1ABOA

Crystal structure of the complex of the abl tyrosine kinase sh3 domain with 3bp-1 synthetic peptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ABL TYROSINE KINASE
publication title High-resolution crystal structures of tyrosine kinase SH3 domains complexed with proline-rich peptides.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (kinase/peptide)
total genus 10
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1995-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1aboA00
1PWTA 1WXUA 1NEBA 3ULRB 1K4US 3IQLA 4RTVA 3LH5A 2K79A 1RUWA 2MIOA 2JW4A 1BU1A 3EG0A 4OMPA 5IHNA 2EW3A 2AK5A 4OMLA 1H3HA 2KYBA 1PKTA 5EC7A 2GTOA 1BBZA 1W70A 2B86A 1WDXA 2FO0A 1UG1A 3VS3A 1PNJA 2ROTA 2DF6A 2EVRA 2KROA 5FWCA 1T0HA 1X69A 1K1ZA 1GCQC 2M0YA 4RTZA 4KRTA 4GLMA 2A37A 5IHKA 2L3PA 2DBKA 1SHFA 2K2MA 2ED1A 2AZSA 1GCPA 2LZ6B 2LP5A 2LQWA 2G6FX 2RQRA 1KFZA 1UUEA 1TUCA 2D8HA 5GJWB 2KXDA 1ZBJA 1QWFA 2IIMA 5HCKA 1H8KA 1YWPA 2EGEA 1M3AA 4JZ3A 1WLPB 1ZSGA 1G2BA 4RTXA 4OMNA 4AG1C 3VS1A 2KBTA 2JMAA 1UFFA 2DL8A 1EFNA 3M0TA 2BTTA 4AFZC 1AEYA 4ESRA 4J9DA 2VWFA 2JTEA 3SEMA 3H41A 1NYFA 2GBQA 2ABLA 3NGPA 1KSWA 2BZYA 1Z9QA 2KE9A 1ABQA 2X3WD 2J6KA 3EGUA 1OEBA 4J9HA 4K11A 3PVLA 4J9CA 2KGTA 2F2XA 1KIKA 4LNPA 3TVTA 4IIOA 2FPDA 4CC4B 1HSQA 1WA7A 4WCIA 2A28A 5L23A 2CUBA 1YCSB 4HCKA 2KEAA 2NUZA 3UA7A 2KR3A 1UJYA 1UDLA 1CKBA 3THKA 2DYBA 1B3QA 3VS0A 1HD3A 1J3TA 4RTYA 2L0AA 1MV0B 1WYXA 2FEIA 1CKAA 2OJ2A 2GNCA 2YUQA 1K76A 3VS5A 2HCKA 1T3LA 4J9FA 4AFUC 1U5SA 2LMJA 2DL4A 2O31A 2J06A 2FRWA 1T3SA 3UF4A 1QLYA 1SRLA 1JEGA 2DL5A 2C0TA 2RF0A 2L3SA 2GTJA 1W1FA 3NPFA 1AZEA 1JQQA 1SPKA 2CT4A 2I0NA 1ABOA 1WX6A 2EGAA 1UECA 1AWXA 3RNJA 2P4RA 2LJ0A 1M8MA 3I9QA 1AZGB 1GCQA 1WFWA 2CSQA 1Y0MA 4HVUA 2LJ1A 2E5KA 2DILA 4IIMA 2LX7A 1M3CA 1NLPC 2HBWA 1G83A 4JPBW 2ESWA 2O2OA 1VYUA 1OPLA 2DVJA 3PVQA 2JMCA 2KRSA 4QT7A 1WXTA 1ARKA 1U3OA 1GRIA 2RQWA 3R6NA 2PNIA 2EYXA 2CH4A 2CREA 2DL3A 2A36A 1RLPC 4RTUA 1FYNA 1X2QA 2YSQA 2ED0A 2CDTA 2DMOA 4J9BA 2DNUA 1AWOA 2DRKA 2FG0A 2KRMA 1GL5A 1TUDA 2ENMA 3M0QA 3M0SA 4RUGA 1QWEA 2RQTA 1SEMA 4X1VA 1AWWA 2YUPA 1W6XA 3EG2A 2O88A 2LJ3A 3EG1A 1V1CA 3I35A 2DM1A 2DLPA 2OAWA 3M0PA 4CC3A 3H0IA 2DRMA 2DJQA 1NG2A 1GFDA 2CUDA 1AOJA 1SSHA 2FPEA 2J6OA 2W10A 1M27C 4HVWA 2VKNA 1B07A 3VS4A 4EIKA 1VYVA 1LCKA 2EGCA 2KRNA 4M4ZA 4F16A 1X6GA 2PZ1A 4Y92A 1ZUUA 1Z9ZA 1YP5A 4F17A 1XOVA 1YNZA 4R0KA 3SHWA 2F2VA 4Z88A 2EPDA 3FJ5A 1JXMA 2JXBA 4LN2A 1GFCA 1BK2A 2DL7A 2D1XA 1E6GA 2M51A 4LUEA 1QKXA 1RLQC 4AG2C 2ROLA 3I5RA 2J05A 1E7OA 4HXJA 4Z8AA 1UHFA 2RMOA 2RN8A 2AZVA 1YN8A 2CSIA 1IO6A 1K9AA 1ZX6A 2JT4A 2JS2A 2JM8A 4JZ4A 2PTKA 1PKSA 2K9GA 1NYGA 1UHCA 1X27A 4JJDA 3GBQA 1I0CA 5FW9A 2KXCA 4DEXA 3C0CA 2DE0X 3H0HA 5I11A 3TSWA 4OMMA 1OPKA 2L3QA 2RNAA 3EG3A 3M0RA 3VS2A 2C0IA 2FPFA 1WIEA 1E6HA 1OV3A 2V1QA 1NLOC 2K6DA 4FSSA 2K7AA 1PHTA 1GBRA 4J9GA 2DBMA 2A08A 2YUNA 5IXFA 2O9VA 3QWXX 2NWMA 2LQNA 4DEYA 3VRZA 4J9IA 3ZL7C 1MUZA 4OMQA 2SEMA 1JU5C 4RTTA 5IXBA 1VA7A 3KFVA 3U23A 3UA6A 4AFQC 2MCNA 2EYWA 2RQVA 3REAB 3RBBB 2XMFA 2YDLA 2AKKA 2EBPA 2D8JA 4JJBA 1UGVA 1JXOA 4J9EA 1VYTA 2JS0A 4GBQA 4ORZA 4JJCA 1X2KA 3QWYA 1X6BA 2HEQA 1M30A 1PRMC 2J7IA 5FWBA 4RTWA 2BZXA 5ECAA 4D8DA 3O5ZA 4OMOA 3H0FA 3VS7A 2X3XD 1H92A 2YUOA 1OOTA 1I1JA 1UE9A 1S1NA 1M3BA 2SRCA 1SHGA 2V1RA 2EYZA 4F14A 2KT8A 3NMZC 1ZLMA 2KNBB 2EQIA 3NHNA 3PE0A 1YWOA 1A0NB 2LNHB 2VVKA 2L2PA 3A98A 1AVZC 3EHQA 1K0SA 2CT3A 2C0OA 2W0ZA 1KJWA 1T0JA 1CSKA 2DX1A 2HSPA 2H8HA 2EYYA 1BB9A 4A63B 4CC2A 3EHRA 2HDAA 1QCFA 2BZ8A 1WI7A 4Z89A 5IHIA 2OI3A 5I22A 1K0XA 4LUDA 1WXBA 1N5ZA 1RI9A 3JV3A 4D8KA 3M0UA 3VRYA 1MV3A 2ECZA 1AD5A 4LE9A 3REBB 1NM7A 2CH4W 2RQUA 2DA9A 2RPNA 3CQTA 1TG0A 2GGRA 2AKLA 1JO8A 1FMKA 1I07A 2MOXA 3I5SA 1GBQA 4HVVA 2GQIA 2YT6A 2K3BA 2EKHA 2KYMA 4E6RA 4ZNXA 1U06A 1SRMA 2JM9A 1AWJA 1PRLC 2QDLA 1Y57A 1HJDA 2KT1A 2FRYA 4AFSC 2LCSA 3UATA 5IH2A 1NEGA 1UJ0A 2F2WA 5GJVB 1ZUKA 2J6FA 3TSZA 1UTIA 1ZUYA 1QKWA 3VS6A 2O9SA 4CC7A 1X43A 2D0NA
chains in the Genus database with same CATH superfamily
3L2UA 1WXUA 2QDYB 2MAMA 1NEBA 2E3IA 3QDRB 2KAFA 2MWOA 1QVGA 4M7AE 1K4US 1N27A 3LH5A 4QQGA 3OB9A 3QJYA 4E47A 5CKEA 5LJ5d 2QXFA 3FEOA 3JCMP 4HT9A 2CZ0B 2AK5A 3HL8A 2KYBA 3BDUA 3EFOA 5EC7A 2RB6A 1YJNQ 2LTOA 1WDXA 2XHCA 2FO0A 1K8AC 5KYWB 3G4SQ 2KROA 2X4JA 4E7HA 3M4YA 2D9TA 5LJ5h 8ATCB 2ED1A 2L5QA 4DBRA 4N0AC 3F70A 1IHWA 4LD6A 5LJ5g 3M5AA 2KXDA 2KY9A 2IIMA 2R5MA 3CCRT 1XNIA 1KC8U 1VQ4T 4ZN3A 3CC2Q 1WLPB 8AT1B 1G2BA 3OYIA 1O75A 4RG2A 3GIBA 1UFFA 2DL8A 3LW5E 1EFNA 3QKJA 2DD5A 4J9DA 2RM4A 2VWFA 2JTEA 3PMTA 4DQ2A 2V8IA 5LJ3j 1I5LA 3LX7A 1KHIA 1VQLT 1S72A 1Q7YU 2COWA 2F2XA 4WTOB 1RAFB 2FPDA 4A4EA 4XTZA 5KYWA 2EYQA 2PUKB 1HSQA 2CUBA 1YCSB 4HCKA 3CCJQ 3UA7A 2E70A 4ZGDB 3S6WA 3QG1A 4VUBA 1Q7YR 4GY5A 1D1BA 1QCNA 3A5ZB 3CCVQ 4XTYA 1LOJA 4F7UB 1VQNA 1J3TA 3CXCP 1WYXA 4MDXA 1W4SA 2OJ2A 3ME9A 2GNCA 2YUQA 1K76A 3HP9A 3BDLA 3VS5A 3ER0A 4AFUC 2DL4A 5KCOA 5GANf 2FRWA 1RL2A 3CCLA 3N5BB 3V8LA 3CXCS 1JJ2A 4M7AD 3PNWC 4C5HA 2L3SA 1AZEA 1JQQA 1NBEB 3UT1A 1YI2Q 3CC7T 2I0NA 1ABOA 2Z0WA 1UECA 2LJ0A 2R57A 3M54A 3I56A 3I9QA 4DOVA 1GCQA 1WFWA 4HVUA 2EFIA 2DILA 1M3CA 2HBWA 4JPBW 1VYUA 3HTRA 5KYUB 1U3OA 1GRIA 3R6NA 2RHIA 1TTHB 3A8GB 3QHSA 4M78E 2DZCA 4F7UA 2DL3A 1FYNA 2O4XB 5KE2A 3I55A 2DNUA 2MYSA 5IN1A 4QQ6A 2LJ3A 3RMQA 2XI9A 3EG1A 1M4ZA 5M9OA 3J80E 3CCRQ 3V7RA 2EIFA 1VQ4Q 3H0IA 2A3LA 3O8VA 1SSHA 2X4XA 4AT1B 3CCST 5CCAA 5CQYA 2F69A 4FYWB 2W10A 2EJFA 2DKGA 3HSBA 4EIKA 1YJWA 4E7JA 1RADB 3CC4T 5KYUA 4F7UE 5GMKe 1YP5A 5GAMj 1XOVA 1VQLQ 5IAYA 2DERA 2F2VA 2O4XA 2FZGB 