1AB3A

Ribosomal protein s15 from thermus thermophilus, nmr, 26 structures
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL RNA BINDING PROTEIN S15
publication title Solution structure of the ribosomal RNA binding protein S15 from Thermus thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
total genus 11
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 1997-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1ab3A00
1N32O 1XMOO 4DR7O 4DR1O 4DV4O 1A32A 1R6TA 1XEQA 4JI1O 3SDLA 4DUZO 1N34O 3J80N 5BY1A 5IWAO 2N74A 4DV1O 4DV7O 4OPAA 4LFBO 4X65O 4LF7O 2VQEO 4DR3O 4JI0O 3T1YO 2UUBO 4JI5O 2DOSA 4GKJO 4DR6O 1HNZO 4JI6O 4LF6O 1F7YA 4YY3O 5FLXN 3T1HO 1XNRO 4B3TO 2LW7A 4DV3O 1R1BA 1HR0O 5A2QN 3RT3C 2E5LO 3JAMN 4JI7O 4LF9O 3F5TA 4KHPO 3O65A 4A5UB 3R66A 1FYJA 4OPHA 1KUQA 1FKAO 5BXZA 1N36O 4DR5O 2F4VO 2UUCO 1D2DA 1N33O 4LFCO 4DV6O 5BR8O 4LF8O 1HNXO 1NS1A 4JI8O 4LF4O 5LL6Y 2UU9O 5H5NA 1XNQO 1FJGO 2ZM6O 2Z0AA 3OTOO 1J5EO 2ZKOA 4JI4O 2UXDO 4DV5O 4X66O 5LMNO 4LF5O 4LFAO 2DJVA 2UXCO 4OX9O 4JI3O 1X59A 4JI2O 4DV2O 5IT9N 2VQFO 1AB3A 1YZBA 4X62O 4DR4O 3M8AA 4B3MO 4B3SO 1XMQO 2JRIA 4K0KO 2HHHO 3J7AU 3J81N 4JYAO 1IBKO 1IBLO 1AILA 1DK1A 2UXBO 4DR2O 2AGAA 1HNWO 4X64O 4DV0O 4NXMO 4B3RO 4DUYO 2UUAO 2FKXA 4JV5O 1G1XB 4AQYO 1I94O 1IBMO 4GKKO 4YHHO 4NXNO 5LMUO
chains in the Genus database with same CATH superfamily
1U97A 3L9DA 4B08A 3K3WA 5IDJA 1Q90D 1KMIZ 1NI8A 4GKKB 1QU7A 2QWNB 2W6IG 1LNQA 4JZGA 2Q8VA 4DR7B 2CGNA 1H2GA 1M57C 1V55B 4WBNB 4J7ZA 3B2EE 4MVOA 5CA0B 1TA8A 1WPBA 2M6YA 2PF4E 1JA8A 3ETGA 1YJNV 1FXKB 1VP7A 5B1OA 3LSQA 1GH6A 4MTXA 4LF9B 3APQA 4KHPB 3ZIAG 3AEIA 4MVUA 3UT5A 4B3TO 1EN6A 4NR1A 3L74H 1GKFA 4O4JB 2ADPA 2UXNA 2XAQA 1FKAO 4AI8A 3OTOB 2ZR3A 4F6RA 4DV6O 3L70H 3X2QB 2P7TC 2BOBC 2YXLA 3TXQA 1OCOB 2HJDA 4QNHB 3I5DA 2IJJA 4X62B 4ZBMA 4UFZA 4X66O 4PV1B 3W7WA 4CH6A 1OCCC 3ABUA 4UVAA 2LP7A 4ZHQB 1GN6A 1DLBA 1JJOA 3CXCU 1NR1A 3CC7V 2P6JA 4FVMA 4JYAO 3E35A 1IBLO 4X64O 1Q6HA 3K0DA 2CH7B 2W0XA 3JAWB 4AQYO 5LGNA 2ZE5A 4I9WA 5B1AC 5HFMA 1AVMA 5KA6A 4MTFA 4DR1O 4TQFA 1U96A 4KXRA 3CRCA 5EYPA 1WAZA 3RYFB 3KCXA 4FPPA 1Q86W 1XEQA 4WFHA 4JTDB 3B8NA 2YIBD 4QJFB 1CP9A 4X1YA 2JS5A 1XNRB 3ABLB 5KAIZ 3BEHA 1I5YA 1W2BU 2EZPA 4BR6A 1O9HA 4GYCB 4O2BA 3W7XA 1QLEC 1AR5A 4HYOA 1CPYA 2ZDIA 3SPJA 2DQ3A 1QR9A 3QNEA 4UV8A 4TWKA 3ETQA 3A0RA 2Q4PA 3OEEG 4PD4F 4A5UB 1OCRC 1XNQB 5EIBD 2A7WA 4D7SA 2QWPB 1D2DA 2JJ2G 3WG7B 3HKBB 1Z2GA 4LF5B 1K3EA 2K9PA 3ML0A 4LF4O 4Z1VA 3CJHB 2YEVA 4JI4O 3BA9A 3ZMSA 4J7KA 4HNAA 4ZOLB 3G71V 1Z5WA 1BMFG 3CCUV 1EZJA 2XAJA 4RO2A 4QGPA 2BCCH 1M57B 3CE2A 4DUYB 3VQXA 2HHHO 1F23A 3U0ZA 1N8RW 4MTOA 3LUTB 1VF6C 1I94B 2PI5A 3ICXA 3G4SV 1WP7A 3LNMB 5FNVB 3ZRSA 1FS0G 1LUWA 2ITDC 2AXTZ 1JCHA 1H8HG 1Y4MA 3BRCA 1N32O 3N27A 4I55A 4FMTA 4JI1B 1NH2B 1NH2D 4NB5A 3CCLV 2LJ2A 3CS5A 3VQVA 1VQNV 5B66Z 3OEHG 3J80N 4JI5B 4IT5A 4G27B 4IHJB 2NN4A 1PP9H 5C8YA 1FXHA 2B1GA 3AG1C 2WPDG 1OCCB 3ZMUA 4U7NA 1W0KG 1PNKA 3E86A 3C3SA 3I56V 1HNZO 2EJRA 2GTSA 5FLXN 4Q6GA 1X4TA 2B1IA 4LNUA 3RT3C 3R66A 2UU9B 1RFYA 3KZIZ 1W0JG 1JFFA 2X6BA 1PNLA 2DN9A 5KLVH 4JI8O 1ZLZA 3JALA 3UQ8A 5B1AB 1BE3H 3STLC 3L71H 4DR5B 4BAYA 2R72A 1H2NA 1X59A 2LGWA 1WJZA 3PJSK 4XDLA 4H37A 3JASB 1S3JA 3UM7A 1PKXA 2G38A 1EFRG 2Y69C 2HP8A 3GWKC 2D3OW 4MVQA 3Q4HB 3HPLC 4B3RO 5CMUA 1QLEB 2Q73A 3RYIB 5IY5C 4H33A 2GSMB 4DV4B 1BHBA 2P90A 4GKKO 5LOVB 2Q5ZA 2ZE7A 3VQYA 1OCRB 1DTOA 3H1HH 4DR7O 3T2MA 1Q6IA 4JYBA 1N0NA 1SC5B 3SDLA 2VWKA 4EB6A 4NYKA 1T5EA 1PM9A 1N0JA 1VQ9V 2WLIB 4I50B 2D2CB 2KKWA 4FFBA 3T1HB 2JGDB 2DE0X 2QTOA 5FL7G 2WLLB 3ZHRA 2VQEO 4JI0O 1QBZA 1YDXA 1NQTA 2NR5A 5LXTB 3K5LA 2UXXA 2ZDIC 1PPJH 2AHZA 4YIPA 2E76B 1TUBA 5L3CA 2Q0AA 4O2AB 2UXDB 1S5HC 2F1MA 4IIJA 4DV5B 5JVDA 1SQXH 1YITV 2HVKC 4RWUA 2NLJC 3BA8A 5B1BC 1SZXA 4CC5A 4H0LB 3NR7A 4R7CA 2YI9A 2QWQB 4LFAO 3ABMC 2ZD9A 3FAVA 2A79B 1XL4A 4ABMA 1AR1B 1WNSA 1AJPA 3M8AA 1R6KA 1K97A 1OJHA 4PDLA 5K1XA 2PYJA 1VQ8V 3AG1B 4JYCA 2IJIA 1R3KC 1I08A 2QWRB 2WWWA 5KMGA 1ORQC 4PI2A 3UT5B 3ASNC 5GTIZ 5J2UA 2WLJA 3OD4A 4GX1A 4WCEV 4LR3A 5BMVA 4RAIA 5IYCO 4JTCB 4NXMB 3K06A 5B3SC 4NKGB 2UUAB 4F6RB 3OW2U 3CSXA 5KA5A 2FTKA 2HR3A 4R8CA 2HFEC 1MG1A 3WFVA 4I0XA 4DUZO 2B5UA 4ZI7A 4DV1O 4X89A 1MNGA 2B9ZA 4ASUG 4O4HB 4LF7O 1Y74A 4BW9A 