;  4A0R A;  2DGL A;  1IVR A;  1MDX A;  2R5C B;  4RJ0 A;  1OAT A;  4WLH A;  4W8I A;  2CST A;  1IX6 A;  4GE9 A;  4GDY A;  3RCH B;  1M0N A;  4AZK A;  4W91 A;  5I92 A;  2W8W A;  2DGK A;  3ECD A;  2F8J A;  3VP6 A;  1AAM A;  2W7K A;  1ASL A;  3HLM A;  1AHG A;  4MGR A;  1QIT A;  1AY5 A;  3WLX A;  4ATQ A;  4XEW A;  5M46 A;  5DX5 A;  1J32 A;  5EFS A;  1XI9 A;  2BIG A;  1S07 A;  1ASA A;  2EPJ A;  3CBF A;  5EAV A;  1X0M A;  2QB3 A;  2TPL A;  1V2D A;  1BJN A;  2VGW A;  3PIU A;  3AEP A;  5LHA A;  3P6K A;  1AY8 A;  2HUF A;  2XH1 A;  3F6T A;  4A0H A;  2CTZ A;  2VLF A;  4M2J A;  1WYT B;  2Z9U A;  2D7Y A;  3EI9 A;  3L8A A;  1VJO A;  4K2I A;  3G0T A;  1DKA A;  2HOR A;  1WYU B;  5EAA A;  4HVK A;  2Z67 A;  1TAR A;  1J04 A;  4ZSY A;  4BA4 A;  3DYD A;  2DKB A;  1M7Y A;  4IXO A;  3NNK A;  1ASC A;  2HOZ A;  1UU0 A;  3Q8N A;  3ASB A;  4GE4 A;  2Z1Y A;  4MY5 A;  4F4E A;  4RKC A;  3N5M A;  4AZJ A;  1B5P A;  3FVU A;  4HF8 A;  4OBU A;  3FCR A;  1O69 A;  1CL2 A;  4W1V A;  5DJ9 A;  4FL0 A;  4E3R A;  3NYS A;  4ZWV A;  2FQ6 A;  2FNI A;  3A9Z A;  3FSL A;  1YNU A;  1VP4 A;  3M5U A;  5G2P A;  2YCT A;  4A72 A;  4BQ0 A;  1EJI A;  1C7N A;  2W7I A;  2EO5 A;  2EGY A;  1M0Q A;  4ZLV A;  8AAT A;  2BWP A;  1MLZ A;  5D95 A;  1N2T A;  1DGD A;  1SPA A;  1ASE A;  2WK7 A;  3BCB A;  1QGN A;  4XJL A;  1WST A;  1PFF A;  2Q7W A;  3AEL A;  3GBX A;  4OYT A;  5G4J A;  4EU1 A;  1B5O A;  1BJO A;  2O7C A;  3W1H A;  3DC1 A;  1O62 A;  3WZF A;  2FYF A;  4K2B A;  1OHV A;  2O0R A;  1JF9 A;  2ZY2 A;  3NU8 A;  4M2M A;  1V2F A;  1ARG A;  2BWN A;  4BHD A;  4ZAH A;  1D2F A;  1X2A A;  3D6K A;  3PD6 A;  1SZK A;  1IJI A;  3AEN A;  5C6U A;  4RIZ A;  2ZY5 A;  1TAS A;  4LNL A;  4GE7 A;  4DBC A;  2ORD A;  4WD2 A;  3QHX A;  3ASA A;  4LNJ A;  3PDB A;  5F9S A;  4H51 A;  4U2H A;  2C7T A;  3AEO A;  2OKK A;  4R2N A;  3LWS A;  1MAP A;  1SF2 A;  1Y4I A;  1P3W A;  3QBO A;  4IX8 A;  3VK3 A;  4LC3 A;  1G7W A;  2DKJ A;  2ZC0 A;  2XBN A;  5BJ3 A;  2VGU A; 
#chains in the Genus database with same CATH topology
 3LG0 A;  3BS8 A;  1SZS A;  3LVM A;  4F5H A;  3ISL A;  4UHO A;  1S09 A;  4KXK A;  5EIG A;  4OCA A;  1N31 A;  2AY3 A;  3G8M A;  3JU7 A;  2W7L A;  3MAU A;  2W8T A;  3ZZJ A;  4ZM4 A;  3RBL A;  1W7L A;  1W23 A;  3DZZ A;  3FDB A;  4B98 A;  1M0P A;  1B9I A;  2ZY3 A;  3EI8 A;  3KGX A;  4ZWM A;  3CQ6 A;  1H0C A;  2G6W A;  1GEY A;  2CIN A;  3E9K A;  1ARS A;  2E7I A;  3AAT A;  3FRK A;  2CAN A;  2Z61 A;  3FQ8 A;  4RLG A;  4K05 A;  2VI8 A;  4EB5 A;  4IW7 A;  3CAI A;  3WY7 A;  3ZRP A;  2W7G A;  3E6G A;  3MKJ A;  1M6S