1ABAA

The structure of oxidized bacteriophage t4 glutaredoxin (thioredoxin). refinement of native and mutant proteins
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
87
structure length
87
Chain Sequence
b'MFKVYGYDSNIHKCGPCDNAKRLLTVKKQPFEFINIMPEKGVFDDEKIAELLTKLGRDTQIGLTMPQVFAPDGSHIGGFDQLREYFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAREDOXIN
publication title Structure of oxidized bacteriophage T4 glutaredoxin (thioredoxin). Refinement of native and mutant proteins.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Electron transport
total genus 24
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 1992-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1abaA00
1I9DA 1H75A 4LA1A 1S3CA 5DQSA 2X64A 1GTBA 1JLVA 2F8FA 3KMOA 4NXIA 2R4VA 2B6MA 5EL8A 1GSDA 3H4KA 3M3MA 3TKSE 3KP9A 3JCML 3UAPA 2H0HA 4OD7A 3FK8A 4L0UA 2AB6A 4MH3A 2CV4A 1TRVA 3WD6A 2BMXA 4EVMA 3TJGA 2HYXA 1O8WA 4ULXA 2OE0A 1TRSA 3RAZA 3TRPA 6GSTA 3ZZXA 1PSQA 4IQAA 2YANA 2O89A 1V40A 4BVYA 4MPFA 1K3LA 4I97A 2FGXA 2XPEA 4JR4A 2KHPA 3Q19A 1OC9B 3FKFA 4HQSA 4ECBA 3HJPA 5CP1A 1R5PA 2VCXA 2QC7A 4O5RA 2YWNA 4YQUA 5G5EA 4K7NA 5H5QA 2DJJA 4YQMA 2QKEA 3D6IA 6GSWA 2I1UA 1XWGA 5E4WA 2MYGA 3FRCA 2C0FA 1QK8A 1SL2B 1GTIA 4G2EA 4MF7A 3F8UA 3GX0A 2H73A 5E59A 3UVTA 2H1DA 4WXTA 4ID0A 3HHVA 3D0ZA 1X0RA 5ECHB 1JZWA 3HJOA 4KAEA 3TDGA 2F9SA 4F82A 2DIYA 1GP1A 5IQYA 1UA5A 3DWVA 3WGDA 1DE1A 5IO2A 1XZOA 4MJBA 2B3SA 4PURA 4HOJA 3M9KA 3ZIVA 4TOPA 3D21A 5CRGA 2M80A 1AC1A 2GVPA 2RIIA 4GSTA 3VI5A 2RM6A 2EC4A 4HQZA 4AJ8A 1TOFA 4HZ2A 5ECPB 3TUEA 3J7Yb 1E2YA 4F9ZA 2O8VB 4KNDA 1WP0A 2YWIA 4TR1B 3EC3A 4MJEA 1O81A 4IP1A 1AQWA 2NBSA 3QD9A 2JSZA 1DBYA 3UL3A 2IMFA 3OR5A 3EU4A 2C8UA 3F3RA 2L6CA 3APOA 5G2ZA 3IBHA 1AXDA 3IDVA 4KCEA 4L5LA 1XW5A 5ECQB 1G6WA 2L57A 5AGYA 3RBTA 3C73A 4AF2A 2AV4A 3IHQA 5GAND 7GSSA 4IGJA 2I81A 3C1RA 1WRYA 2VL2A 2N5BA 1RW1A 5J41A 3ED3A 5AIXA 3F6DA 1GSEA 2AJQB 2R2JA 4ISDA 2JL4A 4EXJA 2FWHA 3I9V2 3QR6A 4HU9A 1CQGA 1QQ2A 2GSTA 3CTFA 1A0RP 4X0XA 2IFQA 3WGEA 3VWXA 2VD1A 5DBQA 2LNTA 2GZPA 2YJ7A 2I4AA 4K7IA 3TCOA 5JCWA 1GTUA 2V6OA 1XWCA 3IK9A 4FH8A 4JZQA 1XVQA 4GQFA 4TN8A 2HRNA 1A0FA 2FA8A 2X8HA 2L5LA 4WF5A 4FO5A 4BA7A 3C7MA 3GIXA 4ECCA 5G31A 2ES7A 5CAXA 3F0IA 2G2QA 1Z5YE 1URMA 3HKRA 1G7OA 4ACSA 1ILOA 5F05A 2YP6A 4N30A 4TRXA 3FR9A 1A24A 3CSHA 1ML6A 2HZFA 5AN1A 1XOAA 4K1FA 2P5QA 4JE1A 3D4MA 4XTSA 2MBSA 1HNBA 3PGTA 2C3QA 3W6GA 1Y25A 3RDWA 4PQIA 1U6TA 1A2LA 2IMDA 2B1KA 2HZEB 3TKRA 3GRXA 1WOUA 2CX3A 1EOHA 1KTEA 2PVOC 5D73A 4ZB9A 3GSSA 4V2MA 3G7IA 2JADA 1B4PA 4BWSA 2WGRA 5LCZA 1O8XA 1BG5A 3IA1A 2RUFA 22GSA 2XC2A 5GSTA 1TK0B 2QGVA 2D2ZA 2H0GA 2OE3A 4K2DA 3L4NA 2DJ0A 3BCIA 1X5CA 3L9UA 4EC0A 4V2LA 4J56E 3FZ9A 1ON4A 5CRDA 2NPBA 1EP7A 3BBYA 1TP9A 1ZZYA 3A3TA 4POBA 3DVXA 2VO4A 4JBBA 2VL9A 1M2BA 2HRFA 2LS5A 3UARA 5HR3A 3UOMA 2YWMA 5D9TA 1U3AA 3Q18A 1Y6EA 5EY6A 4HDEA 1OYJA 3WYWA 4H86A 1R4WA 5ECRB 1F6MC 3ISOA 1Z3EA 3L78A 2YZUA 3ZYWA 4FYBA 3TRQA 1H4OA 1ERUA 1GH2A 2VD0A 2VM1A 3P8WA 4CHSA 2PERA 1YF0A 3FR3A 3GKKA 1ERWA 1EWXA 4O92A 2PBJA 2M72A 3NZNA 2XPDA 4V1Ap 3GL5A 5ECKB 17GSA 1PGTA 5HFKA 3IR4A 3IPZA 5D9WA 4G19A 1WMJA 2CA8A 3KIJA 3EINA 2H71A 1SD8A 2DJ3A 2VUPA 4MLYA 1PKZA 2NTOA 1WWJA 4JU5A 4QQ7A 2C1YA 2OE1A 1OKTA 4BVXA 4GTUA 4F0BA 2HZEA 4IBPA 2DMMA 1TI3A 1AAZA 2H76A 4PXOA 4MJAA 1YF1A 3E3EA 4WETA 2AYTA 3LJRA 2L5OA 4ZXGA 1Z6MA 1R26A 1T00A 5B8AA 4WBRD 2LQQA 5INYA 2E7PA 2CVBA 3M1GA 3ZIJA 6GSXA 3VFIA 3H1NA 5HQPA 2XHFA 3J7Yk 1U3IA 1YY7A 4F0CA 1QMVA 2P0GA 3LFLA 1YDKA 4XHMA 4JR6A 3LQ7A 2YWOA 1X5EA 5KN1A 2VCWA 5F06A 3M8NA 2B5YA 4KA0A 3RPPA 2LRCA 4NHWA 2IMIA 5EPFA 2F51A 3VURA 3HYPA 3QAWA 3L9VA 5DCGA 2ON7A 2H74A 5H5RA 1IYIA 3CRUA 5DCHA 5A4VA 1EEMA 3IAM2 1TXXA 3M0FA 2LQOA 1SKWB 3DD3A 4PNFA 3UMAA 4RQXA 3NOFA 2H70A 1JZRA 5G30A 1O73A 4HEA2 1FB6A 4O32A 1AQXA 4OCFA 1VRSD 2VM2A 2MMNA 5F0GA 1U87A 1XFLA 3GTUB 3Q6OA 1JFUA 4LMWA 1SK0A 3SBCA 4Z7XA 2H30A 4PX1A 3KMNA 2DJ1A 1MDIA 1G0TA 4PGTA 1ZOFA 1K3OA 3ERFA 1EEJA 5HR2A 2XBIA 3K8NA 4DSQA 2Z9SA 1S3AA 1PL2A 1ZCPA 2GSSA 1MTCA 4WBJA 3GFKA 4DSRA 5B7CA 1SKRB 1OE8A 1T7PB 1XWBA 3BOAA 4GQCA 3KTLA 3ZMLA 10GSA 4GXZA 5IOWA 3TOTA 5HR1A 1OC3A 3QFBC 4KE3A 1YEXA 1X5DA 1K0AA 4IW9A 5JWRB 4X1UA 1UN2A 5F07A 2IFQB 2H72A 3KJYA 2IN3A 4NMUA 5COHA 3MNGA 1KEBA 2R5GA 5IMFA 5DJMA 1JZDA 3VPTA 1OE7A 1O6JA 4HU7A 3LYKA 3U6VA 2B5EA 4IJ3A 4EE0A 3LORA 2C3TA 2HXKA 2MMZA 1PMTA 1USBA 3VLNA 5JCUA 4LLRA 3V1WA 3US3A 4XRAA 1MDJA 2E2GA 3KGKA 2C80A 3I69A 2WULA 1Z9HA 4GSNA 3MSZA 1OAZA 2DBCA 1HNCA 1ZL9A 3LWAA 3HA9A 3CXGA 4ML1A 3CTGA 2GZYA 4Q5FA 4RI6A 4D73B 5IMZA 4BWQA 1BJXA 2GSRA 2YJHA 1FAAA 1XCCA 4G9HA 4HJ2A 2L6DA 1OVNA 1X9WB 5D93A 4WKWA 2PN8A 4OCEA 1M0UA 2L59A 1T4YA 1C72A 2H1AA 3FZAA 3GTUA 3EWLA 3VK9A 3F4TA 3UEMA 3H93A 5J9BA 5IM9A 4HS1A 2H6ZA 3EU3A 2OACA 2CZ3A 5EVOA 2K18A 1A23A 1KNGA 4XRDA 1FVJA 4MA9A 3DRNA 2LV3A 6GSUA 1NW2A 1TTZA 1T3BA 3MAKA 3H79A 2LJRA 3VI7A 3D4TA 2ALBA 2F3MA 4TW5A 1SYRA 3KZQA 3QAVA 4GLTA 5HFIA 2FWFA 3HXSA 3TRXA 2K9FA 3F4RA 3QPMA 4ZL8A 2LJAA 1ERVA 2LSTA 1RQMA 2PWJA 2RM5A 5JWOB 3VWVA 1F2EA 2K8SA 4LL1B 1T4ZA 3GN3A 3CYNA 1ERTA 4EO3A 3CSIA 2B1LA 2RUEA 5AISA 1EP8A 5ID2B 3KCMA 1X9SB 2JSYA 1AUCA 2ZCTA 2IWTA 4PUAA 5D96A 1XW9A 2IIYA 1R7HA 5FWGA 2VCVA 4E8EA 1WPIA 3IRAA 2LUSA 1ZYEA 2R6KA 2X8GA 4D73A 4QL7A 2YPMA 1QGVA 2IL3A 2KP2A 3LSZA 2LRTA 20GSA 2V2GA 1BQ7A 3GMFA 3KM6A 1FW1A 3IOSA 2GTUA 3APQA 1J0FA 5D9XA 2FLSA 2IMEA 2O85A 2FD3A 2H19A 5GSSA 4MPGA 5J5NA 2GT5A 2X8CA 4KSOA 3N9JA 2EIQA 2KLXA 3CBUA 2FY6A 3HZ8A 3ME7A 4ZIJA 3H8QA 5DVBA 4L5OA 3TOUA 1F9MA 3TKSA 3ZREA 5ECIB 5ECNB 1GUKA 4KDXA 4E8HA 1JZOA 2VL2C 4Q5RA 4ZL9A 3KXOA 3KH9A 1NHYA 4CDOA 1K0NA 1EV9A 3FW2A 4FYUA 2FNOA 4KH7A 3P7XA 3D5JA 3M9JA 4I2TA 4BL7A 1SK1A 2C4JA 4RQRA 3G7YA 2QSIA 5D9VA 4WF4A 2PGTA 4X43A 2P5RA 3DKSA 5CRHA 2FCHA 4ECJA 1F3BA 3HVSA 2GDRA 2B7JA 1G7EA 1ACVA 1MD3A 1JLWA 2KP1A 2LNSA 4KUNA 2AHEA 3LGCA 4MCUA 3LXTA 4PNGA 1VGLA 2WDUA 3F4SA 2L4QA 1PKWA 5ECMB 4IP6A 3ZMKA 3ERGA 3P90A 4KSMA 3A2VA 3WGXA 4EDYA 1VF4A 4LMVA 2ZNMA 4MF6A 1SD9A 1XVWA 3DMLA 1SJ6A 3WT2A 5A4UA 4K7OA 1PX7A 1B9YC 2J9HA 5ID2A 2R3XA 1WIKA 3G7JA 3D22A 1WE0A 3GSTA 4NV2A 3QOUA 4WR5A 3ZITA 4RI7A 2VCQA 4ZL7A 1V9WA 1TK5B 1MD4A 5ECOB 2PVQA 3Q74A 2HSHA 2OJLA 4CW9A 1V98A 1PRXA 1ZYQB 1SKSB 2GGTA 3GURA 1A2JA 4I6XA 13GSA 2PUKC 1QFNA 2GS3A 4NV5A 1R5AA 2FUG2 3UJ1A 3BD2A 1XPVA 3CRTA 2PMTA 9GSSA 4AJ7A 1CQHA 1V58A 4ZB8A 1I5GA 4YQVA 4GF0A 1F37A 1XWAA 5J9CA 3P2AA 2FA4A 1QXHA 3GKNA 5L71A 2LTKA 5B6NA 4HI7A 2L4CA 3IAS2 4KDYA 1M7TA 4DVCA 1FOVA 2DMLA 4PQ1A 2KUCA 5A4WA 5HR0A 3F3QA 2JZRA 2A4VA 1RK4A 2LEGA 4N0VA 3UVHA 2EIRA 5DAKB 4K0NA 2WCIA 5DALB 1XOBA 2VIMA 5A5KA 1BX9A 4TR3A 5IPHA 4MP4A 2I3YA 3EVIA 11GSA 1GSYA 4AGSA 1ST9A 3GH9A 4J2FA 4KDUA 2YN1A 2GLRA 1TI1A 2M46A 1W89A 2RLIA 4KGIA 2O87A 1XIYA 3GL3A 2TIRA 3GHAA 3I43A 3KD0A 2FWEA 5G5FA 3FYGA 2BTOT 4HUAA 5F8BA 1SJZA 1MEKA 3ME8A 5CYYA 3ZFBA 2A2SA 4K0GA 3FZ4A 3O76A 4V2NA 1NSWA 4MK3A 1V57A 4OFTA 1A8YA 1YKAA 4MJCA 1PD21 1VF2A 2K6VA 4N0ZA 5IMDA 3VPQA 4I8BA 2V41A 1X9MB 5CO3A 2BJXA 1UC7A 4PQHA 5KN2A 4MH2A 2X99A 2MZCA 1W4VA 2EIOA 3ZVJD 2R37A 1FB0A 1PN9A 1J9BA 2REMA 1TK8B 5DQYA 5GZZB 3TJKA 4TXVA 1M9BA 3DYRA 1SU9A 1TRWA 1DUGA 1AQVA 2CX4A 4Q5NA 5ENUA 2V6KA 1PA3A 2YOIA 2JACA 4NAXA 3IE3A 3LG6A 4IKHA 3MWHA 5J3RA 3DVWA 2WZ9A 3U5RE 2JU5A 4DEJA 4K6XA 1GSSA 4YH2A 4DSSA 4NWYA 4YAPA 2NVLA 2DIZA 5KN0A 3TJFA 4F03A 3AY8A 2DJKA 5CRWA 3SWLA 2B7KA 8GSSA 3TGZA 4LL4B 5DAKA 5DALA 5DDLA 4GRFA 4ZBBA 1B48A 1FHEA 4K9ZA 4POKA 2VOCA 3A2XA 1PQNA 3QCPA 2GQKA 3ZFLA 1KBNA 4FIWA 4KX4A 5AIVA 4F2IA 2VCTA 2CVDA 2OBKA 4ILFA 2N5AA 2CVKA 2E0QA 4POLA 4IHUA 4L0WA 1SK2A 4MZWA 5ELGA 2ON5A 1M99A 1LJRA 2DJ2A 2VCZA 4EL1A 5ECSA 1GL8A 5G1KA 3IV4A 3TKQA 5B8BA 1BEDA 1BAYA 4ZB6A 6GSVA 2CAQA 4ZBDA 3VWUA 3DGQA 3W8JA 4KW6A 3LYPA 4ZILA 2AAWA 3E0UA 3UBLA 1GUMA 2PU9C 1M2DA 3FEUA 5H5SA 1SL0B 3GA4A 19GSA 5G1LA 3TB2A 1SENA 1GNEA 1ZGNA 1AIUA 1S3DA 1BYEA 2XBQA 4KB3A 5IOXA 2IJYA 16GSA 3EMPA 3DIEA 2YNXA 1GRXA 1HQOA 2JZTA 1ABAA 4I5QA 5C00A 1A2MA 3MDKA 3BCKA 1SYXA 3C1SA 3FY7A 4MDCA 1EGRA 1F3AA 4XS1A 3ZTLA 2H0IA 3GYKA 5D8IA 5DJLA 2HI7A 3HCZA 1FO5A 2VAFA 3HY2A 3HJMA 3LEFA 4TR4A 3GV1A 1Z7PA 3FR6A 4EF0A 4EUYA 2J23A 2WS2A 1YEPA 2O7KA 1SJIA 3LXZA 1YKCA 2C0GA 2TRXA 2HT9A 1OC9A 3EE2A 5KN3A 1YQ1A 1TJDA 2IPAA 4EKZA 4FYCA 2VL3A 2N5FA 2LKUA 2GSQA 3E9JB 2G0FA 1K0MA 2C3NA 1VF3A 4OO5A 4XS4B 4TR0A 3L0HA 4N10A 3DXBA 2OBIA 3APSA 1NM3A 3ZL5A 4OFNA 2OKAA 1B8XA 1B4QA 2HFDA 1HD2A 1Q98A 4ECIA 3EURA 1Q4JA 1TU7A 2H6YA 1LBKA 3CSJA 2CT6A 2DLXA 5CREA 2KOKA 4IS0A 3KTBA 3G9BA 4IVFA 5J4UA 3TKPA 3A2WA 1EOGA 4JEDA 2TRCP 6GSYA 2YV7A 2WJUA 5KEJA 1A8LA 2PPTA 2MBTA 4TXOB 3TJJA 3DEXA 1XBSA 2VLUA 1XWKA 1HNAA 2H01A 3GKMA 4TR1A 1TKDB 1GSQA 3RPNA 1E6BA 3IC4A 3ZLPA 5ABRA 3IK7A 3HDCA 1JHBA 12GSA 3CMIA 1EGOA 1UVZA 1TDIA 2CAIA 5IMVA 1FVKA 2YV9A 2VLVA 5ELAA 2H75A 4POMA 2VLTA 3WT1A 4KCAA 2YZHA 1G6YA 4OMVA 4G10A 3F6FA 2FHEA 4IJIA 4MMMA 4ZBAA 1HYUA 4BPYA 4EDZA 1GSUA 4GWRA 1K0DA 2JZSA 1GTAA 1O85A 3VWWA 6GSSA 4IELA 1K3YA 1NHOA 3PINA 4XS6A 3HVXA 2HLSA 4QL9A 1N2AA 1XXUA 2GZZA 3ERWA 3L9SA 4MZCA 3GH6A 3TJBA 3KEBA 1GSFA 2NDOA 2WRTA 2H1BA 4GCIA 2CZ2A 2H66A 1GLPA 1ZMAA 3GNJA 5IO0A 1YZXA 4IN0A 4RUVA 1QUWA 5C04A 2GQLA 2DC5A 4XS4A 2ZUPA 2H8LA 3TKSC 1PL1A 2V32A 3RHCA 18GSA 3ZRDA 2B5XA 3GUSA 4P3YB 3R2QA 5LNKe 1EV4A 4J57E 1Z7RA 4IQ1A 5B6MA 2K8VA 3HD5A 1EZKA 2GT6A 4WR4A 3HZ4A 3QFAC 1Z6NA 4L8EA 3A5WA 5JWQB 3C71A 3GX8A 3N5OA 2F8AA 3BJ5A 2GQMA 1OC8A 3PH9A 3ZVJA 4TKYA 5CNWA 1IYHA 4HZ4A 4TXOA 3GKXA 3QDNA 1V2AA 2H6XA 1U88A 2C0EA 2E2MA 1K0CA 1TW9A 2HE3A 3RHBA 3KP8A 1GNWA 1O7UA 4YAVA 4I2UA 4DSSB 5GAPD 4TVEA 4HJMA 2LRNA 5FHIA 2V1MA 1AW9A 4XIHA 1T1VA 3C8EA 5IPGA 1M9AA 5IMAA 2YCDA 1THOA 1B9XC 4N11A 2OA7A 1XW6A 1SL1B 4NPBA 5FT3A 1PX6A 1LU4A 2I9HA 3F9UA 4NHZA 3S9FA 5ECLB 1N8JA 1DSBA 2HSYA 3HVVA 5HFGA 3UIWA 2AUVA 4K8MA 4WEYA 3W8SA 4MZBA 2LJKA 3QMXA 1THXA 4Q5QA 1YJ6A 1OKDA 1K0BA 2WB9A 3O6TA 2CQ9A 4ML6A 3QAGA 4OWYA 4XCSA 4AJ6A 2IMKA 1MDKA 2A2RA 3NIVA 2C0DA 4PUFC 5IMCA 14GSA 2DSAA 1FG4A 2P31A 1M2AA 4OO4A 1DE2A 2MMAA 5JCGA 3I6AA 3F63A 1GLQA 3UBKA 5IIZA 4V1Ag 3EYTA 4GSSA 1GUHA 1GULA 4O7HA 4MF5A 1WJKA 2OADA 3FZ5A 1K0OA 3PR8A 4MABA 1GWCA 3O3TA 1TU8A 2H1GA 3IXRA 2FWGA 5LD0A 1J08A 4JRRA 2MMOA 2HNLA 2WFCA 1VF1A 3FHKA 3KH7A 3EMXA 4OFMA 1TRUA 1T8EB