1O9GA 1Q81W 4DR6O 3SPGA 4JI6O 1BQZA 2EULA 4GZRB 4FK5C 1RP3B 1GN3A 1HNXB 3G67A 5IJ0A 1NTMH 1AP6A 1Q43A 2Y69B 3K58A 5JJEB 2HEPA 1QVGU 4W4LA 4Z2WA 3HKCA 3CCSV 4P9PA 4LFCO 4MTGA 5IY5B 3JATA 3LDEA 4I9QA 1K8AW 1NTZH 4B7KA 2QKCA 4DR4B 2DJVA 5EYPB 3CD6V 2KG7A 4LF8B 4JI2O 5L3FA 1XI1A 1WPXA 2OTJV 3TJTA 4K8ZA 2EIMC 2BSKA 1SQQH 4RQFA 4FIPC 4X1YB 3K03A 2ZE6A 1IBKO 1FXVA 3E22A 3WB2A 1YJ9V 4X20A 5JH7A 1M93A 1H2KA 4MS2A 1HNWO 1KD1W 3A8TA 4O4IA 4O2BB 3IJ4A 4PA4A 4H44B 3WB1A 5EZYA 4MVRA 2XAGA 3SPIA 2ADQB 3UO2A 3AG2C 1B3QA 3ZMTA 2Q0OC 3C90A 1VQ4V 1GN4A 1FAFA 1NU1H 4FLXA 2WLMA 2Z5UA 4WFEA 1A32A 4CS4A 2YEVB 2ZQMA 5B1BB 1QR8A 2BTQA 2IH3C 2OCCC 4OPAA 4DW0A 4HNAB 3ABMB 2A0LA 4JTAB 4CH3A 1F4MA 1YF2A 4PELA 1Q82W 2HVJC 5LP6A 1KYOF 4GUNA 3SJCC 1YSCA 1N36B 4L87A 2BTOA 3APOA 5GTHZ 2R70A 5L3EA 2N05A 3MDSA 3CMEV 3JAMN 5IE9A 3AK1A 3U11A 5J2TA 2ZM6B 1J5EB 4DR5O 1N4CA 3RYCA 3ASNB 2PI4A 1N33O 3ZCCA 4R50A 3K0GA 4IGGA 1FFXA 4I55B 2ZKOA 1S0VA 1H2MA 5B3SB 2QWOB 3M7MX 1WB8A 3MAQA 3AG3C 3ZHQA 2UXCO 2ZNIA 1FPOA 4UCRA 4JI3O 2IBZH 3OTFA 5AG2A 4U7OA 2QKAA 3ETDA 4DV2O 3OGCC 5LGTA 4I4TA 1NBMG 5C8YB 1K7DA 1KB9F 2WLKA 4NVPA 4OX9B 5CBHA 3JYCA 1XBLA 1IBMB 3GB7C 5FPRA 4D7TA 5GONA 2VWJA 4YJ3A 1VQMV 2YC0A 5EBWC 4UV9A 3B4SA 4LNUB 3HKEA 4NXNO 2KQXA 1ZX3A 1XMOO 1JFFB 4EKWA 4J7JA 1GN2A 3SYAA 1VQKV 4LFBB 4N21A 1D5NA 1ZWIC 3JALB 1KKCA 1VF7A 2XAHA 3SGIA 5LMUB 2RN9A 3UCSC 4MVSA 4EFBA 1VQ6V 4QE7A 4LF6B 4UVBA 3L73H 2F95B 1UPGA 3E89A 4J41A 1AP5A 1FFTB 4JI7B 2A9HA 3CWBH 5KHHA 2EIMB 4YY3O 1L1FA 4TOIA 1AJNA 3CHXA 3C3TA 2ETNA 4DV3O 1SZTA 2Q9LA 4JZ2A 3T1YB 2GUZA 1JX9A 1FJGB 1RM1C 3ZRXA 2Y4TA 3ABKC 3AK2A 1MZFA 2QE7G 2AZ2A 5H9CA 4UUJC 3AG2B 3LSUA 5CBFA 5CBGA 5KUMA 5ITZA 5LMNO 2YS8A 2EZOA 2X0LA 1K34A 1EN4A 2GV9A 2VRZA 1YZBA 2EINB 4EB6B 3ZRVA 2LQTA 4B3SO 2OCCB 1XDCA 4FFBB 2RCVA 1R3IC 4UCVA 5KHIA 4JV5B 5JQGA 3KG2A 2PGGA 3DTUB 4NXMO 1JQ0A 1TUEB 3CC4V 1P84F 2UUAO 1TVKA 3E8HA 1Q7YW 4J9ZB 2JK5C 3AG4C 3E83A 2ZNJA 1TUBB 2PYLA 3ZRWA 5DM6V 2MW2B 2DQ0A 5KX5A 3QVNA 1GO3F 2Y0PA 4IIJB 5KAFZ 4UCUA 1NZ6A 5JVDB 2AHYA 3SPHA 3H1JH 2WSSG 1I7FA 5JCOA 1VF5B 4BWAA 3R65A 1V54C 4XDJA 3AG7A 2R9AA 3K9SA 3DSQA 2JGUA 5BY1A 4FLVA 1FD9A 3BCCH 3AG3B 4PJ0Z 2H3OA 3FAVB 3FX7A 3QG5A 5IYDO 3B09A 4J10A 5LP6C 4GKJO 4MW8A 2EILC 2F66C 2A06H 1R3JC 2XASA 5KMGB 2UUBB 3O65A 4GX2A 1RPRA 1MOFA 1L0LH 5J2UB 3B8MA 1AROP 1KC8W 3OUFA 1J95A 1ZAUA 4LF8O 5BMVB 1GM9A 3HB3B 4U3FH 3SYCA 2Q67A 1SQVH 4CH5A 3HR0A 2P4VA 1G8MA 3IAYA 1YCIA 2OIEA 1HWYA 3ETEA 1B6QA 4X1KA 3ZN0A 2CGOA 4I0XB 2EIJC 4ZI7B 4DV0B 2GTAA 3P32A 1XMQO 2JRIA 1YHQV 1P4RA 2ITCC 4E2LA 1Y74B 1Q6UA 4KL1A 5H6QA 1E1QG 2YIDA 4MVZA 1QNMA 4TUYA 2QDOA 3RYHA 2FMLA 2YDEA 1YVWA 3CPWU 1AR4A 1DF4A 4FJCC 3FB5C 3PN1A 1GTOA 5IJ0B 1OHHG 3HKCB 1I5XA 4J80A 1RM1B 4JASA 4UXNA 4TQDA 3ABKB 4J9YB 2CH7A 2QJ1A 3SJQC 2F43G 4LP8A 3JATB 1JVMA 3FKSG 3BABA 3CRQA 1D5AA 1EBOA 2EBOA 2KG7B 4RQEA 2YSUB 3N2GA 2ZXWC 2LGQA 2YICA 3SYQA 2ZIOA 1KP2A 2BSKB 1N34B 1M1KW 3E22B 4X20B 2LW7A 5JH7B 1NTKH 3JCUZ 3CCJV 4O4IB 4LF9O 2RDCA 4KHPO 2QKSA 3U10A 5EZYB 4FLYA 4X66B 3AG4B 2OCHA 1SRYA 4JAVA 3DGEA 3ZHTA 1H2SB 3OTOO 3K5MA 1SESA 4RUFA 2UUCB 5TISZ 4OX9O 2H8PC 4UCOA 5BR8B 4JPRA 5H6RA 4FM1A 4JYAB 1ZL8B 1YTFB 4YJ2A 1YTFD 3K79A 1V54B 1IBLB 5KUKA 2DW4A 4DRXA 4X62O 1W59A 2BTQB 1YI2V 1S72V 3OMIB 2Q69A 3ABTA 3BFRA 3JD2A 5DEDA 3W7UA 2HJFC 1RPOA 3OR7C 1TGOA 3CCMV 1BQ0A 1PL0A 3ZMZA 5CA3A 3F7VC 5LP6B 4B3MB 3DC5A 4LH6A 3SJAC 2LW1A 1G1XB 2EILB 1SKVA 2HLDG 1WLEA 3FYEB 1VQPV 5LBQA 2QM4A 1BSMA 3OR6C 3JD1A 3ZS8C 5J2TB 5LMUO 4D6TH 2YIAA 3RYCB 4CH4A 2FB5A 1S76D 3D8CA 5JCOC 1FFXB 1R6TA 3K08A 2CUGA 1K5SA 2GHYA 3FYIB 2YUAA 1ZTEA 4O4LA 4C7UA 4MT8A 3T1YO 2X6CA 2DOSA 4I4TB 4OXSA 2EIJB 1BZKA 3DXRA 1GM7A 2EIKC 3ZX6A 1F7YA 4DV7B 3CC2V 1XNRO 1VIBA 3LNNA 5CA1A 1VARA 5JJJB 3E8BA 3BHPA 3F5TA 2IJHA 3OMAB 2JDIG 2WA4A 5GONB 2CK3G 4YJ3B 4PHZA 4DO2A 4JI4B 1SS3A 1S77D 2GDSA 2IJKA 4GT1A 2KB1A 1NS1A 3KKYA 1COWG 3HKEB 5H5NA 2E5LB 1XNQO 3D3IA 1QCEA 5J9PC 4LF5O 3OGIB 4X88A 3F7YC 4K3AA 5JJNB 3CMAV 5LA6A 3LDDA 3E2EA 1PNMA 1S5LZ 3B77A 4NTYA 2QEXV 2ZXWB 2VQFB 1XUQA 3F5WC 2JIZG 4DUYO 1N32B 2FKXA 1NR7A 5LHHA 4TV9A 2OTLV 1I94O 2ODMA 4YXWG 4X1IA 2UXBB 4WFGA 2AZ0A 3CCQV 2F23A 1WA8A 3Q4HA 1Y76A 1BCCH 5EC2C 3K5NA 4X9QA 4JI1O 1NKDA 3RW0A 3CXHF 5ITZB 1Y67A 4GLXA 