1ABAA

The structure of oxidized bacteriophage t4 glutaredoxin (thioredoxin). refinement of native and mutant proteins
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
87
structure length
87
Chain Sequence
MFKVYGYDSNIHKCGPCDNAKRLLTVKKQPFEFINIMPEKGVFDDEKIAELLTKLGRDTQIGLTMPQVFAPDGSHIGGFDQLREYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAREDOXIN
publication title Structure of oxidized bacteriophage T4 glutaredoxin (thioredoxin). Refinement of native and mutant proteins.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Electron transport
total genus 24
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 1992-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1abaA00
2X99A 4MPGA 1WP0A 2WRTA 5A5KA 2Z9SA 2ON5A 2VL9A 4YQUA 1R4WA 1DE1A 2FLSA 3F3RA 3Q18A 4KH7A 13GSA 4ZBDA 4PQ1A 3UMAA 2HRFA 3PH9A 4JE1A 2PMTA 4HQZA 3WD6A 4FYCA 4FYBA 3KIJA 2V6OA 4OO4A 2L5LA 1K3YA 1GUHA 1U87A 1YF0A 4I2TA 2WFCA 4G19A 4AJ7A 4NXIA 3UARA 2K9FA 3PR8A 4J2FA 4AJ8A 1V40A 3D4MA 1LBKA 2PN8A 3APQA 1R5PA 5IQYA 2HZFA 3EE2A 2X64A 5JCUA 1OVNA 2LQOA 4X1UA 4ISDA 3DD3A 4FO5A 5IMCA 1EOHA 2C8UA 4L5LA 4EVMA 3A2WA 2B6MA 2GVPA 6GSTA 2X8CA 5LD0A 5AIXA 2DJ3A 5GAPD 1YEXA 4D73B 2PUKC 1SK2A 1R7HA 2CZ2A 2MMAA 3CRUA 5C00A 2AV4A 3QAGA 1AW9A 3RPNA 1GLQA 3HYPA 5F8BA 5ECRB 4IGJA 2JZRA 2OJLA 1ZCPA 3LG6A 2WULA 4QL7A 3P2AA 3ED3A 1S3CA 1JLWA 4E8HA 5J3RA 2CVBA 4V2MA 2NDOA 1GSYA 3ERGA 4XS6A 1HNAA 1FW1A 5G1KA 5J9BA 1SK1A 3GURA 2WZ9A 4L0WA 3E0UA 5ECKB 2KOKA 3HY2A 4WR4A 2FNOA 2YOIA 5F06A 3KCMA 1OC9A 2N5AA 3NIVA 3KH7A 4HI7A 2P5RA 4Q5FA 3FY7A 3EU4A 3FK8A 1X9SB 1PKWA 2IMKA 1HYUA 1T8EB 1GUKA 1ZMAA 5HR3A 2VOCA 5CREA 3O6TA 1K0NA 2GT5A 4TKYA 4HOJA 5INYA 2OKAA 2VCZA 4HU9A 4F82A 3M0FA 4IP6A 2NVLA 1O8XA 2R4VA 1DBYA 2V6KA 4HDEA 1TRWA 4F0BA 1Z9HA 3C71A 4JBBA 3GIXA 3L4NA 4P3YB 4I97A 3CSIA 4PNGA 3IAS2 2QSIA 1X5EA 1XWCA 2KP2A 3TKQA 1XWAA 3W8SA 3VLNA 3A3TA 4TXOA 4JR4A 1X9MB 2OE3A 3SWLA 3DYRA 3EC3A 1I5GA 4POMA 5KN0A 3DGQA 3D4TA 5A4UA 5FWGA 1ERUA 4NHZA 3DXBA 1GTAA 1O81A 2O7KA 2DC5A 2MBTA 3MAKA 1Z6NA 2FD3A 2YV9A 3NZNA 1XWBA 5CRDA 1G7OA 1EGRA 4ZB9A 2X8HA 3GKMA 4BWSA 3L0HA 1N8JA 1JZWA 4I6XA 4XRAA 5JCWA 1UA5A 2H01A 4TRXA 5CRGA 4DSSA 2AUVA 2H6ZA 2H72A 4YAPA 2PVQA 3HJPA 1PD21 1J0FA 4XS4B 5CNWA 3TJBA 3N9JA 3H93A 4YAVA 3C1RA 2QC7A 1AIUA 3H79A 2CX4A 2YWIA 1I9DA 1A0RP 3F4RA 2GLRA 3KH9A 1MDIA 1THXA 5AGYA 1X5DA 3TJKA 1QFNA 3OR5A 3HXSA 4XCSA 1GWCA 5GZZB 4MZBA 3Q74A 4ZILA 1HNCA 2VCXA 2RIIA 4KUNA 2XHFA 19GSA 1GSQA 1FG4A 4PX1A 3FEUA 4F0CA 1NM3A 1PL2A 4EKZA 4RQXA 2L6DA 3KMNA 3VPTA 1BJXA 3R2QA 3GSTA 1A23A 3DWVA 3TUEA 2QKEA 1TU7A 1Z6MA 1EOGA 3HVVA 1M99A 1VF1A 2AYTA 2F3MA 3LJRA 5A4WA 2R6KA 3TRXA 3VK9A 1GSUA 2R2JA 3DMLA 2LRCA 2V1MA 4EO3A 3KP9A 4KSOA 2NPBA 3FYGA 2B5XA 5D73A 1C72A 3MNGA 2P31A 3TOTA 3D5JA 4OMVA 2LSTA 3C1SA 1XCCA 2I4AA 4OCFA 5JWQB 3ZYWA 5J5NA 4NV2A 3DRNA 3ZVJA 5EL8A 1K0BA 1XXUA 3I43A 4IBPA 2GQKA 2OE0A 4TR0A 3KGKA 1QMVA 1WMJA 5D9VA 1K0MA 1EP8A 2DJ2A 1GP1A 3HZ8A 1GSDA 1R26A 2H1GA 5COHA 4LLRA 3WGEA 1V58A 4POLA 3KTBA 4ZB6A 4MJBA 1Z5YE 1TP9A 4CDOA 2GS3A 2VD0A 2FY6A 3DEXA 5GSSA 1GUMA 1V2AA 3RHBA 5IO2A 3G7JA 1ABAA 1NHYA 3K8NA 3TRQA 1V9WA 2YWOA 3IAM2 5A4VA 1OC9B 1TRSA 2PERA 1Z7RA 2YWMA 4OFMA 5ENUA 3Q6OA 3HA9A 2FA4A 2IFQA 3KMOA 2DBCA 2KLXA 4TR1A 1EEJA 1THOA 4KX4A 1ZYQB 2TRXA 1ZZYA 8GSSA 4ID0A 5D9XA 1FVKA 4DEJA 1F3BA 3GKNA 3IPZA 1TJDA 3ME8A 5IMDA 1QUWA 2WDUA 5IOWA 4WKWA 2LTKA 2AB6A 2JACA 4GSNA 2GDRA 3SBCA 3J7Yb 1B4QA 4N11A 1ACVA 1XW9A 2DIYA 1FO5A 5IMFA 2IIYA 1XWGA 4ZBBA 5C04A 2P0GA 3C7MA 4YQVA 3QPMA 4PQHA 3ZTLA 4CHSA 3GL3A 3IK9A 5DJMA 1SK0A 3BCIA 1VF4A 2MBSA 1A2LA 3CBUA 2LV3A 4POKA 3UVTA 2CZ3A 4HJMA 2EC4A 5HR2A 2RM5A 3IA1A 1FOVA 4G2EA 4FH8A 4MJAA 2VL2C 1OC3A 1VRSD 1K3OA 1TI1A 3TKRA 4HJ2A 1T4YA 5DVBA 5E4WA 1SL2B 1TI3A 2MMZA 3TGZA 4DVCA 1O6JA 1U6TA 3GH9A 3ZFBA 4EF0A 1KBNA 3QAWA 1GH2A 4DSSB 2IPAA 4ML1A 3HCZA 3ME7A 1OKTA 2NBSA 2KP1A 1X9WB 1TK8B 4TVEA 2HLSA 5J4UA 4KA0A 1PSQA 5B8BA 4HS1A 2J23A 1EZKA 4F9ZA 1TW9A 5IPGA 1UVZA 2L4CA 4YQMA 2HSHA 4EC0A 3EURA 3F63A 3IC4A 3D0ZA 4V2LA 1XW5A 1OC8A 4WETA 4HU7A 2H73A 1O7UA 1EP7A 3RPPA 4GTUA 4K6XA 2GQMA 5ECNB 1T3BA 4NHWA 1GLPA 1XBSA 1AUCA 2K18A 4EDZA 2MZCA 2IL3A 4IW9A 1WWJA 3FZAA 2N5FA 4NWYA 3HZ4A 1XWKA 4EL1A 2J9HA 2ZUPA 4LL1B 1U3IA 3E3EA 4GQCA 2F8AA 1O8WA 2EIOA 6GSUA 2QGVA 1WRYA 3GH6A 2TIRA 2A2RA 3QDNA 5DAKA 1BAYA 1YY7A 5G30A 3IXRA 3M9JA 1MD3A 5F0GA 1Y6EA 3LSZA 2H0IA 1XIYA 2V41A 5HQPA 3HVXA 9GSSA 2L59A 1M9AA 3RBTA 5CRWA 1JZDA 1EWXA 3UIWA 3VWWA 5ID2A 2MMNA 5IPHA 2ZNMA 3GRXA 5DBQA 3UBLA 2OA7A 4L5OA 1XW6A 3DKSA 3RHCA 1XOBA 2HZEA 4N30A 3GUSA 5G1LA 4N0VA 3CTFA 4TW5A 2YJHA 2FGXA 4WBRD 3IK7A 2ES7A 6GSSA 5G5FA 1Z3EA 20GSA 2K8VA 3APOA 3H4KA 2I3YA 1B48A 10GSA 1B9YC 3U6VA 1U3AA 2JL4A 2G0FA 3PGTA 1BX9A 1WIKA 2RUFA 5DQYA 1W89A 3DIEA 1VF2A 5J9CA 5CAXA 1OKDA 2KHPA 5DDLA 4KDUA 3VFIA 4OCEA 4QQ7A 2IFQB 1PX7A 4TR1B 2C4JA 1B4PA 4I2UA 1PA3A 3ZVJD 2AHEA 4IHUA 2FUG2 2HT9A 4KDXA 1MTCA 4YH2A 3ZFLA 2ZCTA 5IO0A 2YV7A 2B7JA 3I9V2 3L9SA 5AISA 4PUFC 1SJIA 1MEKA 2RLIA 3KTLA 3KEBA 4ZXGA 2GSSA 12GSA 2V2GA 4ZBAA 1PKZA 1FVJA 1K3LA 5IMAA 4J57E 2OACA 5ELAA 2L57A 3P90A 4WXTA 3TKSA 22GSA 1KEBA 2PVOC 1ZGNA 2H8LA 3G7IA 5L71A 1F3AA 3TDGA 2PBJA 2R37A 3W8JA 2H19A 1O85A 4MF6A 2HXKA 1UN2A 1A8LA 2MMOA 1M9BA 2DMLA 2KUCA 2OBIA 3CSJA 2WCIA 3FR6A 3EMPA 1TTZA 4ILFA 2H66A 3EMXA 1YEPA 5D9WA 3APSA 2BJXA 4IS0A 1SKSB 3GSSA 4NAXA 5DALA 2VD1A 1XVWA 4PXOA 2H70A 3E9JB 1ML6A 3ERFA 2O8VB 1TU8A 2FWEA 2FWFA 2GZPA 1FB6A 2DJ1A 3F0IA 3WGXA 4TOPA 1TRVA 3PINA 1Q98A 3QFAC 1F37A 5E59A 3FKFA 4KNDA 1A2MA 4PQIA 4K0NA 3HVSA 3VI5A 2PGTA 4OD7A 4KE3A 3GV1A 2JU5A 2FWGA 1FHEA 1BYEA 2H75A 2I81A 1X0RA 4MMMA 4O5RA 2L6CA 4XRDA 4Q5RA 1GTBA 1M7TA 4JEDA 2F8FA 1ZL9A 2YN1A 2GQLA 3A5WA 1T7PB 3WT1A 4HUAA 2IN3A 3F9UA 1DUGA 2PWJA 4GSSA 1GSSA 2K6VA 2F51A 1T4ZA 1M2AA 3N5OA 2C0GA 4RI6A 2G2QA 4WF5A 4EXJA 4XHMA 2H1BA 1Y25A 2YJ7A 17GSA 3O76A 1EV9A 2H0GA 4GRFA 16GSA 2CAIA 1ERVA 3J7Yk 4WBJA 2B5YA 4ECBA 1TDIA 2LJAA 2C80A 5DAKB 4MH2A 2YCDA 1K0CA 3UL3A 6GSVA 1S3AA 1JFUA 2VLUA 3TCOA 1TOFA 4MPFA 2LQQA 3W6GA 2VIMA 2WS2A 3KM6A 3P7XA 5DQSA 1DSBA 2DLXA 1NW2A 5ECHB 7GSSA 4MK3A 5ID2B 4O7HA 1SKRB 2LNTA 4IN0A 2CX3A 2O89A 1YJ6A 4I5QA 2HZEB 3P8WA 1AAZA 3VPQA 4TN8A 3GMFA 3D22A 2DIZA 5ELGA 2ON7A 4JR6A 1GULA 3LEFA 2HE3A 1Q4JA 4TR3A 1OAZA 4BA7A 1IYIA 4HEA2 2C0FA 2YP6A 2WJUA 2VLVA 4K7NA 2D2ZA 5B7CA 3GFKA 4MF7A 1V57A 5EVOA 1G0TA 3F6DA 3O3TA 4LA1A 4MABA 4J56E 3WGDA 3GX8A 4Q5NA 4ZB8A 2H74A 3QOUA 1ERTA 1MDJA 2LRTA 4X43A 2GZZA 4WEYA 1EGOA 2E0QA 2B1KA 2YWNA 3LXZA 4TXOB 3TOUA 1LU4A 3HHVA 2HYXA 2LJKA 1YF1A 4GCIA 1KTEA 5B8AA 5ECMB 4DSQA 2FWHA 3GTUA 2C0DA 1PQNA 3ZL5A 4KAEA 4JRRA 4KB3A 2IMDA 3BOAA 4POBA 2H76A 1H75A 5D8IA 4ML6A 3A2XA 4ULXA 4XIHA 4TXVA 2JSYA 1ERWA 3TRPA 1OYJA 4V1Ag 2RM6A 1UC7A 1DE2A 2GSRA 3TKPA 1GTUA 1OE8A 1PX6A 3LYPA 3FZ9A 4NPBA 1QXHA 2VCTA 3IHQA 3IR4A 2EIQA 4GLTA 1GTIA 4BPYA 4GXZA 4MLYA 3UVHA 5G2ZA 4MJCA 3ZMKA 5DCGA 1SJZA 3KZQA 1H4OA 2H71A 5JCGA 4X0XA 1WJKA 2LJRA 3IRAA 4OO5A 4MA9A 3CTGA 3VURA 1SYXA 2WGRA 2A4VA 4IQAA 1A0FA 1SJ6A 3EVIA 2BMXA 3I6AA 1QQ2A 5DALB 2L5OA 3LXTA 2YZHA 2B1LA 3M8NA 3DVXA 4RUVA 3M3MA 3QFBC 3G9BA 5JWRB 1PMTA 1JHBA 5IIZA 2GSQA 2VCQA 5CP1A 2H1DA 5HR0A 3ZLPA 18GSA 4MP4A 3CYNA 5EY6A 1SKWB 4K7OA 1WPIA 1AXDA 2XBIA 5CO3A 3LQ7A 5JWOB 2EIRA 4G10A 4NMUA 1ON4A 3QMXA 5DJLA 5EPFA 3ZITA 1K0OA 5D9TA 3CMIA 2YNXA 1CQGA 3IE3A 4EDYA 4MJEA 3QD9A 5D96A 1RK4A 5B6NA 1YDKA 1E2YA 4WR5A 3VWVA 3KJYA 4WF4A 3VI7A 1B9XC 1RW1A 3F6FA 3MWHA 6GSYA 4N10A 2MYGA 3BCKA 3RDWA 4L0UA 1SD9A 2H1AA 2CVDA 5HFKA 2O85A 1G7EA 4E8EA 1URMA 2H6YA 2F9SA 3UAPA 4KCAA 4BL7A 4IKHA 11GSA 3Q19A 3TJGA 4G9HA 3CXGA 1GRXA 4ZL9A 6GSXA 4EUYA 3G7YA 2LEGA 2VCVA 5AIVA 3UJ1A 1JZOA 3F4TA 3FZ5A 1G6YA 2B5EA 5ECLB 1LJRA 4BVXA 3F8UA 3MDKA 1K0AA 5ABRA 4EE0A 1USBA 1YKCA 4N0ZA 1PL1A 4MH3A 4KW6A 3L78A 5G31A 2VM1A 3FW2A 1KNGA 1J08A 4F2IA 3KD0A 2YPMA 3QR6A 1TK5B 2X8GA 2JZSA 3QCPA 4BVYA 1OE7A 3M1GA 1YQ1A 1SU9A 3FZ4A 4PNFA 3FHKA 5G5EA 2XPEA 1A8YA 4KSMA 2TRCP 2JADA 5ECSA 3GHAA 2DSAA 5HR1A 3WYWA 1GNWA 2GGTA 3GKKA 2CV4A 5FT3A 2IMEA 5ECPB 1TXXA 1IYHA 4K9ZA 2DJ0A 1TK0B 3V1WA 1AQWA 5ECIB 4AGSA 2E2GA 2YZUA 1M2BA 4Z7XA 5IMZA 2VL2A 4JU5A 2GZYA 5HFGA 1QK8A 3GL5A 1A24A 2LUSA 5DCHA 2GTUA 1GSFA 1TKDB 2LNSA 3BBYA 4OWYA 2CVKA 4FYUA 4DSRA 3GTUB 4AF2A 4K8MA 3TJJA 3A2VA 2ALBA 5H5SA 4V1Ap 1YZXA 2O87A 1M0UA 3UBKA 4L8EA 3UOMA 2IMFA 4RI7A 2I1UA 1X5CA 3L9UA 4LMVA 3ZZXA 2H6XA 1ST9A 2HSYA 3GN3A 3I69A 2A2SA 4PGTA 2RUEA 4BWQA 4H86A 3DVWA 1PN9A 2WB9A 4ZL7A 2VL3A 3MSZA 3LGCA 3CRTA 5KN2A 5IMVA 2LRNA 2L4QA 2IJYA 1GNEA 3C73A 1BQ7A 3LFLA 3EU3A 1XZOA 4MF5A 1F6MC 2OADA 3GKXA 3GA4A 1JZRA 4HQSA 1XVQA 1WOUA 1BEDA 2HI7A 3H1NA 2YANA 4XS1A 3D21A 3ZMLA 2VO4A 4O92A 3M9KA 3IV4A 1VGLA 1J9BA 4ZIJA 3VWXA 2VM2A 2OBKA 4O32A 4QL9A 1JLVA 4JZQA 2C3NA 1HNBA 3ZRDA 1ZYEA 4XTSA 1SL1B 4K2DA 3KP8A 2BTOT 1WE0A 2DJKA 2E2MA 4D73A 3LWAA 2V32A 1SYRA 2FCHA 5J41A 3ISOA 2JSZA 3GYKA 3FR3A 1G6WA 1PGTA 3IBHA 1MD4A 2CQ9A 2C3QA 3TJFA 2C0EA 3U5RE 4HZ2A 2JZTA 2HNLA 2M80A 5H5RA 4IQ1A 3TB2A 4GWRA 4KCEA 5CYYA 2HFDA 2FHEA 2B7KA 3UEMA 5H5QA 1EEMA 1PRXA 3L9VA 4KDYA 3S9FA 5LCZA 3KXOA 2VLTA 4KGIA 1MDKA 4MZWA 2XPDA 3HJMA 2E7PA 4V2NA 2K8SA 2H30A 3HD5A 5FHIA 1FB0A 1F2EA 4LL4B 2GSTA 1A2JA 5CRHA 5ECOB 2N5BA 14GSA 4MDCA 3H8QA 1FAAA 1F9MA 4HZ4A 4NV5A 2FA8A 4K0GA 4ECCA 4GSTA 4ZL8A 1S3DA 3ZIJA 4IP1A 3EYTA 1RQMA 2LS5A 4F03A 1YKAA 2DMMA 5LNKe 2VUPA 2VAFA 1U88A 4IELA 4CW9A 1VF3A 3GX0A 3EINA 1HD2A 1TRUA 1AC1A 4PUAA 2GT6A 1NSWA 4MCUA 3VWUA 4ACSA 4RQRA 1O73A 2HRNA 1ILOA 2DJJA 2PU9C 3RAZA 3D6IA 4K1FA 1SL0B 3ZIVA 1SENA 4LMWA 5AN1A 1T00A 3C8EA 2XC2A 5IM9A 2OE1A 4ECJA 3WT2A 2NTOA 3GNJA 2P5QA 2XBQA 4IJ3A 3TKSE 3CSHA 1V98A 1R5AA 4OFNA 5GSTA 4Q5QA 1XOAA 3EWLA 5IOXA 3BD2A 4PURA 2M72A 2IMIA 4OFTA 3IDVA 5KN1A 3FR9A 2C3TA 1CQHA 6GSWA 4IJIA 3IOSA 1SD8A 1N2AA 3ERWA 3BJ5A 3FRCA 1NHOA 3US3A 4GF0A 1HQOA 5F05A 3LORA 1ZOFA 4IVFA 5GAND 2R5GA 1AQVA 3HDCA 2LKUA 3NOFA 2REMA 4XS4A 1E6BA 3LYKA 4I8BA 2AAWA 3ZREA 2B3SA 5D93A 1B8XA 2VCWA 2M46A 5KN3A 4GQFA 3AY8A 1BG5A 1XPVA 5F07A 2R3XA 5HFIA 4AJ6A 1GSEA 2C1YA 4K7IA 2CT6A 3QAVA 3F4SA 2H0HA 5KEJA 1XFLA 1W4VA 3TKSC 1GL8A 2CAQA 2IWTA 1AQXA 2PPTA 5B6MA 4MZCA 1M2DA 2CA8A 1EV4A 4TR4A 2I9HA 1Z7PA 3F3QA 2AJQB 3HJOA 5ECQB 4ECIA 4FIWA 1QGVA 3JCML 3HKRA 1T1VA 1K0DA