3FDRA 2X9HA 1UGSB 4LN2A 5D7UA 1VQ6A 2M51A 3CCQA 1U1TA 4Z8AA 1UHFA 3L2QA 3GNFB 1YN8A 4C0DB 1UGPB 2K3YA 1PM3A 4A4HA 1KQSA 4M77B 2JM8A 4JZ4A 2LQ8A 1UHCA 2E6ZA 1I0CA 5FW9A 2KXCA 3MEAA 1YIJQ 2DE0X 5I2MA 2OTLT 4BI3A 4X9CA 1OPKA 1AT1B 3CMEA 4J7FA 1PD0A 5GANd 3WXMB 2FPFA 1WHKA 1I81A 4FW2A 2ZGWA 2L89A 1TH7A 3OYDA 4EMGA 2K7AA 2A08A 1I8FA 2X4YA 1H641 1IZ6A 2NWMA 2OTJA 4BY6B 4J9IA 2C06A 1MUZA 4OMQA 3VU3C 5GANh 1EZZB 3KFVA 1FXXA 4PFPA 1YHQT 2XK0A 5IT9E 2RQVA 3QDFA 2RI5A 1RAAB 2D8JA 5GANg 5LJ5j 1JXOA 4M77A 4PJLA 4PJOE 4J9EA 1VYTA 5GMKm 4PJMA 1BCMA 4JJCA 1IREB 1TUGB 1X6BA 2ZPHB 3C4SA 4BE1A 4N4GA 2LT4A 4RTWA 3O5ZA 2X3XD 4C8QC 1VQPT 1OOTA 3EGXB 1M3BA 1QVGP 3WVEB 3X24B 2JNGA 1I5OB 3NMZC 1YJ9A 2VGMA 1VQ9Q 2EQIA 1YWOA 3M58A 1KQ2A 3OYFA 4TVRA 3ZBDA 2L8DA 5KYYB 3EHQA 2KVQG 3CCSQ 1P92A 2W0ZA 7AT1B 1VQ5T 1RAIB 2DYIA 2EYYA 4A63B 3JB9H 2HDAA 2BZ8A 4Z89A 3CC4Q 1VQMT 4FT4A 4B6MA 3SD4A 3LH0A 5FRMA 1RI9A 3M0UA 5C6SA 1MV3A 2ECZA 1AD5A 3REBB 2M16A 3HRSA 1V29B 1PD1A 2RQUA 4HKEA 1G3WA 3CQTA 1OYXA 1VQ8Q 1TWBA 3OW2S 4MZPA 3OYCA 4DOWA 1YITA 1GBQA 5FU7C 4HVVA 5CVIA 1N8RC 4JJNK 1D1CA 3LLRA 3EGXA 3NTIA 2YXYA 1M1KU 2CP0A 1Y57A 2NUTA 2V8KA 2ZCFB 2KT1A 5IH2A 3URGA 1UJ0A 3PFSA 1R0BG 4M75C 1D0XA 1UTIA 4KT0E 2EQJA 3OA6A 1HYOA 5KYYA 2KI7A 1PWTA 3OYJA 3ULRB 1M1KR 2HKNA 3EFSA 2DO3A 1OQKA 3IQLA 4RTVA 2K79A 3CD6T 1AHJB 2JW4A 2E4HA 2V26A 4FYXB 4OMPA 5AT1B 1KHCA 3ASKA 2PU9B 1H3HA 3NFCA 2K5FA 3CCMA 3VJPA 3QIIA 3QXEB 1UG1A 5GAOn 1YHQQ 9ATCB 4MZMA 5FWCA 2P0QA 3OSSC 4C5IA 2QGGA 2GCXA 2JTMA 4GLMA 3RKYA 2HQHA 1UGQB 2L3PA 2QG9B 2K2MA 2AZSA 2JOYA 2K4YA 2LZ6B 4OMFB 1JJ2P 2K5IA 1TUCA 2D8HA 3L2RA 2VASA 4FSXA 3CCUA 1K73C 1VQPQ 3G7ZA 4KH1B 4FYYB 3CMAT 1ZSGA 5FRNA 2E1HA 3VS1A 5KE3A 2HAXA 2KBTA 2JMAA 3M0TA 1AEYA 1G3YA 1WHHA 3X25B 3SEMA 1Q95G 2AT1B 2KSSA 4A53A 1KSWA 4MZTA 4HCZA 1Z9QA 4M77D 3AHUA 2X3WD 4J6WA 1VQ5Q 4LDWA 4KH0B 1OEBA 2RH2A 4K11A 2FZKB 4KGZB 2KGTA 3CCJT 4LNPA 5FU6C 5J26A 3TVTA 3VYHB 4A4FA 1VQMQ 3BE3A 3CCVT 5GAOm 4PL6A 2IG0A 2COZA 2MK5A 3G6EA 1OULA 3SB2A 1R77A 1N6AA 3RIRA 3THKA 4M77G 1M1FA 5EG2A 2KDSA 3VUBA 1B3QA 4HT8A 1HD3A 5CKBA 5DLQE 1M90C 4PK4A 2FEIA 2RI3A 4Q5WA 1ZSZC 3CBOA 3RESA 4J9FA 4IUVA 4EPCA 4PLLA 2LMJA 5J3BA 1YI2T 2J06A 1X01A 1T3SA 4KGXB 5CKDA 3UF4A 1SRLA 2RHXA 5KYNA 4NS5A 2DL5A 2RF0A 1GXIE 3OBWA 3OYYA 1Y07A 4IUPA 1W1FA 3M56A 2CT4A 4AMCA 4JLGA 1YCYA 1WX6A 2EGAA 1ZQ1A 2QEXA 4C0FA 2ATCB 4C92D 3MEUA 4XQ3A 2CSQA 3EGDB 2MMPA 2RHZA 2JTFA 1M8VA 3CD6Q 4J83A 1EIFA 3MEVA 1G83A 2VUBA 2ESWA 4EMKC 5GANj 2DEQA 5CAIA 4N0AA 2JMCA 4CRIA 2KRSA 4QT7A 3M9QA 3OW2A 1ARKA 3FLGA 4QW2A 2PNIA 1YFNA 2DIGA 1KQSP 4FW1A 2QA4A 1X2QA 4KUIA 4C92G 4ZGJB 2XG8D 1MHNA 2E6NA 3I56Q 1ACMB 1AWOA 4RKUE 1GL5A 3G71A 1JB0E 2WSEE 3H9NA 3M0SA 1D0YA 4RUGA 2BUDA 1BI1A 1RI0A 3JCMe 1W6XA 3EG2A 1KQSS 3JSCA 3CEYA 2O88A 1V1CA 3CCET 1VQ7A 5J39A 4A54A 4C5EA 1DJ7B 4BI8B 3HHTB 2LDMA 1PG5B 4BE0A 1UEBA 1IXDA 3CBPA 3CMAQ 1NG2A 1AOJA 3V8KA 2FPEA 3EGDA 1XTDA 2DFUA 4E7ZA 1B07A 3DKMA 4NOYA 3VS4A 2QQBA 2BKDN 2Y4YA 2DD4A 4M4ZA 1X6GA 1XJWB 1VQOT 4Y92A 4JLIA 1Z9ZA 4XU1A 2DJZA 1BCOA 4L5GA 2BE7D 5L8RE 1D09B 1BK2A 3FB9A 3ZEHA 1LJOA 4BDYA 1KD1C 3E2UA 3LGFA 4AG2C 4M7DC 2X4WA 2J05A 3GF5A 2YWWA 2RMOA 1YJWQ 3NTKA 4M77F 1YIJT 3T9NA 3CPWS 2XIDA 2M1HA 3UPUA 1NJIU 1Q86C 3QJ6A 2HL3A 3JCMQ 4KULA 3JCMc 2V8JA 3H0HA 1G3TA 2RJDA 1Q82U 3TSWA 4OMMA 1PSEA 2RNAA 4XTUA 1WIEA 1NJIR 1KG1A 2HKQB 4O6JA 1E6HA 5GMKi 1YJNA 1QVFA 2RJEA 3QYHB 2EJGA 1Q81C 3QZ5B 3G4SA 1PHTA 1Q82R 4FL6A 1GBRA 4M78C 1WZOA 2DBMA 3AT1B 5FLXE 5HK3A 2O9VA 3P8HA 3X26B 4JRQA 3VRZA 3ZL7C 1KK7A 3CPFA 4YTLA 1BIBA 1VA7A 3U23A 4AFQC 2VB6A 2MCNA 3MP8A 2EYWA 2WACA 3RBBB 2YDLA 2AKKA 2VXEA 4JJBA 3CC2A 2H3EB 4C92F 4GBQA 4PNOA 4ORZA 2AIRB 2J7IA 2PQWA 5LL6S 3PGGA 5ECAA 2QQSA 2YRVA 3H0FA 4OMOA 5HY6A 5CKFA 2OAUA 1VQ9T 5LJ3f 4D6WA 3M53A 4EMHA 1UE9A 1S1NA 4QVDA 2V1RA 4ELYC 3CCEQ 3DB3A 5A2QE 5CKHA 3NHNA 1BKBA 3C94A 2RO0A 3JB9G 3BY7A 2ZPGB 2LNHB 3M55A 4OGEA 2FZCB 1AVZC 2L3RA 3WVDB 2O01E 3QO3A 1QVPA 5GAN8 1KJWA 2DX1A 2HSPA 3J7AF 1K9MU 2KMTA 4O5VA 4HA8A 5IHIA 2OI3A 5GMKh 1VQOQ 2NLUA 2CZ6B 4LE9A 1VQ8T 1NM7A 2P4TA 2CH4W 2QI2A 2CP7A 3FRNA 1K9MR 3OYAA 1X6OA 2RPNA 3TREA 4LDUA 4OB0B 2HL5C 5HKCA 1FMKA 2MOXA 3PIOA 2EKHA 3OY9A 3MPUB 3OQ5A 3EH2A 4ANJA 4KUDK 3OMGA 4RCCA 2F2WA 2QAZA 1G5VA 3X20B 4OB3B 1ZUYA 3VS6A 3OYNA 2O9SA 4CC7A 2R5AA 4DA4A 1TOVA 2DEUA 1M90R 5GAOp 5GAN4 1WQ7A 4OGCA 1KQ1A 5GMKl 4J8OA 2MIOA 3JB9I 1TXQA 1VQKT 2XDPA 2QQRA 4M7DG 3L2ZA 1FX7A 1Y96B 4PJOC 2EW3A 1VUBA 2DXBA 2BIVA 2KQWA 2GTOA 2WSFE 3VS3A 1PNJA 1K8AU 2DTOA 2ROTA 3CPWA 2QYZA 4HCCA 1K1ZA 4C92B 3CCRA 1XQHA 3GP8A 3SFMA 3UDCA 5IHKA 1VQ4A 1U8RA 4XU3A 4JS4A 2DBKA 1H3ZA 1O9SA 1GCPA 2LP5A 1G3SA 2HBPA 1K8AR 3C95A 3MHXA 4JRPA 5GJWB 3SWNC 1ZBJA 2NUTB 1H8KA 1KC8C 1WNLA 2QTXA 5GAMf 1MMDA 3SDZA 4JZ3A 1VQLA 4OMNA 4C0DC 1IB8A 3QYGB 2DPPB 1BI2A 4AFZC 4B9WA 4BD3A 1RAGB 2DVEA 4C0GA 3JB9F 1NYFA 2ABLA 3NGPA 2BZYA 3OW2P 1Y96A 4LD9K 2PVOB 1ABQA 4DBQA 5LJ3e 4M77E 2WSCE 3EGUA 1Q7YC 5GAN3 3OS1A 3V7SA 4IIOA 4CC4B 2XU8A 1LPLA 4WCIA 1OZ3A 2A28A 5L23A 4C92A 4ZTJA 1TSFA 2CZ1B 4LDVA 1S72T 2DYBA 3VS0A 3P8BB 4A4KA 2L0AA 2YRCA 3KBGA 1MV0B 3JCMV 2E65A 1CKAA 3TCJA 4C0ZA 1OU8A 2CGHA 3CC7A 2ZAEA 2PVDB 1QW1A 2HCKA 2HQEA 1T3LA 2JZ2A 1V76A 1VQNT 2A0FB 1KD1R 4QVCA 1OU9A 1JEGA 1BIAA 2C0TA 2GTJA 2COYA 3NPFA 2DK3A 1SPKA 1UB4A 4BDZA 2EQMA 5DY9A 1AWXA 3RNJA 4R56A 2P4RA 3EG9B 3CCLT 1C6VX 1AZGB 4C92E 1Y0MA 2LJ1A 2E5KA 3LYIA 4IIMA 3RR6A 2CP3A 4L6V5 2LX7A 3OYMA 1NLPC 5KYXB 3JCMf 3L2WA 2O2OA 2HMAA 1VQKQ 1QCOA 1MGQA 1OPLA 2DVJA 4ME7A 4M7DF 1ZA2B 3KUFA 2M0OA 2RQWA 3I56T 2CKKA 