1HNZB 5L3BA 5IYZA 3JARA 2DYRC 1OV9A 3QO7A 2ZINA 2UUBO 2W0FC 4JI5O 3BAAA 3QF7A 1JOYA 2H94A 2IH1C 3A0BZ 5IWAB 1AI7A 3EVKA 1GRJA 1RSOA 5LHIA 3SYPA 2X7RB 1R1BA 4X65B 1UJWB 2Q6AA 5JQGB 1H2LA 3H9VA 1SERA 1SA0A 2DWEC 2ZIMA 4F4LA 4OPHA 3CRMA 4JAUA 1TVKB 1P7GA 3JAKA 4U3JA 4QPKA 4UB6Z 5KHJA 1SQBH 1LUVA 3EXAA 1AI4A 4WF9V 3ZRWB 2UU9O 4BIZA 3CRRA 2XAFA 5KX5B 4PA6A 5EBLC 3E8FA 2YXYA 2ILMA 4X8AA 3JCZA 2CTWA 3FD9A 3TGUH 1DGSA 1YXBA 2XT9A 5D5PA 2DWDC 1AB3A 3ASOC 1K5QA 2R9IA 2CTPA 1KQSU 4B3RB 3MHSC 1SQGA 2ATKC 3UKMA 4CS2A 1P7BA 3T1CA 2E3CA 3TK1A 2QGNA 1MABG 3EHBB 2Q68A 5HFLA 1L8DA 2EIKB 3GVMA 3G6BA 1QLNA 2P22C 2IW5A 4PA9A 3CX5F 1IZ3A 1KBHA 4BW5A 5JWPA 2BE3A 4DV4O 4GX0A 2XOKG 3IFXA 2VQEB 4JI0B 1N34O 1EN5A 2N74A 2WLNA 1PL4A 3P3PA 5IYBO 4X1KB 2C2AA 4E4EA 5E79Z 1AJQA 4J11A 1YJWV 1QVFU 5LHGA 3IGAC 3N2KA 4P9OA 2Y4UA 1P49A 4QE9A 5IJ9A 5KHGA 2JVDA 3B40A 3T1HO 4JAAA 1SF9A 1ZSPA 3TCUA 3MD0A 4O4HA 3RVZA 3D36A 4TUYB 1K9MW 2RNBA 3RYHB 2JJ1G 3M99B 3SJBC 5C93A 3VQWA 4IL6Z 2ZT9B 2UUCO 4CBCA 5EC1C 5BR8O 4TV8A 5B5EZ 4LFAB 1HR0B 2Y0IA 3MHHC 5LL6Y 3O9OA 4PDMA 2PTMA 1VMGA 4JGSA 2UXDO 4DV5O 2F4VB 4LWSA 3K57A 2WA3A 2XUMA 5D5QA 3JD0A 3CEIA 4LC1A 2Q7EA 4B3MO 2E74B 2A3QA 4LBEC 3BPZA 4B7EA 1JMKC 3I55V 1XREA 1CXZB 3N2GB 2FYUH 2AW9A 2DYRB 2PY5A 3L72H 1AILA 3SPCA 4FLWA 1G4YB 1EM1A 4I5SA 5GW7A 2W6JG 2QTSA 5CB4A 2X6AA 1K92A 1E1RG 2QM8A 3CYOA 4DR2B 4FFKA 1WP8A 1AI5A 3GWOA 4DUZB 4F6EA 2E75B 3ZHSA 3OAAG 4DV1B 1GM8A 3G6EV 1DF5A 5DECA 2CTRA 2EJ7A 2LFRA 3LDCA 4LF7B 2L6LA 3DC6A 4YHHB 1MSWD 2P5OA 3JD4A 2JEUA 3OE7G 4P30A 4DV7O 4DR6B 4PDVA 5BZBA 4JI6B 3HKDA 1Y6XA 4YJ2B 2QM7A 4DRXB 3RBZA 3ASOB 5LYJA 1SETA 3ZBHA 1XQ8A 3E8GA 4TT3G 4LFCB 4NTXA 3G80A 4DR3B 4AILC 2E5LO 2XHBA 4OGQB 1US6A 1SQFA 2JEXA 2Z3YA 4W4KA 1IXMA 4G28B 2K1EA 2KSDA 2Q7GA 4K35A 1BT8A 3LSSA 1ENVA 1XHZA 1HNXO 3OMNB 5DN6G 2DMXA 4JI2B 1GMGA 2CTQA 4UB8Z 3BY6A 5A9GA 1JR9A 3H1IH 4HAMA 4WBNA 4FM2A 5CA0A 4BIOA 2DYSC 3VBBA 3STZC 1IBKB 4XBFA 4MW3A 2CDYA 2VQFO 2L35A 1Z5VA 2OIGA 1FXKA 2YI8A 4DR4O 1HNWB 4Q20A 3CCRV 1K33A 3J7AU 3S3WA 1M90W 4O4LB 2LO1A 4JYYA 1H38A 4O4JA 2UXBO 1Y66A 3DXRB 4HBNA 4EFEA 4R6ZA 4UVCA 4DK0A 2XTAA 1BHAA 5CA1B 4K0KB 2ARHA 1KKDA 4G2KA 2BOCC 1XOUA 1OCZC 1YEWA 1MZEA 3FB8C 3OM3B 2WLHA 1LR1A 4DYLA 1PV0A 1VEWA 2YXHA 2ZR2A 4ZHQA 4GCZA 1M56C 1IXBA 2P06A 5IWAO 1NT2B 1NVPB 1PD3A 1NVPD 1AI6A 1HP8A 5H2FZ 3RN4A 5B1NA 3WB0A 4X65O 3K9AA 4N23A 5LA6B 4BIUA 2PZSA 4KP4A 4GX5A 2HG5C 4WFBV 1XL6A 4DK1A 4MVMA 3JAWA 1IX9A 5LGUA 3T4ZA 1I0HA 1N33B 1WB7A 3D36C 2O57A 5L3DA 3ZJZA 1FYJA 2M7WA 5BXZA 1N36O 1L0NH 4TV9B 2OWOA 2VS0A 2NNUA 4PDRA 4B3TB 1IURA 1K4CC 1YIJV 3D3QA 2UXCB 4X1IB 4DW1A 4JI3B 3RYFA 4DV2B 1VQ7V 2ZM6O 2Z0AA 4XDKA 4WFAV 3CCVV 4FZ0A 4TSFG 4FM0A 1J5EO 1Q3EA 1WA8B 2V7QG 1M4UA 5FPOA 2P67A 2YIBA 3H01A 1Y76B 2F93B 4DV6B 3UO3A 2Y48A 1THZA 3T4DA 3K04A 2CAZC 1BGYH 3CRAA 2RQ6A 5IYZB 3RWRD 4PI0A 3JARB 1ZUQA 2FL4A 1DK1A 3A0HZ 2R9RB 1MSDA 3TETA 5F2VO 4NXNB 3BVOA 3IC7A 3S3XA 2OYQA 5K1PA 1RSOB 1XMOB 3OFNG 1K73W 3HKBA 1IBMO 1SA0B 1GAXA 4UCTA 3CCEV 4X64B 1CEZA 3CJHA 3RGBA 3QO5A 3JAKB 4U3JB 4IYHA 3AK3A 1E79G 3IC9A 3EFFK 3THOA 4AQYB 4ZOLA 4YIOA 3CB2A 1R3LC 2ZCEA 4KUMA 1M9NA 4DR1B 3ZEDA 4YY3B 3OT7A 4LFBO 2DYSB 3VOUA 4DV3B 5EBMC 4ICGA 3KCYA 4EEQA 3JSNA 4LF6O 3WU2Z 4K8XA 1V9PA 5FNVA 1MA1A 1HR0O 1MMMA 3NXSA 4JI7O 1XHXA 1R73A 3K59A 1OZ0A 2F4VO 4L8JA 2HKOA 5LMNB 4FLUA 1KP3A 4KFMA 1FJGO 3QTCA 1UFIA 4ZIBA 1V55C 3ZHUA 4WFFA 4B3SB 4IHJA 1OCZB 3JSLA 5CN0A 1Q5OA 4JF3A 4LF4B 1QQCA 1FXKC 1M56B 4RUEA 3RVYA 5EK0A 3FB6C 4DXWA 4I7ZB 3P30A 3J81N 1SQPH 1NJIW 3N2KB 1ROPA 3QO8A 4DR2O 2AGAA 3SYOA 1WN7A 2RJZA 3ZMVA 2IU0A 5IJ9B 3OUSA 3W7TA 3H1LH 4AHCA 4JV5O 2HHHB 2OT5A 1S5JA 4CZZA 1VQOV 3X2QC 1OCOC 1F4NA 4YHHO 1VQ5V 5KHKA 2WAMA 4TV8B 1K4DC 2QSAA 4LH7A 1H8EG 3CP1A 1IDSA 5L3GA 4FLZA 1R6NA 4HZ3A 4GKJB 4LWSB 4PA7A 2N04A 2LFSA 4FZ1A 4IYIA 3JASA 2XNDG 2GUZB 4DR3O 1VQLV 5E1AC 2JS3A 3A2FA 1TAEA 3FFQA 4CC6A 2EX3A 3RYIA 2Q7HA 4PA3A 5A2QN 1BS3A 1G6UA 4MSWC 5LOVA 2MK3A 1KECA 1BL8A 1KUQA 3L75H 5CB4B 3P3NA 3FB7C 1URFA 2V1DA 3K5OA 2RMKB 3RFRA 1IVSA 4UCSA 1JPXA 2ZE8A 1EZVH 2CE4A 4NTWA 1B04A 3W7SA 2V4DA 3TXSA 2GBOA 1Q8IA 4H13B 1XMQB 2WLIA 3ZHVA 4I50A 1XILA 2PUSA 3ABLC 4JI8B 2JGDA 5IT9N 2WLLA 2P4KA 4QIWF 3JD3A 3SR2C 2QR4A 3H1KH 1F51A 3HKDB 5LXTA 4K0KO 1HW7A 4LCUC 4CS3A 2QA4V 2IM9A 4J42A 2IU3A 1B06A 4QPJA 1GK9A 4P2ZA 1KU9A 1VF6A 4DV0O 1ZL8A 5EIBC 5LYJB 2EINC 4FLTA 3WG7C 4Z1MG 4O2AA 4ZKIA 3ZN1A 1HDJA 1QHTA 1M5IA 1JJ2U