A;  3FFR A;  1AJS A;  4Y0D A;  2X3L A;  3E2F A;  2VMP A;  1GC3 A;  3GZD A;  5D5S A;  2AAT A;  2BI1 A;  2D65 A;  3ACZ A;  1BJO B;  1X29 A;  3NTJ A;  3R4T A;  1DJE A;  2CJD A;  2JJE A;  3GET A;  4CXQ A;  2QA3 A;  1ZC9 A;  3FTB A;  3I5T A;  3USF A;  3BC8 A;  4KAM A;  4ZSW A;  5AX8 A;  3FQ7 A;  3ZZK A;  2YOB A;  1YIY A;  1LC7 A;  3JW9 A;  3PD6 B;  3W1I A;  3N7N A;  3UAK A;  3AEN B;  2EZ1 A;  3A2B A;  4RIT A;  1S08 A;  1Z3Z A;  2BI3 A;  2Z9W A;  2W7J A;  3EUC A;  1IAY A;  1IUG A;  1WKH A;  1M4N A;  3EIB A;  3QN6 A;  2HOY A;  1AHY A;  3PAA A;  4WYG A;  4WYF A;  3MBB A;  3DXV A;  3N4R A;  2VGT A;  1JG8 A;  4UOY A;  4UHM A;  4WB0 A;  1QJ3 A;  4A0F A;  3RI6 A;  1WYV A;  3NRA A;  3E2Y A;  1LW4 A;  1M0O A;  2EZ2 A;  4MQP A;  3JZL A;  2DGM A;  5J8Q A;  4WLJ A;  4BA5 A;  4WBT A;  3LV2 A;  4Q6R A;  3BN1 A;  3GJU A;  1OXP A;  3BV0 A;  2RFV A;  5EIG B;  1AHX A;  4ZDP A;  1O4S A;  2X5D A;  2ZP7 A;  3WKR A;  4AOA A;  1GC4 A;  1AIC A;  3H7F A;  1MGV A;  4JF0 A;  1LS3 A;  1TOI A;  2HOX A;  1GEX A;  4E1O A;  3NYT A;  4IXS A;  2AY8 A;  3OKS A;  2QSR A;  4LW2 A;  3AOV A;  3WGB A;  3FVX A;  4KYO A;  3A9Y A;  2ZSM A;  1AHF A;  1TPL A;  3TFU A;  1BQA A;  5HXX A;  2BI2 A;  3VAX A;  5FT6 A;  2DOU A;  2E7U A;  4XK1 A;  4JEW A;  1AJS B;  1KL2 A;  2FKI A;  1ASB A;  1MLY A;  1CQ6 A;  3B46 A;  3GZC A;  1EG5 A;  2D64 A;  4XJP A;  1FC4 A;  1UU1 A;  4A6U A;  2HUI A;  2GB3 A;  1D7S A;  1BJ4 A;  2QMA A;  2W7H A;  4GSA A;  1G7X A;  3H9X A;  3QM2 A;  2VGS A;  2YKY A;  1U08 A;  4MKK A;  2VMT A;  4N0W A;  4R5Z A;  4WYE A;  4PVF A;  4AO9 A;  4Q75 A;  1QIR A;  3E2Z A;  2VIB A;  3R9A A;  1BKG A;  4CVQ A;  1G4X A;  4F5F A;  4L0O A;  3AEJ C;  1XEY A;  1SZU A;  4OMA A;  4ATP A;  1JS6 A;  4LW4 A;  4WB0 B;  3RQ1 A;  2HP1 A;  3NYU A;  1TOG A;  3AV7 A;  2WKA A;  4WYA A;  1WYV B;  2BIE A;  3K28 A;  4AH3 A;  3JWB A;  2ZJG A;  3LVJ A;  4OT8 A;  4F5M A;  1GC0 A;  1YOO A;  5E5I A;  1I41 A;  4DQ6 A;  1CQ7 A;  1ASF A;  2HZP A;  1ARI A;  3AEJ A;  3VK2 A;  2YHK A;  2VMN A;  4E77 A;  1CJ0 A;  1CL1 A;  1GCK A;  2AY2 A;  4TN4 A;  1MDZ A;  1OHY A;  3NUB A;  9AAT A;  3NX3 A;  3GSB A;  2D5Y A;  1CQ8 A;  1YIZ A;  2ZUK A;  2JJH A;  1DTY A;  1SVV A;  2JIS A;  2R5C A;  3BCA A;  5LH9 A;  4GEB A;  2E54 A;  4R5F A;  4WXB A;  1GDE A;  1MDO A;  1YJS A;  3QPG A;  3DXW A;  3RCH A;  2PB0 A;  4F5K A;  3NUI A;  2CB1 A;  3LY1 A;  2BIA A;  3G7Q A;  4MQR A;  4JE5 A;  3TQX A;  3WCN A;  1CZE A;  3EZ1 A;  1OHW A;  3F0H A;  2R2N A;  4ADB A;  1T3I A;  2BYL A;  2AY9 A;  3FFH A;  3FQA A;  2AY5 A;  3GZD C;  