chains in the Genus database with same CATH superfamily
1I9DA 1H75A 4LA1A 1S3CA 5DQSA 2X64A 1GTBA 1JLVA 2F8FA 1ZYNA 3KMOA 4NXIA 2R4VA 2B6MA 5EL8A 1GSDA 3H4KA 3M3MA 3TKSE 3KP9A 3JCML 3UAPA 2H0HA 4OD7A 3FK8A 4L0UA 2AB6A 4MH3A 2CV4A 1TRVA 3WD6A 2BMXA 4EVMA 3TJGA 4K5SA 2HYXA 1O8WA 4ULXA 2OE0A 1TRSA 3RAZA 3TRPA 6GSTA 2X4AA 3ZZXA 1PSQA 4IQAA 2YANA 2O89A 1V40A 4BVYA 4MPFA 1K3LA 4I97A 2FGXA 2XPEA 4JR4A 2KHPA 3Q19A 1OC9B 3FKFA 4HQSA 4ECBA 3HJPA 5CP1A 1R5PA 2VCXA 2QC7A 4O5RA 2YWNA 4YQUA 3EPTA 5G5EA 4K7NA 5H5QA 2DJJA 4YQMA 2QKEA 3D6IA 6GSWA 2I1UA 1XWGA 5E4WA 4CY6A 2MYGA 3FRCA 2C0FA 1QK8A 1SL2B 1GTIA 4G2EA 4MF7A 3F8UA 3GX0A 2H73A 5E59A 3UVTA 2H1DA 4WXTA 4ID0A 3HHVA 3D0ZA 1X0RA 5ECHB 1JZWA 3HJOA 4KAEA 3TDGA 2F9SA 4F82A 4Z2UA 2DIYA 1GP1A 5IQYA 1UA5A 3DWVA 3WGDA 1DE1A 5IO2A 1XZOA 4MJBA 2B3SA 4PURA 4HOJA 3M9KA 3ZIVA 4TOPA 3D21A 5CRGA 2M80A 1AC1A 2GVPA 2RIIA 4GSTA 3VI5A 2RM6A 2EC4A 4HQZA 4AJ8A 1TOFA 4HZ2A 5ECPB 3TUEA 3J7Yb 1E2YA 4F9ZA 2O8VB 4KNDA 1WP0A 2YWIA 4TR1B 3EC3A 4MJEA 1O81A 4IP1A 1AQWA 2NBSA 3QD9A 2JSZA 1DBYA 3UL3A 2IMFA 3OR5A 3EU4A 2C8UA 3F3RA 2L6CA 3APOA 5G2ZA 3IBHA 1AXDA 3IDVA 4KCEA 4L5LA 1XW5A 5ECQB 1G6WA 2L57A 5AGYA 3RBTA 3C73A 4AF2A 2AV4A 3IHQA 4PTSA 5GAND 7GSSA 4IGJA 2I81A 3C1RA 1WRYA 2VL2A 2N5BA 1RW1A 5J41A 3ED3A 5AIXA 3F6DA 1GSEA 2AJQB 2R2JA 4ISDA 2JL4A 4EXJA 2FWHA 3I9V2 3QR6A 4HU9A 3PPUA 1CQGA 1QQ2A 2GSTA 3CTFA 1A0RP 4X0XA 3HVNA 2IFQA 3WGEA 3VWXA 2VD1A 5DBQA 2LNTA 2GZPA 2YJ7A 4EIPA 2I4AA 4K7IA 3TCOA 5JCWA 1GTUA 2V6OA 1XWCA 3IK9A 4FH8A 4JZQA 1XVQA 4GQFA 4TN8A 2HRNA 1A0FA 2FA8A 2X8HA 2L5LA 4WF5A 4FO5A 4BA7A 4YKFA 3C7MA 3GIXA 4ECCA 5G31A 2ES7A 5CAXA 3F0IA 2G2QA 1Z5YE 1URMA 3HKRA 1G7OA 4ACSA 1ILOA 5F05A 2YP6A 4N30A 4TRXA 3FR9A 1A24A 3CSHA 1ML6A 2HZFA 5AN1A 1XOAA 4K1FA 2P5QA 4JE1A 3A5IA 3D4MA 4XTSA 2MBSA 1HNBA 3PGTA 2C3QA 3W6GA 1Y25A 3RDWA 4PQIA 1U6TA 4BVXB 1A2LA 2IMDA 2B1KA 2HZEB 3TKRA 3GRXA 1WOUA 2CX3A 1EOHA 1KTEA 2PVOC 5D73A 4ZB9A 3GSSA 4V2MA 3G7IA 2JADA 1B4PA 4BWSA 2WGRA 5LCZA 1O8XA 1BG5A 3IA1A 2RUFA 22GSA 2XC2A 5GSTA 1TK0B 2QGVA 2D2ZA 2H0GA 2OE3A 4K2DA 3L4NA 2DJ0A 3BCIA 1X5CA 3L9UA 4EC0A 4V2LA 3MYDA 4J56E 3FZ9A 1ON4A 5CRDA 2NPBA 1EP7A 3BBYA 1TP9A 1FOHA 1ZZYA 3A3TA 4POBA 3DVXA 2VO4A 4JBBA 2VL9A 1M2BA 2HRFA 2LS5A 3UARA 5HR3A 3UOMA 2YWMA 5D9TA 1U3AA 3Q18A 1Y6EA 5EY6A 4HDEA 1OYJA 3WYWA 4H86A 1R4WA 5ECRB 1F6MC 3ISOA 1Z3EA 3L78A 2YZUA 3ZYWA 4FYBA 3TRQA 4FQUA 1H4OA 1ERUA 1GH2A 2VD0A 2VM1A 3P8WA 4CHSA 2PERA 1YF0A 3FR3A 3GKKA 1ERWA 1EWXA 4O92A 2PBJA 2M72A 3NZNA 2XPDA 4V1Ap 3GL5A 5ECKB 17GSA 1PGTA 5HFKA 3IR4A 3IPZA 5D9WA 4G19A 1WMJA 2CA8A 3KIJA 3EINA 2H71A 1SD8A 2DJ3A 2VUPA 4MLYA 1PKZA 2NTOA 1WWJA 4JU5A 4QQ7A 2C1YA 2OE1A 5BRTA 1OKTA 4BVXA 4GTUA 4F0BA 2HZEA 4IBPA 2DMMA 4K2XA 1TI3A 1AAZA 3CQFA 2H76A 4PXOA 4MJAA 4KF9A 1YF1A 3E3EA 4WETA 2AYTA 3LJRA 2L5OA 4ZXGA 5KOWA 1Z6MA 1R26A 1T00A 5B8AA 4WBRD 2LQQA 5INYA 2E7PA 2CVBA 3M1GA 3ZIJA 6GSXA 3VFIA 3H1NA 5HQPA 2XHFA 3J7Yk 1U3IA 1YY7A 4F0CA 1QMVA 2P0GA 3LFLA 1YDKA 4XHMA 4JR6A 3LQ7A 2YWOA 1X5EA 5KN1A 2VCWA 5F06A 1ZYPA 3M8NA 2B5YA 4KA0A 3RPPA 2LRCA 4NHWA 2IMIA 5EPFA 2F51A 3VURA 3HYPA 3QAWA 3L9VA 5DCGA 2ON7A 4CY8A 2H74A 5H5RA 1IYIA 3CRUA 5DCHA 5A4VA 1EEMA 3IAM2 1TXXA 3M0FA 2LQOA 1SKWB 3DD3A 4PNFA 3UMAA 4RQXA 3NOFA 2H70A 1JZRA 5G30A 1O73A 4HEA2 1FB6A 4O32A 1AQXA 4OCFA 1VRSD 2VM2A 2MMNA 5F0GA 1U87A 1XFLA 3GTUB 3Q6OA 1JFUA 4LMWA 2HRAA 1SK0A 3SBCA 4Z7XA 2H30A 4PX1A 3KMNA 2DJ1A 1MDIA 1G0TA 4PGTA 1ZOFA 1K3OA 3ERFA 1EEJA 5HR2A 2XBIA 3K8NA 4DSQA 2Z9SA 1S3AA 1PL2A 1ZCPA 2GSSA 1MTCA 4WBJA 3GFKA 4DSRA 5B7CA 1SKRB 1OE8A 1T7PB 1XWBA 3BOAA 1XG8A 4GQCA 3KTLA 3ZMLA 10GSA 4GXZA 5IOWA 3TOTA 5HR1A 1OC3A 3QFBC 2QA1A 4KE3A 4Z2RA 1YEXA 1X5DA 1K0AA 4IW9A 5JWRB 4X1UA 1UN2A 5F07A 2IFQB 2H72A 3KJYA 2IN3A 4NMUA 5COHA 3MNGA 1KEBA 2R5GA 5IMFA 5DJMA 1JZDA 3VPTA 1OE7A 1O6JA 4HU7A 3LYKA 3U6VA 2B5EA 4IJ3A 4EE0A 3LORA 2C3TA 2HXKA 2MMZA 1PMTA 1USBA 3VLNA 5JCUA 4G0IA 4LLRA 3US3A 3V1WA 4XRAA 1MDJA 2E2GA 3KGKA 2C80A 3I69A 2WULA 1Z9HA 1M3JA 4GSNA 3MSZA 1OAZA 2DBCA 4K5RA 1HNCA 1ZL9A 3LWAA 3HA9A 3CXGA 4ML1A 3CTGA 2GZYA 4Q5FA 4RI6A 4D73B 5IMZA 4BWQA 1BJXA 3MIXA 2GSRA 2YJHA 1FAAA 1XCCA 4G9HA 4HJ2A 2L6DA 1OVNA 1X9WB 5D93A 4WKWA 2PN8A 4OCEA 1M0UA 2L59A 1T4YA 1C72A 2H1AA 3FZAA 3GTUA 3EWLA 3VK9A 3F4TA 3UEMA 3H93A 5J9BA 5IM9A 4HS1A 2H6ZA 3EU3A 2OACA 2CZ3A 5EVOA 2K18A 1A23A 1KNGA 5BMUA 4XRDA 1FVJA 4MA9A 3DRNA 2LV3A 6GSUA 1NW2A 1TTZA 1T3BA 3MAKA 3H79A 2LJRA 3VI7A 3D4TA 2ALBA 2F3MA 4TW5A 1SYRA 3KZQA 3QAVA 4GLTA 5HFIA 2FWFA 3HXSA 3TRXA 2K9FA 3F4RA 3QPMA 4ZL8A 2LJAA 1ERVA 2LSTA 1RQMA 2PWJA 2RM5A 5JWOB 3VWVA 1F2EA 2K8SA 4LL1B 1T4ZA 3GN3A 3CYNA 1ERTA 4EO3A 3CSIA 2B1LA 2RUEA 5AISA 1EP8A 5ID2B 3KCMA 1X9SB 2JSYA 1AUCA 2ZCTA 2IWTA 4PUAA 5D96A 1XW9A 2IIYA 1R7HA 4Z2TA 5FWGA 4A5PA 2VCVA 4E8EA 1WPIA 3IRAA 2LUSA 1ZYEA 2R6KA 2X8GA 4D73A 4QL7A 2YPMA 1QGVA 2IL3A 2KP2A 3LSZA 2LRTA 20GSA 2V2GA 1BQ7A 3GMFA 3KM6A 1FW1A 3IOSA 2GTUA 3APQA 1J0FA 5D9XA 2FLSA 2IMEA 2O85A 2FD3A 2H19A 5GSSA 4MPGA 5J5NA 2GT5A 2X8CA 4KSOA 3N9JA 2EIQA 2KLXA 3CBUA 2FY6A 3HZ8A 3ME7A 4ZIJA 3H8QA 5DVBA 4L5OA 3TOUA 1F9MA 3TKSA 3ZREA 5ECIB 5ECNB 1GUKA 4KDXA 4E8HA 1JZOA 2VL2C 4Q5RA 4ZL9A 3KXOA 3KH9A 1NHYA 4CDOA 1K0NA 1EV9A 3FW2A 4FYUA 2FNOA 4KH7A 3P7XA 3D5JA 3M9JA 4I2TA 4BL7A 1SK1A 2C4JA 4RQRA 3G7YA 2QSIA 5D9VA 4WF4A 2PGTA 4X43A 2P5RA 3DKSA 5CRHA 2FCHA 4ECJA 1F3BA 3HVSA 2GDRA 2B7JA 1G7EA 1ACVA 1MD3A 1JLWA 2KP1A 2LNSA 4KUNA 2AHEA 3LGCA 4MCUA 4YKGA 3LXTA 4PNGA 1VGLA 2WDUA 3F4SA 2L4QA 1PKWA 1M3IA 5ECMB 4IP6A 3ZMKA 3ERGA 3P90A 4KSMA 3A2VA 3WGXA 4EDYA 1VF4A 4LMVA 2ZNMA 4MF6A 1SD9A 1XVWA 3DMLA 1SJ6A 4G0LA 3WT2A 5A4UA 4K7OA 1PX7A 1B9YC 2J9HA 5ID2A 2R3XA 1WIKA 3G7JA 3D22A 1WE0A 3GSTA 4BIKA 4NV2A 3QOUA 4WR5A 3ZITA 4RI7A 2VCQA 4ZL7A 1V9WA 1TK5B 1MD4A 5ECOB 2PVQA 3Q74A 2HSHA 2OJLA 4CW9A 1V98A 1PRXA 1ZYQB 1SKSB 2GGTA 3GURA 1A2JA 4I6XA 13GSA 2PUKC 1QFNA 2GS3A 4NV5A 1R5AA 2FUG2 3UJ1A 3BD2A 1XPVA 3CRTA 2PMTA 9GSSA 4AJ7A 1CQHA 1V58A 4O5QA 2DKIA 4ZB8A 1I5GA 4YQVA 4GF0A 1F37A 1XWAA 4EIQA 5J9CA 3P2AA 2FA4A 1QXHA 3GKNA 5L71A 2LTKA 5B6NA 4HI7A 2L4CA 3IAS2 4KDYA 1M7TA 4DVCA 1FOVA 2DMLA 4PQ1A 2KUCA 5A4WA 5HR0A 3F3QA 2JZRA 2A4VA 1RK4A 2LEGA 4N0VA 3UVHA 2EIRA 5DAKB 4K0NA 2WCIA 5DALB 1XOBA 2VIMA 5A5KA 1BX9A 4TR3A 5IPHA 4MP4A 2I3YA 3EVIA 11GSA 1GSYA 4AGSA 1ST9A 3GH9A 4J2FA 4KDUA 2YN1A 2GLRA 1TI1A 2M46A 1W89A 2RLIA 4KGIA 2O87A 1XIYA 3GL3A 2TIRA 3GHAA 3I43A 3KD0A 2A2PA 2FWEA 5G5FA 3FYGA 2BTOT 4HUAA 5F8BA 1SJZA 1MEKA 3ME8A 5CYYA 3ZFBA 2A2SA 4K0GA 3FZ4A 3O76A 4V2NA 1NSWA 4MK3A 1V57A 4OFTA 1A8YA 1YKAA 4MJCA 1PD21 1VF2A 2K6VA 4N0ZA 5IMDA 3VPQA 4I8BA 5KOXA 2R0GA 2V41A 2DKHA 1X9MB 5CO3A 2BJXA 1UC7A 4PQHA 5KN2A 4MH2A 2X99A 2MZCA 1W4VA 2EIOA 3ZVJD 2R37A 1FB0A 1PN9A 1J9BA 2REMA 1TK8B 5DQYA 5GZZB 3TJKA 4TXVA 1M9BA 3DYRA 1SU9A 1TRWA 1DUGA 1AQVA 2CX4A 4Q5NA 5ENUA 2V6KA 1PA3A 2YOIA 2JACA 4NAXA 3IE3A 3LG6A 4IKHA 3MWHA 5J3RA 3DVWA 2WZ9A 3U5RE 2JU5A 4DEJA 4K6XA 1GSSA 4YH2A 4DSSA 4NWYA 4YAPA 2NVLA 2DIZA 5KN0A 3TJFA 4F03A 3AY8A 2DJKA 5CRWA 3SWLA 2B7KA 8GSSA 3TGZA 4LL4B 5DAKA 5DALA 5DDLA 4GRFA 4ZBBA 1B48A 1FHEA 4K9ZA 4POKA 2VOCA 3A2XA 1PQNA 3QCPA 2GQKA 3ZFLA 1KBNA 4FIWA 4KX4A 5AIVA 4F2IA 2VCTA 2CVDA 2OBKA 4ILFA 2N5AA 2CVKA 2E0QA 4POLA 4IHUA 4L0WA 1SK2A 4MZWA 5ELGA 2ON5A 1M99A 1LJRA 2DJ2A 2VCZA 4EL1A 5ECSA 1GL8A 5G1KA 2UZ8A 3IV4A 3TKQA 5B8BA 1BEDA 1BAYA 4ZB6A 6GSVA 2CAQA 4ZBDA 3VWUA 3DGQA 3W8JA 4KW6A 3LYPA 4ZILA 2AAWA 4O5UA 3E0UA 3UBLA 1GUMA 2PU9C 1M2DA 3FEUA 5H5SA 1SL0B 2R0CA 3GA4A 19GSA 5G1LA 3TB2A 1SENA 1GNEA 1ZGNA 4USSA 1AIUA 1PFOA 1S3DA 1BYEA 2XBQA 4KB3A 5IOXA 2IJYA 16GSA 3EMPA 4BL7B 3DIEA 2YNXA 1GRXA 1HQOA 2JZTA 1ABAA 4I5QA 5C00A 3R3EA 1A2MA 3MDKA 3BCKA 1SYXA 3C1SA 3FY7A 4MDCA 1EGRA 1F3AA 4XS1A 3ZTLA 2H0IA 3GYKA 5D8IA 5DJLA 2HI7A 3HCZA 1FO5A 3LW9A 2VAFA 3HY2A 2A4HA 3HJMA 3LEFA 4TR4A 3GV1A 1Z7PA 3FR6A 4EF0A 4EUYA 2J23A 2WS2A 1YEPA 2O7KA 1SJIA 3LXZA 1YKCA 2C0GA 2TRXA 2HT9A 1OC9A 3EE2A 5KN3A 1YQ1A 2HSMA 1TJDA 2IPAA 4EKZA 4FYCA 2VL3A 2N5FA 2LKUA 2GSQA 3E9JB 2G0FA 1K0MA 2C3NA 1VF3A 4OO5A 4XS4B 4TR0A 3L0HA 4N10A 3DXBA 2OBIA 3APSA 1NM3A 3ZL5A 4OFNA 2OKAA 1B8XA 1B4QA 2HFDA 1HD2A 1Q98A 4ECIA 3EURA 1Q4JA 1TU7A 2H6YA 1LBKA 3CSJA 2CT6A 2DLXA 5CREA 2KOKA 4IS0A 3KTBA 3G9BA 4IVFA 5J4UA 3TKPA 3A2WA 1EOGA 4JEDA 2TRCP 6GSYA 2YV7A 2WJUA 5KEJA 1A8LA 2PPTA 2MBTA 4TXOB 3TJJA 3DEXA 1XBSA 2VLUA 1XWKA 1HNAA 2H01A 3GKMA 4TR1A 1TKDB 1GSQA 3RPNA 1E6BA 3IC4A 3ZLPA 