chains in the Genus database with same CATH topology
1N32O 1XMOO 4DR7O 4DR1O 4DV4O 1A32A 1R6TA 1XEQA 4JI1O 3SDLA 4DUZO 1N34O 3J80N 5BY1A 5IWAO 2N74A 4DV1O 4DV7O 4OPAA 4LFBO 4X65O 4LF7O 2VQEO 4DR3O 4JI0O 3T1YO 2UUBO 4JI5O 2DOSA 4GKJO 4DR6O 1HNZO 4JI6O 4LF6O 1F7YA 4YY3O 5FLXN 3T1HO 1XNRO 4B3TO 2LW7A 4DV3O 1R1BA 1HR0O 5A2QN 3RT3C 2E5LO 3JAMN 4JI7O 4LF9O 3F5TA 4KHPO 3O65A 4A5UB 3R66A 1FYJA 4OPHA 1KUQA 1FKAO 5BXZA 1N36O 4DR5O 2F4VO 2UUCO 1D2DA 1N33O 4LFCO 4DV6O 5BR8O 4LF8O 1HNXO 1NS1A 4JI8O 4LF4O 5LL6Y 2UU9O 5H5NA 1XNQO 1FJGO 2ZM6O 2Z0AA 3OTOO 1J5EO 2ZKOA 4JI4O 2UXDO 4DV5O 4X66O 5LMNO 4LF5O 4LFAO 2DJVA 2UXCO 4OX9O 4JI3O 1X59A 4JI2O 4DV2O 5IT9N 2VQFO 1AB3A 1YZBA 4X62O 4DR4O 3M8AA 4B3MO 4B3SO 1XMQO 2JRIA 4K0KO 2HHHO 3J7AU 3J81N 4JYAO 1IBKO 1IBLO 1AILA 1DK1A 2UXBO 4DR2O 2AGAA 1HNWO 4X64O 4DV0O 4NXMO 4B3RO 4DUYO 2UUAO 2FKXA 4JV5O 1G1XB 4AQYO 1I94O 1IBMO 4GKKO 4YHHO 4NXNO 5LMUO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N32 O;  1XMO O;  4DR7 O;  4DR1 O;  4DV4 O;  1A32 A;  1R6T A;  1XEQ A;  4JI1 O;  3SDL A;  4DUZ O;  1N34 O;  3J80 N;  5BY1 A;  5IWA O;  2N74 A;  4DV1 O;  4DV7 O;  4OPA A;  4LFB O;  4X65 O;  4LF7 O;  2VQE O;  4DR3 O;  4JI0 O;  3T1Y O;  2UUB O;  4JI5 O;  2DOS A;  4GKJ O;  4DR6 O;  1HNZ O;  4JI6 O;  4LF6 O;  1F7Y A;  4YY3 O;  5FLX N;  3T1H O;  1XNR O;  4B3T O;  2LW7 A;  4DV3 O;  1R1B A;  1HR0 O;  5A2Q N;  3RT3 C;  2E5L O;  3JAM N;  4JI7 O;  4LF9 O;  3F5T A;  4KHP O;  3O65 A;  4A5U B;  3R66 A;  1FYJ A;  4OPH A;  1KUQ A;  1FKA O;  5BXZ A;  1N36 O;  4DR5 O;  2F4V O;  2UUC O;  1D2D A;  1N33 O;  4LFC O;  4DV6 O;  5BR8 O;  4LF8 O;  1HNX O;  1NS1 A;  4JI8 O;  4LF4 O;  5LL6 Y;  2UU9 O;  5H5N A;  1XNQ O;  1FJG O;  2ZM6 O;  2Z0A A;  3OTO O;  1J5E O;  2ZKO A;  4JI4 O;  2UXD O;  4DV5 O;  4X66 O;  5LMN O;  4LF5 O;  4LFA O;  2DJV A;  2UXC O;  4OX9 O;  4JI3 O;  1X59 A;  4JI2 O;  4DV2 O;  5IT9 N;  2VQF O;  1AB3 A;  1YZB A;  4X62 O;  4DR4 O;  3M8A A;  4B3M O;  4B3S O;  1XMQ O;  2JRI A;  4K0K O;  2HHH O;  3J7A U;  3J81 N;  4JYA O;  1IBK O;  1IBL O;  1AIL A;  1DK1 A;  2UXB O;  4DR2 O;  2AGA A;  1HNW O;  4X64 O;  4DV0 O;  4NXM O;  4B3R O;  4DUY O;  2UUA O;  2FKX A;  4JV5 O;  1G1X B;  4AQY O;  1I94 O;  1IBM O;  4GKK O;  4YHH O;  4NXN O;  5LMU O; 
#chains in the Genus database with same CATH topology
 1U97 A;  3L9D A;  4B08 A;  3K3W A;  5IDJ A;  1Q90 D;  1KMI Z;  1NI8 A;  4GKK B;  1QU7 A;  2QWN B;  2W6I G;  1LNQ A;  4JZG A;  2Q8V A;  4DR7 B;  2CGN A;  1H2G A;  1M57 C;  1V55 B;  4WBN B;  4J7Z A;  3B2E E;  4MVO A;  5CA0 B;  1TA8 A;  1WPB A;  2M6Y A;  2PF4 E;  1JA8 A;  3ETG A;  1YJN V;  1FXK B;  1VP7 A;  5B1O A;  3LSQ A;  1GH6 A;  4MTX A;  4LF9 B;  3APQ A;  4KHP B;  3ZIA G;  3AEI A;  4MVU A;  3UT5 A;  4B3T O;  1EN6 A;  4NR1 A;  3L74 H;  1GKF A;  4O4J B;  2ADP A;  2UXN A;  2XAQ A;  1FKA O;  4AI8 A;  3OTO B;  2ZR3 A;  4F6R A;  4DV6 O;  3L70 H;  3X2Q B;  2P7T C;  2BOB C;  2YXL A;  3TXQ A;  1OCO B;  2HJD A;  4QNH B;  3I5D A;  2IJJ A;  4X62 B;  4ZBM A;  4UFZ A;  4X66 O;  4PV1 B;  3W7W A;  4CH6 A;  1OCC C;  3ABU A;  4UVA A;  2LP7 A;  4ZHQ B;  1GN6 A;  1DLB A;  1JJO A;  3CXC U;  1NR1 A;  3CC7 V;  2P6J A;  4FVM A;  4JYA O;  3E35 A;  1IBL O;  4X64 O;  1Q6H A;  3K0D A;  2CH7 B;  2W0X A;  3JAW B;  4AQY O;  5LGN A;  2ZE5 A;  4I9W A;  5B1A C;  5HFM A;  1AVM A;  5KA6 A;  4MTF A;  4DR1 O;  4TQF A;  1U96 A;  4KXR A;  3CRC A;  5EYP A;  1WAZ A;  3RYF B;  3KCX A;  4FPP A;  1Q86 W;  1XEQ A;  4WFH A;  4JTD B;  3B8N A;  2YIB D;  4QJF B;  1CP9 A;  4X1Y A;  2JS5 A;  1XNR B;  3ABL B;  5KAI Z;  3BEH A;  1I5Y A;  1W2B U;  2EZP A;  4BR6 A;  1O9H A;  4GYC B;  4O2B A;  3W7X A;  1QLE C;  1AR5 A;  4HYO A;  1CPY A;  2ZDI A;  3SPJ A;  2DQ3 A;  1QR9 A;  3QNE A;  4UV8 A;  4TWK A;  3ETQ A;  3A0R A;  2Q4P A;  3OEE G;  4PD4 F;  4A5U B;  1OCR C;  1XNQ B;  5EIB D;  2A7W A;  4D7S A;  2QWP B;  1D2D A;  2JJ2 G;  3WG7 B;  3HKB B;  1Z2G A;  4LF5 B;  1K3E A;  2K9P A;  3ML0 A;  4LF4 O;  4Z1V A;  3CJH B;  2YEV A;  4JI4 O;  3BA9 A;  3ZMS A;  4J7K A;  4HNA A;  4ZOL B;  3G71 V;  