chains in the Genus database with same CATH superfamily
2X99A 4MPGA 1WP0A 2WRTA 5A5KA 2Z9SA 2ON5A 2VL9A 4YQUA 1R4WA 1XG8A 1DE1A 2FLSA 3F3RA 3Q18A 4KH7A 13GSA 4ZBDA 4PQ1A 3UMAA 2HRFA 3PH9A 4JE1A 2PMTA 2UZ8A 4HQZA 3WD6A 4FYCA 4FYBA 3KIJA 2V6OA 4OO4A 2L5LA 1K3YA 1GUHA 1U87A 1YF0A 4I2TA 2WFCA 4G19A 4AJ7A 4NXIA 3UARA 2K9FA 3PR8A 4J2FA 4AJ8A 1V40A 3D4MA 1LBKA 2PN8A 3APQA 1R5PA 3R3EA 5IQYA 2HZFA 3EE2A 2X64A 5JCUA 1OVNA 2LQOA 4X1UA 4ISDA 3DD3A 4FO5A 5IMCA 1EOHA 2C8UA 4L5LA 4EVMA 3A2WA 2B6MA 2GVPA 6GSTA 2X8CA 5LD0A 5AIXA 2DJ3A 5GAPD 1YEXA 4D73B 2PUKC 1SK2A 1R7HA 2CZ2A 2MMAA 3CRUA 5C00A 2AV4A 3QAGA 1AW9A 3RPNA 1GLQA 3HYPA 5F8BA 5ECRB 4IGJA 2JZRA 2OJLA 1ZCPA 3LG6A 2WULA 4QL7A 3P2AA 3ED3A 1S3CA 1JLWA 4E8HA 5J3RA 2CVBA 4G0KA 4V2MA 2NDOA 1GSYA 3ERGA 4XS6A 1HNAA 1FW1A 5G1KA 5J9BA 1SK1A 3GURA 2WZ9A 4L0WA 3E0UA 5ECKB 2KOKA 3HY2A 4WR4A 2FNOA 2YOIA 5F06A 3KCMA 1OC9A 2N5AA 3NIVA 2R0PA 3KH7A 4HI7A 2P5RA 4Q5FA 3FY7A 3EU4A 3FK8A 1X9SB 1PKWA 2IMKA 1HYUA 1T8EB 1GUKA 1ZMAA 5HR3A 2VOCA 5CREA 3O6TA 1K0NA 2GT5A 4TKYA 4PTSA 4HOJA 5INYA 2OKAA 4Z2UA 2VCZA 4HU9A 4F82A 3M0FA 4IP6A 2NVLA 1O8XA 2R4VA 1DBYA 2V6KA 4HDEA 1TRWA 4F0BA 1Z9HA 3C71A 4JBBA 3GIXA 3L4NA 4P3YB 4I97A 3CSIA 4PNGA 3IAS2 2QSIA 1X5EA 1XWCA 2KP2A 3TKQA 1XWAA 3W8SA 3VLNA 3A3TA 4TXOA 4JR4A 1X9MB 2OE3A 3SWLA 3DYRA 3EC3A 1I5GA 4POMA 5KN0A 3DGQA 3D4TA 5A4UA 5FWGA 1ERUA 4NHZA 3DXBA 1GTAA 1O81A 2O7KA 2DC5A 2MBTA 3MAKA 1Z6NA 2FD3A 2YV9A 3NZNA 1XWBA 5CRDA 1G7OA 1EGRA 4ZB9A 2X8HA 3GKMA 4BWSA 3L0HA 1N8JA 2X4AA 1JZWA 4I6XA 4XRAA 5JCWA 1UA5A 2H01A 4TRXA 5CRGA 4DSSA 3MYDA 2HSMA 2AUVA 2H6ZA 4USSA 2H72A 4YAPA 2PVQA 3HJPA 1PD21 1J0FA 4XS4B 5CNWA 3TJBA 3N9JA 3H93A 4YAVA 3C1RA 2QC7A 1AIUA 3H79A 2CX4A 2YWIA 1I9DA 1A0RP 4X4JA 3F4RA 2GLRA 3KH9A 1MDIA 1THXA 5AGYA 1X5DA 3TJKA 1QFNA 3OR5A 3HXSA 4XCSA 1GWCA 5GZZB 4MZBA 3Q74A 4ZILA 1HNCA 2VCXA 2RIIA 4KUNA 2XHFA 19GSA 1GSQA 1FG4A 4PX1A 3FEUA 4F0CA 1NM3A 1PL2A 4EKZA 4RQXA 2L6DA 3KMNA 3VPTA 1BJXA 3R2QA 3GSTA 1A23A 3DWVA 3TUEA 2QKEA 1TU7A 1Z6MA 1EOGA 3HVVA 1M99A 1VF1A 2AYTA 2F3MA 3LJRA 5A4WA 2R6KA 3TRXA 3VK9A 1GSUA 2R2JA 3DMLA 2LRCA 2V1MA 4EO3A 3KP9A 4KSOA 2NPBA 3FYGA 2B5XA 5D73A 1C72A 3MNGA 2P31A 3TOTA 3D5JA 4OMVA 2LSTA 3C1SA 1XCCA 2I4AA 4OCFA 5JWQB 3ZYWA 5J5NA 4NV2A 3DRNA 3ZVJA 5EL8A 1K0BA 1XXUA 3I43A 4IBPA 2GQKA 2OE0A 4TR0A 3KGKA 1QMVA 1WMJA 5D9VA 1K0MA 1EP8A 2DJ2A 1GP1A 4BIKA 3HZ8A 1GSDA 1R26A 2H1GA 5COHA 4LLRA 3WGEA 1V58A 1S3RA 4POLA 3KTBA 4ZB6A 4MJBA 1Z5YE 1TP9A 4CDOA 2GS3A 2VD0A 2FY6A 3DEXA 5GSSA 1GUMA 1V2AA 3RHBA 5IO2A 3MIXA 3G7JA 1ABAA 1NHYA 3K8NA 3TRQA 4EIQA 1V9WA 2X49A 2YWOA 3IAM2 5A4VA 1OC9B 1TRSA 2PERA 1Z7RA 2YWMA 4OFMA 5ENUA 3Q6OA 3HA9A 2FA4A 2IFQA 3KMOA 2DBCA 2KLXA 3IC8A 4TR1A 1EEJA 1THOA 4KX4A 1ZYQB 2TRXA 1ZZYA 8GSSA 4ID0A 5D9XA 1FVKA 4DEJA 1F3BA 3GKNA 3IPZA 1TJDA 3ME8A 5IMDA 1QUWA 2WDUA 5IOWA 4WKWA 2LTKA 2AB6A 2JACA 4GSNA 2GDRA 3SBCA 3J7Yb 1B4QA 4N11A 1ACVA 1XW9A 2DIYA 4K5SA 1FO5A 5IMFA 2IIYA 1XWGA 4ZBBA 5C04A 2P0GA 3C7MA 4YQVA 3QPMA 4PQHA 3ZTLA 4CHSA 3GL3A 3IK9A 5DJMA 1SK0A 3BCIA 1VF4A 2MBSA 1A2LA 3CBUA 2LV3A 4POKA 3UVTA 2CZ3A 4HJMA 2EC4A 5HR2A 2RM5A 1ZYNA 4EIPA 3IA1A 2DKHA 1FOVA 4G2EA 4Z2TA 1PN0A 4FH8A 4MJAA 2VL2C 1OC3A 1VRSD 1K3OA 1TI1A 3TKRA 4HJ2A 1T4YA 5DVBA 5E4WA 1SL2B 1TI3A 2MMZA 3TGZA 4DVCA 1O6JA 1U6TA 3GH9A 3ZFBA 4EF0A 1KBNA 3QAWA 1GH2A 4DSSB 2IPAA 4ML1A 3HCZA 3ME7A 1OKTA 2NBSA 2KP1A 1X9WB 1TK8B 4TVEA 2HLSA 5J4UA 4KA0A 1PSQA 5B8BA 4HS1A 2J23A 1EZKA 4F9ZA 1TW9A 5IPGA 1UVZA 2L4CA 4YQMA 1M3JA 2HSHA 4O5QA 4EC0A 3EURA 3F63A 3IC4A 3D0ZA 4V2LA 1XW5A 1OC8A 4WETA 4HU7A 2H73A 1O7UA 1EP7A 3RPPA 4GTUA 4K6XA 2GQMA 5ECNB 1T3BA 4NHWA 1GLPA 1XBSA 1AUCA 4O5UA 2K18A 4EDZA 2MZCA 2IL3A 4IW9A 1WWJA 3FZAA 2N5FA 4NWYA 3HZ4A 1XWKA 4EL1A 2J9HA 2ZUPA 4K5RA 3PPUA 4LL1B 1U3IA 3E3EA 4GQCA 2F8AA 1O8WA 2EIOA 6GSUA 2QGVA 1WRYA 3GH6A 2TIRA 2A2RA 3QDNA 5DAKA 1BAYA 1YY7A 5G30A 3IXRA 3M9JA 1MD3A 5F0GA 1Y6EA 3LSZA 2H0IA 1XIYA 2V41A 5HQPA 3HVXA 9GSSA 2L59A 1M9AA 3RBTA 5CRWA 1JZDA 1EWXA 3CQFA 3UIWA 3VWWA 5ID2A 2MMNA 5IPHA 2ZNMA 3GRXA 5DBQA 3UBLA 2OA7A 4L5OA 1XW6A 3DKSA 3RHCA 1XOBA 2HZEA 4N30A 3LW9A 3GUSA 5G1LA 4YKGA 4N0VA 3CTFA 4TW5A 2YJHA 2FGXA 4WBRD 3IK7A 2ES7A 2R0GA 6GSSA 5G5FA 1Z3EA 20GSA 4K2XA 2K8VA 3APOA 3H4KA 2I3YA 1B48A 10GSA 1B9YC 3U6VA 1U3AA 2HRAA 2JL4A 2G0FA 3PGTA 1BX9A 1WIKA 2RUFA 5DQYA 1W89A 3DIEA 1VF2A 5J9CA 5CAXA 1OKDA 2KHPA 5DDLA 4KDUA 3VFIA 4OCEA 4QQ7A 4A5PA 2IFQB 1PX7A 4TR1B 2C4JA 1B4PA 4I2UA 1PA3A 3ZVJD 2AHEA 4IHUA 2FUG2 2HT9A 4KDXA 1MTCA 4YH2A 3ZFLA 2ZCTA 5IO0A 2YV7A 3HVNA 2B7JA 3I9V2 3L9SA 5AISA 4ICYA 4PUFC 1SJIA 3FMWA 1MEKA 2RLIA 3KTLA 3KEBA 4ZXGA 2GSSA 12GSA 2V2GA 4ZBAA 1PKZA 1FVJA 1K3LA 5IMAA 4J57E 2OACA 5ELAA 2L57A 3P90A 4WXTA 3TKSA 22GSA 1KEBA 2PVOC 1ZGNA 2H8LA 3G7IA 5L71A 1F3AA 3TDGA 2PBJA 2R37A 3W8JA 2H19A 1O85A 4MF6A 2HXKA 1UN2A 1A8LA 2MMOA 1M9BA 1ZYPA 2DMLA 2KUCA 2OBIA 3CSJA 2WCIA 3FR6A 3EMPA 1TTZA 4ILFA 2H66A 3EMXA 1YEPA 5D9WA 3APSA 2BJXA 4IS0A 1SKSB 3GSSA 4NAXA 5DALA 2VD1A 1XVWA 4PXOA 2H70A 3E9JB 1ML6A 3ERFA 2O8VB 1TU8A 2FWEA 2FWFA 2GZPA 1FB6A 2DJ1A 3F0IA 3WGXA 4TOPA 1TRVA 4YKFA 3PINA 3EPTA 1Q98A 3QFAC 1F37A 5E59A 3FKFA 4KNDA 1A2MA 4PQIA 4K0NA 3HVSA 3VI5A 2PGTA 4OD7A 4KE3A 3GV1A 2JU5A 2FWGA 1FHEA 1BYEA 2H75A 2I81A 1X0RA 4MMMA 4O5RA 2L6CA 4XRDA 4Q5RA 1GTBA 1M7TA 4JEDA 2F8FA 1ZL9A 2YN1A 2GQLA 3A5WA 1PFOA 1T7PB 3WT1A 4HUAA 2IN3A 3F9UA 1DUGA 2PWJA 4GSSA 1GSSA 2K6VA 2F51A 1T4ZA 1M2AA 3N5OA 2C0GA 4RI6A 2G2QA 4WF5A 4EXJA 4XHMA 2H1BA 1Y25A 2YJ7A 17GSA 3O76A 1EV9A 2H0GA 4GRFA 16GSA 2CAIA 1ERVA 3J7Yk 4WBJA 2B5YA 4ECBA 1TDIA 2LJAA 4G0IA 2C80A 2A2PA 5DAKB 4MH2A 2YCDA 1K0CA 3UL3A 6GSVA 1S3AA 1JFUA 2VLUA 3TCOA 1TOFA 4MPFA 2LQQA 3W6GA 2VIMA 2WS2A 3KM6A 3P7XA 5DQSA 1DSBA 2DLXA 1NW2A 5ECHB 7GSSA 4MK3A 5ID2B 4O7HA 1SKRB 2LNTA 4IN0A 2CX3A 2O89A 1YJ6A 4I5QA 2HZEB 3P8WA 1AAZA 3VPQA 4TN8A 3GMFA 3D22A 2DIZA 5ELGA 2ON7A 4JR6A 1GULA 3LEFA 2HE3A 1Q4JA 4TR3A 1OAZA 4BA7A 1IYIA 4HEA2 2C0FA 2YP6A 2WJUA 2VLVA 4K7NA 2D2ZA 5B7CA 3GFKA 4MF7A 1V57A 5KOWA 5EVOA 1G0TA 3F6DA 3O3TA 4LA1A 4MABA 4J56E 3WGDA 3GX8A 4Q5NA 4ZB8A 2H74A 2DKIA 3QOUA 1ERTA 1MDJA 2LRTA 4X43A 2GZZA 4WEYA 1EGOA 2E0QA 2B1KA 4TXOB 2YWNA 3LXZA 3TOUA 1LU4A 3HHVA 2HYXA 2QA1A 2LJKA 1YF1A 4GCIA 1KTEA 5B8AA 5ECMB 4DSQA 2FWHA 3GTUA 2C0DA 1PQNA 3ZL5A 4KAEA 4CY8A 4JRRA 4KB3A 2IMDA 3BOAA 4POBA 2H76A 1H75A 5D8IA 4ML6A 3A2XA 4ULXA 4XIHA 4TXVA 2JSYA 1ERWA 3TRPA 1OYJA 4V1Ag 2RM6A 1UC7A 1DE2A 2GSRA 3TKPA 1GTUA 1OE8A 1PX6A 3LYPA 3FZ9A 4NPBA 1QXHA 2VCTA 3IHQA 3IR4A 2EIQA 4GLTA 1GTIA 4BPYA 4GXZA 4MLYA 3UVHA 5G2ZA 4MJCA 3ZMKA 5DCGA 1SJZA 3KZQA 1H4OA 2H71A 5JCGA 4X0XA 1WJKA 2LJRA 3IRAA 4OO5A 4MA9A 3CTGA 3VURA 1SYXA 2WGRA 2A4VA 4IQAA 1A0FA 1SJ6A 3EVIA 2BMXA 2QA2A 3I6AA 1QQ2A 5DALB 2L5OA 3LXTA 2YZHA 2B1LA 3M8NA 3DVXA 4RUVA 2HRKA 3M3MA 3QFBC 3G9BA 5JWRB 1PMTA 1JHBA 5IIZA 2GSQA 2VCQA 5CP1A 2H1DA 5HR0A 3ZLPA 18GSA 4MP4A 3CYNA 5EY6A 1SKWB 4K7OA 1WPIA 1AXDA 2XBIA 5CO3A 3LQ7A 5JWOB 2EIRA 4G10A 4NMUA 1ON4A 3QMXA 5DJLA 5EPFA 3ZITA 1K0OA 5D9TA 3CMIA 2YNXA 1CQGA 3IE3A 4EDYA 4MJEA 3QD9A 5D96A 1RK4A 5B6NA 1YDKA 1E2YA 4WR5A 3VWVA 3KJYA 4WF4A 3VI7A 5KOXA 1B9XC 1RW1A 3F6FA 3MWHA 4CY6A 6GSYA 4N10A 2MYGA 3BCKA 3RDWA 4L0UA 1SD9A 2H1AA 2CVDA 5HFKA 2O85A 1G7EA 4E8EA 1URMA 2H6YA 2F9SA 3UAPA 4KCAA 4BL7A 4IKHA 11GSA 3Q19A 3TJGA 4G9HA 3CXGA 1GRXA 4ZL9A 6GSXA 4EUYA 3G7YA 2LEGA 2VCVA 5AIVA 3UJ1A 1JZOA 3F4TA 3FZ5A 1G6YA 2B5EA 5ECLB 1LJRA 4BVXA 3F8UA 3MDKA 1K0AA 5ABRA 4EE0A 1USBA 1YKCA 4N0ZA 1PL1A 4MH3A 4KW6A 3L78A 5G31A 2VM1A 3FW2A 1KNGA 1J08A 4F2IA 3KD0A 2YPMA 3QR6A 1TK5B 2X8GA 2JZSA 3QCPA 4BVYA 1OE7A 3M1GA 1YQ1A 1SU9A 3IHGA 3FZ4A 4PNFA 3FHKA 3A5IA 5G5EA 2XPEA 1A8YA 4KSMA 2TRCP 2JADA 5ECSA 3GHAA 2DSAA 5HR1A 3WYWA 1GNWA 2GGTA 3GKKA 2CV4A 5FT3A 2IMEA 5ECPB 1TXXA 1IYHA 4K9ZA 5BRTA 2DJ0A 1TK0B 3V1WA 1AQWA 5ECIB 4AGSA 2E2GA 2YZUA 1M2BA 4Z7XA 5IMZA 2VL2A 4JU5A 2GZYA 5HFGA 1QK8A 3GL5A 1A24A 2LUSA 5DCHA 2GTUA 1GSFA 1TKDB 2LNSA 3BBYA 4OWYA 2CVKA 4FYUA 4DSRA 3GTUB 4AF2A 4HSCX 4K8MA 3TJJA 3A2VA 2ALBA 5H5SA 4V1Ap 1YZXA 2O87A 1M0UA 3UBKA 4L8EA 3UOMA 2IMFA 4FQUA 4RI7A 2I1UA 1X5CA 3L9UA 4LMVA 3ZZXA 2H6XA 1ST9A 2HSYA 3GN3A 3I69A 2A2SA 4PGTA 2RUEA 4BWQA 2R0CA 4H86A 3DVWA 1PN9A 2WB9A 4ZL7A 2A4HA 2VL3A 3MSZA 3LGCA 3CRTA 5KN2A 5IMVA 2LRNA 2L4QA 2IJYA 1GNEA 3C73A 1BQ7A 3LFLA 3EU3A 1XZOA 4MF5A 1F6MC 2OADA 3GKXA 3GA4A 1JZRA 4HQSA 1XVQA 1WOUA 1BEDA 2HI7A 3H1NA 2YANA 4XS1A 3D21A 1FOHA 3ZMLA 