5ABRA 3IK7A 4MNNA 3HDCA 1JHBA 12GSA 3CMIA 1EGOA 1UVZA 1TDIA 2CAIA 5IMVA 1FVKA 2YV9A 2VLVA 5ELAA 2H75A 4POMA 2VLTA 3WT1A 4KCAA 2YZHA 1G6YA 4OMVA 4G10A 3F6FA 2FHEA 4IJIA 4MMMA 4ZBAA 1HYUA 4BPYA 4EDZA 1GSUA 4GWRA 1K0DA 2JZSA 1GTAA 1O85A 2R0PA 4G0KA 3VWWA 6GSSA 4IELA 1K3YA 1NHOA 3PINA 4XS6A 3HVXA 2HLSA 4QL9A 1N2AA 1XXUA 2GZZA 3ERWA 4X4JA 3L9SA 4MZCA 3GH6A 3TJBA 3KEBA 3IHGA 1GSFA 2NDOA 2WRTA 2X49A 2H1BA 4GCIA 2CZ2A 2H66A 1GLPA 1ZMAA 3GNJA 5IO0A 1YZXA 4IN0A 4RUVA 1QUWA 5C04A 2GQLA 2DC5A 4XS4A 2ZUPA 2H8LA 3TKSC 1PL1A 2V32A 3RHCA 18GSA 3ZRDA 2B5XA 3GUSA 4P3YB 3R2QA 5LNKe 1EV4A 4J57E 1Z7RA 4IQ1A 5B6MA 2K8VA 2QA2A 3HD5A 1EZKA 2GT6A 4WR4A 3HZ4A 3QFAC 1Z6NA 4L8EA 3A5WA 5JWQB 3C71A 3GX8A 1S3RA 2F8AA 3N5OA 3BJ5A 2GQMA 1OC8A 3PH9A 3ZVJA 4TKYA 5CNWA 1IYHA 4HZ4A 4TXOA 3GKXA 3QDNA 1V2AA 2H6XA 1U88A 2C0EA 2E2MA 1K0CA 1TW9A 2HE3A 3RHBA 3KP8A 1GNWA 1O7UA 4YAVA 4I2UA 4DSSB 5GAPD 4TVEA 4HJMA 2LRNA 5FHIA 2V1MA 1AW9A 4XIHA 1T1VA 3C8EA 5IPGA 1M9AA 5IMAA 2YCDA 4BVYB 1THOA 1B9XC 4N11A 2OA7A 1XW6A 1SL1B 2HRKA 4NPBA 5FT3A 1PX6A 1LU4A 2I9HA 3F9UA 4NHZA 3S9FA 5ECLB 1N8JA 1DSBA 2HSYA 3HVVA 3IC8A 5HFGA 3UIWA 2AUVA 4K8MA 4WEYA 3W8SA 4MZBA 4HSCX 2LJKA 3QMXA 1THXA 4Q5QA 1YJ6A 1OKDA 1K0BA 2WB9A 3O6TA 2CQ9A 4ML6A 3QAGA 4OWYA 4XCSA 4AJ6A 2IMKA 1MDKA 2A2RA 3NIVA 2C0DA 4PUFC 5IMCA 14GSA 2DSAA 1FG4A 2P31A 1M2AA 4OO4A 1DE2A 2MMAA 5JCGA 3I6AA 3F63A 1GLQA 3UBKA 5IIZA 4V1Ag 3EYTA 4GSSA 1GUHA 1GULA 4O7HA 1PN0A 4MF5A 1WJKA 2OADA 3FZ5A 1K0OA 3PR8A 4MABA 1GWCA 3O3TA 1TU8A 2H1GA 3IXRA 2FWGA 5LD0A 1J08A 4ICYA 4JRRA 2MMOA 2HNLA 2WFCA 1VF1A 3FHKA 3KH7A 3EMXA 4OFMA 1TRUA 1T8EB 3FMWA
chains in the Genus database with same CATH topology
1I9DA 1H75A 4LA1A 1S3CA 5DQSA 2X64A 1GTBA 1JLVA 2F8FA 1ZYNA 3KMOA 4NXIA 2R4VA 2B6MA 5EL8A 1GSDA 3H4KA 3M3MA 3TKSE 3KP9A 3JCML 3UAPA 2H0HA 4OD7A 3FK8A 4L0UA 2AB6A 4MH3A 2CV4A 1TRVA 3WD6A 2BMXA 4EVMA 3TJGA 4K5SA 2HYXA 1O8WA 4ULXA 2OE0A 1TRSA 3RAZA 3TRPA 6GSTA 2X4AA 3ZZXA 1PSQA 4IQAA 2YANA 2O89A 1V40A 4BVYA 4MPFA 1K3LA 4I97A 2FGXA 2XPEA 4JR4A 2KHPA 3Q19A 1OC9B 3FKFA 4HQSA 4ECBA 3HJPA 5CP1A 1R5PA 2VCXA 2QC7A 4O5RA 2YWNA 4YQUA 3EPTA 5G5EA 4K7NA 5H5QA 2DJJA 4YQMA 2QKEA 3D6IA 6GSWA 2I1UA 1XWGA 5E4WA 4CY6A 2MYGA 3FRCA 2C0FA 1QK8A 1SL2B 1GTIA 4G2EA 4MF7A 3F8UA 3GX0A 2H73A 5E59A 3UVTA 2H1DA 4WXTA 4ID0A 3HHVA 3D0ZA 1X0RA 5ECHB 1JZWA 3HJOA 4KAEA 3TDGA 2F9SA 4F82A 4Z2UA 2DIYA 1GP1A 5IQYA 1UA5A 3DWVA 3WGDA 1DE1A 5IO2A 1XZOA 4MJBA 2B3SA 4PURA 4HOJA 3M9KA 3ZIVA 4TOPA 3D21A 5CRGA 2M80A 1AC1A 2GVPA 2RIIA 4GSTA 3VI5A 2RM6A 2EC4A 4HQZA 4AJ8A 1TOFA 4HZ2A 5ECPB 3TUEA 3J7Yb 1E2YA 4F9ZA 2O8VB 4KNDA 1WP0A 2YWIA 4TR1B 3EC3A 4MJEA 1O81A 4IP1A 1AQWA 2NBSA 3QD9A 2JSZA 1DBYA 3UL3A 2IMFA 3OR5A 3EU4A 2C8UA 3F3RA 2L6CA 3APOA 5G2ZA 3IBHA 1AXDA 3IDVA 4KCEA 4L5LA 1XW5A 5ECQB 1G6WA 2L57A 5AGYA 3RBTA 3C73A 4AF2A 2AV4A 3IHQA 4PTSA 5GAND 7GSSA 4IGJA 2I81A 3C1RA 1WRYA 2VL2A 2N5BA 1RW1A 5J41A 3ED3A 5AIXA 3F6DA 1GSEA 2AJQB 2R2JA 4ISDA 2JL4A 4EXJA 2FWHA 3I9V2 3QR6A 4HU9A 3PPUA 1CQGA 1QQ2A 2GSTA 3CTFA 1A0RP 4X0XA 2IFQA 3WGEA 3VWXA 2VD1A 5DBQA 2LNTA 2GZPA 2YJ7A 4EIPA 2I4AA 4K7IA 3TCOA 5JCWA 1GTUA 2V6OA 1XWCA 3IK9A 4FH8A 4JZQA 1XVQA 4GQFA 4TN8A 2HRNA 1A0FA 2FA8A 2X8HA 2L5LA 4WF5A 4FO5A 4BA7A 4YKFA 3C7MA 3GIXA 4ECCA 5G31A 2ES7A 5CAXA 3F0IA 2G2QA 1Z5YE 1URMA 3HKRA 1G7OA 4ACSA 1ILOA 5F05A 2YP6A 4N30A 4TRXA 3FR9A 1A24A 3CSHA 1ML6A 2HZFA 5AN1A 1XOAA 4K1FA 2P5QA 4JE1A 3A5IA 3D4MA 4XTSA 2MBSA 1HNBA 3PGTA 2C3QA 3W6GA 1Y25A 3RDWA 4PQIA 1U6TA 4BVXB 1A2LA 2IMDA 2B1KA 2HZEB 3TKRA 3GRXA 1WOUA 2CX3A 1EOHA 1KTEA 2PVOC 5D73A 4ZB9A 3GSSA 4V2MA 3G7IA 2JADA 1B4PA 4BWSA 2WGRA 5LCZA 1O8XA 1BG5A 3IA1A 2RUFA 22GSA 2XC2A 5GSTA 1TK0B 2QGVA 2D2ZA 2H0GA 2OE3A 4K2DA 3L4NA 2DJ0A 3BCIA 1X5CA 3L9UA 4EC0A 4V2LA 3MYDA 4J56E 3FZ9A 1ON4A 5CRDA 2NPBA 1EP7A 3BBYA 1TP9A 1FOHA 1ZZYA 3A3TA 4POBA 3DVXA 2VO4A 4JBBA 2VL9A 1M2BA 2HRFA 2LS5A 3UARA 5HR3A 3UOMA 2YWMA 5D9TA 1U3AA 3Q18A 1Y6EA 5EY6A 4HDEA 1OYJA 3WYWA 4H86A 1R4WA 5ECRB 1F6MC 3ISOA 1Z3EA 3L78A 2YZUA 3ZYWA 4FYBA 3TRQA 4FQUA 1H4OA 1ERUA 1GH2A 2VD0A 2VM1A 3P8WA 4CHSA 2PERA 1YF0A 3FR3A 3GKKA 1ERWA 1EWXA 4O92A 2PBJA 2M72A 3NZNA 2XPDA 4V1Ap 3GL5A 5ECKB 17GSA 1PGTA 5HFKA 3IR4A 3IPZA 5D9WA 4G19A 1WMJA 2CA8A 3KIJA 3EINA 2H71A 1SD8A 2DJ3A 2VUPA 4MLYA 1PKZA 2NTOA 1WWJA 4JU5A 4QQ7A 2C1YA 2OE1A 5BRTA 1OKTA 4BVXA 4GTUA 4F0BA 2HZEA 4IBPA 2DMMA 4K2XA 1TI3A 1AAZA 2H76A 4PXOA 4MJAA 4KF9A 1YF1A 3E3EA 4WETA 2AYTA 3LJRA 2L5OA 4ZXGA 5KOWA 1Z6MA 1R26A 1T00A 5B8AA 4WBRD 2LQQA 5INYA 2E7PA 2CVBA 3M1GA 3ZIJA 6GSXA 3VFIA 3H1NA 5HQPA 2XHFA 3J7Yk 1U3IA 1YY7A 4F0CA 1QMVA 2P0GA 3LFLA 1YDKA 4XHMA 4JR6A 3LQ7A 2YWOA 1X5EA 5KN1A 2VCWA 5F06A 1ZYPA 3M8NA 2B5YA 4KA0A 3RPPA 2LRCA 4NHWA 2IMIA 5EPFA 2F51A 3VURA 3HYPA 3QAWA 3L9VA 5DCGA 2ON7A 4CY8A 2H74A 5H5RA 1IYIA 3CRUA 5DCHA 5A4VA 1EEMA 3IAM2 1TXXA 3M0FA 2LQOA 1SKWB 3DD3A 4PNFA 3UMAA 4RQXA 3NOFA 2H70A 1JZRA 5G30A 1O73A 4HEA2 1FB6A 4O32A 1AQXA 4OCFA 1VRSD 2VM2A 2MMNA 5F0GA 1U87A 1XFLA 3GTUB 3Q6OA 1JFUA 4LMWA 2HRAA 1SK0A 3SBCA 4Z7XA 2H30A 4PX1A 3KMNA 2DJ1A 1MDIA 1G0TA 4PGTA 1ZOFA 1K3OA 3ERFA 1EEJA 5HR2A 2XBIA 3K8NA 4DSQA 2Z9SA 1S3AA 1PL2A 1ZCPA 2GSSA 1MTCA 4WBJA 3GFKA 4DSRA 5B7CA 1SKRB 1OE8A 1T7PB 1XWBA 3BOAA 4GQCA 3KTLA 3ZMLA 10GSA 4GXZA 5IOWA 3TOTA 5HR1A 1OC3A 3QFBC 2QA1A 4KE3A 4Z2RA 1YEXA 1X5DA 1K0AA 4IW9A 5JWRB 4X1UA 1UN2A 5F07A 2IFQB 2H72A 3KJYA 2IN3A 4NMUA 5COHA 3MNGA 1KEBA 2R5GA 5IMFA 5DJMA 1JZDA 3VPTA 1OE7A 1O6JA 4HU7A 3LYKA 3U6VA 2B5EA 4IJ3A 4EE0A 3LORA 2C3TA 2HXKA 2MMZA 1PMTA 1USBA 3VLNA 5JCUA 4G0IA 4LLRA 3US3A 3V1WA 4XRAA 1MDJA 2E2GA 3KGKA 2C80A 3I69A 2WULA 1Z9HA 4GSNA 3MSZA 1OAZA 2DBCA 4K5RA 1HNCA 1ZL9A 3LWAA 3HA9A 3CXGA 4ML1A 3CTGA 2GZYA 4Q5FA 4RI6A 4D73B 5IMZA 4BWQA 1BJXA 3MIXA 2GSRA 2YJHA 1FAAA 1XCCA 4G9HA 4HJ2A 2L6DA 1OVNA 1X9WB 5D93A 4WKWA 2PN8A 4OCEA 1M0UA 2L59A 1T4YA 1C72A 2H1AA 3FZAA 3GTUA 3EWLA 3VK9A 3F4TA 3UEMA 3H93A 5J9BA 5IM9A 4HS1A 2H6ZA 3EU3A 2OACA 2CZ3A 5EVOA 2K18A 1A23A 1KNGA 5BMUA 4XRDA 1FVJA 4MA9A 3DRNA 2LV3A 6GSUA 1NW2A 1TTZA 1T3BA 3MAKA 3H79A 2LJRA 3VI7A 3D4TA 2ALBA 2F3MA 4TW5A 1SYRA 3KZQA 3QAVA 4GLTA 5HFIA 2FWFA 3HXSA 3TRXA 2K9FA 3F4RA 3QPMA 4ZL8A 2LJAA 1ERVA 2LSTA 1RQMA 2PWJA 2RM5A 5JWOB 3VWVA 1F2EA 2K8SA 4LL1B 1T4ZA 3GN3A 3CYNA 1ERTA 4EO3A 3CSIA 2B1LA 2RUEA 5AISA 1EP8A 5ID2B 3KCMA 1X9SB 2JSYA 1AUCA 2ZCTA 2IWTA 4PUAA 5D96A 1XW9A 2IIYA 1R7HA 4Z2TA 5FWGA 4A5PA 2VCVA 4E8EA 1WPIA 3IRAA 2LUSA 1ZYEA 2R6KA 2X8GA 4D73A 4QL7A 2YPMA 1QGVA 2IL3A 2KP2A 3LSZA 2LRTA 20GSA 2V2GA 1BQ7A 3GMFA 3KM6A 1FW1A 3IOSA 2GTUA 3APQA 1J0FA 5D9XA 2FLSA 2IMEA 2O85A 2FD3A 2H19A 5GSSA 4MPGA 5J5NA 2GT5A 2X8CA 4KSOA 3N9JA 2EIQA 2KLXA 3CBUA 2FY6A 3HZ8A 3ME7A 4ZIJA 3H8QA 5DVBA 4L5OA 3TOUA 1F9MA 3TKSA 3ZREA 5ECIB 5ECNB 1GUKA 4KDXA 4E8HA 1JZOA 2VL2C 4Q5RA 4ZL9A 3KXOA 3KH9A 1NHYA 4CDOA 1K0NA 1EV9A 3FW2A 4FYUA 2FNOA 4KH7A 3P7XA 3D5JA 3M9JA 4I2TA 4BL7A 1SK1A 2C4JA 4RQRA 3G7YA 2QSIA 5D9VA 4WF4A 2PGTA 4X43A 2P5RA 3DKSA 5CRHA 2FCHA 4ECJA 1F3BA 3HVSA 2GDRA 2B7JA 1G7EA 1ACVA 1MD3A 1JLWA 2KP1A 2LNSA 4KUNA 2AHEA 3LGCA 4MCUA 4YKGA 3LXTA 4PNGA 1VGLA 2WDUA 3F4SA 2L4QA 1PKWA 5ECMB 4IP6A 3ZMKA 3ERGA 3P90A 4KSMA 3A2VA 3WGXA 4EDYA 1VF4A 4LMVA 2ZNMA 4MF6A 1SD9A 1XVWA 3DMLA 1SJ6A 4G0LA 3WT2A 5A4UA 4K7OA 1PX7A 1B9YC 2J9HA 5ID2A 2R3XA 1WIKA 3G7JA 3D22A 1WE0A 3GSTA 4NV2A 3QOUA 4WR5A 3ZITA 4RI7A 2VCQA 4ZL7A 1V9WA 1TK5B 1MD4A 5ECOB 2PVQA 3Q74A 2HSHA 2OJLA 4CW9A 1V98A 1PRXA 1ZYQB 1SKSB 2GGTA 3GURA 1A2JA 4I6XA 13GSA 2PUKC 1QFNA 2GS3A 4NV5A 1R5AA 2FUG2 3UJ1A 3BD2A 1XPVA 3CRTA 2PMTA 9GSSA 4AJ7A 1CQHA 1V58A 4O5QA 2DKIA 4ZB8A 1I5GA 4YQVA 4GF0A 1F37A 1XWAA 4EIQA 5J9CA 3P2AA 2FA4A 1QXHA 3GKNA 5L71A 2LTKA 5B6NA 4HI7A 2L4CA 3IAS2 4KDYA 1M7TA 4DVCA 1FOVA 2DMLA 4PQ1A 2KUCA 5A4WA 5HR0A 3F3QA 2JZRA 2A4VA 1RK4A 2LEGA 4N0VA 3UVHA 2EIRA 5DAKB 4K0NA 2WCIA 5DALB 1XOBA 2VIMA 5A5KA 1BX9A 4TR3A 5IPHA 4MP4A 2I3YA 3EVIA 11GSA 1GSYA 4AGSA 1ST9A 3GH9A 4J2FA 4KDUA 2YN1A 2GLRA 1TI1A 2M46A 1W89A 2RLIA 4KGIA 2O87A 1XIYA 3GL3A 2TIRA 3GHAA 3I43A 3KD0A 2A2PA 2FWEA 5G5FA 3FYGA 2BTOT 4HUAA 5F8BA 1SJZA 1MEKA 3ME8A 5CYYA 3ZFBA 2A2SA 4K0GA 3FZ4A 3O76A 4V2NA 1NSWA 4MK3A 1V57A 4OFTA 1A8YA 1YKAA 4MJCA 1PD21 1VF2A 2K6VA 4N0ZA 5IMDA 3VPQA 4I8BA 5KOXA 2R0GA 2V41A 2DKHA 1X9MB 5CO3A 2BJXA 1UC7A 4PQHA 5KN2A 4MH2A 2X99A 2MZCA 1W4VA 2EIOA 3ZVJD 2R37A 1FB0A 1PN9A 1J9BA 2REMA 1TK8B 5DQYA 5GZZB 3TJKA 4TXVA 1M9BA 3DYRA 1SU9A 1TRWA 1DUGA 1AQVA 2CX4A 4Q5NA 5ENUA 2V6KA 1PA3A 2YOIA 2JACA 4NAXA 3IE3A 3LG6A 4IKHA 3MWHA 5J3RA 3DVWA 2WZ9A 3U5RE 2JU5A 4DEJA 4K6XA 1GSSA 4YH2A 4DSSA 4NWYA 4YAPA 2NVLA 2DIZA 5KN0A 3TJFA 4F03A 3AY8A 2DJKA 5CRWA 3SWLA 2B7KA 8GSSA 3TGZA 4LL4B 5DAKA 5DALA 5DDLA 4GRFA 4ZBBA 1B48A 1FHEA 4K9ZA 4POKA 2VOCA 3A2XA 1PQNA 3QCPA 2GQKA 3ZFLA 1KBNA 4FIWA 4KX4A 5AIVA 4F2IA 2VCTA 2CVDA 2OBKA 4ILFA 2N5AA 2CVKA 2E0QA 4POLA 4IHUA 4L0WA 1SK2A 4MZWA 5ELGA 2ON5A 1M99A 1LJRA 2DJ2A 2VCZA 4EL1A 5ECSA 1GL8A 5G1KA 2UZ8A 3IV4A 3TKQA 5B8BA 1BEDA 1BAYA 4ZB6A 6GSVA 2CAQA 4ZBDA 3VWUA 3DGQA 3W8JA 4KW6A 3LYPA 4ZILA 2AAWA 4O5UA 3E0UA 3UBLA 1GUMA 2PU9C 1M2DA 3FEUA 5H5SA 1SL0B 2R0CA 3GA4A 19GSA 5G1LA 3TB2A 1SENA 1GNEA 1ZGNA 4USSA 1AIUA 1S3DA 1BYEA 2XBQA 4KB3A 5IOXA 2IJYA 16GSA 3EMPA 4BL7B 3DIEA 2YNXA 1GRXA 1HQOA 2JZTA 1ABAA 4I5QA 5C00A 3R3EA 1A2MA 3MDKA 3BCKA 1SYXA 3C1SA 3FY7A 4MDCA 1EGRA 1F3AA 4XS1A 3ZTLA 2H0IA 3GYKA 5D8IA 