4ITX A;  2VI9 A;  3KKI A;  5HDM A;  2YRR A;  2D66 A;  3GR9 A;  4EMY A;  4O6Z A;  3UE8 A;  1QIS A;  5G09 A;  1W3U A;  1TOK A;  1Z7D A;  1PMO A;  5BJ4 A;  1LC5 A;  7AAT A;  1PG8 A;  1B9H A;  3FZ6 A;  2EYQ A;  3HBX A;  2VMX A;  4Q76 A;  4W1X A;  2C44 A;  2CJG A;  1AAW A;  4RJY A;  3AOW A;  3W1J A;  2BYJ A;  1LK9 A;  1B4X A;  4P7Y A;  1WYU A;  4UQV A;  3B1D A;  3I16 A;  2AEV A;  3II0 A;  2BHX A;  4JEY A;  5M49 A;  3WKS A;  2W8U A;  2W8J A;  3B1C A;  3CQ5 A;  3JTX A;  4J5U A;  4MSO A;  4CBR A;  4F5L A;  4ADE A;  4P3M A;  4I8A A;  1ARH A;  3ZRR A;  2X5F A;  2GQN A;  1ASD A;  3ELE A;  3CQ4 A;  1DJU A;  1AKB A;  1AY4 A;  2OGA A;  2FN6 A;  4RAE A;  2D63 A;  2VMU A;  3BWO A;  4XQ2 A;  2W7D A;  3K7Y A;  4XAU A;  2WB6 A;  1EQB A;  1GEW A;  5EUD A;  1ZOD A;  2VMV A;  4WXG A;  4IY7 A;  1AX4 A;  3PDB B;  4N0B A;  1QZ9 A;  3N75 A;  2QLR A;  5DB5 A;  3PDX A;  1I29 A;  1TOE A;  2ZY4 A;  3A9X A;  2ZYJ A;  3FKD A;  2BWO A;  1AMQ A;  4WP0 A;  4TMR A;  1W7M A;  1B8G A;  1FG3 A;  1W7N A;  3KE3 A;  3E77 A;  4XJO A;  5G2Q A;  2FM1 A;  3PJ0 A;  2X8U A;  1AIA A;  1O61 A;  5JAY A;  4OBV A;  2VGZ A;  1BS0 A;  2Z20 A;  5EUN A;  1RV4 A;  2V1P A;  2R5E A;  4FFC A;  1UU2 A;  3RBF A;  1I43 A;  2VLH A;  4W5K A;  3NU7 A;  4ZDO A;  5E4Z A;  3DU4 A;  2VIA A;  1C7O A;  3FVS A;  3MAF A;  4MQQ A;  4H63 Q;  4J8L A;  1YJZ A;  4Q31 A;  2YKU A;  2JGT A;  2WK8 A;  1AHE A;  1S06 A;  4Y0I A;  4Y0H A;  4A00 A;  2V0Y A;  5HHY A;  1AMS A;  1AMR A;  3QI6 A;  2OGE A;  2CY8 A;  1C9C A;  1CZC A;  1RV3 A;  2CJH A;  2OKJ A;  2HUU A;  2EH6 A;  4UHN A;  1DJ9 A;  3B1E A;  3TCM A;  1E5E A;  3VK4 A;  1YJY A;  3ELP A;  2AY6 A;  4WYD A;  1LKC A;  1UKJ A;  4ADC A;  3L44 A;  2VMR A;  2VMY A;  3IF2 A;  2PB2 A;  1KAF A;  2VMS A;  3DRD A;  1BJW A;  1ZOB A;  1RVU A;  1KMK A;  3HDO A;  1DGE A;  3HMU A;  4M2K A;  2BI5 A;  4TV7 A;  4ZDL A;  1KKJ A;  3T32 A;  4A6T A;  1AMA A;  1AIB A;  1LW5 A;  1D7V A;  1FG7 A;  4JEV A;  1JS3 A;  3OP7 A;  4ZAS A;  3B8X A;  2NMP A;  1AKA A;  3TFT A;  1V72 A;  1IX7 A;  4IYO A;  1X28 A;  1S0A A;  3QGU A;  1E5F A;  5M4B A;  1ART A;  3EI5 A;  3KGW A;  2QBT A;  2VGV A;  2C81 A;  3EI7 A;  1KL1 A;  2BKW A;  4OC9 A;  1IAX A;  2C0R A;  4XJM A;  1ASN A;  1AKC A;  4QGR A;  5TF5 A;  4F5G A;  1ASM A;  3FZ7 A;  1YAA A;  3I4J A;  3BWN C;  4PFF A;  2AY4 A;  2YRI A;  2CFB A;  3K40 A;  2PO3 A;  3UWC A;  3BB8 A;  3VOM A;  2W8V A;  1D7R A;  1G4V A;  2YKV A;  3BCX A;  5M4D A;  2W7M A;  1IX8 A;  1WKG A;  2OAT A;  1DFO A;  1LC8 A;  4PIW A;  1RVY A;  2R0T A;  3HQT A;  4OTL A;  3GWP A;  