2VO4A 4O92A 3M9KA 3IV4A 1VGLA 1J9BA 4ZIJA 3VWXA 2VM2A 2OBKA 4O32A 4QL9A 1JLVA 4JZQA 2C3NA 1HNBA 3ZRDA 1ZYEA 4XTSA 1SL1B 4K2DA 3KP8A 2BTOT 1WE0A 2DJKA 2E2MA 4Z2RA 4D73A 3LWAA 2V32A 1SYRA 2FCHA 5J41A 3ISOA 2JSZA 3GYKA 3FR3A 1G6WA 1PGTA 3IBHA 1MD4A 2CQ9A 2C3QA 3TJFA 2C0EA 3U5RE 4HZ2A 2JZTA 2HNLA 2M80A 5H5RA 4IQ1A 3TB2A 4GWRA 4KCEA 4MNNA 5CYYA 2HFDA 2FHEA 2B7KA 3UEMA 5H5QA 1EEMA 1PRXA 3L9VA 4KDYA 3S9FA 5LCZA 3KXOA 2VLTA 4KGIA 1MDKA 4MZWA 2XPDA 3HJMA 2E7PA 4V2NA 2K8SA 2H30A 5BMUA 3HD5A 5FHIA 1FB0A 1F2EA 4LL4B 2GSTA 1A2JA 5CRHA 5ECOB 2N5BA 14GSA 4MDCA 3H8QA 1FAAA 1F9MA 4HZ4A 4NV5A 2FA8A 4K0GA 4KF9A 4ECCA 4GSTA 4ZL8A 1S3DA 3ZIJA 4IP1A 3EYTA 1RQMA 2LS5A 4F03A 4BL7B 1YKAA 2DMMA 5LNKe 2VUPA 2VAFA 1U88A 4IELA 4G0LA 4CW9A 1VF3A 3GX0A 3EINA 1HD2A 1TRUA 1AC1A 4PUAA 2GT6A 1NSWA 4MCUA 3VWUA 4ACSA 4RQRA 1O73A 4BVXB 2HRNA 1ILOA 2DJJA 2PU9C 3RAZA 3D6IA 4K1FA 1SL0B 3ZIVA 1SENA 4LMWA 5AN1A 1T00A 3C8EA 2XC2A 5IM9A 2OE1A 4ECJA 3WT2A 2NTOA 3GNJA 2P5QA 2XBQA 4IJ3A 3TKSE 3CSHA 1V98A 1R5AA 4OFNA 5GSTA 4Q5QA 1XOAA 3EWLA 4BVYB 5IOXA 3BD2A 4PURA 2M72A 2IMIA 4OFTA 3IDVA 5KN1A 3FR9A 2C3TA 1CQHA 6GSWA 4IJIA 3IOSA 1SD8A 1N2AA 3ERWA 3BJ5A 3FRCA 1NHOA 3US3A 4GF0A 1HQOA 5F05A 3LORA 1ZOFA 4IVFA 5GAND 2R5GA 1AQVA 3HDCA 2LKUA 3NOFA 2REMA 4XS4A 1E6BA 3LYKA 4I8BA 2AAWA 3ZREA 2B3SA 5D93A 1B8XA 2VCWA 2M46A 5KN3A 4GQFA 3AY8A 1BG5A 1XPVA 5F07A 2R3XA 5HFIA 4AJ6A 1GSEA 2C1YA 4K7IA 2CT6A 3QAVA 3F4SA 2H0HA 5KEJA 1XFLA 1W4VA 3TKSC 1GL8A 2CAQA 2IWTA 1AQXA 2PPTA 5B6MA 4MZCA 1M2DA 2CA8A 1EV4A 1M3IA 4TR4A 2I9HA 1Z7PA 3F3QA 2AJQB 3HJOA 5ECQB 4ECIA 4FIWA 1QGVA 3JCML 3HKRA 1T1VA 1K0DA
chains in the Genus database with same CATH topology
2X99A 4MPGA 1WP0A 2WRTA 5A5KA 2Z9SA 2ON5A 2VL9A 4YQUA 1R4WA 1DE1A 2FLSA 3F3RA 3Q18A 4KH7A 13GSA 4ZBDA 4PQ1A 3UMAA 2HRFA 3PH9A 4JE1A 2PMTA 2UZ8A 4HQZA 3WD6A 4FYCA 4FYBA 3KIJA 2V6OA 4OO4A 2L5LA 1K3YA 1GUHA 1U87A 1YF0A 4I2TA 2WFCA 4G19A 4AJ7A 4NXIA 3UARA 2K9FA 3PR8A 4J2FA 4AJ8A 1V40A 3D4MA 1LBKA 2PN8A 3APQA 1R5PA 3R3EA 5IQYA 2HZFA 3EE2A 2X64A 5JCUA 1OVNA 2LQOA 4X1UA 4ISDA 3DD3A 4FO5A 5IMCA 1EOHA 2C8UA 4L5LA 4EVMA 3A2WA 2B6MA 2GVPA 6GSTA 2X8CA 5LD0A 5AIXA 2DJ3A 5GAPD 1YEXA 4D73B 2PUKC 1SK2A 1R7HA 2CZ2A 2MMAA 3CRUA 5C00A 2AV4A 3QAGA 1AW9A 3RPNA 1GLQA 3HYPA 5F8BA 5ECRB 4IGJA 2JZRA 2OJLA 1ZCPA 3LG6A 2WULA 4QL7A 3P2AA 3ED3A 1S3CA 1JLWA 4E8HA 5J3RA 2CVBA 4G0KA 4V2MA 2NDOA 1GSYA 3ERGA 4XS6A 1HNAA 1FW1A 5G1KA 5J9BA 1SK1A 3GURA 2WZ9A 4L0WA 3E0UA 5ECKB 2KOKA 3HY2A 4WR4A 2FNOA 2YOIA 5F06A 3KCMA 1OC9A 2N5AA 3NIVA 2R0PA 3KH7A 4HI7A 2P5RA 4Q5FA 3FY7A 3EU4A 3FK8A 1X9SB 1PKWA 2IMKA 1HYUA 1T8EB 1GUKA 1ZMAA 5HR3A 2VOCA 5CREA 3O6TA 1K0NA 2GT5A 4TKYA 4PTSA 4HOJA 5INYA 2OKAA 4Z2UA 2VCZA 4HU9A 4F82A 3M0FA 4IP6A 2NVLA 1O8XA 2R4VA 1DBYA 2V6KA 4HDEA 1TRWA 4F0BA 1Z9HA 3C71A 4JBBA 3GIXA 3L4NA 4P3YB 4I97A 3CSIA 4PNGA 3IAS2 2QSIA 1X5EA 1XWCA 2KP2A 3TKQA 1XWAA 3W8SA 3VLNA 3A3TA 4TXOA 4JR4A 1X9MB 2OE3A 3SWLA 3DYRA 3EC3A 1I5GA 4POMA 5KN0A 3DGQA 3D4TA 5A4UA 5FWGA 1ERUA 4NHZA 3DXBA 1GTAA 1O81A 2O7KA 2DC5A 2MBTA 3MAKA 1Z6NA 2FD3A 2YV9A 3NZNA 1XWBA 5CRDA 1G7OA 1EGRA 4ZB9A 2X8HA 3GKMA 4BWSA 3L0HA 1N8JA 2X4AA 1JZWA 4I6XA 4XRAA 5JCWA 1UA5A 2H01A 4TRXA 5CRGA 4DSSA 3MYDA 2HSMA 2AUVA 2H6ZA 4USSA 2H72A 4YAPA 2PVQA 3HJPA 1PD21 1J0FA 4XS4B 5CNWA 3TJBA 3N9JA 3H93A 4YAVA 3C1RA 2QC7A 1AIUA 3H79A 2CX4A 2YWIA 1I9DA 1A0RP 4X4JA 3F4RA 2GLRA 3KH9A 1MDIA 1THXA 5AGYA 1X5DA 3TJKA 1QFNA 3OR5A 3HXSA 4XCSA 1GWCA 5GZZB 4MZBA 3Q74A 4ZILA 1HNCA 2VCXA 2RIIA 4KUNA 2XHFA 19GSA 1GSQA 1FG4A 4PX1A 3FEUA 4F0CA 1NM3A 1PL2A 4EKZA 4RQXA 2L6DA 3KMNA 3VPTA 1BJXA 3R2QA 3GSTA 1A23A 3DWVA 3TUEA 2QKEA 1TU7A 1Z6MA 1EOGA 3HVVA 1M99A 1VF1A 2AYTA 2F3MA 3LJRA 5A4WA 2R6KA 3TRXA 3VK9A 1GSUA 2R2JA 3DMLA 2LRCA 2V1MA 4EO3A 3KP9A 4KSOA 2NPBA 3FYGA 2B5XA 5D73A 1C72A 3MNGA 2P31A 3TOTA 3D5JA 4OMVA 2LSTA 3C1SA 1XCCA 2I4AA 4OCFA 5JWQB 3ZYWA 5J5NA 4NV2A 3DRNA 3ZVJA 5EL8A 1K0BA 1XXUA 3I43A 4IBPA 2GQKA 2OE0A 4TR0A 3KGKA 1QMVA 1WMJA 5D9VA 1K0MA 1EP8A 2DJ2A 1GP1A 3HZ8A 1GSDA 1R26A 2H1GA 5COHA 4LLRA 3WGEA 1V58A 4POLA 3KTBA 4ZB6A 4MJBA 1Z5YE 1TP9A 4CDOA 2GS3A 2VD0A 2FY6A 3DEXA 5GSSA 1GUMA 1V2AA 3RHBA 5IO2A 3MIXA 3G7JA 1ABAA 1NHYA 3K8NA 3TRQA 4EIQA 1V9WA 2X49A 2YWOA 3IAM2 5A4VA 1OC9B 1TRSA 2PERA 1Z7RA 2YWMA 4OFMA 5ENUA 3Q6OA 3HA9A 2FA4A 2IFQA 3KMOA 2DBCA 2KLXA 3IC8A 4TR1A 1EEJA 1THOA 4KX4A 1ZYQB 2TRXA 1ZZYA 8GSSA 4ID0A 5D9XA 1FVKA 4DEJA 1F3BA 3GKNA 3IPZA 1TJDA 3ME8A 5IMDA 1QUWA 2WDUA 5IOWA 4WKWA 2LTKA 2AB6A 2JACA 4GSNA 2GDRA 3SBCA 3J7Yb 1B4QA 4N11A 1ACVA 1XW9A 2DIYA 4K5SA 1FO5A 5IMFA 2IIYA 1XWGA 4ZBBA 5C04A 2P0GA 3C7MA 4YQVA 3QPMA 4PQHA 3ZTLA 4CHSA 3GL3A 3IK9A 5DJMA 1SK0A 3BCIA 1VF4A 2MBSA 1A2LA 3CBUA 2LV3A 4POKA 3UVTA 2CZ3A 4HJMA 2EC4A 5HR2A 2RM5A 1ZYNA 4EIPA 3IA1A 2DKHA 1FOVA 4G2EA 4Z2TA 1PN0A 4FH8A 4MJAA 2VL2C 1OC3A 1VRSD 1K3OA 1TI1A 3TKRA 4HJ2A 1T4YA 5DVBA 5E4WA 1SL2B 1TI3A 2MMZA 3TGZA 4DVCA 1O6JA 1U6TA 3GH9A 3ZFBA 4EF0A 1KBNA 3QAWA 1GH2A 4DSSB 2IPAA 4ML1A 3HCZA 3ME7A 1OKTA 2NBSA 2KP1A 1X9WB 1TK8B 4TVEA 2HLSA 5J4UA 4KA0A 1PSQA 5B8BA 4HS1A 2J23A 1EZKA 4F9ZA 1TW9A 5IPGA 1UVZA 2L4CA 4YQMA 2HSHA 4O5QA 4EC0A 3EURA 3F63A 3IC4A 3D0ZA 4V2LA 1XW5A 1OC8A 4WETA 4HU7A 2H73A 1O7UA 1EP7A 3RPPA 4GTUA 4K6XA 2GQMA 5ECNB 1T3BA 4NHWA 1GLPA 1XBSA 1AUCA 4O5UA 2K18A 4EDZA 2MZCA 2IL3A 4IW9A 1WWJA 3FZAA 2N5FA 4NWYA 3HZ4A 1XWKA 4EL1A 2J9HA 2ZUPA 4K5RA 3PPUA 4LL1B 1U3IA 3E3EA 4GQCA 2F8AA 1O8WA 2EIOA 6GSUA 2QGVA 1WRYA 3GH6A 2TIRA 2A2RA 3QDNA 5DAKA 1BAYA 1YY7A 5G30A 3IXRA 3M9JA 1MD3A 5F0GA 1Y6EA 3LSZA 2H0IA 1XIYA 2V41A 5HQPA 3HVXA 9GSSA 2L59A 1M9AA 3RBTA 5CRWA 1JZDA 1EWXA 3UIWA 3VWWA 5ID2A 2MMNA 5IPHA 2ZNMA 3GRXA 5DBQA 3UBLA 2OA7A 4L5OA 1XW6A 3DKSA 3RHCA 1XOBA 2HZEA 4N30A 3LW9A 3GUSA 5G1LA 4YKGA 4N0VA 3CTFA 4TW5A 2YJHA 2FGXA 4WBRD 3IK7A 2ES7A 2R0GA 6GSSA 5G5FA 1Z3EA 20GSA 4K2XA 2K8VA 3APOA 3H4KA 2I3YA 1B48A 10GSA 1B9YC 3U6VA 1U3AA 2HRAA 2JL4A 2G0FA 3PGTA 1BX9A 1WIKA 2RUFA 5DQYA 1W89A 3DIEA 1VF2A 5J9CA 5CAXA 1OKDA 2KHPA 5DDLA 4KDUA 3VFIA 4OCEA 4QQ7A 4A5PA 2IFQB 1PX7A 4TR1B 2C4JA 1B4PA 4I2UA 1PA3A 3ZVJD 2AHEA 4IHUA 2FUG2 2HT9A 4KDXA 1MTCA 4YH2A 3ZFLA 2ZCTA 5IO0A 2YV7A 2B7JA 3I9V2 3L9SA 5AISA 4ICYA 4PUFC 1SJIA 3FMWA 1MEKA 2RLIA 3KTLA 3KEBA 4ZXGA 2GSSA 12GSA 2V2GA 4ZBAA 1PKZA 1FVJA 1K3LA 5IMAA 4J57E 2OACA 5ELAA 2L57A 3P90A 4WXTA 3TKSA 22GSA 1KEBA 2PVOC 1ZGNA 2H8LA 3G7IA 5L71A 1F3AA 3TDGA 2PBJA 2R37A 3W8JA 2H19A 1O85A 4MF6A 2HXKA 1UN2A 1A8LA 2MMOA 1M9BA 1ZYPA 2DMLA 2KUCA 2OBIA 3CSJA 2WCIA 3FR6A 3EMPA 1TTZA 4ILFA 2H66A 3EMXA 1YEPA 5D9WA 3APSA 2BJXA 4IS0A 1SKSB 3GSSA 4NAXA 5DALA 2VD1A 1XVWA 4PXOA 2H70A 3E9JB 1ML6A 3ERFA 2O8VB 1TU8A 2FWEA 2FWFA 2GZPA 1FB6A 2DJ1A 3F0IA 3WGXA 4TOPA 1TRVA 4YKFA 3PINA 3EPTA 1Q98A 3QFAC 1F37A 5E59A 3FKFA 4KNDA 1A2MA 4PQIA 4K0NA 3HVSA 3VI5A 2PGTA 4OD7A 4KE3A 3GV1A 2JU5A 2FWGA 1FHEA 1BYEA 2H75A 2I81A 1X0RA 4MMMA 4O5RA 2L6CA 4XRDA 4Q5RA 1GTBA 1M7TA 4JEDA 2F8FA 1ZL9A 2YN1A 2GQLA 3A5WA 1T7PB 3WT1A 4HUAA 2IN3A 3F9UA 1DUGA 2PWJA 4GSSA 1GSSA 2K6VA 2F51A 1T4ZA 1M2AA 3N5OA 2C0GA 4RI6A 2G2QA 4WF5A 4EXJA 4XHMA 2H1BA 1Y25A 2YJ7A 17GSA 3O76A 1EV9A 2H0GA 4GRFA 16GSA 2CAIA 1ERVA 3J7Yk 4WBJA 2B5YA 4ECBA 1TDIA 2LJAA 4G0IA 2C80A 2A2PA 5DAKB 4MH2A 2YCDA 1K0CA 3UL3A 6GSVA 1S3AA 1JFUA 2VLUA 3TCOA 1TOFA 4MPFA 2LQQA 3W6GA 2VIMA 2WS2A 3KM6A 3P7XA 5DQSA 1DSBA 2DLXA 1NW2A 5ECHB 7GSSA 4MK3A 5ID2B 4O7HA 1SKRB 2LNTA 4IN0A 2CX3A 2O89A 1YJ6A 4I5QA 2HZEB 3P8WA 1AAZA 3VPQA 4TN8A 3GMFA 3D22A 2DIZA 5ELGA 2ON7A 4JR6A 1GULA 3LEFA 2HE3A 1Q4JA 4TR3A 1OAZA 4BA7A 1IYIA 4HEA2 2C0FA 2YP6A 2WJUA 2VLVA 4K7NA 2D2ZA 5B7CA 3GFKA 4MF7A 1V57A 5KOWA 5EVOA 1G0TA 3F6DA 3O3TA 4LA1A 4MABA 4J56E 3WGDA 3GX8A 4Q5NA 4ZB8A 2H74A 2DKIA 3QOUA 1ERTA 1MDJA 2LRTA 4X43A 2GZZA 4WEYA 1EGOA 2E0QA 2B1KA 4TXOB 2YWNA 3LXZA 3TOUA 1LU4A 3HHVA 2HYXA 2QA1A 2LJKA 1YF1A 4GCIA 1KTEA 5B8AA 5ECMB 4DSQA 2FWHA 3GTUA 2C0DA 1PQNA 3ZL5A 4KAEA 4CY8A 4JRRA 4KB3A 2IMDA 3BOAA 4POBA 2H76A 1H75A 5D8IA 4ML6A 3A2XA 4ULXA 4XIHA 4TXVA 2JSYA 1ERWA 3TRPA 1OYJA 4V1Ag 2RM6A 1UC7A 1DE2A 2GSRA 3TKPA 1GTUA 1OE8A 1PX6A 3LYPA 3FZ9A 4NPBA 1QXHA 2VCTA 3IHQA 3IR4A 2EIQA 4GLTA 1GTIA 4BPYA 4GXZA 4MLYA 3UVHA 5G2ZA 4MJCA 3ZMKA 5DCGA 1SJZA 3KZQA 1H4OA 2H71A 5JCGA 4X0XA 1WJKA 2LJRA 3IRAA 4OO5A 4MA9A 3CTGA 3VURA 1SYXA 2WGRA 2A4VA 4IQAA 1A0FA 1SJ6A 3EVIA 2BMXA 2QA2A 3I6AA 1QQ2A 5DALB 2L5OA 3LXTA 2YZHA 2B1LA 3M8NA 3DVXA 4RUVA 2HRKA 3M3MA 3QFBC 3G9BA 5JWRB 1PMTA 1JHBA 5IIZA 2GSQA 2VCQA 5CP1A 2H1DA 5HR0A 3ZLPA 18GSA 4MP4A 3CYNA 5EY6A 1SKWB 4K7OA 1WPIA 1AXDA 2XBIA 5CO3A 3LQ7A 5JWOB 2EIRA 4G10A 4NMUA 1ON4A 3QMXA 5DJLA 5EPFA 3ZITA 1K0OA 5D9TA 3CMIA 2YNXA 1CQGA 3IE3A 4EDYA 4MJEA 3QD9A 5D96A 1RK4A 5B6NA 1YDKA 1E2YA 4WR5A 3VWVA 3KJYA 4WF4A 3VI7A 5KOXA 1B9XC 1RW1A 3F6FA 3MWHA 4CY6A 6GSYA 4N10A 2MYGA 3BCKA 3RDWA 4L0UA 1SD9A 2H1AA 2CVDA 5HFKA 2O85A 1G7EA 4E8EA 1URMA 2H6YA 2F9SA 3UAPA 4KCAA 4BL7A 4IKHA 11GSA 3Q19A 3TJGA 4G9HA 3CXGA 1GRXA 4ZL9A 6GSXA 4EUYA 3G7YA 2LEGA 2VCVA 5AIVA 3UJ1A 1JZOA 3F4TA 3FZ5A 1G6YA 2B5EA 5ECLB 1LJRA 4BVXA 3F8UA 3MDKA 1K0AA 5ABRA 4EE0A 1USBA 1YKCA 4N0ZA 1PL1A 4MH3A 4KW6A 3L78A 5G31A 2VM1A 3FW2A 1KNGA 1J08A 4F2IA 3KD0A 2YPMA 3QR6A 1TK5B 2X8GA 2JZSA 3QCPA 4BVYA 1OE7A 3M1GA 1YQ1A 1SU9A 3IHGA 3FZ4A 4PNFA 3FHKA 3A5IA 5G5EA 2XPEA 1A8YA 4KSMA 2TRCP 2JADA 5ECSA 3GHAA 2DSAA 5HR1A 3WYWA 1GNWA 2GGTA 3GKKA 2CV4A 5FT3A 2IMEA 5ECPB 