5DJLA 2HI7A 3HCZA 1FO5A 3LW9A 2VAFA 3HY2A 2A4HA 3HJMA 3LEFA 4TR4A 3GV1A 1Z7PA 3FR6A 4EF0A 4EUYA 2J23A 2WS2A 1YEPA 2O7KA 1SJIA 3LXZA 1YKCA 2C0GA 2TRXA 2HT9A 1OC9A 3EE2A 5KN3A 1YQ1A 2HSMA 1TJDA 2IPAA 4EKZA 4FYCA 2VL3A 2N5FA 2LKUA 2GSQA 3E9JB 2G0FA 1K0MA 2C3NA 1VF3A 4OO5A 4XS4B 4TR0A 3L0HA 4N10A 3DXBA 2OBIA 3APSA 1NM3A 3ZL5A 4OFNA 2OKAA 1B8XA 1B4QA 2HFDA 1HD2A 1Q98A 4ECIA 3EURA 1Q4JA 1TU7A 2H6YA 1LBKA 3CSJA 2CT6A 2DLXA 5CREA 2KOKA 4IS0A 3KTBA 3G9BA 4IVFA 5J4UA 3TKPA 3A2WA 1EOGA 4JEDA 2TRCP 6GSYA 2YV7A 2WJUA 5KEJA 1A8LA 2PPTA 2MBTA 4TXOB 3TJJA 3DEXA 1XBSA 2VLUA 1XWKA 1HNAA 2H01A 3GKMA 4TR1A 1TKDB 1GSQA 3RPNA 1E6BA 3IC4A 3ZLPA 5ABRA 3IK7A 4MNNA 3HDCA 1JHBA 12GSA 3CMIA 1EGOA 1UVZA 1TDIA 2CAIA 5IMVA 1FVKA 2YV9A 2VLVA 5ELAA 2H75A 4POMA 2VLTA 3WT1A 4KCAA 2YZHA 1G6YA 4OMVA 4G10A 3F6FA 2FHEA 4IJIA 4MMMA 4ZBAA 1HYUA 4BPYA 4EDZA 1GSUA 4GWRA 1K0DA 2JZSA 1GTAA 1O85A 2R0PA 4G0KA 3VWWA 6GSSA 4IELA 1K3YA 1NHOA 3PINA 4XS6A 3HVXA 2HLSA 4QL9A 1N2AA 1XXUA 2GZZA 3ERWA 3L9SA 4X4JA 4MZCA 3GH6A 3TJBA 3KEBA 3IHGA 1GSFA 2NDOA 2WRTA 2X49A 2H1BA 4GCIA 2CZ2A 2H66A 1GLPA 1ZMAA 3GNJA 5IO0A 1YZXA 4IN0A 4RUVA 1QUWA 5C04A 2GQLA 2DC5A 4XS4A 2ZUPA 2H8LA 3TKSC 1PL1A 2V32A 3RHCA 18GSA 3ZRDA 2B5XA 3GUSA 4P3YB 3R2QA 5LNKe 1EV4A 4J57E 1Z7RA 4IQ1A 5B6MA 2K8VA 2QA2A 3HD5A 1EZKA 2GT6A 4WR4A 3HZ4A 3QFAC 1Z6NA 4L8EA 3A5WA 5JWQB 3C71A 3GX8A 3N5OA 2F8AA 3BJ5A 2GQMA 1OC8A 3PH9A 3ZVJA 4TKYA 5CNWA 1IYHA 4HZ4A 4TXOA 3GKXA 3QDNA 1V2AA 2H6XA 1U88A 2C0EA 2E2MA 1K0CA 1TW9A 2HE3A 3RHBA 3KP8A 1GNWA 1O7UA 4YAVA 4I2UA 4DSSB 5GAPD 4TVEA 4HJMA 2LRNA 5FHIA 2V1MA 1AW9A 4XIHA 1T1VA 3C8EA 5IPGA 1M9AA 5IMAA 2YCDA 4BVYB 1THOA 1B9XC 4N11A 2OA7A 1XW6A 1SL1B 2HRKA 4NPBA 5FT3A 1PX6A 1LU4A 2I9HA 3F9UA 4NHZA 3S9FA 5ECLB 1N8JA 1DSBA 2HSYA 3HVVA 3IC8A 5HFGA 3UIWA 2AUVA 4K8MA 4WEYA 3W8SA 4MZBA 2LJKA 3QMXA 1THXA 4Q5QA 1YJ6A 1OKDA 1K0BA 2WB9A 3O6TA 2CQ9A 4ML6A 3QAGA 4OWYA 4XCSA 4AJ6A 2IMKA 1MDKA 2A2RA 3NIVA 2C0DA 4PUFC 5IMCA 14GSA 2DSAA 1FG4A 2P31A 1M2AA 4OO4A 1DE2A 2MMAA 5JCGA 3I6AA 3F63A 1GLQA 3UBKA 5IIZA 4V1Ag 3EYTA 4GSSA 1GUHA 1GULA 4O7HA 1PN0A 4MF5A 1WJKA 2OADA 3FZ5A 1K0OA 3PR8A 4MABA 1GWCA 3O3TA 1TU8A 2H1GA 3IXRA 2FWGA 5LD0A 1J08A 4ICYA 4JRRA 2MMOA 2HNLA 2WFCA 1VF1A 3FHKA 3KH7A 3EMXA 4OFMA 1TRUA 1T8EB 3FMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I9D A;  1H75 A;  4LA1 A;  1S3C A;  5DQS A;  2X64 A;  1GTB A;  1JLV A;  2F8F A;  3KMO A;  4NXI A;  2R4V A;  2B6M A;  5EL8 A;  1GSD A;  3H4K A;  3M3M A;  3TKS E;  3KP9 A;  3JCM L;  3UAP A;  2H0H A;  4OD7 A;  3FK8 A;  4L0U A;  2AB6 A;  4MH3 A;  2CV4 A;  1TRV A;  3WD6 A;  2BMX A;  4EVM A;  3TJG A;  2HYX A;  1O8W A;  4ULX A;  2OE0 A;  1TRS A;  3RAZ A;  3TRP A;  6GST A;  3ZZX A;  1PSQ A;  4IQA A;  2YAN A;  2O89 A;  1V40 A;  4BVY A;  4MPF A;  1K3L A;  4I97 A;  2FGX A;  2XPE A;  4JR4 A;  2KHP A;  3Q19 A;  1OC9 B;  3FKF A;  4HQS A;  4ECB A;  3HJP A;  5CP1 A;  1R5P A;  2VCX A;  2QC7 A;  4O5R A;  2YWN A;  4YQU A;  5G5E A;  4K7N A;  5H5Q A;  2DJJ A;  4YQM A;  2QKE A;  3D6I A;  6GSW A;  2I1U A;  1XWG A;  5E4W A;  2MYG A;  3FRC A;  2C0F A;  1QK8 A;  1SL2 B;  1GTI A;  4G2E A;  4MF7 A;  3F8U A;  3GX0 A;  2H73 A;  5E59 A;  3UVT A;  2H1D A;  4WXT A;  4ID0 A;  3HHV A;  3D0Z A;  1X0R A;  5ECH B;  1JZW A;  3HJO A;  4KAE A;  3TDG A;  2F9S A;  4F82 A;  2DIY A;  1GP1 A;  5IQY A;  1UA5 A;  3DWV A;  3WGD A;  1DE1 A;  5IO2 A;  1XZO A;  4MJB A;  2B3S A;  4PUR A;  4HOJ A;  3M9K A;  3ZIV A;  4TOP A;  3D21 A;  5CRG A;  2M80 A;  1AC1 A;  2GVP A;  2RII A;  4GST A;  3VI5 A;  2RM6 A;  2EC4 A;  4HQZ A;  4AJ8 A;  1TOF A;  4HZ2 A;  5ECP B;  3TUE A;  3J7Y b;  1E2Y A;  4F9Z A;  2O8V B;  4KND A;  1WP0 A;  2YWI A;  4TR1 B;  3EC3 A;  4MJE A;  1O81 A;  4IP1 A;  1AQW A;  2NBS A;  3QD9 A;  2JSZ A;  1DBY A;  3UL3 A;  2IMF A;  3OR5 A;  3EU4 A;  2C8U A;  3F3R A;  2L6C A;  3APO A;  5G2Z A;  3IBH A;  1AXD A;  3IDV A;  4KCE A;  4L5L A;  1XW5 A;  5ECQ B;  1G6W A;  2L57 A;  5AGY A;  3RBT A;  3C73 A;  4AF2 A;  2AV4 A;  3IHQ A;  5GAN D;  7GSS A;  4IGJ A;  2I81 A;  3C1R A;  1WRY A;  2VL2 A;  2N5B A;  1RW1 A;  5J41 A;  3ED3 A;  5AIX A;  3F6D A;  1GSE A;  2AJQ B;  2R2J A;  4ISD A;  2JL4 A;  4EXJ A;  2FWH A;  3I9V 2;  3QR6 A;  4HU9 A;  1CQG A;  1QQ2 A;  2GST A;  3CTF A;  1A0R P;  4X0X A;  2IFQ A;  3WGE A;  3VWX A;  2VD1 A;  5DBQ A;  2LNT A;  2GZP A;  2YJ7 A;  2I4A A;  4K7I A;  3TCO A;  5JCW A;  1GTU A;  2V6O A;  1XWC A;  3IK9 A;  4FH8 A;  4JZQ A;  1XVQ A;  4GQF A;  4TN8 A;  2HRN A;  1A0F A;  2FA8 A;  2X8H A;  2L5L A;  4WF5 A;  4FO5 A;  4BA7 A;  3C7M A;  3GIX A;  4ECC A;  5G31 A;  2ES7 A;  5CAX A;  3F0I A;  2G2Q A;  1Z5Y E;  1URM A;  3HKR A;  1G7O A;  4ACS A;  1ILO A;  5F05 A;  2YP6 A;  4N30 A;  4TRX A;  3FR9 A;  1A24 A;  3CSH A;  1ML6 A;  2HZF A;  5AN1 A;  1XOA A;  4K1F A;  2P5Q A;  4JE1 A;  3D4M A;  4XTS A;  2MBS A;  1HNB A;  3PGT A;  2C3Q A;  3W6G A;  1Y25 A;  3RDW A;  4PQI A;  1U6T A;  1A2L A;  2IMD A;  2B1K A;  2HZE B;  3TKR A;  3GRX A;  1WOU A;  2CX3 A;  1EOH A;  1KTE A;  2PVO C;  5D73 A;  4ZB9 A;  3GSS A;  4V2M A;  3G7I A;  2JAD A;  1B4P A;  4BWS A;  2WGR A;  5LCZ A;  1O8X A;  1BG5 A;  3IA1 A;  2RUF A;  22GS A;  2XC2 A;  5GST A;  1TK0 B;  2QGV A;  2D2Z A;  2H0G A;  2OE3 A;  4K2D A;  3L4N A;  2DJ0 A;  3BCI A;  1X5C A;  3L9U A;  4EC0 A;  4V2L A;  4J56 E;  3FZ9 A;  1ON4 A;  5CRD A;  2NPB A;  1EP7 A;  3BBY A;  1TP9 A;  1ZZY A;  3A3T A;  4POB A;  3DVX A;  2VO4 A;  4JBB A;  2VL9 A;  1M2B A;  2HRF A;  2LS5 A;  3UAR A;  5HR3 A;  3UOM A;  2YWM A;  5D9T A;  1U3A A;  3Q18 A;  1Y6E A;  5EY6 A;  4HDE A;  1OYJ A;  3WYW A;  4H86 A;  1R4W A;  5ECR B;  1F6M C;  3ISO A;  1Z3E A;  3L78 A;  2YZU A;  3ZYW A;  4FYB A;  3TRQ A;  1H4O A;  1ERU A;  1GH2 A;  2VD0 A;  2VM1 A;  3P8W A;  4CHS A;  2PER A;  1YF0 A;  3FR3 A;  3GKK A;  1ERW A;  1EWX A;  4O92 A;  2PBJ A;  2M72 A;  3NZN A;  2XPD A;  4V1A p;  3GL5 A;  5ECK B;  17GS A;  1PGT A;  5HFK A;  3IR4 A;  3IPZ A;  5D9W A;  4G19 A;  1WMJ A;  2CA8 A;  3KIJ A;  3EIN A;  2H71 A;  1SD8 A;  2DJ3 A;  2VUP A;  4MLY A;  1PKZ A;  2NTO A;  1WWJ A;  4JU5 A;  4QQ7 A;  2C1Y A;  2OE1 A;  1OKT A;  4BVX A;  4GTU A;  4F0B A;  2HZE A;  4IBP A;  2DMM A;  1TI3 A;  1AAZ A;  2H76 A;  4PXO A;  4MJA A;  1YF1 A;  3E3E A;  4WET A;  2AYT A;  3LJR A;  2L5O A;  4ZXG A;  1Z6M A;  1R26 A;  1T00 A;  5B8A A;  4WBR D;  2LQQ A;  5INY A;  2E7P A;  2CVB A;  3M1G A;  3ZIJ A;  6GSX A;  3VFI A;  3H1N A;  5HQP A;  2XHF A;  3J7Y k;  1U3I A;  1YY7 A;  4F0C A;  1QMV A;  2P0G A;  3LFL A;  1YDK A;  4XHM A;  4JR6 A;  3LQ7 A;  2YWO A;  1X5E A;  5KN1 A;  2VCW A;  5F06 A;  3M8N A;  2B5Y A;  4KA0 A;  3RPP A;  2LRC A;  4NHW A;  2IMI A;  5EPF A;  2F51 A;  3VUR A;  3HYP A;  3QAW A;  3L9V A;  5DCG A;  2ON7 A;  2H74 A;  5H5R A;  1IYI A;  3CRU A;  5DCH A;  5A4V A;  1EEM A;  3IAM 2;  1TXX A;  3M0F A;  2LQO A;  1SKW B;  3DD3 A;  4PNF A;  3UMA A;  4RQX A;  3NOF A;  2H70 A;  1JZR A;  5G30 A;  1O73 A;  4HEA 2;  1FB6 A;  4O32 A;  1AQX A;  4OCF A;  1VRS D;  2VM2 A;  2MMN A;  5F0G A;  1U87 A;  1XFL A;  3GTU B;  3Q6O A;  1JFU A;  4LMW A;  1SK0 A;  3SBC A;  4Z7X A;  2H30 A;  4PX1 A;  3KMN A;  2DJ1 A;  1MDI A;  1G0T A;  4PGT A;  1ZOF A;  1K3O A;  3ERF A;  1EEJ A;  5HR2 A;  2XBI A;  3K8N A;  4DSQ A;  2Z9S A;  1S3A A;  1PL2 A;  1ZCP A;  2GSS A;  1MTC A;  4WBJ A;  3GFK A;  4DSR A;  5B7C A;  1SKR B;  1OE8 A;  1T7P B;  1XWB A;  3BOA A;  4GQC A;  3KTL A;  3ZML A;  10GS A;  4GXZ A;  5IOW A;  3TOT A;  5HR1 A;  1OC3 A;  3QFB C;  4KE3 A;  1YEX A;  1X5D A;  1K0A A;  4IW9 A;  5JWR B;  4X1U A;  1UN2 A;  5F07 A;  2IFQ B;  2H72 A;  3KJY A;  2IN3 A;  4NMU A;  5COH A;  3MNG A;  1KEB A;  2R5G A;  5IMF A;  5DJM A;  1JZD A;  3VPT A;  1OE7 A;  1O6J A;  4HU7 A;  3LYK A;  3U6V A;  2B5E A;  4IJ3 A;  4EE0 A;  3LOR A;  2C3T A;  2HXK A;  2MMZ A;  1PMT A;  1USB A;  3VLN A;  5JCU A;  4LLR A;  3V1W A;  3US3 A;  4XRA A;  1MDJ A;  2E2G A;  3KGK A;  2C80 A;  3I69 A;  2WUL A;  1Z9H A;  4GSN A;  3MSZ A;  1OAZ A;  2DBC A;  1HNC A;  1ZL9 A;  3LWA A;  3HA9 A;  3CXG A;  4ML1 A;  3CTG A;  2GZY A;  4Q5F A;  4RI6 A;  4D73 B;  5IMZ A;  4BWQ A;  1BJX A;  2GSR A;  2YJH A;  1FAA A;  1XCC A;  4G9H A;  4HJ2 A;  2L6D A;  1OVN A;  1X9W B;  5D93 A;  4WKW A;  2PN8 A;  4OCE A;  1M0U A;  2L59 A;  1T4Y A;  1C72 A;  2H1A A;  3FZA A;  3GTU A;  3EWL A;  3VK9 A;  3F4T A;  3UEM A;  3H93 A;  5J9B A;  5IM9 A;  4HS1 A;  2H6Z A;  3EU3 A;  2OAC A;  2CZ3 A;  5EVO A;  2K18 A;  1A23 A;  1KNG A;  4XRD A;  1FVJ A;  4MA9 A;  3DRN A;  2LV3 A;  6GSU A;  1NW2 A;  1TTZ A;  1T3B A;  3MAK A;  3H79 A;  2LJR A;  3VI7 A;  3D4T A;  2ALB A;  2F3M A;  4TW5 A;  1SYR A;  3KZQ A;  3QAV A;  4GLT A;  5HFI A;  2FWF A;  3HXS A;  3TRX A;  2K9F A;  3F4R A;  3QPM A;  4ZL8 A;  2LJA A;  1ERV A;  2LST A;  1RQM A;  2PWJ A;  2RM5 A;  5JWO B;  3VWV A;  1F2E A;  2K8S A;  4LL1 B;  1T4Z A;  3GN3 A;  3CYN A;  1ERT A;  4EO3 A;  3CSI A;  2B1L A;  2RUE A;  5AIS A;  1EP8 A;  5ID2 B;  3KCM A;  1X9S B;  2JSY A;  1AUC A;  2ZCT A;  2IWT A;  4PUA A;  5D96 A;  1XW9 A;  2IIY A;  1R7H A;  5FWG A;  2VCV A;  4E8E A;  1WPI A;  3IRA A;  2LUS A;  1ZYE A;  2R6K A;  2X8G A;  4D73 A;  4QL7 A;  2YPM A;  1QGV A;  2IL3 A;  2KP2 A;  3LSZ A;  2LRT A;  20GS A;  2V2G A;  1BQ7 A;  3GMF A;  3KM6 A;  1FW1 A;  3IOS A;  2GTU A;  3APQ A;  1J0F