1Z5W A;  1BMF G;  3CCU V;  1EZJ A;  2XAJ A;  4RO2 A;  4QGP A;  2BCC H;  1M57 B;  3CE2 A;  4DUY B;  3VQX A;  2HHH O;  1F23 A;  3U0Z A;  1N8R W;  4MTO A;  3LUT B;  1VF6 C;  1I94 B;  2PI5 A;  3ICX A;  3G4S V;  1WP7 A;  3LNM B;  5FNV B;  3ZRS A;  1FS0 G;  1LUW A;  2ITD C;  2AXT Z;  1JCH A;  1H8H G;  1Y4M A;  3BRC A;  1N32 O;  3N27 A;  4I55 A;  4FMT A;  4JI1 B;  1NH2 B;  1NH2 D;  4NB5 A;  3CCL V;  2LJ2 A;  3CS5 A;  3VQV A;  1VQN V;  5B66 Z;  3OEH G;  3J80 N;  4JI5 B;  4IT5 A;  4G27 B;  4IHJ B;  2NN4 A;  1PP9 H;  5C8Y A;  1FXH A;  2B1G A;  3AG1 C;  2WPD G;  1OCC B;  3ZMU A;  4U7N A;  1W0K G;  1PNK A;  3E86 A;  3C3S A;  3I56 V;  1HNZ O;  2EJR A;  2GTS A;  5FLX N;  4Q6G A;  1X4T A;  2B1I A;  4LNU A;  3RT3 C;  3R66 A;  2UU9 B;  1RFY A;  3KZI Z;  1W0J G;  1JFF A;  2X6B A;  1PNL A;  2DN9 A;  5KLV H;  4JI8 O;  1ZLZ A;  3JAL A;  3UQ8 A;  5B1A B;  1BE3 H;  3STL C;  3L71 H;  4DR5 B;  4BAY A;  2R72 A;  1H2N A;  1X59 A;  2LGW A;  1WJZ A;  3PJS K;  4XDL A;  4H37 A;  3JAS B;  1S3J A;  3UM7 A;  1PKX A;  2G38 A;  1EFR G;  2Y69 C;  2HP8 A;  3GWK C;  2D3O W;  4MVQ A;  3Q4H B;  3HPL C;  4B3R O;  5CMU A;  1QLE B;  2Q73 A;  3RYI B;  5IY5 C;  4H33 A;  2GSM B;  4DV4 B;  1BHB A;  2P90 A;  4GKK O;  5LOV B;  2Q5Z A;  2ZE7 A;  3VQY A;  1OCR B;  1DTO A;  3H1H H;  4DR7 O;  3T2M A;  1Q6I A;  4JYB A;  1N0N A;  1SC5 B;  3SDL A;  2VWK A;  4EB6 A;  4NYK A;  1T5E A;  1PM9 A;  1N0J A;  1VQ9 V;  2WLI B;  4I50 B;  2D2C B;  2KKW A;  4FFB A;  3T1H B;  2JGD B;  2DE0 X;  2QTO A;  5FL7 G;  2WLL B;  3ZHR A;  2VQE O;  4JI0 O;  1QBZ A;  1YDX A;  1NQT A;  2NR5 A;  5LXT B;  3K5L A;  2UXX A;  2ZDI C;  1PPJ H;  2AHZ A;  4YIP A;  2E76 B;  1TUB A;  5L3C A;  2Q0A A;  4O2A B;  2UXD B;  1S5H C;  2F1M A;  4IIJ A;  4DV5 B;  5JVD A;  1SQX H;  1YIT V;  2HVK C;  4RWU A;  2NLJ C;  3BA8 A;  5B1B C;  1SZX A;  4CC5 A;  4H0L B;  3NR7 A;  4R7C A;  2YI9 A;  2QWQ B;  4LFA O;  3ABM C;  2ZD9 A;  3FAV A;  2A79 B;  1XL4 A;  4ABM A;  1AR1 B;  1WNS A;  1AJP A;  3M8A A;  1R6K A;  1K97 A;  1OJH A;  4PDL A;  5K1X A;  2PYJ A;  1VQ8 V;  3AG1 B;  4JYC A;  2IJI A;  1R3K C;  1I08 A;  2QWR B;  2WWW A;  5KMG A;  1ORQ C;  4PI2 A;  3UT5 B;  3ASN C;  5GTI Z;  5J2U A;  2WLJ A;  3OD4 A;  4GX1 A;  4WCE V;  4LR3 A;  5BMV A;  4RAI A;  5IYC O;  4JTC B;  4NXM B;  3K06 A;  5B3S C;  4NKG B;  2UUA B;  4F6R B;  3OW2 U;  3CSX A;  5KA5 A;  2FTK A;  2HR3 A;  4R8C A;  2HFE C;  1MG1 A;  3WFV A;  4I0X A;  4DUZ O;  2B5U A;  4ZI7 A;  4DV1 O;  4X89 A;  1MNG A;  2B9Z A;  4ASU G;  4O4H B;  4LF7 O;  1Y74 A;  4BW9 A;  1O9G A;  1Q81 W;  4DR6 O;  3SPG A;  4JI6 O;  1BQZ A;  2EUL A;  4GZR B;  4FK5 C;  1RP3 B;  1GN3 A;  1HNX B;  3G67 A;  5IJ0 A;  1NTM H;  1AP6 A;  1Q43 A;  2Y69 B;  3K58 A;  5JJE B;  2HEP A;  1QVG U;  4W4L A;  4Z2W A;  3HKC A;  3CCS V;  4P9P A;  4LFC O;  4MTG A;  5IY5 B;  3JAT A;  3LDE A;  4I9Q A;  1K8A W;  1NTZ H;  4B7K A;  2QKC A;  4DR4 B;  2DJV A;  5EYP B;  3CD6 V;  2KG7 A;  4LF8 B;  4JI2 O;  5L3F A;  1XI1 A;  1WPX A;  2OTJ V;  3TJT A;  4K8Z A;  2EIM C;  2BSK A;  1SQQ H;  4RQF A;  4FIP C;  4X1Y B;  3K03 A;  2ZE6 A;  1IBK O;  1FXV A;  3E22 A;  3WB2 A;  1YJ9 V;  4X20 A;  5JH7 A;  1M93 A;  1H2K A;  4MS2 A;  1HNW O;  1KD1 W;  3A8T A;  4O4I A;  4O2B B;  3IJ4 A;  4PA4 A;  4H44 B;  3WB1 A;  5EZY A;  4MVR A;  2XAG A;  3SPI A;  2ADQ B;  3UO2 A;  3AG2 C;  1B3Q A;  3ZMT A;  2Q0O C;  3C90 A;  1VQ4 V;  1GN4 A;  1FAF A;  1NU1 H;  4FLX A;  2WLM A;  2Z5U A;  4WFE A;  1A32 A;  4CS4 A;  2YEV B;  2ZQM A;  5B1B B;  1QR8 A;  2BTQ A;  2IH3 C;  2OCC C;  4OPA A;  4DW0 A;  4HNA B;  3ABM B;  2A0L A;  4JTA B;  4CH3 A;  1F4M A;  1YF2 A;  4PEL A;  1Q82 W;  2HVJ C;  5LP6 A;  1KYO F;  4GUN A;  3SJC C;  1YSC A;  1N36 B;  4L87 A;  2BTO A;  3APO A;  5GTH Z;  2R70 A;  5L3E A;  2N05 A;  3MDS A;  3CME V;  3JAM N;  5IE9 A;  3AK1 A;  3U11 A;  5J2T A;  2ZM6 B;  1J5E B;  4DR5 O;  1N4C A;  3RYC A;  3ASN B;  2PI4 A;  1N33 O;  3ZCC A;  4R50 A;  3K0G A;  4IGG A;  1FFX A;  4I55 B;  2ZKO A;  1S0V A;  1H2M A;  5B3S B;  2QWO B;  3M7M X;  1WB8 A;  3MAQ A;  3AG3 C;  3ZHQ A;  2UXC O;  2ZNI A;  1FPO A;  4UCR A;  4JI3 O;  2IBZ H;  3OTF A;  5AG2 A;  4U7O A;  2QKA A;  3ETD A;  4DV2 O;  3OGC C;  5LGT A;  4I4T A;  1NBM G;  5C8Y B;  1K7D A;  