1TXXA 1IYHA 4K9ZA 5BRTA 2DJ0A 1TK0B 3V1WA 1AQWA 5ECIB 4AGSA 2E2GA 2YZUA 1M2BA 4Z7XA 5IMZA 2VL2A 4JU5A 2GZYA 5HFGA 1QK8A 3GL5A 1A24A 2LUSA 5DCHA 2GTUA 1GSFA 1TKDB 2LNSA 3BBYA 4OWYA 2CVKA 4FYUA 4DSRA 3GTUB 4AF2A 4K8MA 3TJJA 3A2VA 2ALBA 5H5SA 4V1Ap 1YZXA 2O87A 1M0UA 3UBKA 4L8EA 3UOMA 2IMFA 4FQUA 4RI7A 2I1UA 1X5CA 3L9UA 4LMVA 3ZZXA 2H6XA 1ST9A 2HSYA 3GN3A 3I69A 2A2SA 4PGTA 2RUEA 4BWQA 2R0CA 4H86A 3DVWA 1PN9A 2WB9A 4ZL7A 2A4HA 2VL3A 3MSZA 3LGCA 3CRTA 5KN2A 5IMVA 2LRNA 2L4QA 2IJYA 1GNEA 3C73A 1BQ7A 3LFLA 3EU3A 1XZOA 4MF5A 1F6MC 2OADA 3GKXA 3GA4A 1JZRA 4HQSA 1XVQA 1WOUA 1BEDA 2HI7A 3H1NA 2YANA 4XS1A 3D21A 1FOHA 3ZMLA 2VO4A 4O92A 3M9KA 3IV4A 1VGLA 1J9BA 4ZIJA 3VWXA 2VM2A 2OBKA 4O32A 4QL9A 1JLVA 4JZQA 2C3NA 1HNBA 3ZRDA 1ZYEA 4XTSA 1SL1B 4K2DA 3KP8A 2BTOT 1WE0A 2DJKA 2E2MA 4Z2RA 4D73A 3LWAA 2V32A 1SYRA 2FCHA 5J41A 3ISOA 2JSZA 3GYKA 3FR3A 1G6WA 1PGTA 3IBHA 1MD4A 2CQ9A 2C3QA 3TJFA 2C0EA 3U5RE 4HZ2A 2JZTA 2HNLA 2M80A 5H5RA 4IQ1A 3TB2A 4GWRA 4KCEA 4MNNA 5CYYA 2HFDA 2FHEA 2B7KA 3UEMA 5H5QA 1EEMA 1PRXA 3L9VA 4KDYA 3S9FA 5LCZA 3KXOA 2VLTA 4KGIA 1MDKA 4MZWA 2XPDA 3HJMA 2E7PA 4V2NA 2K8SA 2H30A 5BMUA 3HD5A 5FHIA 1FB0A 1F2EA 4LL4B 2GSTA 1A2JA 5CRHA 5ECOB 2N5BA 14GSA 4MDCA 3H8QA 1FAAA 1F9MA 4HZ4A 4NV5A 2FA8A 4K0GA 4KF9A 4ECCA 4GSTA 4ZL8A 1S3DA 3ZIJA 4IP1A 3EYTA 1RQMA 2LS5A 4F03A 4BL7B 1YKAA 2DMMA 5LNKe 2VUPA 2VAFA 1U88A 4IELA 4G0LA 4CW9A 1VF3A 3GX0A 3EINA 1HD2A 1TRUA 1AC1A 4PUAA 2GT6A 1NSWA 4MCUA 3VWUA 4ACSA 4RQRA 1O73A 4BVXB 2HRNA 1ILOA 2DJJA 2PU9C 3RAZA 3D6IA 4K1FA 1SL0B 3ZIVA 1SENA 4LMWA 5AN1A 1T00A 3C8EA 2XC2A 5IM9A 2OE1A 4ECJA 3WT2A 2NTOA 3GNJA 2P5QA 2XBQA 4IJ3A 3TKSE 3CSHA 1V98A 1R5AA 4OFNA 5GSTA 4Q5QA 1XOAA 3EWLA 4BVYB 5IOXA 3BD2A 4PURA 2M72A 2IMIA 4OFTA 3IDVA 5KN1A 3FR9A 2C3TA 1CQHA 6GSWA 4IJIA 3IOSA 1SD8A 1N2AA 3ERWA 3BJ5A 3FRCA 1NHOA 3US3A 4GF0A 1HQOA 5F05A 3LORA 1ZOFA 4IVFA 5GAND 2R5GA 1AQVA 3HDCA 2LKUA 3NOFA 2REMA 4XS4A 1E6BA 3LYKA 4I8BA 2AAWA 3ZREA 2B3SA 5D93A 1B8XA 2VCWA 2M46A 5KN3A 4GQFA 3AY8A 1BG5A 1XPVA 5F07A 2R3XA 5HFIA 4AJ6A 1GSEA 2C1YA 4K7IA 2CT6A 3QAVA 3F4SA 2H0HA 5KEJA 1XFLA 1W4VA 3TKSC 1GL8A 2CAQA 2IWTA 1AQXA 2PPTA 5B6MA 4MZCA 1M2DA 2CA8A 1EV4A 4TR4A 2I9HA 1Z7PA 3F3QA 2AJQB 3HJOA 5ECQB 4ECIA 4FIWA 1QGVA 3JCML 3HKRA 1T1VA 1K0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X99 A;  4MPG A;  1WP0 A;  2WRT A;  5A5K A;  2Z9S A;  2ON5 A;  2VL9 A;  4YQU A;  1R4W A;  1DE1 A;  2FLS A;  3F3R A;  3Q18 A;  4KH7 A;  13GS A;  4ZBD A;  4PQ1 A;  3UMA A;  2HRF A;  3PH9 A;  4JE1 A;  2PMT A;  4HQZ A;  3WD6 A;  4FYC A;  4FYB A;  3KIJ A;  2V6O A;  4OO4 A;  2L5L A;  1K3Y A;  1GUH A;  1U87 A;  1YF0 A;  4I2T A;  2WFC A;  4G19 A;  4AJ7 A;  4NXI A;  3UAR A;  2K9F A;  3PR8 A;  4J2F A;  4AJ8 A;  1V40 A;  3D4M A;  1LBK A;  2PN8 A;  3APQ A;  1R5P A;  5IQY A;  2HZF A;  3EE2 A;  2X64 A;  5JCU A;  1OVN A;  2LQO A;  4X1U A;  4ISD A;  3DD3 A;  4FO5 A;  5IMC A;  1EOH A;  2C8U A;  4L5L A;  4EVM A;  3A2W A;  2B6M A;  2GVP A;  6GST A;  2X8C A;  5LD0 A;  5AIX A;  2DJ3 A;  5GAP D;  1YEX A;  4D73 B;  2PUK C;  1SK2 A;  1R7H A;  2CZ2 A;  2MMA A;  3CRU A;  5C00 A;  2AV4 A;  3QAG A;  1AW9 A;  3RPN A;  1GLQ A;  3HYP A;  5F8B A;  5ECR B;  4IGJ A;  2JZR A;  2OJL A;  1ZCP A;  3LG6 A;  2WUL A;  4QL7 A;  3P2A A;  3ED3 A;  1S3C A;  1JLW A;  4E8H A;  5J3R A;  2CVB A;  4V2M A;  2NDO A;  1GSY A;  3ERG A;  4XS6 A;  1HNA A;  1FW1 A;  5G1K A;  5J9B A;  1SK1 A;  3GUR A;  2WZ9 A;  4L0W A;  3E0U A;  5ECK B;  2KOK A;  3HY2 A;  4WR4 A;  2FNO A;  2YOI A;  5F06 A;  3KCM A;  1OC9 A;  2N5A A;  3NIV A;  3KH7 A;  4HI7 A;  2P5R A;  4Q5F A;  3FY7 A;  3EU4 A;  3FK8 A;  1X9S B;  1PKW A;  2IMK A;  1HYU A;  1T8E B;  1GUK A;  1ZMA A;  5HR3 A;  2VOC A;  5CRE A;  3O6T A;  1K0N A;  2GT5 A;  4TKY A;  4HOJ A;  5INY A;  2OKA A;  2VCZ A;  4HU9 A;  4F82 A;  3M0F A;  4IP6 A;  2NVL A;  1O8X A;  2R4V A;  1DBY A;  2V6K A;  4HDE A;  1TRW A;  4F0B A;  1Z9H A;  3C71 A;  4JBB A;  3GIX A;  3L4N A;  4P3Y B;  4I97 A;  3CSI A;  4PNG A;  3IAS 2;  2QSI A;  1X5E A;  1XWC A;  2KP2 A;  3TKQ A;  1XWA A;  3W8S A;  3VLN A;  3A3T A;  4TXO A;  4JR4 A;  1X9M B;  2OE3 A;  3SWL A;  3DYR A;  3EC3 A;  1I5G A;  4POM A;  5KN0 A;  3DGQ A;  3D4T A;  5A4U A;  5FWG A;  1ERU A;  4NHZ A;  3DXB A;  1GTA A;  1O81 A;  2O7K A;  2DC5 A;  2MBT A;  3MAK A;  1Z6N A;  2FD3 A;  2YV9 A;  3NZN A;  1XWB A;  5CRD A;  1G7O A;  1EGR A;  4ZB9 A;  2X8H A;  3GKM A;  4BWS A;  3L0H A;  1N8J A;  1JZW A;  4I6X A;  4XRA A;  5JCW A;  1UA5 A;  2H01 A;  4TRX A;  5CRG A;  4DSS A;  2AUV A;  2H6Z A;  2H72 A;  4YAP A;  2PVQ A;  3HJP A;  1PD2 1;  1J0F A;  4XS4 B;  5CNW A;  3TJB A;  3N9J A;  3H93 A;  4YAV A;  3C1R A;  2QC7 A;  1AIU A;  3H79 A;  2CX4 A;  2YWI A;  1I9D A;  1A0R P;  3F4R A;  2GLR A;  3KH9 A;  1MDI A;  1THX A;  5AGY A;  1X5D A;  3TJK A;  1QFN A;  3OR5 A;  3HXS A;  4XCS A;  1GWC A;  5GZZ B;  4MZB A;  3Q74 A;  4ZIL A;  1HNC A;  2VCX A;  2RII A;  4KUN A;  2XHF A;  19GS A;  1GSQ A;  1FG4 A;  4PX1 A;  3FEU A;  4F0C A;  1NM3 A;  1PL2 A;  4EKZ A;  4RQX A;  2L6D A;  3KMN A;  3VPT A;  1BJX A;  3R2Q A;  3GST A;  1A23 A;  3DWV A;  3TUE A;  2QKE A;  1TU7 A;  1Z6M A;  1EOG A;  3HVV A;  1M99 A;  1VF1 A;  2AYT A;  2F3M A;  3LJR A;  5A4W A;  2R6K A;  3TRX A;  3VK9 A;  1GSU A;  2R2J A;  3DML A;  2LRC A;  2V1M A;  4EO3 A;  3KP9 A;  4KSO A;  2NPB A;  3FYG A;  2B5X A;  5D73 A;  1C72 A;  3MNG A;  2P31 A;  3TOT A;  3D5J A;  4OMV A;  2LST A;  3C1S A;  1XCC A;  2I4A A;  4OCF A;  5JWQ B;  3ZYW A;  5J5N A;  4NV2 A;  3DRN A;  3ZVJ A;  5EL8 A;  1K0B A;  1XXU A;  3I43 A;  4IBP A;  2GQK A;  2OE0 A;  4TR0 A;  3KGK A;  1QMV A;  1WMJ A;  5D9V A;  1K0M A;  1EP8 A;  2DJ2 A;  1GP1 A;  3HZ8 A;  1GSD A;  1R26 A;  2H1G A;  5COH A;  4LLR A;  3WGE A;  1V58 A;  4POL A;  3KTB A;  4ZB6 A;  4MJB A;  1Z5Y E;  1TP9 A;  4CDO A;  2GS3 A;  2VD0 A;  2FY6 A;  3DEX A;  5GSS A;  1GUM A;  1V2A A;  3RHB A;  5IO2 A;  3G7J A;  1ABA A;  1NHY A;  3K8N A;  3TRQ A;  1V9W A;  2YWO A;  3IAM 2;  5A4V A;  1OC9 B;  1TRS A;  2PER A;  1Z7R A;  2YWM A;  4OFM A;  5ENU A;  3Q6O A;  3HA9 A;  2FA4 A;  2IFQ A;  3KMO A;  2DBC A;  2KLX A;  4TR1 A;  1EEJ A;  1THO A;  4KX4 A;  1ZYQ B;  2TRX A;  1ZZY A;  8GSS A;  4ID0 A;  5D9X A;  1FVK A;  4DEJ A;  1F3B A;  3GKN A;  3IPZ A;  1TJD A;  3ME8 A;  5IMD A;  1QUW A;  2WDU A;  5IOW A;  4WKW A;  2LTK A;  2AB6 A;  2JAC A;  4GSN A;  2GDR A;  3SBC A;  3J7Y b;  1B4Q A;  4N11 A;  1ACV A;  1XW9 A;  2DIY A;  1FO5 A;  5IMF A;  2IIY A;  1XWG A;  4ZBB A;  5C04 A;  2P0G A;  3C7M A;  4YQV A;  3QPM A;  4PQH A;  3ZTL A;  4CHS A;  3GL3 A;  3IK9 A;  5DJM A;  1SK0 A;  3BCI A;  1VF4 A;  2MBS A;  1A2L A;  3CBU A;  2LV3 A;  4POK A;  3UVT A;  2CZ3 A;  4HJM A;  2EC4 A;  5HR2 A;  2RM5 A;  3IA1 A;  1FOV A;  4G2E A;  4FH8 A;  4MJA A;  2VL2 C;  1OC3 A;  1VRS D;  1K3O A;  1TI1 A;  3TKR A;  4HJ2 A;  1T4Y A;  5DVB A;  5E4W A;  1SL2 B;  1TI3 A;  2MMZ A;  3TGZ A;  4DVC A;  1O6J A;  1U6T A;  3GH9 A;  3ZFB A;  4EF0 A;  1KBN A;  3QAW A;  1GH2 A;  4DSS B;  2IPA A;  4ML1 A;  3HCZ A;  3ME7 A;  1OKT A;  2NBS A;  2KP1 A;  1X9W B;  1TK8 B;  4TVE A;  2HLS A;  5J4U A;  4KA0 A;  1PSQ A;  5B8B A;  4HS1 A;  2J23 A;  1EZK A;  4F9Z A;  1TW9 A;  5IPG A;  1UVZ A;  2L4C A;  4YQM A;  2HSH A;  4EC0 A;  3EUR A;  3F63 A;  3IC4 A;  3D0Z A;  4V2L A;  1XW5 A;  1OC8 A;  4WET A;  4HU7 A;  2H73 A;  1O7U A;  1EP7 A;  3RPP A;  4GTU A;  4K6X A;  2GQM A;  5ECN B;  1T3B A;  4NHW A;  1GLP A;  1XBS A;  1AUC A;  2K18 A;  4EDZ A;  2MZC A;  2IL3 A;  4IW9 A;  1WWJ A;  3FZA A;  2N5F A;  4NWY A;  3HZ4 A;  1XWK A;  4EL1 A;  2J9H A;  2ZUP A;  4LL1 B;  1U3I A;  3E3E A;  4GQC A;  2F8A A;  1O8W A;  2EIO A;  6GSU A;  2QGV A;  1WRY A;  3GH6 A;  2TIR A;  2A2R A;  3QDN A;  5DAK A;  1BAY A;  1YY7 A;  5G30 A;  3IXR A;  3M9J A;  1MD3 A;  5F0G A;  1Y6E A;  3LSZ A;  2H0I A;  1XIY A;  2V41 A;  5HQP A;  3HVX A;  9GSS A;  2L59 A;  1M9A A;  3RBT A;  5CRW A;  1JZD A;  1EWX A;  3UIW A;  3VWW A;  5ID2 A;  2MMN A;  5IPH A;  2ZNM A;  3GRX A;  5DBQ A;  3UBL A;  2OA7 A;  4L5O A;  1XW6 A;  3DKS A;  3RHC A;  1XOB A;  2HZE A;  4N30 A;  3GUS A;  5G1L A;  4N0V A;  3CTF A;  4TW5 A;  2YJH A;  2FGX A;  4WBR D;  3IK7 A;  2ES7 A;  6GSS A;  5G5F A;  1Z3E A;  20GS A;  2K8V A;  3APO A;  3H4K A;  2I3Y A;  1B48 A;  10GS A;  1B9Y C;  3U6V A;  1U3A A;  2JL4 A;  2G0F A;  3PGT A;  1BX9 A;  1WIK A;  2RUF A;  5DQY A;  1W89 A;  3DIE A;  1VF2 A;  5J9C A;  5CAX A;  1OKD A;  2KHP A;  5DDL A;  4KDU A;  3VFI A;  4OCE A;  4QQ7 A;  2IFQ B;  1PX7 A;  4TR1 B;  2C4J A;  1B4P A;  4I2U A;  1PA3 A;  3ZVJ D;  2AHE A;  4IHU A;  2FUG 2;  2HT9 A;  4KDX A;  1MTC A;  4YH2 A;  3ZFL A;  2ZCT A;  5IO0 A;  2YV7 A;  2B7J A;  3I9V 2;  3L9S A;  5AIS A;  4PUF C;  1SJI A;  1MEK A;  2RLI A;  3KTL A;  3KEB A;  4ZXG A;  2GSS A;  12GS A;  2V2G A;  4ZBA A;  1PKZ A;  1FVJ A;  1K3L A;  5IMA A;  4J57 E;  2OAC A;  5ELA A;  2L57 A;  3P90 A;  4WXT A;  3TKS A;  22GS A;  1KEB A;  2PVO C;  1ZGN A;  2H8L A;  3G7I A;  5L71 A;  1F3A A;  3TDG A;  2PBJ A;  2R37 A;  3W8J A;  2H19 A;  1O85 A;  4MF6 A;  2HXK A;  1UN2 A;  1A8L A;  2MMO A;  1M9B A;  2DML A;  2KUC A;  2OBI A;  3CSJ A;  2WCI A;  3FR6 A;  3EMP A;  1TTZ A;  4ILF A;  2H66 A;  3EMX A;  1YEP A;  5D9W A;  3APS A;  2BJX A;  4IS0 A;  1SKS B;  3GSS A;  4NAX A;  5DAL