2FNU A;  3EZS A;  1BQD A;  3BWN A;  3JWA A;  2VMQ A;  2OQX A;  3HL2 A;  3AEM C;  1TOJ A;  4LNM A;  2Z9V A;  2A1V A;  2VMO A;  4K2M A;  4AO4 A;  1TAT A;  3MAF B;  1C4K A;  3COG A;  1V2E A;  3A8U X;  2ZSL A;  4MKJ A;  5G4I A;  2VMZ A;  1ASG A;  2JJG A;  1GC2 A;  3AEM A;  3ZRQ A;  2GSA A;  3WX9 A;  1MAQ A;  4IXZ A;  2VYC A;  5G0A A;  2QB2 A;  2VMW A;  1ELU A;  5KTB A;  1C7G A;  3TAT A;  2D7Z A;  1SFF A;  4RM1 A;  4F5I A;  3WCO A;  3FZ8 A;  4R8D A;  2E7J A;  2AEU A;  1BT4 A;  2WK9 A;  2DR1 A;  3MEB A;  5DJ1 A;  3PGY A;  1IBJ A;  2CH1 A;  4JEX A;  4WYC A;  2CH2 A;  2GMU A;  3DR7 A;  3F9T A;  2YCP A;  1WYT A;  3H14 A;  1D7U A;  3FD0 A;  4ISY A;  1C0N A;  3FDD A;  3HT4 A;  4NOG A;  3RUY A;  1N8P A;  2JJF A;  4JE5 D;  5FT4 A;  5E3K A;  4CXR A;  1GBN A;  3DOD A;  3ATH A;  2JG2 A;  1PMM A;  3MC6 C;  4CBS A;  4EB7 A;  4IYO B;  3DR4 A;  2YKX A;  1GD9 A;  2AY1 A;  5EUE A;  1VEF A;  3MAD A;  3E2Z B;  3PA9 A;  3EI6 A;  1QJ5 A;  3PPL A;  2YCN A;  3LVK A;  4W1W A;  2Z1Z A;  1M32 A;  5FT5 A;  4EFF A;  1ECX A;  2BI9 A;  3MC6 A;  1I48 A;  2Z9X A;  1ELQ A;  3WGC A;  3LVL B;  4BMK A;  4E3Q A;  1KMJ A;  4DGT A;  1OXO A;  5FT8 A;  5IWQ A;  2O1B A;  5F8V A;  4GRX A;  4JF1 A;  1BW0 A;  4A0G A;  4B9B A;  1CS1 A;  1KKP A;  2W7F A;  3IHJ A;  3NDN A;  4A6R A;  3P1T A;  4JEZ A;  4U1T A;  4RKD A;  2HP2 A;  2D61 A;  3EIA A;  3HVY A;  4ITG A;  1H1C A;  3N0L A;  4ZM3 A;  1ORD A;  2AY7 A;  4ADD A;  5K8B A;  4WXF A;  4F5J A;  4PFN A;  5EQC A;  2GMS A;  2W7E A;  1AJR A;  4A0R A;  2DGL A;  1IVR A;  1MDX A;  2R5C B;  4RJ0 A;  1OAT A;  4WLH A;  4W8I A;  2CST A;  1IX6 A;  3N4S A;  4GE9 A;  4GDY A;  3RCH B;  1M0N A;  4AZK A;  4W91 A;  5I92 A;  2W8W A;  2DGK A;  3ECD A;  2F8J A;  3VP6 A;  1AAM A;  2W7K A;  1ASL A;  3HLM A;  1AHG A;  4MGR A;  1QIT A;  1AY5 A;  3WLX A;  4ATQ A;  4XEW A;  5M46 A;  5DX5 A;  1J32 A;  5EFS A;  1XI9 A;  2BIG A;  1S07 A;  1ASA A;  2EPJ A;  3CBF A;  5EAV A;  1X0M A;  2QB3 A;  2TPL A;  1V2D A;  1BJN A;  2VGW A;  3PIU A;  3AEP A;  5LHA A;  3N4X A;  3P6K A;  1AY8 A;  2HUF A;  2XH1 A;  3F6T A;  4A0H A;  2CTZ A;  2VLF A;  4M2J A;  1WYT B;  2Z9U A;  2D7Y A;  3EI9 A;  3L8A A;  1VJO A;  4K2I A;  3G0T A;  1DKA A;  2HOR A;  1WYU B;  5EAA A;  4HVK A;  2G7J A;  2Z67 A;  1TAR A;  1J04 A;  4ZSY A;  4BA4 A;  3DYD A;  2DKB A;  1M7Y A;  4IXO A;  3NNK A;  1ASC A;  2HOZ A;  1UU0 A;  3Q8N A;  3ASB A;  4GE4 A;  2Z1Y A;  4MY5 A;  4F4E A;  4RKC A;  3N5M A;  4AZJ A;  1B5P A;  3FVU A;  4HF8 A;  4OBU A;  3FCR A;  1O69 A;  1CL2 A;  4W1V A;  5DJ9 A;  4FL0 A;  4E3R