1KB9 F;  2WLK A;  4NVP A;  4OX9 B;  5CBH A;  3JYC A;  1XBL A;  1IBM B;  3GB7 C;  5FPR A;  4D7T A;  5GON A;  2VWJ A;  4YJ3 A;  1VQM V;  2YC0 A;  5EBW C;  4UV9 A;  3B4S A;  4LNU B;  3HKE A;  4NXN O;  2KQX A;  1ZX3 A;  1XMO O;  1JFF B;  4EKW A;  4J7J A;  1GN2 A;  3SYA A;  1VQK V;  4LFB B;  4N21 A;  1D5N A;  1ZWI C;  3JAL B;  1KKC A;  1VF7 A;  2XAH A;  3SGI A;  5LMU B;  2RN9 A;  3UCS C;  4MVS A;  4EFB A;  1VQ6 V;  4QE7 A;  4LF6 B;  4UVB A;  3L73 H;  2F95 B;  1UPG A;  3E89 A;  4J41 A;  1AP5 A;  1FFT B;  4JI7 B;  2A9H A;  3CWB H;  5KHH A;  2EIM B;  4YY3 O;  1L1F A;  4TOI A;  1AJN A;  3CHX A;  3C3T A;  2ETN A;  4DV3 O;  1SZT A;  2Q9L A;  4JZ2 A;  3T1Y B;  2GUZ A;  1JX9 A;  1FJG B;  1RM1 C;  3ZRX A;  2Y4T A;  3ABK C;  3AK2 A;  1MZF A;  2QE7 G;  2AZ2 A;  5H9C A;  4UUJ C;  3AG2 B;  3LSU A;  5CBF A;  5CBG A;  5KUM A;  5ITZ A;  5LMN O;  2YS8 A;  2EZO A;  2X0L A;  1K34 A;  1EN4 A;  2GV9 A;  2VRZ A;  1YZB A;  2EIN B;  4EB6 B;  3ZRV A;  2LQT A;  4B3S O;  2OCC B;  1XDC A;  4FFB B;  2RCV A;  1R3I C;  4UCV A;  5KHI A;  4JV5 B;  5JQG A;  3KG2 A;  2PGG A;  3DTU B;  4NXM O;  1JQ0 A;  1TUE B;  3CC4 V;  1P84 F;  2UUA O;  1TVK A;  3E8H A;  1Q7Y W;  4J9Z B;  2JK5 C;  3AG4 C;  3E83 A;  2ZNJ A;  1TUB B;  2PYL A;  3ZRW A;  5DM6 V;  2MW2 B;  2DQ0 A;  5KX5 A;  3QVN A;  1GO3 F;  2Y0P A;  4IIJ B;  5KAF Z;  4UCU A;  1NZ6 A;  5JVD B;  2AHY A;  3SPH A;  3H1J H;  2WSS G;  1I7F A;  5JCO A;  1VF5 B;  4BWA A;  3R65 A;  1V54 C;  4XDJ A;  3AG7 A;  2R9A A;  3K9S A;  3DSQ A;  2JGU A;  5BY1 A;  4FLV A;  1FD9 A;  3BCC H;  3AG3 B;  4PJ0 Z;  2H3O A;  3FAV B;  3FX7 A;  3QG5 A;  5IYD O;  3B09 A;  4J10 A;  5LP6 C;  4GKJ O;  4MW8 A;  2EIL C;  2F66 C;  2A06 H;  1R3J C;  2XAS A;  5KMG B;  2UUB B;  3O65 A;  4GX2 A;  1RPR A;  1MOF A;  1L0L H;  5J2U B;  3B8M A;  1ARO P;  1KC8 W;  3OUF A;  1J95 A;  1ZAU A;  4LF8 O;  5BMV B;  1GM9 A;  3HB3 B;  4U3F H;  3SYC A;  2Q67 A;  1SQV H;  4CH5 A;  3HR0 A;  2P4V A;  1G8M A;  3IAY A;  1YCI A;  2OIE A;  1HWY A;  3ETE A;  1B6Q A;  4X1K A;  3ZN0 A;  2CGO A;  4I0X B;  2EIJ C;  4ZI7 B;  4DV0 B;  2GTA A;  3P32 A;  1XMQ O;  2JRI A;  1YHQ V;  1P4R A;  2ITC C;  4E2L A;  1Y74 B;  1Q6U A;  4KL1 A;  5H6Q A;  1E1Q G;  2YID A;  4MVZ A;  1QNM A;  4TUY A;  2QDO A;  3RYH A;  2FML A;  2YDE A;  1YVW A;  3CPW U;  1AR4 A;  1DF4 A;  4FJC C;  3FB5 C;  3PN1 A;  1GTO A;  5IJ0 B;  1OHH G;  3HKC B;  1I5X A;  4J80 A;  1RM1 B;  4JAS A;  4UXN A;  4TQD A;  3ABK B;  4J9Y B;  2CH7 A;  2QJ1 A;  3SJQ C;  2F43 G;  4LP8 A;  3JAT B;  1JVM A;  3FKS G;  3BAB A;  3CRQ A;  1D5A A;  1EBO A;  2EBO A;  2KG7 B;  4RQE A;  2YSU B;  3N2G A;  2ZXW C;  2LGQ A;  2YIC A;  3SYQ A;  2ZIO A;  1KP2 A;  2BSK B;  1N34 B;  1M1K W;  3E22 B;  4X20 B;  2LW7 A;  5JH7 B;  1NTK H;  3JCU Z;  3CCJ V;  4O4I B;  4LF9 O;  2RDC A;  4KHP O;  2QKS A;  3U10 A;  5EZY B;  4FLY A;  4X66 B;  3AG4 B;  2OCH A;  1SRY A;  4JAV A;  3DGE A;  3ZHT A;  1H2S B;  3OTO O;  3K5M A;  1SES A;  4RUF A;  2UUC B;  5TIS Z;  4OX9 O;  2H8P C;  4UCO A;  5BR8 B;  4JPR A;  5H6R A;  4FM1 A;  4JYA B;  1ZL8 B;  1YTF B;  4YJ2 A;  1YTF D;  3K79 A;  1V54 B;  1IBL B;  5KUK A;  2DW4 A;  4DRX A;  4X62 O;  1W59 A;  2BTQ B;  1YI2 V;  1S72 V;  3OMI B;  2Q69 A;  3ABT A;  3BFR A;  3JD2 A;  5DED A;  3W7U A;  2HJF C;  1RPO A;  3OR7 C;  1TGO A;  3CCM V;  1BQ0 A;  1PL0 A;  3ZMZ A;  5CA3 A;  3F7V C;  5LP6 B;  4B3M B;  3DC5 A;  4LH6 A;  3SJA C;  2LW1 A;  1G1X B;  2EIL B;  1SKV A;  2HLD G;  1WLE A;  3FYE B;  1VQP V;  5LBQ A;  2QM4 A;  1BSM A;  3OR6 C;  3JD1 A;  3ZS8 C;  5J2T B;  5LMU O;  4D6T H;  2YIA A;  3RYC B;  4CH4 A;  2FB5 A;  1S76 D;  3D8C A;  5JCO C;  1FFX B;  1R6T A;  3K08 A;  2CUG A;  1K5S A;  2GHY A;  3FYI B;  2YUA A;  1ZTE A;  4O4L A;  4C7U A;  4MT8 A;  3T1Y O;  2X6C A;  2DOS A;  4I4T B;  4OXS A;  2EIJ B;  1BZK A;  3DXR A;  1GM7 A;  2EIK C;  3ZX6 A;  1F7Y A;  4DV7 B;  3CC2 V;  1XNR O;  1VIB A;  3LNN A;  5CA1 A;  1VAR A;  5JJJ B;  3E8B A;  3BHP A;  3F5T A;  2IJH A;  3OMA B;  2JDI G;  2WA4 A;  5GON B;  2CK3 G;  4YJ3 B;  4PHZ A;  4DO2 A;  4JI4 B;  1SS3 A;  1S77 D;  2GDS A;  2IJK A;  4GT1 A;  2KB1 A;  1NS1 A;  3KKY A;  1COW G;  3HKE B;  5H5N A;  2E5L B;  1XNQ O;  3D3I A;  1QCE A;  5J9P C;  4LF5 O;  3OGI B;  4X88 A;  