A;  5D9X A;  2FLS A;  2IME A;  2O85 A;  2FD3 A;  2H19 A;  5GSS A;  4MPG A;  5J5N A;  2GT5 A;  2X8C A;  4KSO A;  3N9J A;  2EIQ A;  2KLX A;  3CBU A;  2FY6 A;  3HZ8 A;  3ME7 A;  4ZIJ A;  3H8Q A;  5DVB A;  4L5O A;  3TOU A;  1F9M A;  3TKS A;  3ZRE A;  5ECI B;  5ECN B;  1GUK A;  4KDX A;  4E8H A;  1JZO A;  2VL2 C;  4Q5R A;  4ZL9 A;  3KXO A;  3KH9 A;  1NHY A;  4CDO A;  1K0N A;  1EV9 A;  3FW2 A;  4FYU A;  2FNO A;  4KH7 A;  3P7X A;  3D5J A;  3M9J A;  4I2T A;  4BL7 A;  1SK1 A;  2C4J A;  4RQR A;  3G7Y A;  2QSI A;  5D9V A;  4WF4 A;  2PGT A;  4X43 A;  2P5R A;  3DKS A;  5CRH A;  2FCH A;  4ECJ A;  1F3B A;  3HVS A;  2GDR A;  2B7J A;  1G7E A;  1ACV A;  1MD3 A;  1JLW A;  2KP1 A;  2LNS A;  4KUN A;  2AHE A;  3LGC A;  4MCU A;  3LXT A;  4PNG A;  1VGL A;  2WDU A;  3F4S A;  2L4Q A;  1PKW A;  5ECM B;  4IP6 A;  3ZMK A;  3ERG A;  3P90 A;  4KSM A;  3A2V A;  3WGX A;  4EDY A;  1VF4 A;  4LMV A;  2ZNM A;  4MF6 A;  1SD9 A;  1XVW A;  3DML A;  1SJ6 A;  3WT2 A;  5A4U A;  4K7O A;  1PX7 A;  1B9Y C;  2J9H A;  5ID2 A;  2R3X A;  1WIK A;  3G7J A;  3D22 A;  1WE0 A;  3GST A;  4NV2 A;  3QOU A;  4WR5 A;  3ZIT A;  4RI7 A;  2VCQ A;  4ZL7 A;  1V9W A;  1TK5 B;  1MD4 A;  5ECO B;  2PVQ A;  3Q74 A;  2HSH A;  2OJL A;  4CW9 A;  1V98 A;  1PRX A;  1ZYQ B;  1SKS B;  2GGT A;  3GUR A;  1A2J A;  4I6X A;  13GS A;  2PUK C;  1QFN A;  2GS3 A;  4NV5 A;  1R5A A;  2FUG 2;  3UJ1 A;  3BD2 A;  1XPV A;  3CRT A;  2PMT A;  9GSS A;  4AJ7 A;  1CQH A;  1V58 A;  4ZB8 A;  1I5G A;  4YQV A;  4GF0 A;  1F37 A;  1XWA A;  5J9C A;  3P2A A;  2FA4 A;  1QXH A;  3GKN A;  5L71 A;  2LTK A;  5B6N A;  4HI7 A;  2L4C A;  3IAS 2;  4KDY A;  1M7T A;  4DVC A;  1FOV A;  2DML A;  4PQ1 A;  2KUC A;  5A4W A;  5HR0 A;  3F3Q A;  2JZR A;  2A4V A;  1RK4 A;  2LEG A;  4N0V A;  3UVH A;  2EIR A;  5DAK B;  4K0N A;  2WCI A;  5DAL B;  1XOB A;  2VIM A;  5A5K A;  1BX9 A;  4TR3 A;  5IPH A;  4MP4 A;  2I3Y A;  3EVI A;  11GS A;  1GSY A;  4AGS A;  1ST9 A;  3GH9 A;  4J2F A;  4KDU A;  2YN1 A;  2GLR A;  1TI1 A;  2M46 A;  1W89 A;  2RLI A;  4KGI A;  2O87 A;  1XIY A;  3GL3 A;  2TIR A;  3GHA A;  3I43 A;  3KD0 A;  2FWE A;  5G5F A;  3FYG A;  2BTO T;  4HUA A;  5F8B A;  1SJZ A;  1MEK A;  3ME8 A;  5CYY A;  3ZFB A;  2A2S A;  4K0G A;  3FZ4 A;  3O76 A;  4V2N A;  1NSW A;  4MK3 A;  1V57 A;  4OFT A;  1A8Y A;  1YKA A;  4MJC A;  1PD2 1;  1VF2 A;  2K6V A;  4N0Z A;  5IMD A;  3VPQ A;  4I8B A;  2V41 A;  1X9M B;  5CO3 A;  2BJX A;  1UC7 A;  4PQH A;  5KN2 A;  4MH2 A;  2X99 A;  2MZC A;  1W4V A;  2EIO A;  3ZVJ D;  2R37 A;  1FB0 A;  1PN9 A;  1J9B A;  2REM A;  1TK8 B;  5DQY A;  5GZZ B;  3TJK A;  4TXV A;  1M9B A;  3DYR A;  1SU9 A;  1TRW A;  1DUG A;  1AQV A;  2CX4 A;  4Q5N A;  5ENU A;  2V6K A;  1PA3 A;  2YOI A;  2JAC A;  4NAX A;  3IE3 A;  3LG6 A;  4IKH A;  3MWH A;  5J3R A;  3DVW A;  2WZ9 A;  3U5R E;  2JU5 A;  4DEJ A;  4K6X A;  1GSS A;  4YH2 A;  4DSS A;  4NWY A;  4YAP A;  2NVL A;  2DIZ A;  5KN0 A;  3TJF A;  4F03 A;  3AY8 A;  2DJK A;  5CRW A;  3SWL A;  2B7K A;  8GSS A;  3TGZ A;  4LL4 B;  5DAK A;  5DAL A;  5DDL A;  4GRF A;  4ZBB A;  1B48 A;  1FHE A;  4K9Z A;  4POK A;  2VOC A;  3A2X A;  1PQN A;  3QCP A;  2GQK A;  3ZFL A;  1KBN A;  4FIW A;  4KX4 A;  5AIV A;  4F2I A;  2VCT A;  2CVD A;  2OBK A;  4ILF A;  2N5A A;  2CVK A;  2E0Q A;  4POL A;  4IHU A;  4L0W A;  1SK2 A;  4MZW A;  5ELG A;  2ON5 A;  1M99 A;  1LJR A;  2DJ2 A;  2VCZ A;  4EL1 A;  5ECS A;  1GL8 A;  5G1K A;  3IV4 A;  3TKQ A;  5B8B A;  1BED A;  1BAY A;  4ZB6 A;  6GSV A;  2CAQ A;  4ZBD A;  3VWU A;  3DGQ A;  3W8J A;  4KW6 A;  3LYP A;  4ZIL A;  2AAW A;  3E0U A;  3UBL A;  1GUM A;  2PU9 C;  1M2D A;  3FEU A;  5H5S A;  1SL0 B;  3GA4 A;  19GS A;  5G1L A;  3TB2 A;  1SEN A;  1GNE A;  1ZGN A;  1AIU A;  1S3D A;  1BYE A;  2XBQ A;  4KB3 A;  5IOX A;  2IJY A;  16GS A;  3EMP A;  3DIE A;  2YNX A;  1GRX A;  1HQO A;  2JZT A;  1ABA A;  4I5Q A;  5C00 A;  1A2M A;  3MDK A;  3BCK A;  1SYX A;  3C1S A;  3FY7 A;  4MDC A;  1EGR A;  1F3A A;  4XS1 A;  3ZTL A;  2H0I A;  3GYK A;  5D8I A;  5DJL A;  2HI7 A;  3HCZ A;  1FO5 A;  2VAF A;  3HY2 A;  3HJM A;  3LEF A;  4TR4 A;  3GV1 A;  1Z7P A;  3FR6 A;  4EF0 A;  4EUY A;  2J23 A;  2WS2 A;  1YEP A;  2O7K A;  1SJI A;  3LXZ A;  1YKC A;  2C0G A;  2TRX A;  2HT9 A;  1OC9 A;  3EE2 A;  5KN3 A;  1YQ1 A;  1TJD A;  2IPA A;  4EKZ A;  4FYC A;  2VL3 A;  2N5F A;  2LKU A;  2GSQ A;  3E9J B;  2G0F A;  1K0M A;  2C3N A;  1VF3 A;  4OO5 A;  4XS4 B;  4TR0 A;  3L0H A;  4N10 A;  3DXB A;  2OBI A;  3APS A;  1NM3 A;  3ZL5 A;  4OFN A;  2OKA A;  1B8X A;  1B4Q A;  2HFD A;  1HD2 A;  1Q98 A;  4ECI A;  3EUR A;  1Q4J A;  1TU7 A;  2H6Y A;  1LBK A;  3CSJ A;  2CT6 A;  2DLX A;  5CRE A;  2KOK A;  4IS0 A;  3KTB A;  3G9B A;  4IVF A;  5J4U A;  3TKP A;  3A2W A;  1EOG A;  4JED A;  2TRC P;  6GSY A;  2YV7 A;  2WJU A;  5KEJ A;  1A8L A;  2PPT A;  2MBT A;  4TXO B;  3TJJ A;  3DEX A;  1XBS A;  2VLU A;  1XWK A;  1HNA A;  2H01 A;  3GKM A;  4TR1 A;  1TKD B;  1GSQ A;  3RPN A;  1E6B A;  3IC4 A;  3ZLP A;  5ABR A;  3IK7 A;  3HDC A;  1JHB A;  12GS A;  3CMI A;  1EGO A;  1UVZ A;  1TDI A;  2CAI A;  5IMV A;  1FVK A;  2YV9 A;  2VLV A;  5ELA A;  2H75 A;  4POM A;  2VLT A;  3WT1 A;  4KCA A;  2YZH A;  1G6Y A;  4OMV A;  4G10 A;  3F6F A;  2FHE A;  4IJI A;  4MMM A;  4ZBA A;  1HYU A;  4BPY A;  4EDZ A;  1GSU A;  4GWR A;  1K0D A;  2JZS A;  1GTA A;  1O85 A;  3VWW A;  6GSS A;  4IEL A;  1K3Y A;  1NHO A;  3PIN A;  4XS6 A;  3HVX A;  2HLS A;  4QL9 A;  1N2A A;  1XXU A;  2GZZ A;  3ERW A;  3L9S A;  4MZC A;  3GH6 A;  3TJB A;  3KEB A;  1GSF A;  2NDO A;  2WRT A;  2H1B A;  4GCI A;  2CZ2 A;  2H66 A;  1GLP A;  1ZMA A;  3GNJ A;  5IO0 A;  1YZX A;  4IN0 A;  4RUV A;  1QUW A;  5C04 A;  2GQL A;  2DC5 A;  4XS4 A;  2ZUP A;  2H8L A;  3TKS C;  1PL1 A;  2V32 A;  3RHC A;  18GS A;  3ZRD A;  2B5X A;  3GUS A;  4P3Y B;  3R2Q A;  5LNK e;  1EV4 A;  4J57 E;  1Z7R A;  4IQ1 A;  5B6M A;  2K8V A;  3HD5 A;  1EZK A;  2GT6 A;  4WR4 A;  3HZ4 A;  3QFA C;  1Z6N A;  4L8E A;  3A5W A;  5JWQ B;  3C71 A;  3GX8 A;  3N5O A;  2F8A A;  3BJ5 A;  2GQM A;  1OC8 A;  3PH9 A;  3ZVJ A;  4TKY A;  5CNW A;  1IYH A;  4HZ4 A;  4TXO A;  3GKX A;  3QDN A;  1V2A A;  2H6X A;  1U88 A;  2C0E A;  2E2M A;  1K0C A;  1TW9 A;  2HE3 A;  3RHB A;  3KP8 A;  1GNW A;  1O7U A;  4YAV A;  4I2U A;  4DSS B;  5GAP D;  4TVE A;  4HJM A;  2LRN A;  5FHI A;  2V1M A;  1AW9 A;  4XIH A;  1T1V A;  3C8E A;  5IPG A;  1M9A A;  5IMA A;  2YCD A;  1THO A;  1B9X C;  4N11 A;  2OA7 A;  1XW6 A;  1SL1 B;  4NPB A;  5FT3 A;  1PX6 A;  1LU4 A;  2I9H A;  3F9U A;  4NHZ A;  3S9F A;  5ECL B;  1N8J A;  1DSB A;  2HSY A;  3HVV A;  5HFG A;  3UIW A;  2AUV A;  4K8M A;  4WEY A;  3W8S A;  4MZB A;  2LJK A;  3QMX A;  1THX A;  4Q5Q A;  1YJ6 A;  1OKD A;  1K0B A;  2WB9 A;  3O6T A;  2CQ9 A;  4ML6 A;  3QAG A;  4OWY A;  4XCS A;  4AJ6 A;  2IMK A;  1MDK A;  2A2R A;  3NIV A;  2C0D A;  4PUF C;  5IMC A;  14GS A;  2DSA A;  1FG4 A;  2P31 A;  1M2A A;  4OO4 A;  1DE2 A;  2MMA A;  5JCG A;  3I6A A;  3F63 A;  1GLQ A;  3UBK A;  5IIZ A;  4V1A g;  3EYT A;  4GSS A;  1GUH A;  1GUL A;  4O7H A;  4MF5 A;  1WJK A;  2OAD A;  3FZ5 A;  1K0O A;  3PR8 A;  4MAB A;  1GWC A;  3O3T A;  1TU8 A;  2H1G A;  3IXR A;  2FWG A;  5LD0 A;  1J08 A;  4JRR A;  2MMO A;  2HNL A;  2WFC A;  1VF1 A;  3FHK A;  3KH7 A;  3EMX A;  4OFM A;  1TRU A;  1T8E B; 
#chains in the Genus database with same CATH topology
 1I9D A;  1H75 A;  4LA1 A;  1S3C A;  5DQS A;  2X64 A;  1GTB A;  1JLV A;  2F8F A;  1ZYN A;  3KMO A;  4NXI A;  2R4V A;  2B6M A;  5EL8 A;  1GSD A;  3H4K A;  3M3M A;  3TKS E;  3KP9 A;  3JCM L;  3UAP A;  2H0H A;  4OD7 A;  3FK8 A;  4L0U A;  2AB6 A;  4MH3 A;  2CV4 A;  1TRV A;  3WD6 A;  2BMX A;  4EVM A;  3TJG A;  4K5S A;  2HYX A;  1O8W A;  4ULX A;  2OE0 A;  1TRS A;  3RAZ A;  3TRP A;  6GST A;  2X4A A;  3ZZX A;  1PSQ A;  4IQA A;  2YAN A;  2O89 A;  1V40 A;  4BVY A;  4MPF A;  1K3L A;  4I97 A;  2FGX A;  2XPE A;  4JR4 A;  2KHP A;  3Q19 A;  1OC9 B;  3FKF A;  4HQS A;  4ECB A;  3HJP A;  5CP1 A;  1R5P A;  2VCX A;  2QC7 A;  4O5R A;  2YWN A;  4YQU A;  3EPT A;  5G5E A;  4K7N A;  5H5Q A;  2DJJ A;  4YQM A;  2QKE A;  3D6I A;  6GSW A;  2I1U A;  1XWG A;  5E4W A;  4CY6 A;  2MYG A;  3FRC A;  2C0F A;  1QK8 A;  1SL2 B;  1GTI A;  4G2E A;  4MF7 A;  3F8U A;  3GX0 A;  2H73 A;  5E59 A;  3UVT A;  2H1D A;  4WXT A;  4ID0 A;  3HHV A;  3D0Z A;  1X0R A;  5ECH B;  1JZW A;  3HJO A;  4KAE A;  3TDG A;  2F9S A;  4F82 A;  4Z2U A;  2DIY A;  1GP1 A;  5IQY A;  1UA5 A;  3DWV A;  3WGD A;  1DE1 A;  5IO2 A;  1XZO A;  4MJB A;  2B3S A;  4PUR A;  4HOJ A;  3M9K A;  3ZIV A;  4TOP A;  3D21 A;  5CRG A;  2M80 A;  1AC1 A;  2GVP A;  2RII A;  4GST A;  3VI5 A;  2RM6 A;  2EC4 A;  4HQZ A;  4AJ8 A;  1TOF A;  4HZ2 A;  5ECP B;  3TUE A;  3J7Y b;  1E2Y A;  4F9Z A;  2O8V B;  4KND A;  1WP0 A;  2YWI A;  4TR1 B;  3EC3 A;  4MJE A;  1O81 A;  4IP1 A;  1AQW A;  2NBS A;  3QD9 A;  2JSZ A;  1DBY A;  3UL3 A;  2IMF A;  3OR5 A;  3EU4 A;  2C8U A;  3F3R A;  2L6C A;  3APO A;  5G2Z A;  3IBH A;  1AXD A;  3IDV A;  4KCE A;  4L5L A;  1XW5 A;  5ECQ B;  1G6W A;  2L57 A;  5AGY A;  3RBT A;  3C73 A;  4AF2 A;  2AV4 A;  3IHQ A;  4PTS A;  5GAN D;  7GSS A;  4IGJ A;  2I81 A;  3C1R A;  1WRY A;  2VL2 A;  2N5B A;  1RW1 A;  5J41 A;  3ED3 A;  5AIX A;  3F6D A;  1GSE A;  2AJQ B;  2R2J A;  4ISD A;  2JL4 A;  4EXJ A;  2FWH A;  3I9V 2;  3QR6 A;  