A;  2VD1 A;  1XVW A;  4PXO A;  2H70 A;  3E9J B;  1ML6 A;  3ERF A;  2O8V B;  1TU8 A;  2FWE A;  2FWF A;  2GZP A;  1FB6 A;  2DJ1 A;  3F0I A;  3WGX A;  4TOP A;  1TRV A;  3PIN A;  1Q98 A;  3QFA C;  1F37 A;  5E59 A;  3FKF A;  4KND A;  1A2M A;  4PQI A;  4K0N A;  3HVS A;  3VI5 A;  2PGT A;  4OD7 A;  4KE3 A;  3GV1 A;  2JU5 A;  2FWG A;  1FHE A;  1BYE A;  2H75 A;  2I81 A;  1X0R A;  4MMM A;  4O5R A;  2L6C A;  4XRD A;  4Q5R A;  1GTB A;  1M7T A;  4JED A;  2F8F A;  1ZL9 A;  2YN1 A;  2GQL A;  3A5W A;  1T7P B;  3WT1 A;  4HUA A;  2IN3 A;  3F9U A;  1DUG A;  2PWJ A;  4GSS A;  1GSS A;  2K6V A;  2F51 A;  1T4Z A;  1M2A A;  3N5O A;  2C0G A;  4RI6 A;  2G2Q A;  4WF5 A;  4EXJ A;  4XHM A;  2H1B A;  1Y25 A;  2YJ7 A;  17GS A;  3O76 A;  1EV9 A;  2H0G A;  4GRF A;  16GS A;  2CAI A;  1ERV A;  3J7Y k;  4WBJ A;  2B5Y A;  4ECB A;  1TDI A;  2LJA A;  2C80 A;  5DAK B;  4MH2 A;  2YCD A;  1K0C A;  3UL3 A;  6GSV A;  1S3A A;  1JFU A;  2VLU A;  3TCO A;  1TOF A;  4MPF A;  2LQQ A;  3W6G A;  2VIM A;  2WS2 A;  3KM6 A;  3P7X A;  5DQS A;  1DSB A;  2DLX A;  1NW2 A;  5ECH B;  7GSS A;  4MK3 A;  5ID2 B;  4O7H A;  1SKR B;  2LNT A;  4IN0 A;  2CX3 A;  2O89 A;  1YJ6 A;  4I5Q A;  2HZE B;  3P8W A;  1AAZ A;  3VPQ A;  4TN8 A;  3GMF A;  3D22 A;  2DIZ A;  5ELG A;  2ON7 A;  4JR6 A;  1GUL A;  3LEF A;  2HE3 A;  1Q4J A;  4TR3 A;  1OAZ A;  4BA7 A;  1IYI A;  4HEA 2;  2C0F A;  2YP6 A;  2WJU A;  2VLV A;  4K7N A;  2D2Z A;  5B7C A;  3GFK A;  4MF7 A;  1V57 A;  5EVO A;  1G0T A;  3F6D A;  3O3T A;  4LA1 A;  4MAB A;  4J56 E;  3WGD A;  3GX8 A;  4Q5N A;  4ZB8 A;  2H74 A;  3QOU A;  1ERT A;  1MDJ A;  2LRT A;  4X43 A;  2GZZ A;  4WEY A;  1EGO A;  2E0Q A;  2B1K A;  2YWN A;  3LXZ A;  4TXO B;  3TOU A;  1LU4 A;  3HHV A;  2HYX A;  2LJK A;  1YF1 A;  4GCI A;  1KTE A;  5B8A A;  5ECM B;  4DSQ A;  2FWH A;  3GTU A;  2C0D A;  1PQN A;  3ZL5 A;  4KAE A;  4JRR A;  4KB3 A;  2IMD A;  3BOA A;  4POB A;  2H76 A;  1H75 A;  5D8I A;  4ML6 A;  3A2X A;  4ULX A;  4XIH A;  4TXV A;  2JSY A;  1ERW A;  3TRP A;  1OYJ A;  4V1A g;  2RM6 A;  1UC7 A;  1DE2 A;  2GSR A;  3TKP A;  1GTU A;  1OE8 A;  1PX6 A;  3LYP A;  3FZ9 A;  4NPB A;  1QXH A;  2VCT A;  3IHQ A;  3IR4 A;  2EIQ A;  4GLT A;  1GTI A;  4BPY A;  4GXZ A;  4MLY A;  3UVH A;  5G2Z A;  4MJC A;  3ZMK A;  5DCG A;  1SJZ A;  3KZQ A;  1H4O A;  2H71 A;  5JCG A;  4X0X A;  1WJK A;  2LJR A;  3IRA A;  4OO5 A;  4MA9 A;  3CTG A;  3VUR A;  1SYX A;  2WGR A;  2A4V A;  4IQA A;  1A0F A;  1SJ6 A;  3EVI A;  2BMX A;  3I6A A;  1QQ2 A;  5DAL B;  2L5O A;  3LXT A;  2YZH A;  2B1L A;  3M8N A;  3DVX A;  4RUV A;  3M3M A;  3QFB C;  3G9B A;  5JWR B;  1PMT A;  1JHB A;  5IIZ A;  2GSQ A;  2VCQ A;  5CP1 A;  2H1D A;  5HR0 A;  3ZLP A;  18GS A;  4MP4 A;  3CYN A;  5EY6 A;  1SKW B;  4K7O A;  1WPI A;  1AXD A;  2XBI A;  5CO3 A;  3LQ7 A;  5JWO B;  2EIR A;  4G10 A;  4NMU A;  1ON4 A;  3QMX A;  5DJL A;  5EPF A;  3ZIT A;  1K0O A;  5D9T A;  3CMI A;  2YNX A;  1CQG A;  3IE3 A;  4EDY A;  4MJE A;  3QD9 A;  5D96 A;  1RK4 A;  5B6N A;  1YDK A;  1E2Y A;  4WR5 A;  3VWV A;  3KJY A;  4WF4 A;  3VI7 A;  1B9X C;  1RW1 A;  3F6F A;  3MWH A;  6GSY A;  4N10 A;  2MYG A;  3BCK A;  3RDW A;  4L0U A;  1SD9 A;  2H1A A;  2CVD A;  5HFK A;  2O85 A;  1G7E A;  4E8E A;  1URM A;  2H6Y A;  2F9S A;  3UAP A;  4KCA A;  4BL7 A;  4IKH A;  11GS A;  3Q19 A;  3TJG A;  4G9H A;  3CXG A;  1GRX A;  4ZL9 A;  6GSX A;  4EUY A;  3G7Y A;  2LEG A;  2VCV A;  5AIV A;  3UJ1 A;  1JZO A;  3F4T A;  3FZ5 A;  1G6Y A;  2B5E A;  5ECL B;  1LJR A;  4BVX A;  3F8U A;  3MDK A;  1K0A A;  5ABR A;  4EE0 A;  1USB A;  1YKC A;  4N0Z A;  1PL1 A;  4MH3 A;  4KW6 A;  3L78 A;  5G31 A;  2VM1 A;  3FW2 A;  1KNG A;  1J08 A;  4F2I A;  3KD0 A;  2YPM A;  3QR6 A;  1TK5 B;  2X8G A;  2JZS A;  3QCP A;  4BVY A;  1OE7 A;  3M1G A;  1YQ1 A;  1SU9 A;  3FZ4 A;  4PNF A;  3FHK A;  5G5E A;  2XPE A;  1A8Y A;  4KSM A;  2TRC P;  2JAD A;  5ECS A;  3GHA A;  2DSA A;  5HR1 A;  3WYW A;  1GNW A;  2GGT A;  3GKK A;  2CV4 A;  5FT3 A;  2IME A;  5ECP B;  1TXX A;  1IYH A;  4K9Z A;  2DJ0 A;  1TK0 B;  3V1W A;  1AQW A;  5ECI B;  4AGS A;  2E2G A;  2YZU A;  1M2B A;  4Z7X A;  5IMZ A;  2VL2 A;  4JU5 A;  2GZY A;  5HFG A;  1QK8 A;  3GL5 A;  1A24 A;  2LUS A;  5DCH A;  2GTU A;  1GSF A;  1TKD B;  2LNS A;  3BBY A;  4OWY A;  2CVK A;  4FYU A;  4DSR A;  3GTU B;  4AF2 A;  4K8M A;  3TJJ A;  3A2V A;  2ALB A;  5H5S A;  4V1A p;  1YZX A;  2O87 A;  1M0U A;  3UBK A;  4L8E A;  3UOM A;  2IMF A;  4RI7 A;  2I1U A;  1X5C A;  3L9U A;  4LMV A;  3ZZX A;  2H6X A;  1ST9 A;  2HSY A;  3GN3 A;  3I69 A;  2A2S A;  4PGT A;  2RUE A;  4BWQ A;  4H86 A;  3DVW A;  1PN9 A;  2WB9 A;  4ZL7 A;  2VL3 A;  3MSZ A;  3LGC A;  3CRT A;  5KN2 A;  5IMV A;  2LRN A;  2L4Q A;  2IJY A;  1GNE A;  3C73 A;  1BQ7 A;  3LFL A;  3EU3 A;  1XZO A;  4MF5 A;  1F6M C;  2OAD A;  3GKX A;  3GA4 A;  1JZR A;  4HQS A;  1XVQ A;  1WOU A;  1BED A;  2HI7 A;  3H1N A;  2YAN A;  4XS1 A;  3D21 A;  3ZML A;  2VO4 A;  4O92 A;  3M9K A;  3IV4 A;  1VGL A;  1J9B A;  4ZIJ A;  3VWX A;  2VM2 A;  2OBK A;  4O32 A;  4QL9 A;  1JLV A;  4JZQ A;  2C3N A;  1HNB A;  3ZRD A;  1ZYE A;  4XTS A;  1SL1 B;  4K2D A;  3KP8 A;  2BTO T;  1WE0 A;  2DJK A;  2E2M A;  4D73 A;  3LWA A;  2V32 A;  1SYR A;  2FCH A;  5J41 A;  3ISO A;  2JSZ A;  3GYK A;  3FR3 A;  1G6W A;  1PGT A;  3IBH A;  1MD4 A;  2CQ9 A;  2C3Q A;  3TJF A;  2C0E A;  3U5R E;  4HZ2 A;  2JZT A;  2HNL A;  2M80 A;  5H5R A;  4IQ1 A;  3TB2 A;  4GWR A;  4KCE A;  5CYY A;  2HFD A;  2FHE A;  2B7K A;  3UEM A;  5H5Q A;  1EEM A;  1PRX A;  3L9V A;  4KDY A;  3S9F A;  5LCZ A;  3KXO A;  2VLT A;  4KGI A;  1MDK A;  4MZW A;  2XPD A;  3HJM A;  2E7P A;  4V2N A;  2K8S A;  2H30 A;  3HD5 A;  5FHI A;  1FB0 A;  1F2E A;  4LL4 B;  2GST A;  1A2J A;  5CRH A;  5ECO B;  2N5B A;  14GS A;  4MDC A;  3H8Q A;  1FAA A;  1F9M A;  4HZ4 A;  4NV5 A;  2FA8 A;  4K0G A;  4ECC A;  4GST A;  4ZL8 A;  1S3D A;  3ZIJ A;  4IP1 A;  3EYT A;  1RQM A;  2LS5 A;  4F03 A;  1YKA A;  2DMM A;  5LNK e;  2VUP A;  2VAF A;  1U88 A;  4IEL A;  4CW9 A;  1VF3 A;  3GX0 A;  3EIN A;  1HD2 A;  1TRU A;  1AC1 A;  4PUA A;  2GT6 A;  1NSW A;  4MCU A;  3VWU A;  4ACS A;  4RQR A;  1O73 A;  2HRN A;  1ILO A;  2DJJ A;  2PU9 C;  3RAZ A;  3D6I A;  4K1F A;  1SL0 B;  3ZIV A;  1SEN A;  4LMW A;  5AN1 A;  1T00 A;  3C8E A;  2XC2 A;  5IM9 A;  2OE1 A;  4ECJ A;  3WT2 A;  2NTO A;  3GNJ A;  2P5Q A;  2XBQ A;  4IJ3 A;  3TKS E;  3CSH A;  1V98 A;  1R5A A;  4OFN A;  5GST A;  4Q5Q A;  1XOA A;  3EWL A;  5IOX A;  3BD2 A;  4PUR A;  2M72 A;  2IMI A;  4OFT A;  3IDV A;  5KN1 A;  3FR9 A;  2C3T A;  1CQH A;  6GSW A;  4IJI A;  3IOS A;  1SD8 A;  1N2A A;  3ERW A;  3BJ5 A;  3FRC A;  1NHO A;  3US3 A;  4GF0 A;  1HQO A;  5F05 A;  3LOR A;  1ZOF A;  4IVF A;  5GAN D;  2R5G A;  1AQV A;  3HDC A;  2LKU A;  3NOF A;  2REM A;  4XS4 A;  1E6B A;  3LYK A;  4I8B A;  2AAW A;  3ZRE A;  2B3S A;  5D93 A;  1B8X A;  2VCW A;  2M46 A;  5KN3 A;  4GQF A;  3AY8 A;  1BG5 A;  1XPV A;  5F07 A;  2R3X A;  5HFI A;  4AJ6 A;  1GSE A;  2C1Y A;  4K7I A;  2CT6 A;  3QAV A;  3F4S A;  2H0H A;  5KEJ A;  1XFL A;  1W4V A;  3TKS C;  1GL8 A;  2CAQ A;  2IWT A;  1AQX A;  2PPT A;  5B6M A;  4MZC A;  1M2D A;  2CA8 A;  1EV4 A;  4TR4 A;  2I9H A;  1Z7P A;  3F3Q A;  2AJQ B;  3HJO A;  5ECQ B;  4ECI A;  4FIW A;  1QGV A;  3JCM L;  3HKR A;  1T1V A;  1K0D A; 
#chains in the Genus database with same CATH topology
 2X99 A;  4MPG A;  1WP0 A;  2WRT A;  5A5K A;  2Z9S A;  2ON5 A;  2VL9 A;  4YQU A;  1R4W A;  1XG8 A;  1DE1 A;  2FLS A;  3F3R A;  3Q18 A;  4KH7 A;  13GS A;  4ZBD A;  4PQ1 A;  3UMA A;  2HRF A;  3PH9 A;  4JE1 A;  2PMT A;  2UZ8 A;  4HQZ A;  3WD6 A;  4FYC A;  4FYB A;  3KIJ A;  2V6O A;  4OO4 A;  2L5L A;  1K3Y A;  1GUH A;  1U87 A;  1YF0 A;  4I2T A;  2WFC A;  4G19 A;  4AJ7 A;  4NXI A;  3UAR A;  2K9F A;  3PR8 A;  4J2F A;  4AJ8 A;  1V40 A;  3D4M A;  1LBK A;  2PN8 A;  3APQ A;  1R5P A;  3R3E A;  5IQY A;  2HZF A;  3EE2 A;  2X64 A;  5JCU A;  1OVN A;  2LQO A;  4X1U A;  4ISD A;  3DD3 A;  4FO5 A;  5IMC A;  1EOH A;  2C8U A;  4L5L A;  4EVM A;  3A2W A;  2B6M A;  2GVP A;  6GST A;  2X8C A;  5LD0 A;  5AIX A;  2DJ3 A;  5GAP D;  1YEX A;  4D73 B;  2PUK C;  1SK2 A;  1R7H A;  2CZ2 A;  2MMA A;  3CRU A;  5C00 A;  2AV4 A;  3QAG A;  1AW9 A;  3RPN A;  1GLQ A;  3HYP A;  5F8B A;  5ECR B;  4IGJ A;  2JZR A;  2OJL A;  1ZCP A;  3LG6 A;  2WUL A;  4QL7 A;  3P2A A;  3ED3 A;  1S3C A;  1JLW A;  4E8H A;  5J3R A;  2CVB A;  4G0K A;  4V2M A;  2NDO A;  1GSY A;  3ERG A;  4XS6 A;  1HNA A;  1FW1 A;  5G1K A;  5J9B A;  1SK1 A;  3GUR A;  2WZ9 A;  4L0W A;  3E0U A;  5ECK B;  2KOK A;  3HY2 A;  4WR4 A;  2FNO A;  2YOI A;  5F06 A;  3KCM A;  1OC9 A;  2N5A A;  3NIV A;  2R0P A;  3KH7 A;  4HI7 A;  2P5R A;  4Q5F A;  3FY7 A;  3EU4 A;  3FK8 A;  1X9S B;  1PKW A;  2IMK A;  1HYU A;  1T8E B;  1GUK A;  1ZMA A;  5HR3 A;  2VOC A;  5CRE A;  3O6T A;  1K0N A;  2GT5 A;  4TKY A;  4PTS A;  4HOJ A;  5INY A;  2OKA A;  4Z2U A;  2VCZ A;  4HU9 A;  4F82 A;  3M0F A;  4IP6 A;  2NVL A;  1O8X A;  2R4V A;  1DBY A;  2V6K A;  4HDE A;  1TRW A;  4F0B A;  1Z9H A;  3C71 A;  4JBB A;  3GIX A;  3L4N A;  4P3Y B;  4I97 A;  3CSI A;  4PNG A;  3IAS 2;  2QSI A;  1X5E A;  1XWC A;  2KP2 A;  3TKQ A;  1XWA A;  3W8S A;  3VLN A;  3A3T A;  4TXO A;  4JR4 A;  1X9M B;  2OE3 A;  3SWL A;  3DYR A;  3EC3 A;  1I5G A;  4POM A;  5KN0 A;  3DGQ A;  3D4T A;  