4XTVA 2EYXA 2CREA 3GNGA 2A36A 3P8DA 1WGSA 4RTUA 1WJSA 2ED0A 2CDTA 4ZN1A 4FCYA 2DMOA 2YLBA 4N4HA 2QQAA 4J9BA 4Z02A 2D6FA 2DRKA 2FG0A 2KRMA 3INZA 3S3NA 2M02A 3JRZA 3M0QA 1QWEA 4HCBA 4FU6A 1SEMA 3LWHA 1AWWA 3EAEA 3CCSA 3FIFA 4X34A 1JBMA 2FB7A 3I55T 1QVFP 2ZPBB 2LT1A 4JUVA 3CC4A 2DLPA 2OAWA 2QA4Q 4CC3A 2LX9A 2DRMA 4NL2A 5GAOl 3EG9A 4PJOG 5DLOA 4EMKB 3TQ7P 2J6OA 4HVWA 3D7SB 5KYXA 1VYVA 2B8AA 2EGCA 4IKFA 2KRNA 1QVFS 2YLCA 2MPXC 4F16A 5A0GA 5GMKj 4C5GA 5GAMe 3OYGA 1SSFA 2DAQA 2A7YA 1FMWA 3R6OA 3E9GA 2K2VA 4Z88A 3FJ5A 5CR2A 1JXMA 4C8QG 2RJCA 1YJWT 1FWZA 2F1LA 1HXDA 2RA2A 1E6GA 1QKXA 2ROLA 2XDBA 4HXJA 1E7OA 4XTWA 1S72Q 3E1SA 1VIEA 2LQKA 2OTLA 2CSIA 1IO6A 1K9AA 4JRKA 3S3OA 1IHVA 2FYKA 1MMAA 1W2BS 2DZ9A 4M7AC 1QMCA 1RABB 2XD0A 1VQ6T 2ZPEB 4A4GA 2K9GA 1NYGA 3CCQT 3GBQA 5GAN7 1NPRA 5C0MA 2I2LA 4EMKA 4BI4A 1VQNQ 2QTVA 4PJJA 3VS2A 2C0IA 2X35A 1OV3A 1M5Q1 2V1QA 2JVVA 4M75D 1YHQA 1ZHIA 3QPHA 2LC4A 4J9GA 3TU4K 1JRIA 2P0PA 2YUNA 3X28B 5IXFA 3CCLQ 3CMET 4JS5A 3QWXX 1MMNA 2XICA 4DEYA 4WF2A 4M7DB 4J6XA 1JU5C 4RTTA 5IXBA 4OB2B 2CZ7B 1QQJA 3JCMd 1WHLA 2XMFA 3OS5A 1WPYA 4M75G 3H8ZA 1VQPA 1C1AA 5LJ5e 2OTJT 3Q1JA 1B7TA 2JS0A 1ZA1B 2KK4A 3GPLA 1M30A 2DXCA 1M2OA 2X51A 2DXUA 4D8DA 3TEEA 4XAXB 3VS7A 1H92A 2EQUA 2YUOA 2IPOB 3JCMh 1I1JA 1VQ5A 3HFOA 4F14A 3RKWA 4MMLA 4M78B 3I55Q 4QQDA 1ZBXA 3JCMg 3A8MB 1RAEB 3S3MA 1VQMA 5CO7A 3DLLA 3H6ZA 2ZZDA 4PJOF 2CT3A 1CSKA 3MKDA 2H8HA 4M7DA 5FROA 4CC2A 1YJ9T 1KC8R 1WI7A 1TU0B 3CPWP 1TS9A 1K0XA 1WXBA 1N5ZA 3DLMA 2E3HA 3JV3A 3VRYA 2RHUA 4IUQA 2Y90A 4DBHA 5DM7R 2QASA 3LGLA 2NYSA 2DA9A 4RCBA 4C8QF 5GAOq 5KCHA 3MP1A 4FIBA 2XDDA 1B34B 1WHGA 3JCMX 1JO8A 4J6YA 3I5SA 2GQIA 2ZPIB 2K3BA 2RK1A 3VKIA 1N8RU 1U06A 1SRMA 1OI1A 2JM9A 4RG8A 1UGRB 1AWJA 1M1KC 4M78A 4OP0A 1HJDA 2VC8A 2FRYA 1VQ6Q 4AFSC 1NEGA 1WHJA 1F1BB 3CCQQ 3CD6A 4ZTFA 3G1JA 1NZ9A 3OMCA 1YITT 3A8HB 4Y91A 4M7DE 1X43A 1N8RR 1PCXA 2OX7A 2VV5A 3OYEA 4KBMB 2EJ9A 4IUUA 4B9XA 1RUWA 1BU1A 3EG0A 1OX8A 2GF7A 5IHNA 2YHTA 3CMEQ 3JCMW 4OMLA 4N4IA 3KXTA 1PSFA 1PKTA 1NPPA 3DB4A 4MDWA 4ZGEB 1BBZA 1B34A 1W70A 2B86A 3ZFJA 4M7AG 4LDXA 4P5NA 3GLXA 4II1A 2DF6A 2EVRA 1W2BA 4J7IA 3JB9J 1T0HA 1X69A 2RHYA 3JB9D 1GCQC 2M0YA 4RTZA 4KRTA 4M75F 2A37A 3BFMA 3CCMT 4J5YA 3CMAA 2OTJQ 1D0ZA 1SHFA 3JAME 2LQWA 2G6FX 2RQRA 1KFZA 3FJPA 1UUEA 2F5TX 2E10A 1K73U 3VYGA 1QWFA 1WHMA 5HCKA 1SF9A 3OS0A 1YWPA 2CP6A 1NE8A 2GQVA 2EGEA 1M3AA 2HSEB 4RTXA 1SG5A 4X9DA 4AG1C 4Y28E 3CCJA 4R55A 3PT9A 1K73R 4PJOB 4XU0A 2BTTA 5A0DA 3CCUT 4ESRA 2IVWA 3MJXA 3CCVA 2HNIA 2K3XA 3H41A 2GFUA 2GBQA 3OYBA 5GAN6 5GAOr 2KE9A 4QVZA 2J6KA 3EH1A 4J9HA 3A1PA 3PVLA 4J9CA 1KIKA 1YJ9Q 4OVAA 3EFRA 1HK9A 3RKXA 5D6YA 1WA7A 3QBYA 2E64A 4PLIA 4KGVB 4C8QB 2KEAA 2NUZA 2KR3A 1UJYA 2XKOC 5AYFA 1UDLA 1CKBA 2LCCA 3SWNB 1YI2A 2CP5A 5GAN5 4IURA 4RTYA 2RJFA 1M90U 2FHDA 1WQWA 3HRUA 1I4K1 4BE2A 4DBFA 3G6ET 2PUOB 5I21A 1QP2A 3RDVA 4M7DD 3V8JA 2HZYA 1U5SA 3J81E 2VYTA 3C12A 2LCLA 2O31A 2Y4XA 3L2VA 4ATOA 1QLYA 2NUPB 4PJOA 1YITQ 4FYVB 4LDYA 1U1SA 1D1AA 1M8MA 1QP3A 1YBYA 3FC3A 2MF2A 2E5QA 2RK2A 1M1GA 3CC7Q 4MMKA 1Y7XA 2JJ9A 4E7IA 5FU7B 4C8QA 5GANe 3PVQA 4L59A 1WXTA 3CBMA 4PJNA 3QUIA 2QEXT 4M78D 1MNDA 3SWNA 2EQKA 2CH4A 1RLPC 4V2SA 2YSQA 4M7AF 3PIPA 4M75B 1D3BB 3CCEA 3OYHA 1TUDA 2ENMA 3HRTA 2RQTA 3CCMQ 2DTIA 4X1VA 2YUPA 2K57A 4M78G 2QA4T 2NUPA 3CXCA 2P0KA 5LJ3d 3I35A 2DM1A 3G71T 2GFAA 2K5LA 1VQOA 3M0PA 4M77C 4E2FB 2DJQA 5CK9A 3MCAB 2DETA 1GFDA 5CIUA 2CUDA 1IRXA 4C8QE 1BYMA 2G3RA 2R58A 3OS2A 1EX4A 1M27C 2VKNA 1M2VB 1VQ7T 2RD1A 3CCUQ 4QKUA 1LCKA 3RERA 2F5KA 2PZ1A 1SKUB 4JDSA 4OF1A 1ZUUA 5LJ3h 4F17A 1YNZA 4R0KA 4JRIA 3SHWA 1QVGS 1N9RA 3NTHA 2EPDA 2JXBA 1YIJA 5LJ3g 4M75A 1D3BA 1OZ2A 1WJRA 3VV0A 1GFCA 3PTAA 1X75C 2DL7A 2D1XA 4LUEA 1KD1U 2M9UA 2DXTA 4BY6C 1BI0A 1RLQC 4F7UG 3I5RA 1PC0A 1VIFA 4FM4B 2VXFA 3E19A 2RN8A 2AZVA 4PFOA 1ZX6A 5CQXA 2CP2A 2JT4A 2HQXA 5D6WA 2JS2A 1NJIC 2EKOA 1Q86U 2PTKA 1IGQA 1PKSA 1X27A 4JJDA 3G6EQ 5I2SA 4E7KA 4DEXA 3C0CA 1MNEA 2E41A 1Q82C 5I11A 4C92C 3V7CA 2L3QA 5A0LA 5FU6B 3EG3A 3M0RA 1M2VA 1RAHB 4ELZC 4IUTA 1M9SA 2DTHA 3UWNA 1Q86R 3JCMJ 3HKSA 1NLOC 2OTLQ 5LJ5f 2K6DA 4FSSA 3QSUA 1Q81U 2H3JA 4M75E 2DIQA 4EDUA 2BE9B 3L42A 2P84A 3LWIA 2LNVA 2JUFA 4GLKA 2QQ9A 2LQNA 1LNXA 1FMVA 1IGUA 1YJNT 5D6XA 2HD0A 1VOMA 2SEMA 1ZSZB 1RACB 3A8LB 4RMOA 1R8OB 3HPWA 3UA6A 1Q81R 3MO8A 2JN0A 2QK0A 3G4ST 2QEXQ 2EAYA 4BACA 3REAB 4M7AB 1C0MA 1VQ9A 2EBPA 4PJOD 1UGVA 4FT2A 1R0CB 5HK0A 5GAN2 3L1AA 1X2KA 3QWYA 2HEQA 6AT1B 1PRMC 4NL3A 3PMIA 5FWBA 2QGFB 3RUXA 2BZXA 2EWNA 4XU2A 2LRQA 2FL7A 3CC2T 2AHJB 4M78F 2CYZB 2SRCA 1SHGA 3M59A 2EYZA 3E9FA 2KT8A 3A8OB 4C8QD 1ZLMA 2VGNA 5GAMd 2KNBB 3MP6A 3OBYA 3G71Q 3PE0A 1WJQA 1A0NB 2VVKA 3MEWA 2ZPFB 1MMGA 2L2PA 3A98A 1VQ8A 4XTXA 1K0SA 4XK8E 1JJ2S 2C0OA 1T0JA 4E7LA 3JCMb 3OYLA 2LVMA 1BB9A 1VQ7Q 4CI0C 3EHRA 1K9MC 4PKCC 1QCFA 4E7SA 1ZSZA 1LVKA 5I22A 2E12A 4LUDA 1W2BP 4D8KA 3OYKA 3BW1A 2YRDA 3RMSA 5GAMh 4M7AA 4BB7A 2PVGB 4PFZA 4BUGA 4LXCA 5KH6A 1BI3A 3M4GA 5GAMg 3EFOB 1G8XA 1TG0A 2GGRA 2AKLA 3HFNA 1I07A 2MWPA 3M57A 4F7UF 3META 2RI2A 3OSVA 4UC4A 2YT6A 2KYMA 4E6RA 4F04B 4ZNXA 3VUZA 3GOXA 2MI6A 1PRLC 2QDLA 3QZ9B 1Y71A 2CS7A 2LCSA 1N9SA 3UATA 2FVUA 5GJVB 1ZUKA 2J6FA 3TSZA 2D0QB 1QKWA 4OB1B 1VQKA 1OX9A 2D0NA
chains in the Genus database with same CATH topology