A;  3NYS A;  4ZWV A;  2FQ6 A;  2FNI A;  3A9Z A;  2KFP A;  3FSL A;  1YNU A;  1VP4 A;  3M5U A;  5G2P A;  2YCT A;  4A72 A;  4BQ0 A;  1EJI A;  1C7N A;  2W7I A;  2EO5 A;  2EGY A;  1M0Q A;  4ZLV A;  8AAT A;  2BWP A;  1MLZ A;  5D95 A;  1N2T A;  1DGD A;  1SPA A;  1ASE A;  2WK7 A;  3BCB A;  1QGN A;  4XJL A;  1WST A;  1PFF A;  2Q7W A;  3AEL A;  3GBX A;  4OYT A;  5G4J A;  4EU1 A;  1B5O A;  1BJO A;  2O7C A;  3W1H A;  3DC1 A;  1O62 A;  3WZF A;  2FYF A;  4K2B A;  1OHV A;  2O0R A;  1JF9 A;  2ZY2 A;  3NU8 A;  4M2M A;  1V2F A;  1ARG A;  2BWN A;  4BHD A;  4ZAH A;  1D2F A;  1X2A A;  3D6K A;  3PD6 A;  1SZK A;  1IJI A;  3AEN A;  5C6U A;  4RIZ A;  2ZY5 A;  1TAS A;  4LNL A;  4GE7 A;  4DBC A;  2ORD A;  4WD2 A;  3QHX A;  3ASA A;  4LNJ A;  3PDB A;  5F9S A;  4H51 A;  4U2H A;  2C7T A;  3AEO A;  2OKK A;  4R2N A;  3LWS A;  1MAP A;  1SF2 A;  1Y4I A;  1P3W A;  3QBO A;  4IX8 A;  3VK3 A;  4LC3 A;  1G7W A;  2DKJ A;  2ZC0 A;  2XBN A;  5BJ3 A;  2VGU A; 
#chains in the Genus database with same CATH homology
 3LG0 A;  3BS8 A;  1SZS A;  3LVM A;  4F5H A;  3ISL A;  4UHO A;  1S09 A;  4KXK A;  5EIG A;  4OCA A;  1N31 A;  2AY3 A;  3G8M A;  3JU7 A;  2W7L A;  3MAU A;  2W8T A;  3ZZJ A;  4ZM4 A;  3RBL A;  1W7L A;  1W23 A;  3DZZ A;  3FDB A;  4B98 A;  1M0P A;  1B9I A;  2ZY3 A;  3EI8 A;  3KGX A;  4ZWM A;  3CQ6 A;  1H0C A;  2G6W A;  1GEY A;  2CIN A;  3E9K A;  1ARS A;  2E7I A;  3AAT A;  3FRK A;  2CAN A;  2Z61 A;  3FQ8 A;  4RLG A;  4K05 A;  2VI8 A;  4EB5 A;  4IW7 A;  3CAI A;  3WY7 A;  3ZRP A;  2W7G A;  3E6G A;  3MKJ A;  1M6S A;  3FFR A;  1AJS A;  4Y0D A;  2X3L A;  3E2F A;  2VMP A;  1GC3 A;  3GZD A;  5D5S A;  2AAT A;  2BI1 A;  2D65 A;  3ACZ A;  1BJO B;  1X29 A;  3NTJ A;  3R4T A;  1DJE A;  2CJD A;  2JJE A;  3GET A;  4CXQ A;  2QA3 A;  1ZC9 A;  3FTB A;  3I5T A;  3USF A;  3BC8 A;  4KAM A;  4ZSW A;  5AX8 A;  3FQ7 A;  3ZZK A;  2YOB A;  1YIY A;  1LC7 A;  3JW9 A;  3PD6 B;  3W1I A;  3N7N A;  3UAK A;  3AEN B;  2EZ1 A;  3A2B A;  4RIT A;  1S08 A;  1Z3Z A;  2BI3 A;  2Z9W A;  2W7J A;  3EUC A;  1IAY A;  1IUG A;  1WKH A;  1M4N A;  3EIB A;  3QN6 A;  2HOY A;  1AHY A;  3PAA A;  4WYG A;  4WYF A;  3MBB A;  3DXV A;  3N4R A;  2VGT A;  1JG8 A;  4UOY A;  4UHM A;  4WB0 A;  1QJ3 A;  4A0F A;  3RI6 A;  1WYV A;  3NRA A;  3E2Y A;  1LW4 A;  1M0O A;  2EZ2 A;  4MQP A;  3JZL A;  2DGM A;  5J8Q A;  4WLJ A;  4BA5 A;  4WBT A;  3LV2 A;  4Q6R A;  3BN1 A;  3GJU A;  1OXP A;  3BV0 A;  2RFV A;  5EIG B;  1AHX A;  4ZDP A;  1O4S A;  2X5D A;  2ZP7 A;  3WKR A;  4AOA A;  1GC4 A;  1AIC A;  3H7F A;  1MGV A;  4JF0 A;  1LS3 A;  