5A4U A;  5FWG A;  1ERU A;  4NHZ A;  3DXB A;  1GTA A;  1O81 A;  2O7K A;  2DC5 A;  2MBT A;  3MAK A;  1Z6N A;  2FD3 A;  2YV9 A;  3NZN A;  1XWB A;  5CRD A;  1G7O A;  1EGR A;  4ZB9 A;  2X8H A;  3GKM A;  4BWS A;  3L0H A;  1N8J A;  2X4A A;  1JZW A;  4I6X A;  4XRA A;  5JCW A;  1UA5 A;  2H01 A;  4TRX A;  5CRG A;  4DSS A;  3MYD A;  2HSM A;  2AUV A;  2H6Z A;  4USS A;  2H72 A;  4YAP A;  2PVQ A;  3HJP A;  1PD2 1;  1J0F A;  4XS4 B;  5CNW A;  3TJB A;  3N9J A;  3H93 A;  4YAV A;  3C1R A;  2QC7 A;  1AIU A;  3H79 A;  2CX4 A;  2YWI A;  1I9D A;  1A0R P;  4X4J A;  3F4R A;  2GLR A;  3KH9 A;  1MDI A;  1THX A;  5AGY A;  1X5D A;  3TJK A;  1QFN A;  3OR5 A;  3HXS A;  4XCS A;  1GWC A;  5GZZ B;  4MZB A;  3Q74 A;  4ZIL A;  1HNC A;  2VCX A;  2RII A;  4KUN A;  2XHF A;  19GS A;  1GSQ A;  1FG4 A;  4PX1 A;  3FEU A;  4F0C A;  1NM3 A;  1PL2 A;  4EKZ A;  4RQX A;  2L6D A;  3KMN A;  3VPT A;  1BJX A;  3R2Q A;  3GST A;  1A23 A;  3DWV A;  3TUE A;  2QKE A;  1TU7 A;  1Z6M A;  1EOG A;  3HVV A;  1M99 A;  1VF1 A;  2AYT A;  2F3M A;  3LJR A;  5A4W A;  2R6K A;  3TRX A;  3VK9 A;  1GSU A;  2R2J A;  3DML A;  2LRC A;  2V1M A;  4EO3 A;  3KP9 A;  4KSO A;  2NPB A;  3FYG A;  2B5X A;  5D73 A;  1C72 A;  3MNG A;  2P31 A;  3TOT A;  3D5J A;  4OMV A;  2LST A;  3C1S A;  1XCC A;  2I4A A;  4OCF A;  5JWQ B;  3ZYW A;  5J5N A;  4NV2 A;  3DRN A;  3ZVJ A;  5EL8 A;  1K0B A;  1XXU A;  3I43 A;  4IBP A;  2GQK A;  2OE0 A;  4TR0 A;  3KGK A;  1QMV A;  1WMJ A;  5D9V A;  1K0M A;  1EP8 A;  2DJ2 A;  1GP1 A;  4BIK A;  3HZ8 A;  1GSD A;  1R26 A;  2H1G A;  5COH A;  4LLR A;  3WGE A;  1V58 A;  1S3R A;  4POL A;  3KTB A;  4ZB6 A;  4MJB A;  1Z5Y E;  1TP9 A;  4CDO A;  2GS3 A;  2VD0 A;  2FY6 A;  3DEX A;  5GSS A;  1GUM A;  1V2A A;  3RHB A;  5IO2 A;  3MIX A;  3G7J A;  1ABA A;  1NHY A;  3K8N A;  3TRQ A;  4EIQ A;  1V9W A;  2X49 A;  2YWO A;  3IAM 2;  5A4V A;  1OC9 B;  1TRS A;  2PER A;  1Z7R A;  2YWM A;  4OFM A;  5ENU A;  3Q6O A;  3HA9 A;  2FA4 A;  2IFQ A;  3KMO A;  2DBC A;  2KLX A;  3IC8 A;  4TR1 A;  1EEJ A;  1THO A;  4KX4 A;  1ZYQ B;  2TRX A;  1ZZY A;  8GSS A;  4ID0 A;  5D9X A;  1FVK A;  4DEJ A;  1F3B A;  3GKN A;  3IPZ A;  1TJD A;  3ME8 A;  5IMD A;  1QUW A;  2WDU A;  5IOW A;  4WKW A;  2LTK A;  2AB6 A;  2JAC A;  4GSN A;  2GDR A;  3SBC A;  3J7Y b;  1B4Q A;  4N11 A;  1ACV A;  1XW9 A;  2DIY A;  4K5S A;  1FO5 A;  5IMF A;  2IIY A;  1XWG A;  4ZBB A;  5C04 A;  2P0G A;  3C7M A;  4YQV A;  3QPM A;  4PQH A;  3ZTL A;  4CHS A;  3GL3 A;  3IK9 A;  5DJM A;  1SK0 A;  3BCI A;  1VF4 A;  2MBS A;  1A2L A;  3CBU A;  2LV3 A;  4POK A;  3UVT A;  2CZ3 A;  4HJM A;  2EC4 A;  5HR2 A;  2RM5 A;  1ZYN A;  4EIP A;  3IA1 A;  2DKH A;  1FOV A;  4G2E A;  4Z2T A;  1PN0 A;  4FH8 A;  4MJA A;  2VL2 C;  1OC3 A;  1VRS D;  1K3O A;  1TI1 A;  3TKR A;  4HJ2 A;  1T4Y A;  5DVB A;  5E4W A;  1SL2 B;  1TI3 A;  2MMZ A;  3TGZ A;  4DVC A;  1O6J A;  1U6T A;  3GH9 A;  3ZFB A;  4EF0 A;  1KBN A;  3QAW A;  1GH2 A;  4DSS B;  2IPA A;  4ML1 A;  3HCZ A;  3ME7 A;  1OKT A;  2NBS A;  2KP1 A;  1X9W B;  1TK8 B;  4TVE A;  2HLS A;  5J4U A;  4KA0 A;  1PSQ A;  5B8B A;  4HS1 A;  2J23 A;  1EZK A;  4F9Z A;  1TW9 A;  5IPG A;  1UVZ A;  2L4C A;  4YQM A;  1M3J A;  2HSH A;  4O5Q A;  4EC0 A;  3EUR A;  3F63 A;  3IC4 A;  3D0Z A;  4V2L A;  1XW5 A;  1OC8 A;  4WET A;  4HU7 A;  2H73 A;  1O7U A;  1EP7 A;  3RPP A;  4GTU A;  4K6X A;  2GQM A;  5ECN B;  1T3B A;  4NHW A;  1GLP A;  1XBS A;  1AUC A;  4O5U A;  2K18 A;  4EDZ A;  2MZC A;  2IL3 A;  4IW9 A;  1WWJ A;  3FZA A;  2N5F A;  4NWY A;  3HZ4 A;  1XWK A;  4EL1 A;  2J9H A;  2ZUP A;  4K5R A;  3PPU A;  4LL1 B;  1U3I A;  3E3E A;  4GQC A;  2F8A A;  1O8W A;  2EIO A;  6GSU A;  2QGV A;  1WRY A;  3GH6 A;  2TIR A;  2A2R A;  3QDN A;  5DAK A;  1BAY A;  1YY7 A;  5G30 A;  3IXR A;  3M9J A;  1MD3 A;  5F0G A;  1Y6E A;  3LSZ A;  2H0I A;  1XIY A;  2V41 A;  5HQP A;  3HVX A;  9GSS A;  2L59 A;  1M9A A;  3RBT A;  5CRW A;  1JZD A;  1EWX A;  3CQF A;  3UIW A;  3VWW A;  5ID2 A;  2MMN A;  5IPH A;  2ZNM A;  3GRX A;  5DBQ A;  3UBL A;  2OA7 A;  4L5O A;  1XW6 A;  3DKS A;  3RHC A;  1XOB A;  2HZE A;  4N30 A;  3LW9 A;  3GUS A;  5G1L A;  4YKG A;  4N0V A;  3CTF A;  4TW5 A;  2YJH A;  2FGX A;  4WBR D;  3IK7 A;  2ES7 A;  2R0G A;  6GSS A;  5G5F A;  1Z3E A;  20GS A;  4K2X A;  2K8V A;  3APO A;  3H4K A;  2I3Y A;  1B48 A;  10GS A;  1B9Y C;  3U6V A;  1U3A A;  2HRA A;  2JL4 A;  2G0F A;  3PGT A;  1BX9 A;  1WIK A;  2RUF A;  5DQY A;  1W89 A;  3DIE A;  1VF2 A;  5J9C A;  5CAX A;  1OKD A;  2KHP A;  5DDL A;  4KDU A;  3VFI A;  4OCE A;  4QQ7 A;  4A5P A;  2IFQ B;  1PX7 A;  4TR1 B;  2C4J A;  1B4P A;  4I2U A;  1PA3 A;  3ZVJ D;  2AHE A;  4IHU A;  2FUG 2;  2HT9 A;  4KDX A;  1MTC A;  4YH2 A;  3ZFL A;  2ZCT A;  5IO0 A;  2YV7 A;  3HVN A;  2B7J A;  3I9V 2;  3L9S A;  5AIS A;  4ICY A;  4PUF C;  1SJI A;  3FMW A;  1MEK A;  2RLI A;  3KTL A;  3KEB A;  4ZXG A;  2GSS A;  12GS A;  2V2G A;  4ZBA A;  1PKZ A;  1FVJ A;  1K3L A;  5IMA A;  4J57 E;  2OAC A;  5ELA A;  2L57 A;  3P90 A;  4WXT A;  3TKS A;  22GS A;  1KEB A;  2PVO C;  1ZGN A;  2H8L A;  3G7I A;  5L71 A;  1F3A A;  3TDG A;  2PBJ A;  2R37 A;  3W8J A;  2H19 A;  1O85 A;  4MF6 A;  2HXK A;  1UN2 A;  1A8L A;  2MMO A;  1M9B A;  1ZYP A;  2DML A;  2KUC A;  2OBI A;  3CSJ A;  2WCI A;  3FR6 A;  3EMP A;  1TTZ A;  4ILF A;  2H66 A;  3EMX A;  1YEP A;  5D9W A;  3APS A;  2BJX A;  4IS0 A;  1SKS B;  3GSS A;  4NAX A;  5DAL A;  2VD1 A;  1XVW A;  4PXO A;  2H70 A;  3E9J B;  1ML6 A;  3ERF A;  2O8V B;  1TU8 A;  2FWE A;  2FWF A;  2GZP A;  1FB6 A;  2DJ1 A;  3F0I A;  3WGX A;  4TOP A;  1TRV A;  4YKF A;  3PIN A;  3EPT A;  1Q98 A;  3QFA C;  1F37 A;  5E59 A;  3FKF A;  4KND A;  1A2M A;  4PQI A;  4K0N A;  3HVS A;  3VI5 A;  2PGT A;  4OD7 A;  4KE3 A;  3GV1 A;  2JU5 A;  2FWG A;  1FHE A;  1BYE A;  2H75 A;  2I81 A;  1X0R A;  4MMM A;  4O5R A;  2L6C A;  4XRD A;  4Q5R A;  1GTB A;  1M7T A;  4JED A;  2F8F A;  1ZL9 A;  2YN1 A;  2GQL A;  3A5W A;  1PFO A;  1T7P B;  3WT1 A;  4HUA A;  2IN3 A;  3F9U A;  1DUG A;  2PWJ A;  4GSS A;  1GSS A;  2K6V A;  2F51 A;  1T4Z A;  1M2A A;  3N5O A;  2C0G A;  4RI6 A;  2G2Q A;  4WF5 A;  4EXJ A;  4XHM A;  2H1B A;  1Y25 A;  2YJ7 A;  17GS A;  3O76 A;  1EV9 A;  2H0G A;  4GRF A;  16GS A;  2CAI A;  1ERV A;  3J7Y k;  4WBJ A;  2B5Y A;  4ECB A;  1TDI A;  2LJA A;  4G0I A;  2C80 A;  2A2P A;  5DAK B;  4MH2 A;  2YCD A;  1K0C A;  3UL3 A;  6GSV A;  1S3A A;  1JFU A;  2VLU A;  3TCO A;  1TOF A;  4MPF A;  2LQQ A;  3W6G A;  2VIM A;  2WS2 A;  3KM6 A;  3P7X A;  5DQS A;  1DSB A;  2DLX A;  1NW2 A;  5ECH B;  7GSS A;  4MK3 A;  5ID2 B;  4O7H A;  1SKR B;  2LNT A;  4IN0 A;  2CX3 A;  2O89 A;  1YJ6 A;  4I5Q A;  2HZE B;  3P8W A;  1AAZ A;  3VPQ A;  4TN8 A;  3GMF A;  3D22 A;  2DIZ A;  5ELG A;  2ON7 A;  4JR6 A;  1GUL A;  3LEF A;  2HE3 A;  1Q4J A;  4TR3 A;  1OAZ A;  4BA7 A;  1IYI A;  4HEA 2;  2C0F A;  2YP6 A;  2WJU A;  2VLV A;  4K7N A;  2D2Z A;  5B7C A;  3GFK A;  4MF7 A;  1V57 A;  5KOW A;  5EVO A;  1G0T A;  3F6D A;  3O3T A;  4LA1 A;  4MAB A;  4J56 E;  3WGD A;  3GX8 A;  4Q5N A;  4ZB8 A;  2H74 A;  2DKI A;  3QOU A;  1ERT A;  1MDJ A;  2LRT A;  4X43 A;  2GZZ A;  4WEY A;  1EGO A;  2E0Q A;  2B1K A;  4TXO B;  2YWN A;  3LXZ A;  3TOU A;  1LU4 A;  3HHV A;  2HYX A;  2QA1 A;  2LJK A;  1YF1 A;  4GCI A;  1KTE A;  5B8A A;  5ECM B;  4DSQ A;  2FWH A;  3GTU A;  2C0D A;  1PQN A;  3ZL5 A;  4KAE A;  4CY8 A;  4JRR A;  4KB3 A;  2IMD A;  3BOA A;  4POB A;  2H76 A;  1H75 A;  5D8I A;  4ML6 A;  3A2X A;  4ULX A;  4XIH A;  4TXV A;  2JSY A;  1ERW A;  3TRP A;  1OYJ A;  4V1A g;  2RM6 A;  1UC7 A;  1DE2 A;  2GSR A;  3TKP A;  1GTU A;  1OE8 A;  1PX6 A;  3LYP A;  3FZ9 A;  4NPB A;  1QXH A;  2VCT A;  3IHQ A;  3IR4 A;  2EIQ A;  4GLT A;  1GTI A;  4BPY A;  4GXZ A;  4MLY A;  3UVH A;  5G2Z A;  4MJC A;  3ZMK A;  5DCG A;  1SJZ A;  3KZQ A;  1H4O A;  2H71 A;  5JCG A;  4X0X A;  1WJK A;  2LJR A;  3IRA A;  4OO5 A;  4MA9 A;  3CTG A;  3VUR A;  1SYX A;  2WGR A;  2A4V A;  4IQA A;  1A0F A;  1SJ6 A;  3EVI A;  2BMX A;  2QA2 A;  3I6A A;  1QQ2 A;  5DAL B;  2L5O A;  3LXT A;  2YZH A;  2B1L A;  3M8N A;  3DVX A;  4RUV A;  2HRK A;  3M3M A;  3QFB C;  3G9B A;  5JWR B;  1PMT A;  1JHB A;  5IIZ A;  2GSQ A;  2VCQ A;  5CP1 A;  2H1D A;  5HR0 A;  3ZLP A;  18GS A;  4MP4 A;  3CYN A;  5EY6 A;  1SKW B;  4K7O A;  1WPI A;  1AXD A;  2XBI A;  5CO3 A;  3LQ7 A;  5JWO B;  2EIR A;  4G10 A;  4NMU A;  1ON4 A;  3QMX A;  5DJL A;  5EPF A;  3ZIT A;  1K0O A;  5D9T A;  3CMI A;  2YNX A;  1CQG A;  3IE3 A;  4EDY A;  4MJE A;  3QD9 A;  5D96 A;  1RK4 A;  5B6N A;  1YDK A;  1E2Y A;  4WR5 A;  3VWV A;  3KJY A;  4WF4 A;  3VI7 A;  5KOX A;  1B9X C;  1RW1 A;  3F6F A;  3MWH A;  4CY6 A;  6GSY A;  4N10 A;  2MYG A;  3BCK A;  3RDW A;  4L0U A;  1SD9 A;  2H1A A;  2CVD A;  5HFK A;  2O85 A;  1G7E A;  4E8E A;  1URM A;  2H6Y A;  2F9S A;  3UAP A;  4KCA A;  4BL7 A;  4IKH A;  11GS A;  3Q19 A;  3TJG A;  4G9H A;  3CXG A;  1GRX A;  4ZL9 A;  6GSX A;  4EUY A;  3G7Y A;  2LEG A;  2VCV A;  5AIV A;  3UJ1 A;  1JZO A;  3F4T A;  3FZ5 A;  1G6Y A;  2B5E A;  5ECL B;  1LJR A;  4BVX A;  3F8U A;  3MDK A;  1K0A A;  5ABR A;  4EE0 A;  1USB A;  1YKC A;  4N0Z A;  1PL1 A;  4MH3 A;  4KW6 A;  3L78 A;  5G31 A;  2VM1 A;  3FW2 A;  1KNG A;  1J08 A;  4F2I A;  3KD0 A;  2YPM A;  3QR6 A;  1TK5 B;  2X8G A;  2JZS A;  3QCP A;  4BVY A;  1OE7 A;  3M1G A;  1YQ1 A;  