1PWTA 1WXUA 1NEBA 3ULRB 1K4US 3IQLA 4RTVA 3LH5A 2K79A 1RUWA 2MIOA 2JW4A 1BU1A 3EG0A 4OMPA 5IHNA 2EW3A 2AK5A 4OMLA 1H3HA 2KYBA 1PKTA 5EC7A 2GTOA 1BBZA 1W70A 2B86A 1WDXA 2FO0A 1UG1A 3VS3A 1PNJA 2ROTA 2DF6A 2EVRA 2KROA 5FWCA 1T0HA 1X69A 1K1ZA 1GCQC 2M0YA 4RTZA 4KRTA 4GLMA 2A37A 5IHKA 2L3PA 2DBKA 1SHFA 2K2MA 2ED1A 2AZSA 1GCPA 2LZ6B 2LP5A 2LQWA 2G6FX 2RQRA 1KFZA 1UUEA 1TUCA 2D8HA 5GJWB 2KXDA 1ZBJA 1QWFA 2IIMA 5HCKA 1H8KA 1YWPA 2EGEA 1M3AA 4JZ3A 1WLPB 1ZSGA 1G2BA 4RTXA 4OMNA 4AG1C 3VS1A 2KBTA 2JMAA 1UFFA 2DL8A 1EFNA 3M0TA 2BTTA 4AFZC 1AEYA 4ESRA 4J9DA 2VWFA 2JTEA 3SEMA 3H41A 1NYFA 2GBQA 2ABLA 3NGPA 1KSWA 2BZYA 1Z9QA 2KE9A 1ABQA 2X3WD 2J6KA 3EGUA 1OEBA 4J9HA 4K11A 3PVLA 4J9CA 2KGTA 2F2XA 1KIKA 4LNPA 3TVTA 4IIOA 2FPDA 4CC4B 1HSQA 1WA7A 4WCIA 2A28A 5L23A 2CUBA 1YCSB 4HCKA 2KEAA 2NUZA 3UA7A 2KR3A 1UJYA 1UDLA 1CKBA 3THKA 2DYBA 1B3QA 3VS0A 1HD3A 1J3TA 4RTYA 2L0AA 1MV0B 1WYXA 2FEIA 1CKAA 2OJ2A 2GNCA 2YUQA 1K76A 3VS5A 2HCKA 1T3LA 4J9FA 4AFUC 1U5SA 2LMJA 2DL4A 2O31A 2J06A 2FRWA 1T3SA 3UF4A 1QLYA 1SRLA 1JEGA 2DL5A 2C0TA 2RF0A 2L3SA 2GTJA 1W1FA 3NPFA 1AZEA 1JQQA 1SPKA 2CT4A 2I0NA 1ABOA 1WX6A 2EGAA 1UECA 1AWXA 3RNJA 2P4RA 2LJ0A 1M8MA 3I9QA 1AZGB 1GCQA 1WFWA 2CSQA 1Y0MA 4HVUA 2LJ1A 2E5KA 2DILA 4IIMA 2LX7A 1M3CA 1NLPC 2HBWA 1G83A 4JPBW 2ESWA 2O2OA 1VYUA 1OPLA 2DVJA 3PVQA 2JMCA 2KRSA 4QT7A 1WXTA 1ARKA 1U3OA 1GRIA 2RQWA 3R6NA 2PNIA 2EYXA 2CH4A 2CREA 2DL3A 2A36A 1RLPC 4RTUA 1FYNA 1X2QA 2YSQA 2ED0A 2CDTA 2DMOA 4J9BA 2DNUA 1AWOA 2DRKA 2FG0A 2KRMA 1GL5A 1TUDA 2ENMA 3M0QA 3M0SA 4RUGA 1QWEA 2RQTA 1SEMA 4X1VA 1AWWA 2YUPA 1W6XA 3EG2A 2O88A 2LJ3A 3EG1A 1V1CA 3I35A 2DM1A 2DLPA 2OAWA 3M0PA 4CC3A 3H0IA 2DRMA 2DJQA 1NG2A 1GFDA 2CUDA 1AOJA 1SSHA 2FPEA 2J6OA 2W10A 1M27C 4HVWA 2VKNA 1B07A 3VS4A 4EIKA 1VYVA 1LCKA 2EGCA 2KRNA 4M4ZA 4F16A 1X6GA 2PZ1A 4Y92A 1ZUUA 1Z9ZA 1YP5A 4F17A 1XOVA 1YNZA 4R0KA 3SHWA 2F2VA 4Z88A 2EPDA 3FJ5A 1JXMA 2JXBA 4LN2A 1GFCA 1BK2A 2DL7A 2D1XA 1E6GA 2M51A 4LUEA 1QKXA 1RLQC 4AG2C 2ROLA 3I5RA 2J05A 1E7OA 4HXJA 4Z8AA 1UHFA 2RMOA 2RN8A 2AZVA 1YN8A 2CSIA 1IO6A 1K9AA 1ZX6A 2JT4A 2JS2A 2JM8A 4JZ4A 2PTKA 1PKSA 2K9GA 1NYGA 1UHCA 1X27A 4JJDA 3GBQA 1I0CA 5FW9A 2KXCA 4DEXA 3C0CA 2DE0X 3H0HA 5I11A 3TSWA 4OMMA 1OPKA 2L3QA 2RNAA 3EG3A 3M0RA 3VS2A 2C0IA 2FPFA 1WIEA 1E6HA 1OV3A 2V1QA 1NLOC 2K6DA 4FSSA 2K7AA 1PHTA 1GBRA 4J9GA 2DBMA 2A08A 2YUNA 5IXFA 2O9VA 3QWXX 2NWMA 2LQNA 4DEYA 3VRZA 4J9IA 3ZL7C 1MUZA 4OMQA 2SEMA 1JU5C 4RTTA 5IXBA 1VA7A 3KFVA 3U23A 3UA6A 4AFQC 2MCNA 2EYWA 2RQVA 3REAB 3RBBB 2XMFA 2YDLA 2AKKA 2EBPA 2D8JA 4JJBA 1UGVA 1JXOA 4J9EA 1VYTA 2JS0A 4GBQA 4ORZA 4JJCA 1X2KA 3QWYA 1X6BA 2HEQA 1M30A 1PRMC 2J7IA 5FWBA 4RTWA 2BZXA 5ECAA 4D8DA 3O5ZA 4OMOA 3H0FA 3VS7A 2X3XD 1H92A 2YUOA 1OOTA 1I1JA 1UE9A 1S1NA 1M3BA 2SRCA 1SHGA 2V1RA 2EYZA 4F14A 2KT8A 3NMZC 1ZLMA 2KNBB 2EQIA 3NHNA 3PE0A 1YWOA 1A0NB 2LNHB 2VVKA 2L2PA 3A98A 1AVZC 3EHQA 1K0SA 2CT3A 2C0OA 2W0ZA 1KJWA 1T0JA 1CSKA 2DX1A 2HSPA 2H8HA 2EYYA 1BB9A 4A63B 4CC2A 3EHRA 2HDAA 1QCFA 2BZ8A 1WI7A 4Z89A 5IHIA 2OI3A 5I22A 1K0XA 4LUDA 1WXBA 1N5ZA 1RI9A 3JV3A 4D8KA 3M0UA 3VRYA 1MV3A 2ECZA 1AD5A 4LE9A 3REBB 1NM7A 2CH4W 2RQUA 2DA9A 2RPNA 3CQTA 1TG0A 2GGRA 2AKLA 1JO8A 1FMKA 1I07A 2MOXA 3I5SA 1GBQA 4HVVA 2GQIA 2YT6A 2K3BA 2EKHA 2KYMA 4E6RA 4ZNXA 1U06A 1SRMA 2JM9A 1AWJA 1PRLC 2QDLA 1Y57A 1HJDA 2KT1A 2FRYA 4AFSC 2LCSA 3UATA 5IH2A 1NEGA 1UJ0A 2F2WA 5GJVB 1ZUKA 2J6FA 3TSZA 1UTIA 1ZUYA 1QKWA 3VS6A 2O9SA 4CC7A 1X43A 2D0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PWT A;  1WXU A;  1NEB A;  3ULR B;  1K4U S;  3IQL A;  4RTV A;  3LH5 A;  2K79 A;  1RUW A;  2MIO A;  2JW4 A;  1BU1 A;  3EG0 A;  4OMP A;  5IHN A;  2EW3 A;  2AK5 A;  4OML A;  1H3H A;  2KYB A;  1PKT A;  5EC7 A;  2GTO A;  1BBZ A;  1W70 A;  2B86 A;  1WDX A;  2FO0 A;  1UG1 A;  3VS3 A;  1PNJ A;  2ROT A;  2DF6 A;  2EVR A;  2KRO A;  5FWC A;  1T0H A;  1X69 A;  1K1Z A;  1GCQ C;  2M0Y A;  4RTZ A;  4KRT A;  4GLM A;  2A37 A;  5IHK A;  2L3P A;  2DBK A;  1SHF A;  2K2M A;  2ED1 A;  2AZS A;  1GCP A;  2LZ6 B;  2LP5 A;  2LQW A;  2G6F X;  2RQR A;  1KFZ A;  1UUE A;  1TUC A;  2D8H A;  5GJW B;  2KXD A;  1ZBJ A;  1QWF A;  2IIM A;  5HCK A;  1H8K A;  1YWP A;  2EGE A;  1M3A A;  4JZ3 A;  1WLP B;  1ZSG A;  1G2B A;  4RTX A;  4OMN A;  4AG1 C;  3VS1 A;  2KBT A;  2JMA A;  1UFF A;  2DL8 A;  1EFN A;  3M0T A;  2BTT A;  4AFZ C;  1AEY A;  4ESR A;  4J9D A;  2VWF A;  2JTE A;  3SEM A;  3H41 A;  1NYF A;  2GBQ A;  2ABL A;  3NGP A;  1KSW A;  2BZY A;  1Z9Q A;  2KE9 A;  1ABQ A;  2X3W D;  2J6K A;  3EGU A;  1OEB A;  4J9H A;  4K11 A;  3PVL A;  4J9C A;  2KGT A;  2F2X A;  1KIK A;  4LNP A;  3TVT A;  4IIO A;  2FPD A;  4CC4 B;  1HSQ A;  1WA7 A;  4WCI A;  2A28 A;  5L23 A;  2CUB A;  1YCS B;  4HCK A;  2KEA A;  2NUZ A;  3UA7 A;  2KR3 A;  1UJY A;  1UDL A;  1CKB A;  3THK A;  2DYB A;  1B3Q A;  3VS0 A;  1HD3 A;  1J3T A;  4RTY A;  2L0A A;  1MV0 B;  1WYX A;  2FEI A;  1CKA A;  2OJ2 A;  2GNC A;  2YUQ A;  1K76 A;  3VS5 A;  2HCK A;  1T3L A;  4J9F A;  4AFU C;  1U5S A;  2LMJ A;  2DL4 A;  2O31 A;  2J06 A;  2FRW A;  1T3S A;  3UF4 A;  1QLY A;  1SRL A;  1JEG A;  2DL5 A;  2C0T A;  2RF0 A;  2L3S A;  2GTJ A;  1W1F A;  3NPF A;  1AZE A;  1JQQ A;  1SPK A;  2CT4 A;  2I0N A;  1ABO A;  1WX6 A;  2EGA A;  1UEC A;  1AWX A;  3RNJ A;  2P4R A;  2LJ0 A;  1M8M A;  3I9Q A;  1AZG B;  1GCQ A;  1WFW A;  2CSQ A;  1Y0M A;  4HVU A;  2LJ1 A;  2E5K A;  2DIL A;  4IIM A;  2LX7 A;  1M3C A;  1NLP C;  2HBW A;  1G83 A;  4JPB W;  2ESW A;  2O2O A;  1VYU A;  1OPL A;  2DVJ A;  3PVQ A;  2JMC A;  2KRS A;  4QT7 A;  1WXT A;  1ARK A;  1U3O A;  1GRI A;  2RQW A;  3R6N A;  2PNI A;  2EYX A;  2CH4 A;  2CRE A;  2DL3 A;  2A36 A;  1RLP C;  4RTU A;  1FYN A;  1X2Q A;  2YSQ A;  2ED0 A;  2CDT A;  2DMO A;  4J9B A;  2DNU A;  1AWO A;  2DRK A;  2FG0 A;  2KRM A;  1GL5 A;  1TUD A;  2ENM A;  3M0Q A;  3M0S A;  4RUG A;  1QWE A;  