1TOI A;  2HOX A;  1GEX A;  4E1O A;  3NYT A;  4IXS A;  2AY8 A;  3OKS A;  2QSR A;  4LW2 A;  3AOV A;  3WGB A;  3FVX A;  4KYO A;  3A9Y A;  2ZSM A;  1AHF A;  1TPL A;  3TFU A;  1BQA A;  5HXX A;  2BI2 A;  3VAX A;  5FT6 A;  2DOU A;  2E7U A;  4XK1 A;  4JEW A;  1AJS B;  1KL2 A;  2FKI A;  1ASB A;  1MLY A;  1CQ6 A;  3B46 A;  3GZC A;  1EG5 A;  2D64 A;  4XJP A;  1FC4 A;  1UU1 A;  4A6U A;  2HUI A;  2GB3 A;  1D7S A;  1BJ4 A;  2QMA A;  2W7H A;  4GSA A;  1G7X A;  3H9X A;  3QM2 A;  2VGS A;  2YKY A;  1U08 A;  4MKK A;  2VMT A;  4N0W A;  4R5Z A;  4WYE A;  4PVF A;  4AO9 A;  4Q75 A;  1QIR A;  3E2Z A;  2VIB A;  3R9A A;  1BKG A;  4CVQ A;  1G4X A;  4F5F A;  4L0O A;  3AEJ C;  1XEY A;  1SZU A;  4OMA A;  4ATP A;  1JS6 A;  4LW4 A;  4WB0 B;  3RQ1 A;  2HP1 A;  3NYU A;  1TOG A;  3AV7 A;  2WKA A;  4WYA A;  1WYV B;  2BIE A;  3K28 A;  4AH3 A;  3JWB A;  2ZJG A;  3LVJ A;  4OT8 A;  4F5M A;  1GC0 A;  1YOO A;  5E5I A;  1I41 A;  4DQ6 A;  1CQ7 A;  1ASF A;  2HZP A;  1ARI A;  3AEJ A;  3VK2 A;  2YHK A;  2VMN A;  4E77 A;  1CJ0 A;  1CL1 A;  1GCK A;  2AY2 A;  4TN4 A;  1MDZ A;  1OHY A;  3NUB A;  9AAT A;  3NX3 A;  3GSB A;  2D5Y A;  1CQ8 A;  1YIZ A;  2ZUK A;  2JJH A;  1DTY A;  1SVV A;  2JIS A;  2R5C A;  3BCA A;  5LH9 A;  4GEB A;  2E54 A;  4R5F A;  4WXB A;  1GDE A;  1MDO A;  1YJS A;  3QPG A;  3DXW A;  3RCH A;  2PB0 A;  4F5K A;  3NUI A;  2CB1 A;  3LY1 A;  2BIA A;  3G7Q A;  4MQR A;  4JE5 A;  3TQX A;  3WCN A;  1CZE A;  3EZ1 A;  1OHW A;  3F0H A;  2R2N A;  4ADB A;  1T3I A;  2BYL A;  2AY9 A;  3FFH A;  3FQA A;  2AY5 A;  3GZD C;  4ITX A;  2VI9 A;  3KKI A;  5HDM A;  2YRR A;  2D66 A;  3GR9 A;  4EMY A;  4O6Z A;  3UE8 A;  1QIS A;  5G09 A;  1W3U A;  1TOK A;  1Z7D A;  1PMO A;  5BJ4 A;  1LC5 A;  7AAT A;  1PG8 A;  1B9H A;  3FZ6 A;  2EYQ A;  3HBX A;  2VMX A;  4Q76 A;  4W1X A;  2C44 A;  2CJG A;  1AAW A;  4RJY A;  3AOW A;  3W1J A;  2BYJ A;  1LK9 A;  1B4X A;  4P7Y A;  1WYU A;  4UQV A;  3B1D A;  3I16 A;  2AEV A;  3II0 A;  2BHX A;  4JEY A;  5M49 A;  3WKS A;  2W8U A;  2W8J A;  3B1C A;  3CQ5 A;  3JTX A;  4J5U A;  4MSO A;  4CBR A;  4F5L A;  4ADE A;  4P3M A;  4I8A A;  1ARH A;  3ZRR A;  2X5F A;  2GQN A;  1ASD A;  3ELE A;  3CQ4 A;  1DJU A;  1AKB A;  1AY4 A;  2OGA A;  2FN6 A;  4RAE A;  2D63 A;  2VMU A;  3BWO A;  4XQ2 A;  2W7D A;  3K7Y A;  4XAU A;  2WB6 A;  1EQB A;  1GEW A;  5EUD A;  1ZOD A;  2VMV A;  4WXG A;  4IY7 A;  1AX4 A;  3PDB B;  4N0B A;  1QZ9 A;  3N75 A;  2QLR A;  5DB5 A;  3PDX A;  1I29 A;  1TOE A;  2ZY4 A;  3A9X A;  2ZYJ A;  3FKD A;  2BWO A;  1AMQ A;  4WP0 A;  4TMR A;  1W7M A;  1B8G A;  1FG3 A;  