1SU9 A;  3IHG A;  3FZ4 A;  4PNF A;  3FHK A;  3A5I A;  5G5E A;  2XPE A;  1A8Y A;  4KSM A;  2TRC P;  2JAD A;  5ECS A;  3GHA A;  2DSA A;  5HR1 A;  3WYW A;  1GNW A;  2GGT A;  3GKK A;  2CV4 A;  5FT3 A;  2IME A;  5ECP B;  1TXX A;  1IYH A;  4K9Z A;  5BRT A;  2DJ0 A;  1TK0 B;  3V1W A;  1AQW A;  5ECI B;  4AGS A;  2E2G A;  2YZU A;  1M2B A;  4Z7X A;  5IMZ A;  2VL2 A;  4JU5 A;  2GZY A;  5HFG A;  1QK8 A;  3GL5 A;  1A24 A;  2LUS A;  5DCH A;  2GTU A;  1GSF A;  1TKD B;  2LNS A;  3BBY A;  4OWY A;  2CVK A;  4FYU A;  4DSR A;  3GTU B;  4AF2 A;  4HSC X;  4K8M A;  3TJJ A;  3A2V A;  2ALB A;  5H5S A;  4V1A p;  1YZX A;  2O87 A;  1M0U A;  3UBK A;  4L8E A;  3UOM A;  2IMF A;  4FQU A;  4RI7 A;  2I1U A;  1X5C A;  3L9U A;  4LMV A;  3ZZX A;  2H6X A;  1ST9 A;  2HSY A;  3GN3 A;  3I69 A;  2A2S A;  4PGT A;  2RUE A;  4BWQ A;  2R0C A;  4H86 A;  3DVW A;  1PN9 A;  2WB9 A;  4ZL7 A;  2A4H A;  2VL3 A;  3MSZ A;  3LGC A;  3CRT A;  5KN2 A;  5IMV A;  2LRN A;  2L4Q A;  2IJY A;  1GNE A;  3C73 A;  1BQ7 A;  3LFL A;  3EU3 A;  1XZO A;  4MF5 A;  1F6M C;  2OAD A;  3GKX A;  3GA4 A;  1JZR A;  4HQS A;  1XVQ A;  1WOU A;  1BED A;  2HI7 A;  3H1N A;  2YAN A;  4XS1 A;  3D21 A;  1FOH A;  3ZML A;  2VO4 A;  4O92 A;  3M9K A;  3IV4 A;  1VGL A;  1J9B A;  4ZIJ A;  3VWX A;  2VM2 A;  2OBK A;  4O32 A;  4QL9 A;  1JLV A;  4JZQ A;  2C3N A;  1HNB A;  3ZRD A;  1ZYE A;  4XTS A;  1SL1 B;  4K2D A;  3KP8 A;  2BTO T;  1WE0 A;  2DJK A;  2E2M A;  4Z2R A;  4D73 A;  3LWA A;  2V32 A;  1SYR A;  2FCH A;  5J41 A;  3ISO A;  2JSZ A;  3GYK A;  3FR3 A;  1G6W A;  1PGT A;  3IBH A;  1MD4 A;  2CQ9 A;  2C3Q A;  3TJF A;  2C0E A;  3U5R E;  4HZ2 A;  2JZT A;  2HNL A;  2M80 A;  5H5R A;  4IQ1 A;  3TB2 A;  4GWR A;  4KCE A;  4MNN A;  5CYY A;  2HFD A;  2FHE A;  2B7K A;  3UEM A;  5H5Q A;  1EEM A;  1PRX A;  3L9V A;  4KDY A;  3S9F A;  5LCZ A;  3KXO A;  2VLT A;  4KGI A;  1MDK A;  4MZW A;  2XPD A;  3HJM A;  2E7P A;  4V2N A;  2K8S A;  2H30 A;  5BMU A;  3HD5 A;  5FHI A;  1FB0 A;  1F2E A;  4LL4 B;  2GST A;  1A2J A;  5CRH A;  5ECO B;  2N5B A;  14GS A;  4MDC A;  3H8Q A;  1FAA A;  1F9M A;  4HZ4 A;  4NV5 A;  2FA8 A;  4K0G A;  4KF9 A;  4ECC A;  4GST A;  4ZL8 A;  1S3D A;  3ZIJ A;  4IP1 A;  3EYT A;  1RQM A;  2LS5 A;  4F03 A;  4BL7 B;  1YKA A;  2DMM A;  5LNK e;  2VUP A;  2VAF A;  1U88 A;  4IEL A;  4G0L A;  4CW9 A;  1VF3 A;  3GX0 A;  3EIN A;  1HD2 A;  1TRU A;  1AC1 A;  4PUA A;  2GT6 A;  1NSW A;  4MCU A;  3VWU A;  4ACS A;  4RQR A;  1O73 A;  4BVX B;  2HRN A;  1ILO A;  2DJJ A;  2PU9 C;  3RAZ A;  3D6I A;  4K1F A;  1SL0 B;  3ZIV A;  1SEN A;  4LMW A;  5AN1 A;  1T00 A;  3C8E A;  2XC2 A;  5IM9 A;  2OE1 A;  4ECJ A;  3WT2 A;  2NTO A;  3GNJ A;  2P5Q A;  2XBQ A;  4IJ3 A;  3TKS E;  3CSH A;  1V98 A;  1R5A A;  4OFN A;  5GST A;  4Q5Q A;  1XOA A;  3EWL A;  4BVY B;  5IOX A;  3BD2 A;  4PUR A;  2M72 A;  2IMI A;  4OFT A;  3IDV A;  5KN1 A;  3FR9 A;  2C3T A;  1CQH A;  6GSW A;  4IJI A;  3IOS A;  1SD8 A;  1N2A A;  3ERW A;  3BJ5 A;  3FRC A;  1NHO A;  3US3 A;  4GF0 A;  1HQO A;  5F05 A;  3LOR A;  1ZOF A;  4IVF A;  5GAN D;  2R5G A;  1AQV A;  3HDC A;  2LKU A;  3NOF A;  2REM A;  4XS4 A;  1E6B A;  3LYK A;  4I8B A;  2AAW A;  3ZRE A;  2B3S A;  5D93 A;  1B8X A;  2VCW A;  2M46 A;  5KN3 A;  4GQF A;  3AY8 A;  1BG5 A;  1XPV A;  5F07 A;  2R3X A;  5HFI A;  4AJ6 A;  1GSE A;  2C1Y A;  4K7I A;  2CT6 A;  3QAV A;  3F4S A;  2H0H A;  5KEJ A;  1XFL A;  1W4V A;  3TKS C;  1GL8 A;  2CAQ A;  2IWT A;  1AQX A;  2PPT A;  5B6M A;  4MZC A;  1M2D A;  2CA8 A;  1EV4 A;  1M3I A;  4TR4 A;  2I9H A;  1Z7P A;  3F3Q A;  2AJQ B;  3HJO A;  5ECQ B;  4ECI A;  4FIW A;  1QGV A;  3JCM L;  3HKR A;  1T1V A;  1K0D A; 
#chains in the Genus database with same CATH homology
 2X99 A;  4MPG A;  1WP0 A;  2WRT A;  5A5K A;  2Z9S A;  2ON5 A;  2VL9 A;  4YQU A;  1R4W A;  1DE1 A;  2FLS A;  3F3R A;  3Q18 A;  4KH7 A;  13GS A;  4ZBD A;  4PQ1 A;  3UMA A;  2HRF A;  3PH9 A;  4JE1 A;  2PMT A;  2UZ8 A;  4HQZ A;  3WD6 A;  4FYC A;  4FYB A;  3KIJ A;  2V6O A;  4OO4 A;  2L5L A;  1K3Y A;  1GUH A;  1U87 A;  1YF0 A;  4I2T A;  2WFC A;  4G19 A;  4AJ7 A;  4NXI A;  3UAR A;  2K9F A;  3PR8 A;  4J2F A;  4AJ8 A;  1V40 A;  3D4M A;  1LBK A;  2PN8 A;  3APQ A;  1R5P A;  3R3E A;  5IQY A;  2HZF A;  3EE2 A;  2X64 A;  5JCU A;  1OVN A;  2LQO A;  4X1U A;  4ISD A;  3DD3 A;  4FO5 A;  5IMC A;  1EOH A;  2C8U A;  4L5L A;  4EVM A;  3A2W A;  2B6M A;  2GVP A;  6GST A;  2X8C A;  5LD0 A;  5AIX A;  2DJ3 A;  5GAP D;  1YEX A;  4D73 B;  2PUK C;  1SK2 A;  1R7H A;  2CZ2 A;  2MMA A;  3CRU A;  5C00 A;  2AV4 A;  3QAG A;  1AW9 A;  3RPN A;  1GLQ A;  3HYP A;  5F8B A;  5ECR B;  4IGJ A;  2JZR A;  2OJL A;  1ZCP A;  3LG6 A;  2WUL A;  4QL7 A;  3P2A A;  3ED3 A;  1S3C A;  1JLW A;  4E8H A;  5J3R A;  2CVB A;  4G0K A;  4V2M A;  2NDO A;  1GSY A;  3ERG A;  4XS6 A;  1HNA A;  1FW1 A;  5G1K A;  5J9B A;  1SK1 A;  3GUR A;  2WZ9 A;  4L0W A;  3E0U A;  5ECK B;  2KOK A;  3HY2 A;  4WR4 A;  2FNO A;  2YOI A;  5F06 A;  3KCM A;  1OC9 A;  2N5A A;  3NIV A;  2R0P A;  3KH7 A;  4HI7 A;  2P5R A;  4Q5F A;  3FY7 A;  3EU4 A;  3FK8 A;  1X9S B;  1PKW A;  2IMK A;  1HYU A;  1T8E B;  1GUK A;  1ZMA A;  5HR3 A;  2VOC A;  5CRE A;  3O6T A;  1K0N A;  2GT5 A;  4TKY A;  4PTS A;  4HOJ A;  5INY A;  2OKA A;  4Z2U A;  2VCZ A;  4HU9 A;  4F82 A;  3M0F A;  4IP6 A;  2NVL A;  1O8X A;  2R4V A;  1DBY A;  2V6K A;  4HDE A;  1TRW A;  4F0B A;  1Z9H A;  3C71 A;  4JBB A;  3GIX A;  3L4N A;  4P3Y B;  4I97 A;  3CSI A;  4PNG A;  3IAS 2;  2QSI A;  1X5E A;  1XWC A;  2KP2 A;  3TKQ A;  1XWA A;  3W8S A;  3VLN A;  3A3T A;  4TXO A;  4JR4 A;  1X9M B;  2OE3 A;  3SWL A;  3DYR A;  3EC3 A;  1I5G A;  4POM A;  5KN0 A;  3DGQ A;  3D4T A;  5A4U A;  5FWG A;  1ERU A;  4NHZ A;  3DXB A;  1GTA A;  1O81 A;  2O7K A;  2DC5 A;  2MBT A;  3MAK A;  1Z6N A;  2FD3 A;  2YV9 A;  3NZN A;  1XWB A;  5CRD A;  1G7O A;  1EGR A;  4ZB9 A;  2X8H A;  3GKM A;  4BWS A;  3L0H A;  1N8J A;  2X4A A;  1JZW A;  4I6X A;  4XRA A;  5JCW A;  1UA5 A;  2H01 A;  4TRX A;  5CRG A;  4DSS A;  3MYD A;  2HSM A;  2AUV A;  2H6Z A;  4USS A;  2H72 A;  4YAP A;  2PVQ A;  3HJP A;  1PD2 1;  1J0F A;  4XS4 B;  5CNW A;  3TJB A;  3N9J A;  3H93 A;  4YAV A;  3C1R A;  2QC7 A;  1AIU A;  3H79 A;  2CX4 A;  2YWI A;  1I9D A;  1A0R P;  4X4J A;  3F4R A;  2GLR A;  3KH9 A;  1MDI A;  1THX A;  5AGY A;  1X5D A;  3TJK A;  1QFN A;  3OR5 A;  3HXS A;  4XCS A;  1GWC A;  5GZZ B;  4MZB A;  3Q74 A;  4ZIL A;  1HNC A;  2VCX A;  2RII A;  4KUN A;  2XHF A;  19GS A;  1GSQ A;  1FG4 A;  4PX1 A;  3FEU A;  4F0C A;  1NM3 A;  1PL2 A;  4EKZ A;  4RQX A;  2L6D A;  3KMN A;  3VPT A;  1BJX A;  3R2Q A;  3GST A;  1A23 A;  3DWV A;  3TUE A;  2QKE A;  1TU7 A;  1Z6M A;  1EOG A;  3HVV A;  1M99 A;  1VF1 A;  2AYT A;  2F3M A;  3LJR A;  5A4W A;  2R6K A;  3TRX A;  3VK9 A;  1GSU A;  2R2J A;  3DML A;  2LRC A;  2V1M A;  4EO3 A;  3KP9 A;  4KSO A;  2NPB A;  3FYG A;  2B5X A;  5D73 A;  1C72 A;  3MNG A;  2P31 A;  3TOT A;  3D5J A;  4OMV A;  2LST A;  3C1S A;  1XCC A;  2I4A A;  4OCF A;  5JWQ B;  3ZYW A;  5J5N A;  4NV2 A;  3DRN A;  3ZVJ A;  5EL8 A;  1K0B A;  1XXU A;  3I43 A;  4IBP A;  2GQK A;  2OE0 A;  4TR0 A;  3KGK A;  1QMV A;  1WMJ A;  5D9V A;  1K0M A;  1EP8 A;  2DJ2 A;  1GP1 A;  3HZ8 A;  1GSD A;  1R26 A;  2H1G A;  5COH A;  4LLR A;  3WGE A;  1V58 A;  4POL A;  3KTB A;  4ZB6 A;  4MJB A;  1Z5Y E;  1TP9 A;  4CDO A;  2GS3 A;  2VD0 A;  2FY6 A;  3DEX A;  5GSS A;  1GUM A;  1V2A A;  3RHB A;  5IO2 A;  3MIX A;  3G7J A;  1ABA A;  1NHY A;  3K8N A;  3TRQ A;  4EIQ A;  1V9W A;  2X49 A;  2YWO A;  3IAM 2;  5A4V A;  1OC9 B;  1TRS A;  2PER A;  1Z7R A;  2YWM A;  4OFM A;  5ENU A;  3Q6O A;  3HA9 A;  2FA4 A;  2IFQ A;  3KMO A;  2DBC A;  2KLX A;  3IC8 A;  4TR1 A;  1EEJ A;  1THO A;  4KX4 A;  1ZYQ B;  2TRX A;  1ZZY A;  8GSS A;  4ID0 A;  5D9X A;  1FVK A;  4DEJ A;  1F3B A;  3GKN A;  3IPZ A;  1TJD A;  3ME8 A;  5IMD A;  1QUW A;  2WDU A;  5IOW A;  4WKW A;  2LTK A;  2AB6 A;  2JAC A;  4GSN A;  2GDR A;  3SBC A;  3J7Y b;  1B4Q A;  4N11 A;  1ACV A;  1XW9 A;  2DIY A;  4K5S A;  1FO5 A;  5IMF A;  2IIY A;  1XWG A;  4ZBB A;  5C04 A;  2P0G A;  3C7M A;  4YQV A;  3QPM A;  4PQH A;  3ZTL A;  4CHS A;  3GL3 A;  3IK9 A;  5DJM A;  1SK0 A;  3BCI A;  1VF4 A;  2MBS A;  1A2L A;  3CBU A;  2LV3 A;  4POK A;  3UVT A;  2CZ3 A;  4HJM A;  2EC4 A;  5HR2 A;  2RM5 A;  1ZYN A;  4EIP A;  3IA1 A;  2DKH A;  1FOV A;  4G2E A;  4Z2T A;  1PN0 A;  4FH8 A;  4MJA A;  2VL2 C;  1OC3 A;  1VRS D;  1K3O A;  1TI1 A;  3TKR A;  4HJ2 A;  1T4Y A;  5DVB A;  5E4W A;  1SL2 B;  1TI3 A;  2MMZ A;  3TGZ A;  4DVC A;  1O6J A;  1U6T A;  3GH9 A;  3ZFB A;  4EF0 A;  1KBN A;  3QAW A;  1GH2 A;  4DSS B;  2IPA A;  4ML1 A;  3HCZ A;  3ME7 A;  1OKT A;  2NBS A;  2KP1 A;  1X9W B;  1TK8 B;  4TVE A;  2HLS A;  5J4U A;  4KA0 A;  1PSQ A;  5B8B A;  4HS1 A;  2J23 A;  1EZK A;  4F9Z A;  1TW9 A;  5IPG A;  1UVZ A;  2L4C A;  4YQM A;  2HSH A;  4O5Q A;  4EC0 A;  3EUR A;  3F63 A;  3IC4 A;  3D0Z A;  4V2L A;  1XW5 A;  1OC8 A;  4WET A;  4HU7 A;  2H73 A;  1O7U A;  1EP7 A;  3RPP A;  4GTU A;  4K6X A;  2GQM A;  5ECN B;  1T3B A;  4NHW A;  1GLP A;  1XBS A;  1AUC A;  4O5U A;  2K18 A;  4EDZ A;  2MZC A;  2IL3 A;  4IW9 A;  1WWJ A;  3FZA A;  2N5F A;  4NWY A;  3HZ4 A;  1XWK A;  4EL1 A;  2J9H A;  2ZUP A;  4K5R A;  3PPU A;  4LL1 B;  1U3I A;  3E3E A;  4GQC A;  2F8A A;  1O8W A;  2EIO A;  6GSU