2RQT A;  1SEM A;  4X1V A;  1AWW A;  2YUP A;  1W6X A;  3EG2 A;  2O88 A;  2LJ3 A;  3EG1 A;  1V1C A;  3I35 A;  2DM1 A;  2DLP A;  2OAW A;  3M0P A;  4CC3 A;  3H0I A;  2DRM A;  2DJQ A;  1NG2 A;  1GFD A;  2CUD A;  1AOJ A;  1SSH A;  2FPE A;  2J6O A;  2W10 A;  1M27 C;  4HVW A;  2VKN A;  1B07 A;  3VS4 A;  4EIK A;  1VYV A;  1LCK A;  2EGC A;  2KRN A;  4M4Z A;  4F16 A;  1X6G A;  2PZ1 A;  4Y92 A;  1ZUU A;  1Z9Z A;  1YP5 A;  4F17 A;  1XOV A;  1YNZ A;  4R0K A;  3SHW A;  2F2V A;  4Z88 A;  2EPD A;  3FJ5 A;  1JXM A;  2JXB A;  4LN2 A;  1GFC A;  1BK2 A;  2DL7 A;  2D1X A;  1E6G A;  2M51 A;  4LUE A;  1QKX A;  1RLQ C;  4AG2 C;  2ROL A;  3I5R A;  2J05 A;  1E7O A;  4HXJ A;  4Z8A A;  1UHF A;  2RMO A;  2RN8 A;  2AZV A;  1YN8 A;  2CSI A;  1IO6 A;  1K9A A;  1ZX6 A;  2JT4 A;  2JS2 A;  2JM8 A;  4JZ4 A;  2PTK A;  1PKS A;  2K9G A;  1NYG A;  1UHC A;  1X27 A;  4JJD A;  3GBQ A;  1I0C A;  5FW9 A;  2KXC A;  4DEX A;  3C0C A;  2DE0 X;  3H0H A;  5I11 A;  3TSW A;  4OMM A;  1OPK A;  2L3Q A;  2RNA A;  3EG3 A;  3M0R A;  3VS2 A;  2C0I A;  2FPF A;  1WIE A;  1E6H A;  1OV3 A;  2V1Q A;  1NLO C;  2K6D A;  4FSS A;  2K7A A;  1PHT A;  1GBR A;  4J9G A;  2DBM A;  2A08 A;  2YUN A;  5IXF A;  2O9V A;  3QWX X;  2NWM A;  2LQN A;  4DEY A;  3VRZ A;  4J9I A;  3ZL7 C;  1MUZ A;  4OMQ A;  2SEM A;  1JU5 C;  4RTT A;  5IXB A;  1VA7 A;  3KFV A;  3U23 A;  3UA6 A;  4AFQ C;  2MCN A;  2EYW A;  2RQV A;  3REA B;  3RBB B;  2XMF A;  2YDL A;  2AKK A;  2EBP A;  2D8J A;  4JJB A;  1UGV A;  1JXO A;  4J9E A;  1VYT A;  2JS0 A;  4GBQ A;  4ORZ A;  4JJC A;  1X2K A;  3QWY A;  1X6B A;  2HEQ A;  1M30 A;  1PRM C;  2J7I A;  5FWB A;  4RTW A;  2BZX A;  5ECA A;  4D8D A;  3O5Z A;  4OMO A;  3H0F A;  3VS7 A;  2X3X D;  1H92 A;  2YUO A;  1OOT A;  1I1J A;  1UE9 A;  1S1N A;  1M3B A;  2SRC A;  1SHG A;  2V1R A;  2EYZ A;  4F14 A;  2KT8 A;  3NMZ C;  1ZLM A;  2KNB B;  2EQI A;  3NHN A;  3PE0 A;  1YWO A;  1A0N B;  2LNH B;  2VVK A;  2L2P A;  3A98 A;  1AVZ C;  3EHQ A;  1K0S A;  2CT3 A;  2C0O A;  2W0Z A;  1KJW A;  1T0J A;  1CSK A;  2DX1 A;  2HSP A;  2H8H A;  2EYY A;  1BB9 A;  4A63 B;  4CC2 A;  3EHR A;  2HDA A;  1QCF A;  2BZ8 A;  1WI7 A;  4Z89 A;  5IHI A;  2OI3 A;  5I22 A;  1K0X A;  4LUD A;  1WXB A;  1N5Z A;  1RI9 A;  3JV3 A;  4D8K A;  3M0U A;  3VRY A;  1MV3 A;  2ECZ A;  1AD5 A;  4LE9 A;  3REB B;  1NM7 A;  2CH4 W;  2RQU A;  2DA9 A;  2RPN A;  3CQT A;  1TG0 A;  2GGR A;  2AKL A;  1JO8 A;  1FMK A;  1I07 A;  2MOX A;  3I5S A;  1GBQ A;  4HVV A;  2GQI A;  2YT6 A;  2K3B A;  2EKH A;  2KYM A;  4E6R A;  4ZNX A;  1U06 A;  1SRM A;  2JM9 A;  1AWJ A;  1PRL C;  2QDL A;  1Y57 A;  1HJD A;  2KT1 A;  2FRY A;  4AFS C;  2LCS A;  3UAT A;  5IH2 A;  1NEG A;  1UJ0 A;  2F2W A;  5GJV B;  1ZUK A;  2J6F A;  3TSZ A;  1UTI A;  1ZUY A;  1QKW A;  3VS6 A;  2O9S A;  4CC7 A;  1X43 A;  2D0N A; 
#chains in the Genus database with same CATH topology
 3L2U A;  1WXU A;  2QDY B;  2MAM A;  1NEB A;  2E3I A;  3QDR B;  2KAF A;  2MWO A;  1QVG A;  4M7A E;  1K4U S;  1N27 A;  3LH5 A;  4QQG A;  3OB9 A;  3QJY A;  4E47 A;  5CKE A;  5LJ5 d;  2QXF A;  3FEO A;  3JCM P;  4HT9 A;  2CZ0 B;  2AK5 A;  3HL8 A;  2KYB A;  3BDU A;  3EFO A;  5EC7 A;  2RB6 A;  1YJN Q;  2LTO A;  1WDX A;  2XHC A;  2FO0 A;  1K8A C;  5KYW B;  3G4S Q;  2KRO A;  2X4J A;  4E7H A;  3M4Y A;  2D9T A;  5LJ5 h;  8ATC B;  2ED1 A;  2L5Q A;  4DBR A;  4N0A C;  3F70 A;  1IHW A;  4LD6 A;  5LJ5 g;  3M5A A;  2KXD A;  2KY9 A;  2IIM A;  2R5M A;  3CCR T;  1XNI A;  1KC8 U;  1VQ4 T;  4ZN3 A;  3CC2 Q;  1WLP B;  8AT1 B;  1G2B A;  3OYI A;  1O75 A;  4RG2 A;  3GIB A;  1UFF A;  2DL8 A;  3LW5 E;  1EFN A;  3QKJ A;  2DD5 A;  4J9D A;  2RM4 A;  2VWF A;  2JTE A;  3PMT A;  4DQ2 A;  2V8I A;  5LJ3 j;  1I5L A;  3LX7 A;  1KHI A;  1VQL T;  1S72 A;  1Q7Y U;  2COW A;  2F2X A;  4WTO B;  1RAF B;  2FPD A;  4A4E A;  4XTZ A;  5KYW A;  2EYQ A;  2PUK B;  1HSQ A;  2CUB A;  1YCS B;  4HCK A;  3CCJ Q;  3UA7 A;  2E70 A;  4ZGD B;  3S6W A;  3QG1 A;  4VUB A;  1Q7Y R;  4GY5 A;  1D1B A;  1QCN A;  3A5Z B;  3CCV Q;  4XTY A;  1LOJ A;  4F7U B;  1VQN A;  1J3T A;  3CXC P;  1WYX A;  4MDX A;  1W4S A;  2OJ2 A;  3ME9 A;  2GNC A;  2YUQ A;  1K76 A;  3HP9 A;  3BDL A;  3VS5 A;  3ER0 A;  4AFU C;  2DL4 A;  5KCO A;  5GAN f;  2FRW A;  1RL2 A;  3CCL A;  3N5B B;  3V8L A;  3CXC S;  1JJ2 A;  4M7A D;  3PNW C;  4C5H A;  2L3S A;  1AZE A;  1JQQ A;  1NBE B;  3UT1 A;  1YI2 Q;  3CC7 T;  2I0N A;  1ABO A;  2Z0W A;  1UEC A;  2LJ0 A;  2R57 A;  3M54 A;  3I56 A;  3I9Q A;  4DOV A;  1GCQ A;  1WFW A;  4HVU A;  2EFI A;  2DIL A;  1M3C A;  2HBW A;  4JPB W;  1VYU A;  3HTR A;  5KYU B;  1U3O A;  1GRI A;  3R6N A;  2RHI A;  1TTH B;  3A8G B;  3QHS A;  4M78 E;  2DZC A;  4F7U A;  2DL3 A;  1FYN A;  2O4X B;  5KE2 A;  3I55 A;  2DNU A;  2MYS A;  5IN1 A;  4QQ6 A;  2LJ3 A;  3RMQ A;  2XI9 A;  3EG1 A;  1M4Z A;  5M9O A;  3J80 E;  3CCR Q;  3V7R A;  2EIF A;  1VQ4 Q;  3H0I A;  2A3L A;  3O8V A;  1SSH A;  2X4X A;  4AT1 B;  3CCS T;  5CCA A;  5CQY A;  2F69 A;  4FYW B;  2W10 A;  2EJF A;  2DKG A;  3HSB A;  4EIK A;  1YJW A;  4E7J A;  1RAD B;  3CC4 T;  5KYU A;  4F7U E;  5GMK e;  1YP5 A;  5GAM j;  1XOV A;  1VQL Q;  5IAY A;  2DER A;  2F2V A;  2O4X A;  2FZG B;  3FDR A;  2X9H A;  1UGS B;  4LN2 A;  5D7U A;  1VQ6 A;  2M51 A;  3CCQ A;  1U1T A;  4Z8A A;  1UHF A;  3L2Q A;  3GNF B;  1YN8 A;  4C0D B;  1UGP B;  2K3Y A;  1PM3 A;  4A4H A;  1KQS A;  4M77 B;  2JM8 A;  4JZ4 A;  2LQ8 A;  1UHC A;  2E6Z A;  1I0C A;  5FW9 A;  2KXC A;  3MEA A;  1YIJ Q;  2DE0 X;  5I2M A;  2OTL T;  4BI3 A;  4X9C A;  1OPK A;  1AT1 B;  3CME A;  4J7F A;  1PD0 A;  