4HU9 A;  3PPU A;  1CQG A;  1QQ2 A;  2GST A;  3CTF A;  1A0R P;  4X0X A;  3HVN A;  2IFQ A;  3WGE A;  3VWX A;  2VD1 A;  5DBQ A;  2LNT A;  2GZP A;  2YJ7 A;  4EIP A;  2I4A A;  4K7I A;  3TCO A;  5JCW A;  1GTU A;  2V6O A;  1XWC A;  3IK9 A;  4FH8 A;  4JZQ A;  1XVQ A;  4GQF A;  4TN8 A;  2HRN A;  1A0F A;  2FA8 A;  2X8H A;  2L5L A;  4WF5 A;  4FO5 A;  4BA7 A;  4YKF A;  3C7M A;  3GIX A;  4ECC A;  5G31 A;  2ES7 A;  5CAX A;  3F0I A;  2G2Q A;  1Z5Y E;  1URM A;  3HKR A;  1G7O A;  4ACS A;  1ILO A;  5F05 A;  2YP6 A;  4N30 A;  4TRX A;  3FR9 A;  1A24 A;  3CSH A;  1ML6 A;  2HZF A;  5AN1 A;  1XOA A;  4K1F A;  2P5Q A;  4JE1 A;  3A5I A;  3D4M A;  4XTS A;  2MBS A;  1HNB A;  3PGT A;  2C3Q A;  3W6G A;  1Y25 A;  3RDW A;  4PQI A;  1U6T A;  4BVX B;  1A2L A;  2IMD A;  2B1K A;  2HZE B;  3TKR A;  3GRX A;  1WOU A;  2CX3 A;  1EOH A;  1KTE A;  2PVO C;  5D73 A;  4ZB9 A;  3GSS A;  4V2M A;  3G7I A;  2JAD A;  1B4P A;  4BWS A;  2WGR A;  5LCZ A;  1O8X A;  1BG5 A;  3IA1 A;  2RUF A;  22GS A;  2XC2 A;  5GST A;  1TK0 B;  2QGV A;  2D2Z A;  2H0G A;  2OE3 A;  4K2D A;  3L4N A;  2DJ0 A;  3BCI A;  1X5C A;  3L9U A;  4EC0 A;  4V2L A;  3MYD A;  4J56 E;  3FZ9 A;  1ON4 A;  5CRD A;  2NPB A;  1EP7 A;  3BBY A;  1TP9 A;  1FOH A;  1ZZY A;  3A3T A;  4POB A;  3DVX A;  2VO4 A;  4JBB A;  2VL9 A;  1M2B A;  2HRF A;  2LS5 A;  3UAR A;  5HR3 A;  3UOM A;  2YWM A;  5D9T A;  1U3A A;  3Q18 A;  1Y6E A;  5EY6 A;  4HDE A;  1OYJ A;  3WYW A;  4H86 A;  1R4W A;  5ECR B;  1F6M C;  3ISO A;  1Z3E A;  3L78 A;  2YZU A;  3ZYW A;  4FYB A;  3TRQ A;  4FQU A;  1H4O A;  1ERU A;  1GH2 A;  2VD0 A;  2VM1 A;  3P8W A;  4CHS A;  2PER A;  1YF0 A;  3FR3 A;  3GKK A;  1ERW A;  1EWX A;  4O92 A;  2PBJ A;  2M72 A;  3NZN A;  2XPD A;  4V1A p;  3GL5 A;  5ECK B;  17GS A;  1PGT A;  5HFK A;  3IR4 A;  3IPZ A;  5D9W A;  4G19 A;  1WMJ A;  2CA8 A;  3KIJ A;  3EIN A;  2H71 A;  1SD8 A;  2DJ3 A;  2VUP A;  4MLY A;  1PKZ A;  2NTO A;  1WWJ A;  4JU5 A;  4QQ7 A;  2C1Y A;  2OE1 A;  5BRT A;  1OKT A;  4BVX A;  4GTU A;  4F0B A;  2HZE A;  4IBP A;  2DMM A;  4K2X A;  1TI3 A;  1AAZ A;  3CQF A;  2H76 A;  4PXO A;  4MJA A;  4KF9 A;  1YF1 A;  3E3E A;  4WET A;  2AYT A;  3LJR A;  2L5O A;  4ZXG A;  5KOW A;  1Z6M A;  1R26 A;  1T00 A;  5B8A A;  4WBR D;  2LQQ A;  5INY A;  2E7P A;  2CVB A;  3M1G A;  3ZIJ A;  6GSX A;  3VFI A;  3H1N A;  5HQP A;  2XHF A;  3J7Y k;  1U3I A;  1YY7 A;  4F0C A;  1QMV A;  2P0G A;  3LFL A;  1YDK A;  4XHM A;  4JR6 A;  3LQ7 A;  2YWO A;  1X5E A;  5KN1 A;  2VCW A;  5F06 A;  1ZYP A;  3M8N A;  2B5Y A;  4KA0 A;  3RPP A;  2LRC A;  4NHW A;  2IMI A;  5EPF A;  2F51 A;  3VUR A;  3HYP A;  3QAW A;  3L9V A;  5DCG A;  2ON7 A;  4CY8 A;  2H74 A;  5H5R A;  1IYI A;  3CRU A;  5DCH A;  5A4V A;  1EEM A;  3IAM 2;  1TXX A;  3M0F A;  2LQO A;  1SKW B;  3DD3 A;  4PNF A;  3UMA A;  4RQX A;  3NOF A;  2H70 A;  1JZR A;  5G30 A;  1O73 A;  4HEA 2;  1FB6 A;  4O32 A;  1AQX A;  4OCF A;  1VRS D;  2VM2 A;  2MMN A;  5F0G A;  1U87 A;  1XFL A;  3GTU B;  3Q6O A;  1JFU A;  4LMW A;  2HRA A;  1SK0 A;  3SBC A;  4Z7X A;  2H30 A;  4PX1 A;  3KMN A;  2DJ1 A;  1MDI A;  1G0T A;  4PGT A;  1ZOF A;  1K3O A;  3ERF A;  1EEJ A;  5HR2 A;  2XBI A;  3K8N A;  4DSQ A;  2Z9S A;  1S3A A;  1PL2 A;  1ZCP A;  2GSS A;  1MTC A;  4WBJ A;  3GFK A;  4DSR A;  5B7C A;  1SKR B;  1OE8 A;  1T7P B;  1XWB A;  3BOA A;  1XG8 A;  4GQC A;  3KTL A;  3ZML A;  10GS A;  4GXZ A;  5IOW A;  3TOT A;  5HR1 A;  1OC3 A;  3QFB C;  2QA1 A;  4KE3 A;  4Z2R A;  1YEX A;  1X5D A;  1K0A A;  4IW9 A;  5JWR B;  4X1U A;  1UN2 A;  5F07 A;  2IFQ B;  2H72 A;  3KJY A;  2IN3 A;  4NMU A;  5COH A;  3MNG A;  1KEB A;  2R5G A;  5IMF A;  5DJM A;  1JZD A;  3VPT A;  1OE7 A;  1O6J A;  4HU7 A;  3LYK A;  3U6V A;  2B5E A;  4IJ3 A;  4EE0 A;  3LOR A;  2C3T A;  2HXK A;  2MMZ A;  1PMT A;  1USB A;  3VLN A;  5JCU A;  4G0I A;  4LLR A;  3US3 A;  3V1W A;  4XRA A;  1MDJ A;  2E2G A;  3KGK A;  2C80 A;  3I69 A;  2WUL A;  1Z9H A;  1M3J A;  4GSN A;  3MSZ A;  1OAZ A;  2DBC A;  4K5R A;  1HNC A;  1ZL9 A;  3LWA A;  3HA9 A;  3CXG A;  4ML1 A;  3CTG A;  2GZY A;  4Q5F A;  4RI6 A;  4D73 B;  5IMZ A;  4BWQ A;  1BJX A;  3MIX A;  2GSR A;  2YJH A;  1FAA A;  1XCC A;  4G9H A;  4HJ2 A;  2L6D A;  1OVN A;  1X9W B;  5D93 A;  4WKW A;  2PN8 A;  4OCE A;  1M0U A;  2L59 A;  1T4Y A;  1C72 A;  2H1A A;  3FZA A;  3GTU A;  3EWL A;  3VK9 A;  3F4T A;  3UEM A;  3H93 A;  5J9B A;  5IM9 A;  4HS1 A;  2H6Z A;  3EU3 A;  2OAC A;  2CZ3 A;  5EVO A;  2K18 A;  1A23 A;  1KNG A;  5BMU A;  4XRD A;  1FVJ A;  4MA9 A;  3DRN A;  2LV3 A;  6GSU A;  1NW2 A;  1TTZ A;  1T3B A;  3MAK A;  3H79 A;  2LJR A;  3VI7 A;  3D4T A;  2ALB A;  2F3M A;  4TW5 A;  1SYR A;  3KZQ A;  3QAV A;  4GLT A;  5HFI A;  2FWF A;  3HXS A;  3TRX A;  2K9F A;  3F4R A;  3QPM A;  4ZL8 A;  2LJA A;  1ERV A;  2LST A;  1RQM A;  2PWJ A;  2RM5 A;  5JWO B;  3VWV A;  1F2E A;  2K8S A;  4LL1 B;  1T4Z A;  3GN3 A;  3CYN A;  1ERT A;  4EO3 A;  3CSI A;  2B1L A;  2RUE A;  5AIS A;  1EP8 A;  5ID2 B;  3KCM A;  1X9S B;  2JSY A;  1AUC A;  2ZCT A;  2IWT A;  4PUA A;  5D96 A;  1XW9 A;  2IIY A;  1R7H A;  4Z2T A;  5FWG A;  4A5P A;  2VCV A;  4E8E A;  1WPI A;  3IRA A;  2LUS A;  1ZYE A;  2R6K A;  2X8G A;  4D73 A;  4QL7 A;  2YPM A;  1QGV A;  2IL3 A;  2KP2 A;  3LSZ A;  2LRT A;  20GS A;  2V2G A;  1BQ7 A;  3GMF A;  3KM6 A;  1FW1 A;  3IOS A;  2GTU A;  3APQ A;  1J0F A;  5D9X A;  2FLS A;  2IME A;  2O85 A;  2FD3 A;  2H19 A;  5GSS A;  4MPG A;  5J5N A;  2GT5 A;  2X8C A;  4KSO A;  3N9J A;  2EIQ A;  2KLX A;  3CBU A;  2FY6 A;  3HZ8 A;  3ME7 A;  4ZIJ A;  3H8Q A;  5DVB A;  4L5O A;  3TOU A;  1F9M A;  3TKS A;  3ZRE A;  5ECI B;  5ECN B;  1GUK A;  4KDX A;  4E8H A;  1JZO A;  2VL2 C;  4Q5R A;  4ZL9 A;  3KXO A;  3KH9 A;  1NHY A;  4CDO A;  1K0N A;  1EV9 A;  3FW2 A;  4FYU A;  2FNO A;  4KH7 A;  3P7X A;  3D5J A;  3M9J A;  4I2T A;  4BL7 A;  1SK1 A;  2C4J A;  4RQR A;  3G7Y A;  2QSI A;  5D9V A;  4WF4 A;  2PGT A;  4X43 A;  2P5R A;  3DKS A;  5CRH A;  2FCH A;  4ECJ A;  1F3B A;  3HVS A;  2GDR A;  2B7J A;  1G7E A;  1ACV A;  1MD3 A;  1JLW A;  2KP1 A;  2LNS A;  4KUN A;  2AHE A;  3LGC A;  4MCU A;  4YKG A;  3LXT A;  4PNG A;  1VGL A;  2WDU A;  3F4S A;  2L4Q A;  1PKW A;  1M3I A;  5ECM B;  4IP6 A;  3ZMK A;  3ERG A;  3P90 A;  4KSM A;  3A2V A;  3WGX A;  4EDY A;  1VF4 A;  4LMV A;  2ZNM A;  4MF6 A;  1SD9 A;  1XVW A;  3DML A;  1SJ6 A;  4G0L A;  3WT2 A;  5A4U A;  4K7O A;  1PX7 A;  1B9Y C;  2J9H A;  5ID2 A;  2R3X A;  1WIK A;  3G7J A;  3D22 A;  1WE0 A;  3GST A;  4BIK A;  4NV2 A;  3QOU A;  4WR5 A;  3ZIT A;  4RI7 A;  2VCQ A;  4ZL7 A;  1V9W A;  1TK5 B;  1MD4 A;  5ECO B;  2PVQ A;  3Q74 A;  2HSH A;  2OJL A;  4CW9 A;  1V98 A;  1PRX A;  1ZYQ B;  1SKS B;  2GGT A;  3GUR A;  1A2J A;  4I6X A;  13GS A;  2PUK C;  1QFN A;  2GS3 A;  4NV5 A;  1R5A A;  2FUG 2;  3UJ1 A;  3BD2 A;  1XPV A;  3CRT A;  2PMT A;  9GSS A;  4AJ7 A;  1CQH A;  1V58 A;  4O5Q A;  2DKI A;  4ZB8 A;  1I5G A;  4YQV A;  4GF0 A;  1F37 A;  1XWA A;  4EIQ A;  5J9C A;  3P2A A;  2FA4 A;  1QXH A;  3GKN A;  5L71 A;  2LTK A;  5B6N A;  4HI7 A;  2L4C A;  3IAS 2;  4KDY A;  1M7T A;  4DVC A;  1FOV A;  2DML A;  4PQ1 A;  2KUC A;  5A4W A;  5HR0 A;  3F3Q A;  2JZR A;  2A4V A;  1RK4 A;  2LEG A;  4N0V A;  3UVH A;  2EIR A;  5DAK B;  4K0N A;  2WCI A;  5DAL B;  1XOB A;  2VIM A;  5A5K A;  1BX9 A;  4TR3 A;  5IPH A;  4MP4 A;  2I3Y A;  3EVI A;  11GS A;  1GSY A;  4AGS A;  1ST9 A;  3GH9 A;  4J2F A;  4KDU A;  2YN1 A;  2GLR A;  1TI1 A;  2M46 A;  1W89 A;  2RLI A;  4KGI A;  2O87 A;  1XIY A;  3GL3 A;  2TIR A;  3GHA A;  3I43 A;  3KD0 A;  2A2P A;  2FWE A;  5G5F A;  3FYG A;  2BTO T;  4HUA A;  5F8B A;  1SJZ A;  1MEK A;  3ME8 A;  5CYY A;  3ZFB A;  2A2S A;  4K0G A;  3FZ4 A;  3O76 A;  4V2N A;  1NSW A;  4MK3 A;  1V57 A;  4OFT A;  1A8Y A;  1YKA A;  4MJC A;  1PD2 1;  1VF2 A;  2K6V A;  4N0Z A;  5IMD A;  3VPQ A;  4I8B A;  5KOX A;  2R0G A;  2V41 A;  2DKH A;  1X9M B;  5CO3 A;  2BJX A;  1UC7 A;  4PQH A;  5KN2 A;  4MH2 A;  2X99 A;  2MZC A;  1W4V A;  2EIO A;  3ZVJ D;  2R37 A;  1FB0 A;  1PN9 A;  1J9B A;  2REM A;  1TK8 B;  5DQY A;  5GZZ B;  3TJK A;  4TXV A;  1M9B A;  3DYR A;  1SU9 A;  1TRW A;  1DUG A;  1AQV A;  2CX4 A;  4Q5N A;  5ENU A;  2V6K A;  1PA3 A;  2YOI A;  2JAC A;  4NAX A;  3IE3 A;  3LG6 A;  4IKH A;  3MWH A;  5J3R A;  3DVW A;  2WZ9 A;  3U5R E;  2JU5 A;  4DEJ A;  4K6X A;  1GSS A;  4YH2 A;  4DSS A;  4NWY A;  4YAP A;  2NVL A;  2DIZ A;  5KN0 A;  3TJF A;  4F03 A;  3AY8 A;  2DJK A;  5CRW A;  3SWL A;  2B7K A;  8GSS A;  3TGZ A;  4LL4 B;  5DAK A;  5DAL A;  5DDL A;  4GRF A;  4ZBB A;  1B48 A;  1FHE A;  4K9Z A;  4POK A;  2VOC A;  3A2X A;  1PQN A;  3QCP A;  2GQK A;  3ZFL A;  1KBN A;  4FIW A;  4KX4 A;  5AIV A;  4F2I A;  2VCT A;  2CVD A;  2OBK A;  4ILF A;  2N5A A;  2CVK A;  2E0Q A;  4POL A;  4IHU A;  4L0W A;  1SK2 A;  4MZW A;  5ELG A;  2ON5 A;  1M99 A;  1LJR A;  2DJ2 A;  2VCZ A;  4EL1 A;  5ECS A;  1GL8 A;  5G1K A;  2UZ8 A;  3IV4 A;  3TKQ A;  5B8B A;  1BED A;  1BAY A;  4ZB6 A;  6GSV A;  2CAQ A;  4ZBD A;  3VWU A;  3DGQ A;  3W8J A;  4KW6 A;  3LYP A;  4ZIL A;  2AAW A;  4O5U A;  3E0U A;  3UBL A;  1GUM A;  2PU9 C;  1M2D A;  3FEU A;  5H5S A;  1SL0 B;  2R0C A;  3GA4 A;  19GS A;  5G1L A;  3TB2 A;  1SEN A;  1GNE A;  1ZGN A;  4USS A;  1AIU A;  1PFO A;  1S3D A;  1BYE A;  2XBQ A;  4KB3 A;  5IOX A;  2IJY A;  16GS A;  3EMP A;  4BL7 B;  