A;  2QGV A;  1WRY A;  3GH6 A;  2TIR A;  2A2R A;  3QDN A;  5DAK A;  1BAY A;  1YY7 A;  5G30 A;  3IXR A;  3M9J A;  1MD3 A;  5F0G A;  1Y6E A;  3LSZ A;  2H0I A;  1XIY A;  2V41 A;  5HQP A;  3HVX A;  9GSS A;  2L59 A;  1M9A A;  3RBT A;  5CRW A;  1JZD A;  1EWX A;  3UIW A;  3VWW A;  5ID2 A;  2MMN A;  5IPH A;  2ZNM A;  3GRX A;  5DBQ A;  3UBL A;  2OA7 A;  4L5O A;  1XW6 A;  3DKS A;  3RHC A;  1XOB A;  2HZE A;  4N30 A;  3LW9 A;  3GUS A;  5G1L A;  4YKG A;  4N0V A;  3CTF A;  4TW5 A;  2YJH A;  2FGX A;  4WBR D;  3IK7 A;  2ES7 A;  2R0G A;  6GSS A;  5G5F A;  1Z3E A;  20GS A;  4K2X A;  2K8V A;  3APO A;  3H4K A;  2I3Y A;  1B48 A;  10GS A;  1B9Y C;  3U6V A;  1U3A A;  2HRA A;  2JL4 A;  2G0F A;  3PGT A;  1BX9 A;  1WIK A;  2RUF A;  5DQY A;  1W89 A;  3DIE A;  1VF2 A;  5J9C A;  5CAX A;  1OKD A;  2KHP A;  5DDL A;  4KDU A;  3VFI A;  4OCE A;  4QQ7 A;  4A5P A;  2IFQ B;  1PX7 A;  4TR1 B;  2C4J A;  1B4P A;  4I2U A;  1PA3 A;  3ZVJ D;  2AHE A;  4IHU A;  2FUG 2;  2HT9 A;  4KDX A;  1MTC A;  4YH2 A;  3ZFL A;  2ZCT A;  5IO0 A;  2YV7 A;  2B7J A;  3I9V 2;  3L9S A;  5AIS A;  4ICY A;  4PUF C;  1SJI A;  3FMW A;  1MEK A;  2RLI A;  3KTL A;  3KEB A;  4ZXG A;  2GSS A;  12GS A;  2V2G A;  4ZBA A;  1PKZ A;  1FVJ A;  1K3L A;  5IMA A;  4J57 E;  2OAC A;  5ELA A;  2L57 A;  3P90 A;  4WXT A;  3TKS A;  22GS A;  1KEB A;  2PVO C;  1ZGN A;  2H8L A;  3G7I A;  5L71 A;  1F3A A;  3TDG A;  2PBJ A;  2R37 A;  3W8J A;  2H19 A;  1O85 A;  4MF6 A;  2HXK A;  1UN2 A;  1A8L A;  2MMO A;  1M9B A;  1ZYP A;  2DML A;  2KUC A;  2OBI A;  3CSJ A;  2WCI A;  3FR6 A;  3EMP A;  1TTZ A;  4ILF A;  2H66 A;  3EMX A;  1YEP A;  5D9W A;  3APS A;  2BJX A;  4IS0 A;  1SKS B;  3GSS A;  4NAX A;  5DAL A;  2VD1 A;  1XVW A;  4PXO A;  2H70 A;  3E9J B;  1ML6 A;  3ERF A;  2O8V B;  1TU8 A;  2FWE A;  2FWF A;  2GZP A;  1FB6 A;  2DJ1 A;  3F0I A;  3WGX A;  4TOP A;  1TRV A;  4YKF A;  3PIN A;  3EPT A;  1Q98 A;  3QFA C;  1F37 A;  5E59 A;  3FKF A;  4KND A;  1A2M A;  4PQI A;  4K0N A;  3HVS A;  3VI5 A;  2PGT A;  4OD7 A;  4KE3 A;  3GV1 A;  2JU5 A;  2FWG A;  1FHE A;  1BYE A;  2H75 A;  2I81 A;  1X0R A;  4MMM A;  4O5R A;  2L6C A;  4XRD A;  4Q5R A;  1GTB A;  1M7T A;  4JED A;  2F8F A;  1ZL9 A;  2YN1 A;  2GQL A;  3A5W A;  1T7P B;  3WT1 A;  4HUA A;  2IN3 A;  3F9U A;  1DUG A;  2PWJ A;  4GSS A;  1GSS A;  2K6V A;  2F51 A;  1T4Z A;  1M2A A;  3N5O A;  2C0G A;  4RI6 A;  2G2Q A;  4WF5 A;  4EXJ A;  4XHM A;  2H1B A;  1Y25 A;  2YJ7 A;  17GS A;  3O76 A;  1EV9 A;  2H0G A;  4GRF A;  16GS A;  2CAI A;  1ERV A;  3J7Y k;  4WBJ A;  2B5Y A;  4ECB A;  1TDI A;  2LJA A;  4G0I A;  2C80 A;  2A2P A;  5DAK B;  4MH2 A;  2YCD A;  1K0C A;  3UL3 A;  6GSV A;  1S3A A;  1JFU A;  2VLU A;  3TCO A;  1TOF A;  4MPF A;  2LQQ A;  3W6G A;  2VIM A;  2WS2 A;  3KM6 A;  3P7X A;  5DQS A;  1DSB A;  2DLX A;  1NW2 A;  5ECH B;  7GSS A;  4MK3 A;  5ID2 B;  4O7H A;  1SKR B;  2LNT A;  4IN0 A;  2CX3 A;  2O89 A;  1YJ6 A;  4I5Q A;  2HZE B;  3P8W A;  1AAZ A;  3VPQ A;  4TN8 A;  3GMF A;  3D22 A;  2DIZ A;  5ELG A;  2ON7 A;  4JR6 A;  1GUL A;  3LEF A;  2HE3 A;  1Q4J A;  4TR3 A;  1OAZ A;  4BA7 A;  1IYI A;  4HEA 2;  2C0F A;  2YP6 A;  2WJU A;  2VLV A;  4K7N A;  2D2Z A;  5B7C A;  3GFK A;  4MF7 A;  1V57 A;  5KOW A;  5EVO A;  1G0T A;  3F6D A;  3O3T A;  4LA1 A;  4MAB A;  4J56 E;  3WGD A;  3GX8 A;  4Q5N A;  4ZB8 A;  2H74 A;  2DKI A;  3QOU A;  1ERT A;  1MDJ A;  2LRT A;  4X43 A;  2GZZ A;  4WEY A;  1EGO A;  2E0Q A;  2B1K A;  4TXO B;  2YWN A;  3LXZ A;  3TOU A;  1LU4 A;  3HHV A;  2HYX A;  2QA1 A;  2LJK A;  1YF1 A;  4GCI A;  1KTE A;  5B8A A;  5ECM B;  4DSQ A;  2FWH A;  3GTU A;  2C0D A;  1PQN A;  3ZL5 A;  4KAE A;  4CY8 A;  4JRR A;  4KB3 A;  2IMD A;  3BOA A;  4POB A;  2H76 A;  1H75 A;  5D8I A;  4ML6 A;  3A2X A;  4ULX A;  4XIH A;  4TXV A;  2JSY A;  1ERW A;  3TRP A;  1OYJ A;  4V1A g;  2RM6 A;  1UC7 A;  1DE2 A;  2GSR A;  3TKP A;  1GTU A;  1OE8 A;  1PX6 A;  3LYP A;  3FZ9 A;  4NPB A;  1QXH A;  2VCT A;  3IHQ A;  3IR4 A;  2EIQ A;  4GLT A;  1GTI A;  4BPY A;  4GXZ A;  4MLY A;  3UVH A;  5G2Z A;  4MJC A;  3ZMK A;  5DCG A;  1SJZ A;  3KZQ A;  1H4O A;  2H71 A;  5JCG A;  4X0X A;  1WJK A;  2LJR A;  3IRA A;  4OO5 A;  4MA9 A;  3CTG A;  3VUR A;  1SYX A;  2WGR A;  2A4V A;  4IQA A;  1A0F A;  1SJ6 A;  3EVI A;  2BMX A;  2QA2 A;  3I6A A;  1QQ2 A;  5DAL B;  2L5O A;  3LXT A;  2YZH A;  2B1L A;  3M8N A;  3DVX A;  4RUV A;  2HRK A;  3M3M A;  3QFB C;  3G9B A;  5JWR B;  1PMT A;  1JHB A;  5IIZ A;  2GSQ A;  2VCQ A;  5CP1 A;  2H1D A;  5HR0 A;  3ZLP A;  18GS A;  4MP4 A;  3CYN A;  5EY6 A;  1SKW B;  4K7O A;  1WPI A;  1AXD A;  2XBI A;  5CO3 A;  3LQ7 A;  5JWO B;  2EIR A;  4G10 A;  4NMU A;  1ON4 A;  3QMX A;  5DJL A;  5EPF A;  3ZIT A;  1K0O A;  5D9T A;  3CMI A;  2YNX A;  1CQG A;  3IE3 A;  4EDY A;  4MJE A;  3QD9 A;  5D96 A;  1RK4 A;  5B6N A;  1YDK A;  1E2Y A;  4WR5 A;  3VWV A;  3KJY A;  4WF4 A;  3VI7 A;  5KOX A;  1B9X C;  1RW1 A;  3F6F A;  3MWH A;  4CY6 A;  6GSY A;  4N10 A;  2MYG A;  3BCK A;  3RDW A;  4L0U A;  1SD9 A;  2H1A A;  2CVD A;  5HFK A;  2O85 A;  1G7E A;  4E8E A;  1URM A;  2H6Y A;  2F9S A;  3UAP A;  4KCA A;  4BL7 A;  4IKH A;  11GS A;  3Q19 A;  3TJG A;  4G9H A;  3CXG A;  1GRX A;  4ZL9 A;  6GSX A;  4EUY A;  3G7Y A;  2LEG A;  2VCV A;  5AIV A;  3UJ1 A;  1JZO A;  3F4T A;  3FZ5 A;  1G6Y A;  2B5E A;  5ECL B;  1LJR A;  4BVX A;  3F8U A;  3MDK A;  1K0A A;  5ABR A;  4EE0 A;  1USB A;  1YKC A;  4N0Z A;  1PL1 A;  4MH3 A;  4KW6 A;  3L78 A;  5G31 A;  2VM1 A;  3FW2 A;  1KNG A;  1J08 A;  4F2I A;  3KD0 A;  2YPM A;  3QR6 A;  1TK5 B;  2X8G A;  2JZS A;  3QCP A;  4BVY A;  1OE7 A;  3M1G A;  1YQ1 A;  1SU9 A;  3IHG A;  3FZ4 A;  4PNF A;  3FHK A;  3A5I A;  5G5E A;  2XPE A;  1A8Y A;  4KSM A;  2TRC P;  2JAD A;  5ECS A;  3GHA A;  2DSA A;  5HR1 A;  3WYW A;  1GNW A;  2GGT A;  3GKK A;  2CV4 A;  5FT3 A;  2IME A;  5ECP B;  1TXX A;  1IYH A;  4K9Z A;  5BRT A;  2DJ0 A;  1TK0 B;  3V1W A;  1AQW A;  5ECI B;  4AGS A;  2E2G A;  2YZU A;  1M2B A;  4Z7X A;  5IMZ A;  2VL2 A;  4JU5 A;  2GZY A;  5HFG A;  1QK8 A;  3GL5 A;  1A24 A;  2LUS A;  5DCH A;  2GTU A;  1GSF A;  1TKD B;  2LNS A;  3BBY A;  4OWY A;  2CVK A;  4FYU A;  4DSR A;  3GTU B;  4AF2 A;  4K8M A;  3TJJ A;  3A2V A;  2ALB A;  5H5S A;  4V1A p;  1YZX A;  2O87 A;  1M0U A;  3UBK A;  4L8E A;  3UOM A;  2IMF A;  4FQU A;  4RI7 A;  2I1U A;  1X5C A;  3L9U A;  4LMV A;  3ZZX A;  2H6X A;  1ST9 A;  2HSY A;  3GN3 A;  3I69 A;  2A2S A;  4PGT A;  2RUE A;  4BWQ A;  2R0C A;  4H86 A;  3DVW A;  1PN9 A;  2WB9 A;  4ZL7 A;  2A4H A;  2VL3 A;  3MSZ A;  3LGC A;  3CRT A;  5KN2 A;  5IMV A;  2LRN A;  2L4Q A;  2IJY A;  1GNE A;  3C73 A;  1BQ7 A;  3LFL A;  3EU3 A;  1XZO A;  4MF5 A;  1F6M C;  2OAD A;  3GKX A;  3GA4 A;  1JZR A;  4HQS A;  1XVQ A;  1WOU A;  1BED A;  2HI7 A;  3H1N A;  2YAN A;  4XS1 A;  3D21 A;  1FOH A;  3ZML A;  2VO4 A;  4O92 A;  3M9K A;  3IV4 A;  1VGL A;  1J9B A;  4ZIJ A;  3VWX A;  2VM2 A;  2OBK A;  4O32 A;  4QL9 A;  1JLV A;  4JZQ A;  2C3N A;  1HNB A;  3ZRD A;  1ZYE A;  4XTS A;  1SL1 B;  4K2D A;  3KP8 A;  2BTO T;  1WE0 A;  2DJK A;  2E2M A;  4Z2R A;  4D73 A;  3LWA A;  2V32 A;  1SYR A;  2FCH A;  5J41 A;  3ISO A;  2JSZ A;  3GYK A;  3FR3 A;  1G6W A;  1PGT A;  3IBH A;  1MD4 A;  2CQ9 A;  2C3Q A;  3TJF A;  2C0E A;  3U5R E;  4HZ2 A;  2JZT A;  2HNL A;  2M80 A;  5H5R A;  4IQ1 A;  3TB2 A;  4GWR A;  4KCE A;  4MNN A;  5CYY A;  2HFD A;  2FHE A;  2B7K A;  3UEM A;  5H5Q A;  1EEM A;  1PRX A;  3L9V A;  4KDY A;  3S9F A;  5LCZ A;  3KXO A;  2VLT A;  4KGI A;  1MDK A;  4MZW A;  2XPD A;  3HJM A;  2E7P A;  4V2N A;  2K8S A;  2H30 A;  5BMU A;  3HD5 A;  5FHI A;  1FB0 A;  1F2E A;  4LL4 B;  2GST A;  1A2J A;  5CRH A;  5ECO B;  2N5B A;  14GS A;  4MDC A;  3H8Q A;  1FAA A;  1F9M A;  4HZ4 A;  4NV5 A;  2FA8 A;  4K0G A;  4KF9 A;  4ECC A;  4GST A;  4ZL8 A;  1S3D A;  3ZIJ A;  4IP1 A;  3EYT A;  1RQM A;  2LS5 A;  4F03 A;  4BL7 B;  1YKA A;  2DMM A;  5LNK e;  2VUP A;  2VAF A;  1U88 A;  4IEL A;  4G0L A;  4CW9 A;  1VF3 A;  3GX0 A;  3EIN A;  1HD2 A;  1TRU A;  1AC1 A;  4PUA A;  2GT6 A;  1NSW A;  4MCU A;  3VWU A;  4ACS A;  4RQR A;  1O73 A;  4BVX B;  2HRN A;  1ILO A;  2DJJ A;  2PU9 C;  3RAZ A;  3D6I A;  4K1F A;  1SL0 B;  3ZIV A;  1SEN A;  4LMW A;  5AN1 A;  1T00 A;  3C8E A;  2XC2 A;  5IM9 A;  2OE1 A;  4ECJ A;  3WT2 A;  2NTO A;  3GNJ A;  2P5Q A;  2XBQ A;  4IJ3 A;  3TKS E;  3CSH A;  1V98 A;  1R5A A;  4OFN A;  5GST A;  4Q5Q A;  1XOA A;  3EWL A;  4BVY B;  5IOX A;  3BD2 A;  4PUR A;  2M72 A;  2IMI A;  4OFT A;  3IDV A;  5KN1 A;  3FR9 A;  2C3T A;  1CQH A;  6GSW A;  4IJI A;  3IOS A;  1SD8 A;  1N2A A;  3ERW A;  3BJ5 A;  3FRC A;  1NHO A;  3US3 A;  4GF0 A;  1HQO A;  5F05 A;  3LOR A;  1ZOF A;  4IVF A;  5GAN D;  2R5G A;  1AQV A;  3HDC A;  2LKU A;  3NOF A;  2REM A;  4XS4 A;  1E6B A;  3LYK A;  4I8B A;  2AAW A;  3ZRE A;  2B3S A;  5D93 A;  1B8X A;  2VCW A;  2M46 A;  5KN3 A;  4GQF A;  3AY8 A;  1BG5 A;  1XPV A;  5F07 A;  2R3X A;  5HFI A;  4AJ6 A;  1GSE A;  2C1Y A;  4K7I A;  2CT6 A;  3QAV A;  3F4S A;  2H0H A;  5KEJ A;  1XFL A;  1W4V A;  3TKS C;  1GL8 A;  2CAQ A;  2IWT A;  1AQX A;  2PPT A;  5B6M A;  4MZC A;  1M2D A;  2CA8 A;  1EV4 A;  4TR4 A;  2I9H A;  1Z7P A;  3F3Q A;  2AJQ B;  3HJO A;  5ECQ B;  4ECI A;  4FIW A;  1QGV A;  3JCM L;  3HKR A;  1T1V A;  1K0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...