5GAN d;  3WXM B;  2FPF A;  1WHK A;  1I81 A;  4FW2 A;  2ZGW A;  2L89 A;  1TH7 A;  3OYD A;  4EMG A;  2K7A A;  2A08 A;  1I8F A;  2X4Y A;  1H64 1;  1IZ6 A;  2NWM A;  2OTJ A;  4BY6 B;  4J9I A;  2C06 A;  1MUZ A;  4OMQ A;  3VU3 C;  5GAN h;  1EZZ B;  3KFV A;  1FXX A;  4PFP A;  1YHQ T;  2XK0 A;  5IT9 E;  2RQV A;  3QDF A;  2RI5 A;  1RAA B;  2D8J A;  5GAN g;  5LJ5 j;  1JXO A;  4M77 A;  4PJL A;  4PJO E;  4J9E A;  1VYT A;  5GMK m;  4PJM A;  1BCM A;  4JJC A;  1IRE B;  1TUG B;  1X6B A;  2ZPH B;  3C4S A;  4BE1 A;  4N4G A;  2LT4 A;  4RTW A;  3O5Z A;  2X3X D;  4C8Q C;  1VQP T;  1OOT A;  3EGX B;  1M3B A;  1QVG P;  3WVE B;  3X24 B;  2JNG A;  1I5O B;  3NMZ C;  1YJ9 A;  2VGM A;  1VQ9 Q;  2EQI A;  1YWO A;  3M58 A;  1KQ2 A;  3OYF A;  4TVR A;  3ZBD A;  2L8D A;  5KYY B;  3EHQ A;  2KVQ G;  3CCS Q;  1P92 A;  2W0Z A;  7AT1 B;  1VQ5 T;  1RAI B;  2DYI A;  2EYY A;  4A63 B;  3JB9 H;  2HDA A;  2BZ8 A;  4Z89 A;  3CC4 Q;  1VQM T;  4FT4 A;  4B6M A;  3SD4 A;  3LH0 A;  5FRM A;  1RI9 A;  3M0U A;  5C6S A;  1MV3 A;  2ECZ A;  1AD5 A;  3REB B;  2M16 A;  3HRS A;  1V29 B;  1PD1 A;  2RQU A;  4HKE A;  1G3W A;  3CQT A;  1OYX A;  1VQ8 Q;  1TWB A;  3OW2 S;  4MZP A;  3OYC A;  4DOW A;  1YIT A;  1GBQ A;  5FU7 C;  4HVV A;  5CVI A;  1N8R C;  4JJN K;  1D1C A;  3LLR A;  3EGX A;  3NTI A;  2YXY A;  1M1K U;  2CP0 A;  1Y57 A;  2NUT A;  2V8K A;  2ZCF B;  2KT1 A;  5IH2 A;  3URG A;  1UJ0 A;  3PFS A;  1R0B G;  4M75 C;  1D0X A;  1UTI A;  4KT0 E;  2EQJ A;  3OA6 A;  1HYO A;  5KYY A;  2KI7 A;  1PWT A;  3OYJ A;  3ULR B;  1M1K R;  2HKN A;  3EFS A;  2DO3 A;  1OQK A;  3IQL A;  4RTV A;  2K79 A;  3CD6 T;  1AHJ B;  2JW4 A;  2E4H A;  2V26 A;  4FYX B;  4OMP A;  5AT1 B;  1KHC A;  3ASK A;  2PU9 B;  1H3H A;  3NFC A;  2K5F A;  3CCM A;  3VJP A;  3QII A;  3QXE B;  1UG1 A;  5GAO n;  1YHQ Q;  9ATC B;  4MZM A;  5FWC A;  2P0Q A;  3OSS C;  4C5I A;  2QGG A;  2GCX A;  2JTM A;  4GLM A;  3RKY A;  2HQH A;  1UGQ B;  2L3P A;  2QG9 B;  2K2M A;  2AZS A;  2JOY A;  2K4Y A;  2LZ6 B;  4OMF B;  1JJ2 P;  2K5I A;  1TUC A;  2D8H A;  3L2R A;  2VAS A;  4FSX A;  3CCU A;  1K73 C;  1VQP Q;  3G7Z A;  4KH1 B;  4FYY B;  3CMA T;  1ZSG A;  5FRN A;  2E1H A;  3VS1 A;  5KE3 A;  2HAX A;  2KBT A;  2JMA A;  3M0T A;  1AEY A;  1G3Y A;  1WHH A;  3X25 B;  3SEM A;  1Q95 G;  2AT1 B;  2KSS A;  4A53 A;  1KSW A;  4MZT A;  4HCZ A;  1Z9Q A;  4M77 D;  3AHU A;  2X3W D;  4J6W A;  1VQ5 Q;  4LDW A;  4KH0 B;  1OEB A;  2RH2 A;  4K11 A;  2FZK B;  4KGZ B;  2KGT A;  3CCJ T;  4LNP A;  5FU6 C;  5J26 A;  3TVT A;  3VYH B;  4A4F A;  1VQM Q;  3BE3 A;  3CCV T;  5GAO m;  4PL6 A;  2IG0 A;  2COZ A;  2MK5 A;  3G6E A;  1OUL A;  3SB2 A;  1R77 A;  1N6A A;  3RIR A;  3THK A;  4M77 G;  1M1F A;  5EG2 A;  2KDS A;  3VUB A;  1B3Q A;  4HT8 A;  1HD3 A;  5CKB A;  5DLQ E;  1M90 C;  4PK4 A;  2FEI A;  2RI3 A;  4Q5W A;  1ZSZ C;  3CBO A;  3RES A;  4J9F A;  4IUV A;  4EPC A;  4PLL A;  2LMJ A;  5J3B A;  1YI2 T;  2J06 A;  1X01 A;  1T3S A;  4KGX B;  5CKD A;  3UF4 A;  1SRL A;  2RHX A;  5KYN A;  4NS5 A;  2DL5 A;  2RF0 A;  1GXI E;  3OBW A;  3OYY A;  1Y07 A;  4IUP A;  1W1F A;  3M56 A;  2CT4 A;  4AMC A;  4JLG A;  1YCY A;  1WX6 A;  2EGA A;  1ZQ1 A;  2QEX A;  4C0F A;  2ATC B;  4C92 D;  3MEU A;  4XQ3 A;  2CSQ A;  3EGD B;  2MMP A;  2RHZ A;  2JTF A;  1M8V A;  3CD6 Q;  4J83 A;  1EIF A;  3MEV A;  1G83 A;  2VUB A;  2ESW A;  4EMK C;  5GAN j;  2DEQ A;  5CAI A;  4N0A A;  2JMC A;  4CRI A;  2KRS A;  4QT7 A;  3M9Q A;  3OW2 A;  1ARK A;  3FLG A;  4QW2 A;  2PNI A;  1YFN A;  2DIG A;  1KQS P;  4FW1 A;  2QA4 A;  1X2Q A;  4KUI A;  4C92 G;  4ZGJ B;  2XG8 D;  1MHN A;  2E6N A;  3I56 Q;  1ACM B;  1AWO A;  4RKU E;  1GL5 A;  3G71 A;  1JB0 E;  2WSE E;  3H9N A;  3M0S A;  1D0Y A;  4RUG A;  2BUD A;  1BI1 A;  1RI0 A;  3JCM e;  1W6X A;  3EG2 A;  1KQS S;  3JSC A;  3CEY A;  2O88 A;  1V1C A;  3CCE T;  1VQ7 A;  5J39 A;  4A54 A;  4C5E A;  1DJ7 B;  4BI8 B;  3HHT B;  2LDM A;  1PG5 B;  4BE0 A;  1UEB A;  1IXD A;  3CBP A;  3CMA Q;  1NG2 A;  1AOJ A;  3V8K A;  2FPE A;  3EGD A;  1XTD A;  2DFU A;  4E7Z A;  1B07 A;  3DKM A;  4NOY A;  3VS4 A;  2QQB A;  2BKD N;  2Y4Y A;  2DD4 A;  4M4Z A;  1X6G A;  1XJW B;  1VQO T;  4Y92 A;  4JLI A;  1Z9Z A;  4XU1 A;  2DJZ A;  1BCO A;  4L5G A;  2BE7 D;  5L8R E;  1D09 B;  1BK2 A;  3FB9 A;  3ZEH A;  1LJO A;  4BDY A;  1KD1 C;  3E2U A;  3LGF A;  4AG2 C;  4M7D C;  2X4W A;  2J05 A;  3GF5 A;  2YWW A;  2RMO A;  1YJW Q;  3NTK A;  4M77 F;  1YIJ T;  3T9N A;  3CPW S;  2XID A;  2M1H A;  3UPU A;  1NJI U;  1Q86 C;  3QJ6 A;  2HL3 A;  3JCM Q;  4KUL A;  3JCM c;  2V8J A;  3H0H A;  1G3T A;  2RJD A;  1Q82 U;  3TSW A;  4OMM A;  1PSE A;  2RNA A;  4XTU A;  1WIE A;  1NJI R;  1KG1 A;  2HKQ B;  4O6J A;  1E6H A;  5GMK i;  1YJN A;  1QVF A;  2RJE A;  3QYH B;  2EJG A;  1Q81 C;  3QZ5 B;  3G4S A;  1PHT A;  1Q82 R;  4FL6 A;  1GBR A;  4M78 C;  1WZO A;  2DBM A;  3AT1 B;  5FLX E;  5HK3 A;  2O9V A;  3P8H A;  3X26 B;  4JRQ A;  3VRZ A;  3ZL7 C;  1KK7 A;  3CPF A;  4YTL A;  1BIB A;  1VA7 A;  3U23 A;  4AFQ C;  2VB6 A;  2MCN A;  3MP8 A;  2EYW A;  2WAC A;  3RBB B;  2YDL A;  2AKK A;  2VXE A;  4JJB A;  3CC2 A;  2H3E B;  4C92 F;  4GBQ A;  4PNO A;  4ORZ A;  2AIR B;  2J7I A;  2PQW A;  5LL6 S;  3PGG A;  5ECA A;  2QQS A;  2YRV A;  3H0F A;  4OMO A;  5HY6 A;  5CKF A;  2OAU A;  1VQ9 T;  5LJ3 f;  4D6W A;  3M53 A;  4EMH A;  1UE9 A;  1S1N A;  4QVD A;  2V1R A;  4ELY C;  3CCE Q;  3DB3 A;  5A2Q E;  5CKH A;  3NHN A;  1BKB A;  3C94 A;  2RO0 A;  3JB9 G;  3BY7 A;  2ZPG B;  2LNH B;  3M55 A;  4OGE A;  2FZC B;  1AVZ C;  2L3R A;  3WVD B;  2O01 E;  3QO3 A;  