3DIE A;  2YNX A;  1GRX A;  1HQO A;  2JZT A;  1ABA A;  4I5Q A;  5C00 A;  3R3E A;  1A2M A;  3MDK A;  3BCK A;  1SYX A;  3C1S A;  3FY7 A;  4MDC A;  1EGR A;  1F3A A;  4XS1 A;  3ZTL A;  2H0I A;  3GYK A;  5D8I A;  5DJL A;  2HI7 A;  3HCZ A;  1FO5 A;  3LW9 A;  2VAF A;  3HY2 A;  2A4H A;  3HJM A;  3LEF A;  4TR4 A;  3GV1 A;  1Z7P A;  3FR6 A;  4EF0 A;  4EUY A;  2J23 A;  2WS2 A;  1YEP A;  2O7K A;  1SJI A;  3LXZ A;  1YKC A;  2C0G A;  2TRX A;  2HT9 A;  1OC9 A;  3EE2 A;  5KN3 A;  1YQ1 A;  2HSM A;  1TJD A;  2IPA A;  4EKZ A;  4FYC A;  2VL3 A;  2N5F A;  2LKU A;  2GSQ A;  3E9J B;  2G0F A;  1K0M A;  2C3N A;  1VF3 A;  4OO5 A;  4XS4 B;  4TR0 A;  3L0H A;  4N10 A;  3DXB A;  2OBI A;  3APS A;  1NM3 A;  3ZL5 A;  4OFN A;  2OKA A;  1B8X A;  1B4Q A;  2HFD A;  1HD2 A;  1Q98 A;  4ECI A;  3EUR A;  1Q4J A;  1TU7 A;  2H6Y A;  1LBK A;  3CSJ A;  2CT6 A;  2DLX A;  5CRE A;  2KOK A;  4IS0 A;  3KTB A;  3G9B A;  4IVF A;  5J4U A;  3TKP A;  3A2W A;  1EOG A;  4JED A;  2TRC P;  6GSY A;  2YV7 A;  2WJU A;  5KEJ A;  1A8L A;  2PPT A;  2MBT A;  4TXO B;  3TJJ A;  3DEX A;  1XBS A;  2VLU A;  1XWK A;  1HNA A;  2H01 A;  3GKM A;  4TR1 A;  1TKD B;  1GSQ A;  3RPN A;  1E6B A;  3IC4 A;  3ZLP A;  5ABR A;  3IK7 A;  4MNN A;  3HDC A;  1JHB A;  12GS A;  3CMI A;  1EGO A;  1UVZ A;  1TDI A;  2CAI A;  5IMV A;  1FVK A;  2YV9 A;  2VLV A;  5ELA A;  2H75 A;  4POM A;  2VLT A;  3WT1 A;  4KCA A;  2YZH A;  1G6Y A;  4OMV A;  4G10 A;  3F6F A;  2FHE A;  4IJI A;  4MMM A;  4ZBA A;  1HYU A;  4BPY A;  4EDZ A;  1GSU A;  4GWR A;  1K0D A;  2JZS A;  1GTA A;  1O85 A;  2R0P A;  4G0K A;  3VWW A;  6GSS A;  4IEL A;  1K3Y A;  1NHO A;  3PIN A;  4XS6 A;  3HVX A;  2HLS A;  4QL9 A;  1N2A A;  1XXU A;  2GZZ A;  3ERW A;  4X4J A;  3L9S A;  4MZC A;  3GH6 A;  3TJB A;  3KEB A;  3IHG A;  1GSF A;  2NDO A;  2WRT A;  2X49 A;  2H1B A;  4GCI A;  2CZ2 A;  2H66 A;  1GLP A;  1ZMA A;  3GNJ A;  5IO0 A;  1YZX A;  4IN0 A;  4RUV A;  1QUW A;  5C04 A;  2GQL A;  2DC5 A;  4XS4 A;  2ZUP A;  2H8L A;  3TKS C;  1PL1 A;  2V32 A;  3RHC A;  18GS A;  3ZRD A;  2B5X A;  3GUS A;  4P3Y B;  3R2Q A;  5LNK e;  1EV4 A;  4J57 E;  1Z7R A;  4IQ1 A;  5B6M A;  2K8V A;  2QA2 A;  3HD5 A;  1EZK A;  2GT6 A;  4WR4 A;  3HZ4 A;  3QFA C;  1Z6N A;  4L8E A;  3A5W A;  5JWQ B;  3C71 A;  3GX8 A;  1S3R A;  2F8A A;  3N5O A;  3BJ5 A;  2GQM A;  1OC8 A;  3PH9 A;  3ZVJ A;  4TKY A;  5CNW A;  1IYH A;  4HZ4 A;  4TXO A;  3GKX A;  3QDN A;  1V2A A;  2H6X A;  1U88 A;  2C0E A;  2E2M A;  1K0C A;  1TW9 A;  2HE3 A;  3RHB A;  3KP8 A;  1GNW A;  1O7U A;  4YAV A;  4I2U A;  4DSS B;  5GAP D;  4TVE A;  4HJM A;  2LRN A;  5FHI A;  2V1M A;  1AW9 A;  4XIH A;  1T1V A;  3C8E A;  5IPG A;  1M9A A;  5IMA A;  2YCD A;  4BVY B;  1THO A;  1B9X C;  4N11 A;  2OA7 A;  1XW6 A;  1SL1 B;  2HRK A;  4NPB A;  5FT3 A;  1PX6 A;  1LU4 A;  2I9H A;  3F9U A;  4NHZ A;  3S9F A;  5ECL B;  1N8J A;  1DSB A;  2HSY A;  3HVV A;  3IC8 A;  5HFG A;  3UIW A;  2AUV A;  4K8M A;  4WEY A;  3W8S A;  4MZB A;  4HSC X;  2LJK A;  3QMX A;  1THX A;  4Q5Q A;  1YJ6 A;  1OKD A;  1K0B A;  2WB9 A;  3O6T A;  2CQ9 A;  4ML6 A;  3QAG A;  4OWY A;  4XCS A;  4AJ6 A;  2IMK A;  1MDK A;  2A2R A;  3NIV A;  2C0D A;  4PUF C;  5IMC A;  14GS A;  2DSA A;  1FG4 A;  2P31 A;  1M2A A;  4OO4 A;  1DE2 A;  2MMA A;  5JCG A;  3I6A A;  3F63 A;  1GLQ A;  3UBK A;  5IIZ A;  4V1A g;  3EYT A;  4GSS A;  1GUH A;  1GUL A;  4O7H A;  1PN0 A;  4MF5 A;  1WJK A;  2OAD A;  3FZ5 A;  1K0O A;  3PR8 A;  4MAB A;  1GWC A;  3O3T A;  1TU8 A;  2H1G A;  3IXR A;  2FWG A;  5LD0 A;  1J08 A;  4ICY A;  4JRR A;  2MMO A;  2HNL A;  2WFC A;  1VF1 A;  3FHK A;  3KH7 A;  3EMX A;  4OFM A;  1TRU A;  1T8E B;  3FMW A; 
#chains in the Genus database with same CATH homology
 1I9D A;  1H75 A;  4LA1 A;  1S3C A;  5DQS A;  2X64 A;  1GTB A;  1JLV A;  2F8F A;  1ZYN A;  3KMO A;  4NXI A;  2R4V A;  2B6M A;  5EL8 A;  1GSD A;  3H4K A;  3M3M A;  3TKS E;  3KP9 A;  3JCM L;  3UAP A;  2H0H A;  4OD7 A;  3FK8 A;  4L0U A;  2AB6 A;  4MH3 A;  2CV4 A;  1TRV A;  3WD6 A;  2BMX A;  4EVM A;  3TJG A;  4K5S A;  2HYX A;  1O8W A;  4ULX A;  2OE0 A;  1TRS A;  3RAZ A;  3TRP A;  6GST A;  2X4A A;  3ZZX A;  1PSQ A;  4IQA A;  2YAN A;  2O89 A;  1V40 A;  4BVY A;  4MPF A;  1K3L A;  4I97 A;  2FGX A;  2XPE A;  4JR4 A;  2KHP A;  3Q19 A;  1OC9 B;  3FKF A;  4HQS A;  4ECB A;  3HJP A;  5CP1 A;  1R5P A;  2VCX A;  2QC7 A;  4O5R A;  2YWN A;  4YQU A;  3EPT A;  5G5E A;  4K7N A;  5H5Q A;  2DJJ A;  4YQM A;  2QKE A;  3D6I A;  6GSW A;  2I1U A;  1XWG A;  5E4W A;  4CY6 A;  2MYG A;  3FRC A;  2C0F A;  1QK8 A;  1SL2 B;  1GTI A;  4G2E A;  4MF7 A;  3F8U A;  3GX0 A;  2H73 A;  5E59 A;  3UVT A;  2H1D A;  4WXT A;  4ID0 A;  3HHV A;  3D0Z A;  1X0R A;  5ECH B;  1JZW A;  3HJO A;  4KAE A;  3TDG A;  2F9S A;  4F82 A;  4Z2U A;  2DIY A;  1GP1 A;  5IQY A;  1UA5 A;  3DWV A;  3WGD A;  1DE1 A;  5IO2 A;  1XZO A;  4MJB A;  2B3S A;  4PUR A;  4HOJ A;  3M9K A;  3ZIV A;  4TOP A;  3D21 A;  5CRG A;  2M80 A;  1AC1 A;  2GVP A;  2RII A;  4GST A;  3VI5 A;  2RM6 A;  2EC4 A;  4HQZ A;  4AJ8 A;  1TOF A;  4HZ2 A;  5ECP B;  3TUE A;  3J7Y b;  1E2Y A;  4F9Z A;  2O8V B;  4KND A;  1WP0 A;  2YWI A;  4TR1 B;  3EC3 A;  4MJE A;  1O81 A;  4IP1 A;  1AQW A;  2NBS A;  3QD9 A;  2JSZ A;  1DBY A;  3UL3 A;  2IMF A;  3OR5 A;  3EU4 A;  2C8U A;  3F3R A;  2L6C A;  3APO A;  5G2Z A;  3IBH A;  1AXD A;  3IDV A;  4KCE A;  4L5L A;  1XW5 A;  5ECQ B;  1G6W A;  2L57 A;  5AGY A;  3RBT A;  3C73 A;  4AF2 A;  2AV4 A;  3IHQ A;  4PTS A;  5GAN D;  7GSS A;  4IGJ A;  2I81 A;  3C1R A;  1WRY A;  2VL2 A;  2N5B A;  1RW1 A;  5J41 A;  3ED3 A;  5AIX A;  3F6D A;  1GSE A;  2AJQ B;  2R2J A;  4ISD A;  2JL4 A;  4EXJ A;  2FWH A;  3I9V 2;  3QR6 A;  4HU9 A;  3PPU A;  1CQG A;  1QQ2 A;  2GST A;  3CTF A;  1A0R P;  4X0X A;  2IFQ A;  3WGE A;  3VWX A;  2VD1 A;  5DBQ A;  2LNT A;  2GZP A;  2YJ7 A;  4EIP A;  2I4A A;  4K7I A;  3TCO A;  5JCW A;  1GTU A;  2V6O A;  1XWC A;  3IK9 A;  4FH8 A;  4JZQ A;  1XVQ A;  4GQF A;  4TN8 A;  2HRN A;  1A0F A;  2FA8 A;  2X8H A;  2L5L A;  4WF5 A;  4FO5 A;  4BA7 A;  4YKF A;  3C7M A;  3GIX A;  4ECC A;  5G31 A;  2ES7 A;  5CAX A;  3F0I A;  2G2Q A;  1Z5Y E;  1URM A;  3HKR A;  1G7O A;  4ACS A;  1ILO A;  5F05 A;  2YP6 A;  4N30 A;  4TRX A;  3FR9 A;  1A24 A;  3CSH A;  1ML6 A;  2HZF A;  5AN1 A;  1XOA A;  4K1F A;  2P5Q A;  4JE1 A;  3A5I A;  3D4M A;  4XTS A;  2MBS A;  1HNB A;  3PGT A;  2C3Q A;  3W6G A;  1Y25 A;  3RDW A;  4PQI A;  1U6T A;  4BVX B;  1A2L A;  2IMD A;  2B1K A;  2HZE B;  3TKR A;  3GRX A;  1WOU A;  2CX3 A;  1EOH A;  1KTE A;  2PVO C;  5D73 A;  4ZB9 A;  3GSS A;  4V2M A;  3G7I A;  2JAD A;  1B4P A;  4BWS A;  2WGR A;  5LCZ A;  1O8X A;  1BG5 A;  3IA1 A;  2RUF A;  22GS A;  2XC2 A;  5GST A;  1TK0 B;  2QGV A;  2D2Z A;  2H0G A;  2OE3 A;  4K2D A;  3L4N A;  2DJ0 A;  3BCI A;  1X5C A;  3L9U A;  4EC0 A;  4V2L A;  3MYD A;  4J56 E;  3FZ9 A;  1ON4 A;  5CRD A;  2NPB A;  1EP7 A;  3BBY A;  1TP9 A;  1FOH A;  1ZZY A;  3A3T A;  4POB A;  3DVX A;  2VO4 A;  4JBB A;  2VL9 A;  1M2B A;  2HRF A;  2LS5 A;  3UAR A;  5HR3 A;  3UOM A;  2YWM A;  5D9T A;  1U3A A;  3Q18 A;  1Y6E A;  5EY6 A;  4HDE A;  1OYJ A;  3WYW A;  4H86 A;  1R4W A;  5ECR B;  1F6M C;  3ISO A;  1Z3E A;  3L78 A;  2YZU A;  3ZYW A;  4FYB A;  3TRQ A;  4FQU A;  1H4O A;  1ERU A;  1GH2 A;  2VD0 A;  2VM1 A;  3P8W A;  4CHS A;  2PER A;  1YF0 A;  3FR3 A;  3GKK A;  1ERW A;  1EWX A;  4O92 A;  2PBJ A;  2M72 A;  3NZN A;  2XPD A;  4V1A p;  3GL5 A;  5ECK B;  17GS A;  1PGT A;  5HFK A;  3IR4 A;  3IPZ A;  5D9W A;  4G19 A;  1WMJ A;  2CA8 A;  3KIJ A;  3EIN A;  2H71 A;  1SD8 A;  2DJ3 A;  2VUP A;  4MLY A;  1PKZ A;  2NTO A;  1WWJ A;  4JU5 A;  4QQ7 A;  2C1Y A;  2OE1 A;  5BRT A;  1OKT A;  4BVX A;  4GTU A;  4F0B A;  2HZE A;  4IBP A;  2DMM A;  4K2X A;  1TI3 A;  1AAZ A;  2H76 A;  4PXO A;  4MJA A;  4KF9 A;  1YF1 A;  3E3E A;  4WET A;  2AYT A;  3LJR A;  2L5O A;  4ZXG A;  5KOW A;  1Z6M A;  1R26 A;  1T00 A;  5B8A A;  4WBR D;  2LQQ A;  5INY A;  2E7P A;  2CVB A;  3M1G A;  3ZIJ A;  6GSX A;  3VFI A;  3H1N A;  5HQP A;  2XHF A;  3J7Y k;  1U3I A;  1YY7 A;  4F0C A;  1QMV A;  2P0G A;  3LFL A;  1YDK A;  4XHM A;  4JR6 A;  3LQ7 A;  2YWO A;  1X5E A;  5KN1 A;  2VCW A;  5F06 A;  1ZYP A;  3M8N A;  2B5Y A;  4KA0 A;  3RPP A;  2LRC A;  4NHW A;  2IMI A;  5EPF A;  2F51 A;  3VUR A;  3HYP A;  3QAW A;  3L9V A;  5DCG A;  2ON7 A;  4CY8 A;  2H74 A;  5H5R A;  1IYI A;  3CRU A;  5DCH A;  5A4V A;  1EEM A;  3IAM 2;  1TXX A;  3M0F A;  2LQO A;  1SKW B;  3DD3 A;  4PNF A;  3UMA A;  4RQX A;  3NOF A;  2H70 A;  1JZR A;  5G30 A;  1O73 A;  4HEA 2;  1FB6 A;  4O32 A;  1AQX A;  4OCF A;  1VRS D;  2VM2 A;  2MMN A;  5F0G A;  1U87 A;  1XFL A;  3GTU B;  3Q6O A;  1JFU A;  4LMW A;  2HRA A;  1SK0 A;  3SBC A;  4Z7X A;  2H30 A;  4PX1 A;  3KMN A;  2DJ1 A;  1MDI A;  1G0T A;  4PGT A;  1ZOF A;  1K3O A;  3ERF A;  1EEJ A;  5HR2 A;  2XBI A;  3K8N A;  4DSQ A;  2Z9S A;  1S3A A;  1PL2 A;  1ZCP A;  2GSS A;  1MTC A;  4WBJ A;  3GFK A;  4DSR A;  5B7C A;  1SKR B;  1OE8 A;  1T7P B;  1XWB A;  3BOA A;  4GQC A;  3KTL A;  3ZML A;  10GS A;  4GXZ A;  5IOW A;  3TOT A;  5HR1 A;  1OC3 A;  3QFB C;  2QA1 A;  4KE3 A;  4Z2R A;  1YEX A;  1X5D A;  1K0A A;  4IW9 A;  5JWR B;  4X1U A;  1UN2 A;  5F07 A;  2IFQ B;  2H72 A;  3KJY A;  2IN3 A;  4NMU A;  5COH A;  3MNG A;  1KEB A;  2R5G A;  5IMF A;  5DJM A;  1JZD