1W7N A;  3KE3 A;  3E77 A;  4XJO A;  5G2Q A;  2FM1 A;  3PJ0 A;  2X8U A;  1AIA A;  1O61 A;  5JAY A;  4OBV A;  2VGZ A;  1BS0 A;  2Z20 A;  5EUN A;  1RV4 A;  2V1P A;  2R5E A;  4FFC A;  1UU2 A;  3RBF A;  1I43 A;  2VLH A;  4W5K A;  3NU7 A;  4ZDO A;  5E4Z A;  3DU4 A;  2VIA A;  1C7O A;  3FVS A;  3MAF A;  4MQQ A;  4H63 Q;  4J8L A;  1YJZ A;  4Q31 A;  2YKU A;  2JGT A;  2WK8 A;  1AHE A;  1S06 A;  4Y0I A;  4Y0H A;  4A00 A;  2V0Y A;  5HHY A;  1AMS A;  1AMR A;  3QI6 A;  2OGE A;  2CY8 A;  1C9C A;  1CZC A;  1RV3 A;  2CJH A;  2OKJ A;  2HUU A;  2EH6 A;  4UHN A;  1DJ9 A;  3B1E A;  3TCM A;  1E5E A;  3VK4 A;  1YJY A;  3ELP A;  2AY6 A;  4WYD A;  1LKC A;  1UKJ A;  4ADC A;  3L44 A;  2VMR A;  2VMY A;  3IF2 A;  2PB2 A;  2VMS A;  3DRD A;  1BJW A;  1ZOB A;  1RVU A;  1KMK A;  3HDO A;  1DGE A;  3HMU A;  4M2K A;  2BI5 A;  4TV7 A;  4ZDL A;  1KKJ A;  3T32 A;  4A6T A;  1AMA A;  1AIB A;  1LW5 A;  1D7V A;  1FG7 A;  4JEV A;  1JS3 A;  3OP7 A;  4ZAS A;  3B8X A;  2NMP A;  1AKA A;  3TFT A;  1V72 A;  1IX7 A;  4IYO A;  1X28 A;  1S0A A;  3QGU A;  1E5F A;  5M4B A;  1ART A;  3EI5 A;  3KGW A;  2QBT A;  2VGV A;  2C81 A;  3EI7 A;  1KL1 A;  2BKW A;  4OC9 A;  1IAX A;  2C0R A;  4XJM A;  1ASN A;  1AKC A;  4QGR A;  5TF5 A;  4F5G A;  1ASM A;  3FZ7 A;  1YAA A;  3I4J A;  3BWN C;  4PFF A;  2AY4 A;  2YRI A;  2CFB A;  3K40 A;  2PO3 A;  3UWC A;  3BB8 A;  3VOM A;  2W8V A;  1D7R A;  1G4V A;  2YKV A;  3BCX A;  5M4D A;  2W7M A;  1IX8 A;  1WKG A;  2OAT A;  1DFO A;  1LC8 A;  4PIW A;  1RVY A;  2R0T A;  3HQT A;  4OTL A;  3GWP A;  2FNU A;  3EZS A;  1BQD A;  3BWN A;  3JWA A;  2VMQ A;  2OQX A;  3HL2 A;  3AEM C;  1TOJ A;  4LNM A;  2Z9V A;  2A1V A;  2VMO A;  4K2M A;  4AO4 A;  1TAT A;  3MAF B;  1C4K A;  3COG A;  1V2E A;  3A8U X;  2ZSL A;  4MKJ A;  5G4I A;  2VMZ A;  1ASG A;  2JJG A;  1GC2 A;  3AEM A;  3ZRQ A;  2GSA A;  3WX9 A;  1MAQ A;  4IXZ A;  2VYC A;  5G0A A;  2QB2 A;  2VMW A;  1ELU A;  5KTB A;  1C7G A;  3TAT A;  2D7Z A;  1SFF A;  4RM1 A;  4F5I A;  3WCO A;  3FZ8 A;  4R8D A;  2E7J A;  2AEU A;  1BT4 A;  2WK9 A;  2DR1 A;  3MEB A;  5DJ1 A;  3PGY A;  1IBJ A;  2CH1 A;  4JEX A;  4WYC A;  2CH2 A;  2GMU A;  3DR7 A;  3F9T A;  2YCP A;  1WYT A;  3H14 A;  1D7U A;  3FD0 A;  4ISY A;  1C0N A;  3FDD A;  3HT4 A;  4NOG A;  3RUY A;  1N8P A;  2JJF A;  4JE5 D;  5FT4 A;  5E3K A;  4CXR A;  1GBN A;  3DOD A;  3ATH A;  2JG2 A;  1PMM A;  3MC6 C;  4CBS A;  4EB7 A;  4IYO B;  3DR4 A;  2YKX A;  1GD9 A;  2AY1 A;  5EUE A;  1VEF A;  3MAD A;  3E2Z B;  3PA9 A;  3EI6 A;  1QJ5 A;  3PPL A;  2YCN A;  3LVK A;  4W1W A;  2Z1Z A;  1M32 A;  