1QVP A;  5GAN 8;  1KJW A;  2DX1 A;  2HSP A;  3J7A F;  1K9M U;  2KMT A;  4O5V A;  4HA8 A;  5IHI A;  2OI3 A;  5GMK h;  1VQO Q;  2NLU A;  2CZ6 B;  4LE9 A;  1VQ8 T;  1NM7 A;  2P4T A;  2CH4 W;  2QI2 A;  2CP7 A;  3FRN A;  1K9M R;  3OYA A;  1X6O A;  2RPN A;  3TRE A;  4LDU A;  4OB0 B;  2HL5 C;  5HKC A;  1FMK A;  2MOX A;  3PIO A;  2EKH A;  3OY9 A;  3MPU B;  3OQ5 A;  3EH2 A;  4ANJ A;  4KUD K;  3OMG A;  4RCC A;  2F2W A;  2QAZ A;  1G5V A;  3X20 B;  4OB3 B;  1ZUY A;  3VS6 A;  3OYN A;  2O9S A;  4CC7 A;  2R5A A;  4DA4 A;  1TOV A;  2DEU A;  1M90 R;  5GAO p;  5GAN 4;  1WQ7 A;  4OGC A;  1KQ1 A;  5GMK l;  4J8O A;  2MIO A;  3JB9 I;  1TXQ A;  1VQK T;  2XDP A;  2QQR A;  4M7D G;  3L2Z A;  1FX7 A;  1Y96 B;  4PJO C;  2EW3 A;  1VUB A;  2DXB A;  2BIV A;  2KQW A;  2GTO A;  2WSF E;  3VS3 A;  1PNJ A;  1K8A U;  2DTO A;  2ROT A;  3CPW A;  2QYZ A;  4HCC A;  1K1Z A;  4C92 B;  3CCR A;  1XQH A;  3GP8 A;  3SFM A;  3UDC A;  5IHK A;  1VQ4 A;  1U8R A;  4XU3 A;  4JS4 A;  2DBK A;  1H3Z A;  1O9S A;  1GCP A;  2LP5 A;  1G3S A;  2HBP A;  1K8A R;  3C95 A;  3MHX A;  4JRP A;  5GJW B;  3SWN C;  1ZBJ A;  2NUT B;  1H8K A;  1KC8 C;  1WNL A;  2QTX A;  5GAM f;  1MMD A;  3SDZ A;  4JZ3 A;  1VQL A;  4OMN A;  4C0D C;  1IB8 A;  3QYG B;  2DPP B;  1BI2 A;  4AFZ C;  4B9W A;  4BD3 A;  1RAG B;  2DVE A;  4C0G A;  3JB9 F;  1NYF A;  2ABL A;  3NGP A;  2BZY A;  3OW2 P;  1Y96 A;  4LD9 K;  2PVO B;  1ABQ A;  4DBQ A;  5LJ3 e;  4M77 E;  2WSC E;  3EGU A;  1Q7Y C;  5GAN 3;  3OS1 A;  3V7S A;  4IIO A;  4CC4 B;  2XU8 A;  1LPL A;  4WCI A;  1OZ3 A;  2A28 A;  5L23 A;  4C92 A;  4ZTJ A;  1TSF A;  2CZ1 B;  4LDV A;  1S72 T;  2DYB A;  3VS0 A;  3P8B B;  4A4K A;  2L0A A;  2YRC A;  3KBG A;  1MV0 B;  3JCM V;  2E65 A;  1CKA A;  3TCJ A;  4C0Z A;  1OU8 A;  2CGH A;  3CC7 A;  2ZAE A;  2PVD B;  1QW1 A;  2HCK A;  2HQE A;  1T3L A;  2JZ2 A;  1V76 A;  1VQN T;  2A0F B;  1KD1 R;  4QVC A;  1OU9 A;  1JEG A;  1BIA A;  2C0T A;  2GTJ A;  2COY A;  3NPF A;  2DK3 A;  1SPK A;  1UB4 A;  4BDZ A;  2EQM A;  5DY9 A;  1AWX A;  3RNJ A;  4R56 A;  2P4R A;  3EG9 B;  3CCL T;  1C6V X;  1AZG B;  4C92 E;  1Y0M A;  2LJ1 A;  2E5K A;  3LYI A;  4IIM A;  3RR6 A;  2CP3 A;  4L6V 5;  2LX7 A;  3OYM A;  1NLP C;  5KYX B;  3JCM f;  3L2W A;  2O2O A;  2HMA A;  1VQK Q;  1QCO A;  1MGQ A;  1OPL A;  2DVJ A;  4ME7 A;  4M7D F;  1ZA2 B;  3KUF A;  2M0O A;  2RQW A;  3I56 T;  2CKK A;  4XTV A;  2EYX A;  2CRE A;  3GNG A;  2A36 A;  3P8D A;  1WGS A;  4RTU A;  1WJS A;  2ED0 A;  2CDT A;  4ZN1 A;  4FCY A;  2DMO A;  2YLB A;  4N4H A;  2QQA A;  4J9B A;  4Z02 A;  2D6F A;  2DRK A;  2FG0 A;  2KRM A;  3INZ A;  3S3N A;  2M02 A;  3JRZ A;  3M0Q A;  1QWE A;  4HCB A;  4FU6 A;  1SEM A;  3LWH A;  1AWW A;  3EAE A;  3CCS A;  3FIF A;  4X34 A;  1JBM A;  2FB7 A;  3I55 T;  1QVF P;  2ZPB B;  2LT1 A;  4JUV A;  3CC4 A;  2DLP A;  2OAW A;  2QA4 Q;  4CC3 A;  2LX9 A;  2DRM A;  4NL2 A;  5GAO l;  3EG9 A;  4PJO G;  5DLO A;  4EMK B;  3TQ7 P;  2J6O A;  4HVW A;  3D7S B;  5KYX A;  1VYV A;  2B8A A;  2EGC A;  4IKF A;  2KRN A;  1QVF S;  2YLC A;  2MPX C;  4F16 A;  5A0G A;  5GMK j;  4C5G A;  5GAM e;  3OYG A;  1SSF A;  2DAQ A;  2A7Y A;  1FMW A;  3R6O A;  3E9G A;  2K2V A;  4Z88 A;  3FJ5 A;  5CR2 A;  1JXM A;  4C8Q G;  2RJC A;  1YJW T;  1FWZ A;  2F1L A;  1HXD A;  2RA2 A;  1E6G A;  1QKX A;  2ROL A;  2XDB A;  4HXJ A;  1E7O A;  4XTW A;  1S72 Q;  3E1S A;  1VIE A;  2LQK A;  2OTL A;  2CSI A;  1IO6 A;  1K9A A;  4JRK A;  3S3O A;  1IHV A;  2FYK A;  1MMA A;  1W2B S;  2DZ9 A;  4M7A C;  1QMC A;  1RAB B;  2XD0 A;  1VQ6 T;  2ZPE B;  4A4G A;  2K9G A;  1NYG A;  3CCQ T;  3GBQ A;  5GAN 7;  1NPR A;  5C0M A;  2I2L A;  4EMK A;  4BI4 A;  1VQN Q;  2QTV A;  4PJJ A;  3VS2 A;  2C0I A;  2X35 A;  1OV3 A;  1M5Q 1;  2V1Q A;  2JVV A;  4M75 D;  1YHQ A;  1ZHI A;  3QPH A;  2LC4 A;  4J9G A;  3TU4 K;  1JRI A;  2P0P A;  2YUN A;  3X28 B;  5IXF A;  3CCL Q;  3CME T;  4JS5 A;  3QWX X;  1MMN A;  2XIC A;  4DEY A;  4WF2 A;  4M7D B;  4J6X A;  1JU5 C;  4RTT A;  5IXB A;  4OB2 B;  2CZ7 B;  1QQJ A;  3JCM d;  1WHL A;  2XMF A;  3OS5 A;  1WPY A;  4M75 G;  3H8Z A;  1VQP A;  1C1A A;  5LJ5 e;  2OTJ T;  3Q1J A;  1B7T A;  2JS0 A;  1ZA1 B;  2KK4 A;  3GPL A;  1M30 A;  2DXC A;  1M2O A;  2X51 A;  2DXU A;  4D8D A;  3TEE A;  4XAX B;  3VS7 A;  1H92 A;  2EQU A;  2YUO A;  2IPO B;  3JCM h;  1I1J A;  1VQ5 A;  3HFO A;  4F14 A;  3RKW A;  4MML A;  4M78 B;  3I55 Q;  4QQD A;  1ZBX A;  3JCM g;  3A8M B;  1RAE B;  3S3M A;  1VQM A;  5CO7 A;  3DLL A;  3H6Z A;  2ZZD A;  4PJO F;  2CT3 A;  1CSK A;  3MKD A;  2H8H A;  4M7D A;  5FRO A;  4CC2 A;  1YJ9 T;  1KC8 R;  1WI7 A;  1TU0 B;  3CPW P;  1TS9 A;  1K0X A;  1WXB A;  1N5Z A;  3DLM A;  2E3H A;  3JV3 A;  3VRY A;  2RHU A;  4IUQ A;  2Y90 A;  4DBH A;  5DM7 R;  2QAS A;  3LGL A;  2NYS A;  2DA9 A;  4RCB A;  4C8Q F;  5GAO q;  5KCH A;  3MP1 A;  4FIB A;  2XDD A;  1B34 B;  1WHG A;  3JCM X;  1JO8 A;  4J6Y A;  3I5S A;  2GQI A;  2ZPI B;  2K3B A;  2RK1 A;  3VKI A;  1N8R U;  1U06 A;  1SRM A;  1OI1 A;  2JM9 A;  4RG8 A;  1UGR B;  1AWJ A;  1M1K C;  4M78 A;  4OP0 A;  1HJD A;  2VC8 A;  2FRY A;  1VQ6 Q;  4AFS C;  1NEG A;  1WHJ A;  1F1B B;  3CCQ Q;  3CD6 A;  4ZTF A;  3G1J A;  1NZ9 A;  3OMC A;  1YIT T;  3A8H B;  4Y91 A;  4M7D E;  1X43 A;  1N8R R;  1PCX A;  2OX7 A;  2VV5 A;  3OYE A;  4KBM B;  2EJ9 A;  4IUU A;  4B9X A;  1RUW A;  1BU1 A;  3EG0 A;  1OX8 A;  2GF7 A;  5IHN A;  2YHT A;  3CME Q;  3JCM W;  4OML A;  4N4I A;  3KXT A;  1PSF A;  1PKT A;  1NPP A;  3DB4 A;  4MDW A;  4ZGE B;  1BBZ A;  1B34 A;  1W70 A;  2B86 A;  3ZFJ A;  4M7A G;  4LDX A;  4P5N A;  3GLX