3F7Y C;  4K3A A;  5JJN B;  3CMA V;  5LA6 A;  3LDD A;  3E2E A;  1PNM A;  1S5L Z;  3B77 A;  4NTY A;  2QEX V;  2ZXW B;  2VQF B;  1XUQ A;  3F5W C;  2JIZ G;  4DUY O;  1N32 B;  2FKX A;  1NR7 A;  5LHH A;  4TV9 A;  2OTL V;  1I94 O;  2ODM A;  4YXW G;  4X1I A;  2UXB B;  4WFG A;  2AZ0 A;  3CCQ V;  2F23 A;  1WA8 A;  3Q4H A;  1Y76 A;  1BCC H;  5EC2 C;  3K5N A;  4X9Q A;  4JI1 O;  1NKD A;  3RW0 A;  3CXH F;  5ITZ B;  1Y67 A;  4GLX A;  1HNZ B;  5L3B A;  5IYZ A;  3JAR A;  2DYR C;  1OV9 A;  3QO7 A;  2ZIN A;  2UUB O;  2W0F C;  4JI5 O;  3BAA A;  3QF7 A;  1JOY A;  2H94 A;  2IH1 C;  3A0B Z;  5IWA B;  1AI7 A;  3EVK A;  1GRJ A;  1RSO A;  5LHI A;  3SYP A;  2X7R B;  1R1B A;  4X65 B;  1UJW B;  2Q6A A;  5JQG B;  1H2L A;  3H9V A;  1SER A;  1SA0 A;  2DWE C;  2ZIM A;  4F4L A;  4OPH A;  3CRM A;  4JAU A;  1TVK B;  1P7G A;  3JAK A;  4U3J A;  4QPK A;  4UB6 Z;  5KHJ A;  1SQB H;  1LUV A;  3EXA A;  1AI4 A;  4WF9 V;  3ZRW B;  2UU9 O;  4BIZ A;  3CRR A;  2XAF A;  5KX5 B;  4PA6 A;  5EBL C;  3E8F A;  2YXY A;  2ILM A;  4X8A A;  3JCZ A;  2CTW A;  3FD9 A;  3TGU H;  1DGS A;  1YXB A;  2XT9 A;  5D5P A;  2DWD C;  1AB3 A;  3ASO C;  1K5Q A;  2R9I A;  2CTP A;  1KQS U;  4B3R B;  3MHS C;  1SQG A;  2ATK C;  3UKM A;  4CS2 A;  1P7B A;  3T1C A;  2E3C A;  3TK1 A;  2QGN A;  1MAB G;  3EHB B;  2Q68 A;  5HFL A;  1L8D A;  2EIK B;  3GVM A;  3G6B A;  1QLN A;  2P22 C;  2IW5 A;  4PA9 A;  3CX5 F;  1IZ3 A;  1KBH A;  4BW5 A;  5JWP A;  2BE3 A;  4DV4 O;  4GX0 A;  2XOK G;  3IFX A;  2VQE B;  4JI0 B;  1N34 O;  1EN5 A;  2N74 A;  2WLN A;  1PL4 A;  3P3P A;  5IYB O;  4X1K B;  2C2A A;  4E4E A;  5E79 Z;  1AJQ A;  4J11 A;  1YJW V;  1QVF U;  5LHG A;  3IGA C;  3N2K A;  4P9O A;  2Y4U A;  1P49 A;  4QE9 A;  5IJ9 A;  5KHG A;  2JVD A;  3B40 A;  3T1H O;  4JAA A;  1SF9 A;  1ZSP A;  3TCU A;  3MD0 A;  4O4H A;  3RVZ A;  3D36 A;  4TUY B;  1K9M W;  2RNB A;  3RYH B;  2JJ1 G;  3M99 B;  3SJB C;  5C93 A;  3VQW A;  4IL6 Z;  2ZT9 B;  2UUC O;  4CBC A;  5EC1 C;  5BR8 O;  4TV8 A;  5B5E Z;  4LFA B;  1HR0 B;  2Y0I A;  3MHH C;  5LL6 Y;  3O9O A;  4PDM A;  2PTM A;  1VMG A;  4JGS A;  2UXD O;  4DV5 O;  2F4V B;  4LWS A;  3K57 A;  2WA3 A;  2XUM A;  5D5Q A;  3JD0 A;  3CEI A;  4LC1 A;  2Q7E A;  4B3M O;  2E74 B;  2A3Q A;  4LBE C;  3BPZ A;  4B7E A;  1JMK C;  3I55 V;  1XRE A;  1CXZ B;  3N2G B;  2FYU H;  2AW9 A;  2DYR B;  2PY5 A;  3L72 H;  1AIL A;  3SPC A;  4FLW A;  1G4Y B;  1EM1 A;  4I5S A;  5GW7 A;  2W6J G;  2QTS A;  5CB4 A;  2X6A A;  1K92 A;  1E1R G;  2QM8 A;  3CYO A;  4DR2 B;  4FFK A;  1WP8 A;  1AI5 A;  3GWO A;  4DUZ B;  4F6E A;  2E75 B;  3ZHS A;  3OAA G;  4DV1 B;  1GM8 A;  3G6E V;  1DF5 A;  5DEC A;  2CTR A;  2EJ7 A;  2LFR A;  3LDC A;  4LF7 B;  2L6L A;  3DC6 A;  4YHH B;  1MSW D;  2P5O A;  3JD4 A;  2JEU A;  3OE7 G;  4P30 A;  4DV7 O;  4DR6 B;  4PDV A;  5BZB A;  4JI6 B;  3HKD A;  1Y6X A;  4YJ2 B;  2QM7 A;  4DRX B;  3RBZ A;  3ASO B;  5LYJ A;  1SET A;  3ZBH A;  1XQ8 A;  3E8G A;  4TT3 G;  4LFC B;  4NTX A;  3G80 A;  4DR3 B;  4AIL C;  2E5L O;  2XHB A;  4OGQ B;  1US6 A;  1SQF A;  2JEX A;  2Z3Y A;  4W4K A;  1IXM A;  4G28 B;  2K1E A;  2KSD A;  2Q7G A;  4K35 A;  1BT8 A;  3LSS A;  1ENV A;  1XHZ A;  1HNX O;  3OMN B;  5DN6 G;  2DMX A;  4JI2 B;  1GMG A;  2CTQ A;  4UB8 Z;  3BY6 A;  5A9G A;  1JR9 A;  3H1I H;  4HAM A;  4WBN A;  4FM2 A;  5CA0 A;  4BIO A;  2DYS C;  3VBB A;  3STZ C;  1IBK B;  4XBF A;  4MW3 A;  2CDY A;  2VQF O;  2L35 A;  1Z5V A;  2OIG A;  1FXK A;  2YI8 A;  4DR4 O;  1HNW B;  4Q20 A;  3CCR V;  1K33 A;  3J7A U;  3S3W A;  1M90 W;  4O4L B;  2LO1 A;  4JYY A;  1H38 A;  4O4J A;  2UXB O;  1Y66 A;  3DXR B;  4HBN A;  4EFE A;  4R6Z A;  4UVC A;  4DK0 A;  2XTA A;  1BHA A;  5CA1 B;  4K0K B;  2ARH A;  1KKD A;  4G2K A;  2BOC C;  1XOU A;  1OCZ C;  1YEW A;  1MZE A;  3FB8 C;  3OM3 B;  2WLH A;  1LR1 A;  4DYL A;  1PV0 A;  1VEW A;  2YXH A;  2ZR2 A;  4ZHQ A;  4GCZ A;  1M56 C;  1IXB A;  2P06 A;  5IWA O;  1NT2 B;  1NVP B;  1PD3 A;  1NVP D;  1AI6 A;  1HP8 A;  5H2F Z;  3RN4 A;  5B1N A;  3WB0 A;  4X65 O;  3K9A A;  4N23 A;  5LA6 B;  4BIU A;  2PZS A;  4KP4 A;  4GX5 A;  2HG5 C;  4WFB V;  1XL6 A;  4DK1 A;  4MVM A;  3JAW A;  1IX9 A;  5LGU A;  3T4Z A;  1I0H A;  1N33 B;  1WB7 A;  3D36 C;  2O57 A;  5L3D A;  3ZJZ A;  1FYJ A;  2M7W A;  5BXZ A;  