A;  3VPT A;  1OE7 A;  1O6J A;  4HU7 A;  3LYK A;  3U6V A;  2B5E A;  4IJ3 A;  4EE0 A;  3LOR A;  2C3T A;  2HXK A;  2MMZ A;  1PMT A;  1USB A;  3VLN A;  5JCU A;  4G0I A;  4LLR A;  3US3 A;  3V1W A;  4XRA A;  1MDJ A;  2E2G A;  3KGK A;  2C80 A;  3I69 A;  2WUL A;  1Z9H A;  4GSN A;  3MSZ A;  1OAZ A;  2DBC A;  4K5R A;  1HNC A;  1ZL9 A;  3LWA A;  3HA9 A;  3CXG A;  4ML1 A;  3CTG A;  2GZY A;  4Q5F A;  4RI6 A;  4D73 B;  5IMZ A;  4BWQ A;  1BJX A;  3MIX A;  2GSR A;  2YJH A;  1FAA A;  1XCC A;  4G9H A;  4HJ2 A;  2L6D A;  1OVN A;  1X9W B;  5D93 A;  4WKW A;  2PN8 A;  4OCE A;  1M0U A;  2L59 A;  1T4Y A;  1C72 A;  2H1A A;  3FZA A;  3GTU A;  3EWL A;  3VK9 A;  3F4T A;  3UEM A;  3H93 A;  5J9B A;  5IM9 A;  4HS1 A;  2H6Z A;  3EU3 A;  2OAC A;  2CZ3 A;  5EVO A;  2K18 A;  1A23 A;  1KNG A;  5BMU A;  4XRD A;  1FVJ A;  4MA9 A;  3DRN A;  2LV3 A;  6GSU A;  1NW2 A;  1TTZ A;  1T3B A;  3MAK A;  3H79 A;  2LJR A;  3VI7 A;  3D4T A;  2ALB A;  2F3M A;  4TW5 A;  1SYR A;  3KZQ A;  3QAV A;  4GLT A;  5HFI A;  2FWF A;  3HXS A;  3TRX A;  2K9F A;  3F4R A;  3QPM A;  4ZL8 A;  2LJA A;  1ERV A;  2LST A;  1RQM A;  2PWJ A;  2RM5 A;  5JWO B;  3VWV A;  1F2E A;  2K8S A;  4LL1 B;  1T4Z A;  3GN3 A;  3CYN A;  1ERT A;  4EO3 A;  3CSI A;  2B1L A;  2RUE A;  5AIS A;  1EP8 A;  5ID2 B;  3KCM A;  1X9S B;  2JSY A;  1AUC A;  2ZCT A;  2IWT A;  4PUA A;  5D96 A;  1XW9 A;  2IIY A;  1R7H A;  4Z2T A;  5FWG A;  4A5P A;  2VCV A;  4E8E A;  1WPI A;  3IRA A;  2LUS A;  1ZYE A;  2R6K A;  2X8G A;  4D73 A;  4QL7 A;  2YPM A;  1QGV A;  2IL3 A;  2KP2 A;  3LSZ A;  2LRT A;  20GS A;  2V2G A;  1BQ7 A;  3GMF A;  3KM6 A;  1FW1 A;  3IOS A;  2GTU A;  3APQ A;  1J0F A;  5D9X A;  2FLS A;  2IME A;  2O85 A;  2FD3 A;  2H19 A;  5GSS A;  4MPG A;  5J5N A;  2GT5 A;  2X8C A;  4KSO A;  3N9J A;  2EIQ A;  2KLX A;  3CBU A;  2FY6 A;  3HZ8 A;  3ME7 A;  4ZIJ A;  3H8Q A;  5DVB A;  4L5O A;  3TOU A;  1F9M A;  3TKS A;  3ZRE A;  5ECI B;  5ECN B;  1GUK A;  4KDX A;  4E8H A;  1JZO A;  2VL2 C;  4Q5R A;  4ZL9 A;  3KXO A;  3KH9 A;  1NHY A;  4CDO A;  1K0N A;  1EV9 A;  3FW2 A;  4FYU A;  2FNO A;  4KH7 A;  3P7X A;  3D5J A;  3M9J A;  4I2T A;  4BL7 A;  1SK1 A;  2C4J A;  4RQR A;  3G7Y A;  2QSI A;  5D9V A;  4WF4 A;  2PGT A;  4X43 A;  2P5R A;  3DKS A;  5CRH A;  2FCH A;  4ECJ A;  1F3B A;  3HVS A;  2GDR A;  2B7J A;  1G7E A;  1ACV A;  1MD3 A;  1JLW A;  2KP1 A;  2LNS A;  4KUN A;  2AHE A;  3LGC A;  4MCU A;  4YKG A;  3LXT A;  4PNG A;  1VGL A;  2WDU A;  3F4S A;  2L4Q A;  1PKW A;  5ECM B;  4IP6 A;  3ZMK A;  3ERG A;  3P90 A;  4KSM A;  3A2V A;  3WGX A;  4EDY A;  1VF4 A;  4LMV A;  2ZNM A;  4MF6 A;  1SD9 A;  1XVW A;  3DML A;  1SJ6 A;  4G0L A;  3WT2 A;  5A4U A;  4K7O A;  1PX7 A;  1B9Y C;  2J9H A;  5ID2 A;  2R3X A;  1WIK A;  3G7J A;  3D22 A;  1WE0 A;  3GST A;  4NV2 A;  3QOU A;  4WR5 A;  3ZIT A;  4RI7 A;  2VCQ A;  4ZL7 A;  1V9W A;  1TK5 B;  1MD4 A;  5ECO B;  2PVQ A;  3Q74 A;  2HSH A;  2OJL A;  4CW9 A;  1V98 A;  1PRX A;  1ZYQ B;  1SKS B;  2GGT A;  3GUR A;  1A2J A;  4I6X A;  13GS A;  2PUK C;  1QFN A;  2GS3 A;  4NV5 A;  1R5A A;  2FUG 2;  3UJ1 A;  3BD2 A;  1XPV A;  3CRT A;  2PMT A;  9GSS A;  4AJ7 A;  1CQH A;  1V58 A;  4O5Q A;  2DKI A;  4ZB8 A;  1I5G A;  4YQV A;  4GF0 A;  1F37 A;  1XWA A;  4EIQ A;  5J9C A;  3P2A A;  2FA4 A;  1QXH A;  3GKN A;  5L71 A;  2LTK A;  5B6N A;  4HI7 A;  2L4C A;  3IAS 2;  4KDY A;  1M7T A;  4DVC A;  1FOV A;  2DML A;  4PQ1 A;  2KUC A;  5A4W A;  5HR0 A;  3F3Q A;  2JZR A;  2A4V A;  1RK4 A;  2LEG A;  4N0V A;  3UVH A;  2EIR A;  5DAK B;  4K0N A;  2WCI A;  5DAL B;  1XOB A;  2VIM A;  5A5K A;  1BX9 A;  4TR3 A;  5IPH A;  4MP4 A;  2I3Y A;  3EVI A;  11GS A;  1GSY A;  4AGS A;  1ST9 A;  3GH9 A;  4J2F A;  4KDU A;  2YN1 A;  2GLR A;  1TI1 A;  2M46 A;  1W89 A;  2RLI A;  4KGI A;  2O87 A;  1XIY A;  3GL3 A;  2TIR A;  3GHA A;  3I43 A;  3KD0 A;  2A2P A;  2FWE A;  5G5F A;  3FYG A;  2BTO T;  4HUA A;  5F8B A;  1SJZ A;  1MEK A;  3ME8 A;  5CYY A;  3ZFB A;  2A2S A;  4K0G A;  3FZ4 A;  3O76 A;  4V2N A;  1NSW A;  4MK3 A;  1V57 A;  4OFT A;  1A8Y A;  1YKA A;  4MJC A;  1PD2 1;  1VF2 A;  2K6V A;  4N0Z A;  5IMD A;  3VPQ A;  4I8B A;  5KOX A;  2R0G A;  2V41 A;  2DKH A;  1X9M B;  5CO3 A;  2BJX A;  1UC7 A;  4PQH A;  5KN2 A;  4MH2 A;  2X99 A;  2MZC A;  1W4V A;  2EIO A;  3ZVJ D;  2R37 A;  1FB0 A;  1PN9 A;  1J9B A;  2REM A;  1TK8 B;  5DQY A;  5GZZ B;  3TJK A;  4TXV A;  1M9B A;  3DYR A;  1SU9 A;  1TRW A;  1DUG A;  1AQV A;  2CX4 A;  4Q5N A;  5ENU A;  2V6K A;  1PA3 A;  2YOI A;  2JAC A;  4NAX A;  3IE3 A;  3LG6 A;  4IKH A;  3MWH A;  5J3R A;  3DVW A;  2WZ9 A;  3U5R E;  2JU5 A;  4DEJ A;  4K6X A;  1GSS A;  4YH2 A;  4DSS A;  4NWY A;  4YAP A;  2NVL A;  2DIZ A;  5KN0 A;  3TJF A;  4F03 A;  3AY8 A;  2DJK A;  5CRW A;  3SWL A;  2B7K A;  8GSS A;  3TGZ A;  4LL4 B;  5DAK A;  5DAL A;  5DDL A;  4GRF A;  4ZBB A;  1B48 A;  1FHE A;  4K9Z A;  4POK A;  2VOC A;  3A2X A;  1PQN A;  3QCP A;  2GQK A;  3ZFL A;  1KBN A;  4FIW A;  4KX4 A;  5AIV A;  4F2I A;  2VCT A;  2CVD A;  2OBK A;  4ILF A;  2N5A A;  2CVK A;  2E0Q A;  4POL A;  4IHU A;  4L0W A;  1SK2 A;  4MZW A;  5ELG A;  2ON5 A;  1M99 A;  1LJR A;  2DJ2 A;  2VCZ A;  4EL1 A;  5ECS A;  1GL8 A;  5G1K A;  2UZ8 A;  3IV4 A;  3TKQ A;  5B8B A;  1BED A;  1BAY A;  4ZB6 A;  6GSV A;  2CAQ A;  4ZBD A;  3VWU A;  3DGQ A;  3W8J A;  4KW6 A;  3LYP A;  4ZIL A;  2AAW A;  4O5U A;  3E0U A;  3UBL A;  1GUM A;  2PU9 C;  1M2D A;  3FEU A;  5H5S A;  1SL0 B;  2R0C A;  3GA4 A;  19GS A;  5G1L A;  3TB2 A;  1SEN A;  1GNE A;  1ZGN A;  4USS A;  1AIU A;  1S3D A;  1BYE A;  2XBQ A;  4KB3 A;  5IOX A;  2IJY A;  16GS A;  3EMP A;  4BL7 B;  3DIE A;  2YNX A;  1GRX A;  1HQO A;  2JZT A;  1ABA A;  4I5Q A;  5C00 A;  3R3E A;  1A2M A;  3MDK A;  3BCK A;  1SYX A;  3C1S A;  3FY7 A;  4MDC A;  1EGR A;  1F3A A;  4XS1 A;  3ZTL A;  2H0I A;  3GYK A;  5D8I A;  5DJL A;  2HI7 A;  3HCZ A;  1FO5 A;  3LW9 A;  2VAF A;  3HY2 A;  2A4H A;  3HJM A;  3LEF A;  4TR4 A;  3GV1 A;  1Z7P A;  3FR6 A;  4EF0 A;  4EUY A;  2J23 A;  2WS2 A;  1YEP A;  2O7K A;  1SJI A;  3LXZ A;  1YKC A;  2C0G A;  2TRX A;  2HT9 A;  1OC9 A;  3EE2 A;  5KN3 A;  1YQ1 A;  2HSM A;  1TJD A;  2IPA A;  4EKZ A;  4FYC A;  2VL3 A;  2N5F A;  2LKU A;  2GSQ A;  3E9J B;  2G0F A;  1K0M A;  2C3N A;  1VF3 A;  4OO5 A;  4XS4 B;  4TR0 A;  3L0H A;  4N10 A;  3DXB A;  2OBI A;  3APS A;  1NM3 A;  3ZL5 A;  4OFN A;  2OKA A;  1B8X A;  1B4Q A;  2HFD A;  1HD2 A;  1Q98 A;  4ECI A;  3EUR A;  1Q4J A;  1TU7 A;  2H6Y A;  1LBK A;  3CSJ A;  2CT6 A;  2DLX A;  5CRE A;  2KOK A;  4IS0 A;  3KTB A;  3G9B A;  4IVF A;  5J4U A;  3TKP A;  3A2W A;  1EOG A;  4JED A;  2TRC P;  6GSY A;  2YV7 A;  2WJU A;  5KEJ A;  1A8L A;  2PPT A;  2MBT A;  4TXO B;  3TJJ A;  3DEX A;  1XBS A;  2VLU A;  1XWK A;  1HNA A;  2H01 A;  3GKM A;  4TR1 A;  1TKD B;  1GSQ A;  3RPN A;  1E6B A;  3IC4 A;  3ZLP A;  5ABR A;  3IK7 A;  4MNN A;  3HDC A;  1JHB A;  12GS A;  3CMI A;  1EGO A;  1UVZ A;  1TDI A;  2CAI A;  5IMV A;  1FVK A;  2YV9 A;  2VLV A;  5ELA A;  2H75 A;  4POM A;  2VLT A;  3WT1 A;  4KCA A;  2YZH A;  1G6Y A;  4OMV A;  4G10 A;  3F6F A;  2FHE A;  4IJI A;  4MMM A;  4ZBA A;  1HYU A;  4BPY A;  4EDZ A;  1GSU A;  4GWR A;  1K0D A;  2JZS A;  1GTA A;  1O85 A;  2R0P A;  4G0K A;  3VWW A;  6GSS A;  4IEL A;  1K3Y A;  1NHO A;  3PIN A;  4XS6 A;  3HVX A;  2HLS A;  4QL9 A;  1N2A A;  1XXU A;  2GZZ A;  3ERW A;  3L9S A;  4X4J A;  4MZC A;  3GH6 A;  3TJB A;  3KEB A;  3IHG A;  1GSF A;  2NDO A;  2WRT A;  2X49 A;  2H1B A;  4GCI A;  2CZ2 A;  2H66 A;  1GLP A;  1ZMA A;  3GNJ A;  5IO0 A;  1YZX A;  4IN0 A;  4RUV A;  1QUW A;  5C04 A;  2GQL A;  2DC5 A;  4XS4 A;  2ZUP A;  2H8L A;  3TKS C;  1PL1 A;  2V32 A;  3RHC A;  18GS A;  3ZRD A;  2B5X A;  3GUS A;  4P3Y B;  3R2Q A;  5LNK e;  1EV4 A;  4J57 E;  1Z7R A;  4IQ1 A;  5B6M A;  2K8V A;  2QA2 A;  3HD5 A;  1EZK A;  2GT6 A;  4WR4 A;  3HZ4 A;  3QFA C;  1Z6N A;  4L8E A;  3A5W A;  5JWQ B;  3C71 A;  3GX8 A;  3N5O A;  2F8A A;  3BJ5 A;  2GQM A;  1OC8 A;  3PH9 A;  3ZVJ A;  4TKY A;  5CNW A;  1IYH A;  4HZ4 A;  4TXO A;  3GKX A;  3QDN A;  1V2A A;  2H6X A;  1U88 A;  2C0E A;  2E2M A;  1K0C A;  1TW9 A;  2HE3 A;  3RHB A;  3KP8 A;  1GNW A;  1O7U A;  4YAV A;  4I2U A;  4DSS B;  5GAP D;  4TVE A;  4HJM A;  2LRN A;  5FHI A;  2V1M A;  1AW9 A;  4XIH A;  1T1V A;  3C8E A;  5IPG A;  1M9A A;  5IMA A;  2YCD A;  4BVY B;  1THO A;  1B9X C;  4N11 A;  2OA7 A;  1XW6 A;  1SL1 B;  2HRK A;  4NPB A;  5FT3 A;  1PX6 A;  1LU4 A;  2I9H A;  3F9U A;  4NHZ A;  3S9F A;  5ECL B;  1N8J A;  1DSB A;  2HSY A;  3HVV A;  3IC8 A;  5HFG A;  3UIW A;  2AUV A;  4K8M A;  4WEY A;  3W8S A;  4MZB A;  2LJK A;  3QMX A;  1THX A;  4Q5Q A;  1YJ6 A;  1OKD A;  1K0B A;  2WB9 A;  3O6T A;  2CQ9 A;  4ML6 A;  3QAG A;  4OWY A;  4XCS A;  4AJ6 A;  2IMK A;  1MDK A;  2A2R A;  3NIV A;  2C0D A;  4PUF C;  5IMC A;  14GS A;  2DSA A;  1FG4 A;  2P31 A;  1M2A A;  4OO4 A;  1DE2 A;  2MMA A;  5JCG A;  3I6A A;  3F63 A;  1GLQ A;  3UBK A;  5IIZ A;  4V1A g;  3EYT A;  4GSS A;  1GUH A;  1GUL A;  4O7H A;  1PN0 A;  4MF5 A;  1WJK A;  2OAD A;  3FZ5 A;  1K0O A;  3PR8 A;  4MAB A;  1GWC A;  3O3T A;  1TU8 A;  2H1G A;  3IXR A;  2FWG A;  5LD0 A;  1J08 A;  4ICY A;  4JRR A;  2MMO A;  2HNL A;  2WFC A;  1VF1 A;  3FHK A;  3KH7 A;  3EMX A;  4OFM A;  1TRU A;  1T8E B;  3FMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...