5FT5 A;  4EFF A;  1ECX A;  2BI9 A;  3MC6 A;  1I48 A;  2Z9X A;  1ELQ A;  3WGC A;  3LVL B;  4BMK A;  4E3Q A;  1KMJ A;  4DGT A;  1OXO A;  5FT8 A;  5IWQ A;  2O1B A;  5F8V A;  4GRX A;  4JF1 A;  1BW0 A;  4A0G A;  4B9B A;  1CS1 A;  1KKP A;  2W7F A;  3IHJ A;  3NDN A;  4A6R A;  3P1T A;  4JEZ A;  4U1T A;  4RKD A;  2HP2 A;  2D61 A;  3EIA A;  3HVY A;  4ITG A;  1H1C A;  3N0L A;  4ZM3 A;  1ORD A;  2AY7 A;  4ADD A;  5K8B A;  4WXF A;  4F5J A;  4PFN A;  5EQC A;  2GMS A;  2W7E A;  1AJR A;  4A0R A;  2DGL A;  1IVR A;  1MDX A;  2R5C B;  4RJ0 A;  1OAT A;  4WLH A;  4W8I A;  2CST A;  1IX6 A;  3N4S A;  4GE9 A;  4GDY A;  3RCH B;  1M0N A;  4AZK A;  4W91 A;  5I92 A;  2W8W A;  2DGK A;  3ECD A;  2F8J A;  3VP6 A;  1AAM A;  2W7K A;  1ASL A;  3HLM A;  1AHG A;  4MGR A;  1QIT A;  1AY5 A;  3WLX A;  4ATQ A;  4XEW A;  5M46 A;  5DX5 A;  1J32 A;  5EFS A;  1XI9 A;  2BIG A;  1S07 A;  1ASA A;  2EPJ A;  3CBF A;  5EAV A;  1X0M A;  2QB3 A;  2TPL A;  1V2D A;  1BJN A;  2VGW A;  3PIU A;  3AEP A;  5LHA A;  3N4X A;  3P6K A;  1AY8 A;  2HUF A;  2XH1 A;  3F6T A;  4A0H A;  2CTZ A;  2VLF A;  4M2J A;  1WYT B;  2Z9U A;  2D7Y A;  3EI9 A;  3L8A A;  1VJO A;  4K2I A;  3G0T A;  1DKA A;  2HOR A;  1WYU B;  5EAA A;  4HVK A;  2G7J A;  2Z67 A;  1TAR A;  1J04 A;  4ZSY A;  4BA4 A;  3DYD A;  2DKB A;  1M7Y A;  4IXO A;  3NNK A;  1ASC A;  2HOZ A;  1UU0 A;  3Q8N A;  3ASB A;  4GE4 A;  2Z1Y A;  4MY5 A;  4F4E A;  4RKC A;  3N5M A;  4AZJ A;  1B5P A;  3FVU A;  4HF8 A;  4OBU A;  3FCR A;  1O69 A;  1CL2 A;  4W1V A;  5DJ9 A;  4FL0 A;  4E3R A;  3NYS A;  4ZWV A;  2FQ6 A;  2FNI A;  3A9Z A;  2KFP A;  3FSL A;  1YNU A;  1VP4 A;  3M5U A;  5G2P A;  2YCT A;  4A72 A;  4BQ0 A;  1EJI A;  1C7N A;  2W7I A;  2EO5 A;  2EGY A;  1M0Q A;  4ZLV A;  8AAT A;  2BWP A;  1MLZ A;  5D95 A;  1N2T A;  1DGD A;  1SPA A;  1ASE A;  2WK7 A;  3BCB A;  1QGN A;  4XJL A;  1WST A;  1PFF A;  2Q7W A;  3AEL A;  3GBX A;  4OYT A;  5G4J A;  4EU1 A;  1B5O A;  1BJO A;  2O7C A;  3W1H A;  3DC1 A;  1O62 A;  3WZF A;  2FYF A;  4K2B A;  1OHV A;  2O0R A;  1JF9 A;  2ZY2 A;  3NU8 A;  4M2M A;  1V2F A;  1ARG A;  2BWN A;  4BHD A;  4ZAH A;  1D2F A;  1X2A A;  3D6K A;  3PD6 A;  1SZK A;  1IJI A;  3AEN A;  5C6U A;  4RIZ A;  2ZY5 A;  1TAS A;  4LNL A;  4GE7 A;  4DBC A;  2ORD A;  4WD2 A;  3QHX A;  3ASA A;  4LNJ A;  3PDB A;  5F9S A;  4H51 A;  4U2H A;  2C7T A;  3AEO A;  2OKK A;  4R2N A;  3LWS A;  1MAP A;  1SF2 A;  1Y4I A;  1P3W A;  3QBO A;  4IX8 A;  3VK3 A;  4LC3 A;  1G7W A;  2DKJ A;  2ZC0 A;  2XBN A;  5BJ3 A;  2VGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...