1N36 O;  1L0N H;  4TV9 B;  2OWO A;  2VS0 A;  2NNU A;  4PDR A;  4B3T B;  1IUR A;  1K4C C;  1YIJ V;  3D3Q A;  2UXC B;  4X1I B;  4DW1 A;  4JI3 B;  3RYF A;  4DV2 B;  1VQ7 V;  2ZM6 O;  2Z0A A;  4XDK A;  4WFA V;  3CCV V;  4FZ0 A;  4TSF G;  4FM0 A;  1J5E O;  1Q3E A;  1WA8 B;  2V7Q G;  1M4U A;  5FPO A;  2P67 A;  2YIB A;  3H01 A;  1Y76 B;  2F93 B;  4DV6 B;  3UO3 A;  2Y48 A;  1THZ A;  3T4D A;  3K04 A;  2CAZ C;  1BGY H;  3CRA A;  2RQ6 A;  5IYZ B;  3RWR D;  4PI0 A;  3JAR B;  1ZUQ A;  2FL4 A;  1DK1 A;  3A0H Z;  2R9R B;  1MSD A;  3TET A;  5F2V O;  4NXN B;  3BVO A;  3IC7 A;  3S3X A;  2OYQ A;  5K1P A;  1RSO B;  1XMO B;  3OFN G;  1K73 W;  3HKB A;  1IBM O;  1SA0 B;  1GAX A;  4UCT A;  3CCE V;  4X64 B;  1CEZ A;  3CJH A;  3RGB A;  3QO5 A;  3JAK B;  4U3J B;  4IYH A;  3AK3 A;  1E79 G;  3IC9 A;  3EFF K;  3THO A;  4AQY B;  4ZOL A;  4YIO A;  3CB2 A;  1R3L C;  2ZCE A;  4KUM A;  1M9N A;  4DR1 B;  3ZED A;  4YY3 B;  3OT7 A;  4LFB O;  2DYS B;  3VOU A;  4DV3 B;  5EBM C;  4ICG A;  3KCY A;  4EEQ A;  3JSN A;  4LF6 O;  3WU2 Z;  4K8X A;  1V9P A;  5FNV A;  1MA1 A;  1HR0 O;  1MMM A;  3NXS A;  4JI7 O;  1XHX A;  1R73 A;  3K59 A;  1OZ0 A;  2F4V O;  4L8J A;  2HKO A;  5LMN B;  4FLU A;  1KP3 A;  4KFM A;  1FJG O;  3QTC A;  1UFI A;  4ZIB A;  1V55 C;  3ZHU A;  4WFF A;  4B3S B;  4IHJ A;  1OCZ B;  3JSL A;  5CN0 A;  1Q5O A;  4JF3 A;  4LF4 B;  1QQC A;  1FXK C;  1M56 B;  4RUE A;  3RVY A;  5EK0 A;  3FB6 C;  4DXW A;  4I7Z B;  3P30 A;  3J81 N;  1SQP H;  1NJI W;  3N2K B;  1ROP A;  3QO8 A;  4DR2 O;  2AGA A;  3SYO A;  1WN7 A;  2RJZ A;  3ZMV A;  2IU0 A;  5IJ9 B;  3OUS A;  3W7T A;  3H1L H;  4AHC A;  4JV5 O;  2HHH B;  2OT5 A;  1S5J A;  4CZZ A;  1VQO V;  3X2Q C;  1OCO C;  1F4N A;  4YHH O;  1VQ5 V;  5KHK A;  2WAM A;  4TV8 B;  1K4D C;  2QSA A;  4LH7 A;  1H8E G;  3CP1 A;  1IDS A;  5L3G A;  4FLZ A;  1R6N A;  4HZ3 A;  4GKJ B;  4LWS B;  4PA7 A;  2N04 A;  2LFS A;  4FZ1 A;  4IYI A;  3JAS A;  2XND G;  2GUZ B;  4DR3 O;  1VQL V;  5E1A C;  2JS3 A;  3A2F A;  1TAE A;  3FFQ A;  4CC6 A;  2EX3 A;  3RYI A;  2Q7H A;  4PA3 A;  5A2Q N;  1BS3 A;  1G6U A;  4MSW C;  5LOV A;  2MK3 A;  1KEC A;  1BL8 A;  1KUQ A;  3L75 H;  5CB4 B;  3P3N A;  3FB7 C;  1URF A;  2V1D A;  3K5O A;  2RMK B;  3RFR A;  1IVS A;  4UCS A;  1JPX A;  2ZE8 A;  1EZV H;  2CE4 A;  4NTW A;  1B04 A;  3W7S A;  2V4D A;  3TXS A;  2GBO A;  1Q8I A;  4H13 B;  1XMQ B;  2WLI A;  3ZHV A;  4I50 A;  1XIL A;  2PUS A;  3ABL C;  4JI8 B;  2JGD A;  5IT9 N;  2WLL A;  2P4K A;  4QIW F;  3JD3 A;  3SR2 C;  2QR4 A;  3H1K H;  1F51 A;  3HKD B;  5LXT A;  4K0K O;  1HW7 A;  4LCU C;  4CS3 A;  2QA4 V;  2IM9 A;  4J42 A;  2IU3 A;  1B06 A;  4QPJ A;  1GK9 A;  4P2Z A;  1KU9 A;  1VF6 A;  4DV0 O;  1ZL8 A;  5EIB C;  5LYJ B;  2EIN C;  4FLT A;  3WG7 C;  4Z1M G;  4O2A A;  4ZKI A;  3ZN1 A;  1HDJ A;  1QHT A;  1M5I A;  1JJ2 U; 
#chains in the Genus database with same CATH homology
 1N32 O;  1XMO O;  4DR7 O;  4DR1 O;  4DV4 O;  1A32 A;  1R6T A;  1XEQ A;  4JI1 O;  3SDL A;  4DUZ O;  1N34 O;  3J80 N;  5BY1 A;  5IWA O;  2N74 A;  4DV1 O;  4DV7 O;  4OPA A;  4LFB O;  4X65 O;  4LF7 O;  2VQE O;  4DR3 O;  4JI0 O;  3T1Y O;  2UUB O;  4JI5 O;  2DOS A;  4GKJ O;  4DR6 O;  1HNZ O;  4JI6 O;  4LF6 O;  1F7Y A;  4YY3 O;  5FLX N;  3T1H O;  1XNR O;  4B3T O;  2LW7 A;  4DV3 O;  1R1B A;  1HR0 O;  5A2Q N;  3RT3 C;  2E5L O;  3JAM N;  4JI7 O;  4LF9 O;  3F5T A;  4KHP O;  3O65 A;  4A5U B;  3R66 A;  1FYJ A;  4OPH A;  1KUQ A;  1FKA O;  5BXZ A;  1N36 O;  4DR5 O;  2F4V O;  2UUC O;  1D2D A;  1N33 O;  4LFC O;  4DV6 O;  5BR8 O;  4LF8 O;  1HNX O;  1NS1 A;  4JI8 O;  4LF4 O;  5LL6 Y;  2UU9 O;  5H5N A;  1XNQ O;  1FJG O;  2ZM6 O;  2Z0A A;  3OTO O;  1J5E O;  2ZKO A;  4JI4 O;  2UXD O;  4DV5 O;  4X66 O;  5LMN O;  4LF5 O;  4LFA O;  2DJV A;  2UXC O;  4OX9 O;  4JI3 O;  1X59 A;  4JI2 O;  4DV2 O;  5IT9 N;  2VQF O;  1AB3 A;  1YZB A;  4X62 O;  4DR4 O;  3M8A A;  4B3M O;  4B3S O;  1XMQ O;  2JRI A;  4K0K O;  2HHH O;  3J7A U;  3J81 N;  4JYA O;  1IBK O;  1IBL O;  1AIL A;  1DK1 A;  2UXB O;  4DR2 O;  2AGA A;  1HNW O;  4X64 O;  4DV0 O;  4NXM O;  4B3R O;  4DUY O;  2UUA O;  2FKX A;  4JV5 O;  1G1X B;  4AQY O;  1I94 O;  1IBM O;  4GKK O;  4YHH O;  4NXN O;  5LMU O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...