A;  4II1 A;  2DF6 A;  2EVR A;  1W2B A;  4J7I A;  3JB9 J;  1T0H A;  1X69 A;  2RHY A;  3JB9 D;  1GCQ C;  2M0Y A;  4RTZ A;  4KRT A;  4M75 F;  2A37 A;  3BFM A;  3CCM T;  4J5Y A;  3CMA A;  2OTJ Q;  1D0Z A;  1SHF A;  3JAM E;  2LQW A;  2G6F X;  2RQR A;  1KFZ A;  3FJP A;  1UUE A;  2F5T X;  2E10 A;  1K73 U;  3VYG A;  1QWF A;  1WHM A;  5HCK A;  1SF9 A;  3OS0 A;  1YWP A;  2CP6 A;  1NE8 A;  2GQV A;  2EGE A;  1M3A A;  2HSE B;  4RTX A;  1SG5 A;  4X9D A;  4AG1 C;  4Y28 E;  3CCJ A;  4R55 A;  3PT9 A;  1K73 R;  4PJO B;  4XU0 A;  2BTT A;  5A0D A;  3CCU T;  4ESR A;  2IVW A;  3MJX A;  3CCV A;  2HNI A;  2K3X A;  3H41 A;  2GFU A;  2GBQ A;  3OYB A;  5GAN 6;  5GAO r;  2KE9 A;  4QVZ A;  2J6K A;  3EH1 A;  4J9H A;  3A1P A;  3PVL A;  4J9C A;  1KIK A;  1YJ9 Q;  4OVA A;  3EFR A;  1HK9 A;  3RKX A;  5D6Y A;  1WA7 A;  3QBY A;  2E64 A;  4PLI A;  4KGV B;  4C8Q B;  2KEA A;  2NUZ A;  2KR3 A;  1UJY A;  2XKO C;  5AYF A;  1UDL A;  1CKB A;  2LCC A;  3SWN B;  1YI2 A;  2CP5 A;  5GAN 5;  4IUR A;  4RTY A;  2RJF A;  1M90 U;  2FHD A;  1WQW A;  3HRU A;  1I4K 1;  4BE2 A;  4DBF A;  3G6E T;  2PUO B;  5I21 A;  1QP2 A;  3RDV A;  4M7D D;  3V8J A;  2HZY A;  1U5S A;  3J81 E;  2VYT A;  3C12 A;  2LCL A;  2O31 A;  2Y4X A;  3L2V A;  4ATO A;  1QLY A;  2NUP B;  4PJO A;  1YIT Q;  4FYV B;  4LDY A;  1U1S A;  1D1A A;  1M8M A;  1QP3 A;  1YBY A;  3FC3 A;  2MF2 A;  2E5Q A;  2RK2 A;  1M1G A;  3CC7 Q;  4MMK A;  1Y7X A;  2JJ9 A;  4E7I A;  5FU7 B;  4C8Q A;  5GAN e;  3PVQ A;  4L59 A;  1WXT A;  3CBM A;  4PJN A;  3QUI A;  2QEX T;  4M78 D;  1MND A;  3SWN A;  2EQK A;  2CH4 A;  1RLP C;  4V2S A;  2YSQ A;  4M7A F;  3PIP A;  4M75 B;  1D3B B;  3CCE A;  3OYH A;  1TUD A;  2ENM A;  3HRT A;  2RQT A;  3CCM Q;  2DTI A;  4X1V A;  2YUP A;  2K57 A;  4M78 G;  2QA4 T;  2NUP A;  3CXC A;  2P0K A;  5LJ3 d;  3I35 A;  2DM1 A;  3G71 T;  2GFA A;  2K5L A;  1VQO A;  3M0P A;  4M77 C;  4E2F B;  2DJQ A;  5CK9 A;  3MCA B;  2DET A;  1GFD A;  5CIU A;  2CUD A;  1IRX A;  4C8Q E;  1BYM A;  2G3R A;  2R58 A;  3OS2 A;  1EX4 A;  1M27 C;  2VKN A;  1M2V B;  1VQ7 T;  2RD1 A;  3CCU Q;  4QKU A;  1LCK A;  3RER A;  2F5K A;  2PZ1 A;  1SKU B;  4JDS A;  4OF1 A;  1ZUU A;  5LJ3 h;  4F17 A;  1YNZ A;  4R0K A;  4JRI A;  3SHW A;  1QVG S;  1N9R A;  3NTH A;  2EPD A;  2JXB A;  1YIJ A;  5LJ3 g;  4M75 A;  1D3B A;  1OZ2 A;  1WJR A;  3VV0 A;  1GFC A;  3PTA A;  1X75 C;  2DL7 A;  2D1X A;  4LUE A;  1KD1 U;  2M9U A;  2DXT A;  4BY6 C;  1BI0 A;  1RLQ C;  4F7U G;  3I5R A;  1PC0 A;  1VIF A;  4FM4 B;  2VXF A;  3E19 A;  2RN8 A;  2AZV A;  4PFO A;  1ZX6 A;  5CQX A;  2CP2 A;  2JT4 A;  2HQX A;  5D6W A;  2JS2 A;  1NJI C;  2EKO A;  1Q86 U;  2PTK A;  1IGQ A;  1PKS A;  1X27 A;  4JJD A;  3G6E Q;  5I2S A;  4E7K A;  4DEX A;  3C0C A;  1MNE A;  2E41 A;  1Q82 C;  5I11 A;  4C92 C;  3V7C A;  2L3Q A;  5A0L A;  5FU6 B;  3EG3 A;  3M0R A;  1M2V A;  1RAH B;  4ELZ C;  4IUT A;  1M9S A;  2DTH A;  3UWN A;  1Q86 R;  3JCM J;  3HKS A;  1NLO C;  2OTL Q;  5LJ5 f;  2K6D A;  4FSS A;  3QSU A;  1Q81 U;  2H3J A;  4M75 E;  2DIQ A;  4EDU A;  2BE9 B;  3L42 A;  2P84 A;  3LWI A;  2LNV A;  2JUF A;  4GLK A;  2QQ9 A;  2LQN A;  1LNX A;  1FMV A;  1IGU A;  1YJN T;  5D6X A;  2HD0 A;  1VOM A;  2SEM A;  1ZSZ B;  1RAC B;  3A8L B;  4RMO A;  1R8O B;  3HPW A;  3UA6 A;  1Q81 R;  3MO8 A;  2JN0 A;  2QK0 A;  3G4S T;  2QEX Q;  2EAY A;  4BAC A;  3REA B;  4M7A B;  1C0M A;  1VQ9 A;  2EBP A;  4PJO D;  1UGV A;  4FT2 A;  1R0C B;  5HK0 A;  5GAN 2;  3L1A A;  1X2K A;  3QWY A;  2HEQ A;  6AT1 B;  1PRM C;  4NL3 A;  3PMI A;  5FWB A;  2QGF B;  3RUX A;  2BZX A;  2EWN A;  4XU2 A;  2LRQ A;  2FL7 A;  3CC2 T;  2AHJ B;  4M78 F;  2CYZ B;  2SRC A;  1SHG A;  3M59 A;  2EYZ A;  3E9F A;  2KT8 A;  3A8O B;  4C8Q D;  1ZLM A;  2VGN A;  5GAM d;  2KNB B;  3MP6 A;  3OBY A;  3G71 Q;  3PE0 A;  1WJQ A;  1A0N B;  2VVK A;  3MEW A;  2ZPF B;  1MMG A;  2L2P A;  3A98 A;  1VQ8 A;  4XTX A;  1K0S A;  4XK8 E;  1JJ2 S;  2C0O A;  1T0J A;  4E7L A;  3JCM b;  3OYL A;  2LVM A;  1BB9 A;  1VQ7 Q;  4CI0 C;  3EHR A;  1K9M C;  4PKC C;  1QCF A;  4E7S A;  1ZSZ A;  1LVK A;  5I22 A;  2E12 A;  4LUD A;  1W2B P;  4D8K A;  3OYK A;  3BW1 A;  2YRD A;  3RMS A;  5GAM h;  4M7A A;  4BB7 A;  2PVG B;  4PFZ A;  4BUG A;  4LXC A;  5KH6 A;  1BI3 A;  3M4G A;  5GAM g;  3EFO B;  1G8X A;  1TG0 A;  2GGR A;  2AKL A;  3HFN A;  1I07 A;  2MWP A;  3M57 A;  4F7U F;  3MET A;  2RI2 A;  3OSV A;  4UC4 A;  2YT6 A;  2KYM A;  4E6R A;  4F04 B;  4ZNX A;  3VUZ A;  3GOX A;  2MI6 A;  1PRL C;  2QDL A;  3QZ9 B;  1Y71 A;  2CS7 A;  2LCS A;  1N9S A;  3UAT A;  2FVU A;  5GJV B;  1ZUK A;  2J6F A;  3TSZ A;  2D0Q B;  1QKW A;  4OB1 B;  1VQK A;  1OX9 A;  2D0N A; 
#chains in the Genus database with same CATH homology
 1PWT A;  1WXU A;  1NEB A;  3ULR B;  1K4U S;  3IQL A;  4RTV A;  3LH5 A;  2K79 A;  1RUW A;  2MIO A;  2JW4 A;  1BU1 A;  3EG0 A;  4OMP A;  5IHN A;  2EW3 A;  2AK5 A;  4OML A;  1H3H A;  2KYB A;  1PKT A;  5EC7 A;  2GTO A;  1BBZ A;  1W70 A;  2B86 A;  1WDX A;  2FO0 A;  1UG1 A;  3VS3 A;  1PNJ A;  2ROT A;  2DF6 A;  2EVR A;  2KRO A;  5FWC A;  1T0H A;  1X69 A;  1K1Z A;  1GCQ C;  2M0Y A;  4RTZ A;  4KRT A;  4GLM A;  2A37 A;  5IHK A;  2L3P A;  2DBK A;  1SHF A;  2K2M A;  2ED1 A;  2AZS A;  1GCP A;  2LZ6 B;  2LP5 A;  2LQW A;  2G6F X;  2RQR A;  1KFZ A;  1UUE A;  1TUC A;  2D8H A;  5GJW B;  2KXD A;  1ZBJ A;  1QWF A;  2IIM A;  5HCK A;  1H8K A;  1YWP A;  2EGE A;  1M3A A;  4JZ3 A;  1WLP B;  1ZSG A;  1G2B A;  4RTX A;  4OMN A;  4AG1 C;  3VS1 A;  2KBT A;  2JMA A;  1UFF A;  2DL8 A;  1EFN A;  3M0T A;  2BTT A;  4AFZ C;  1AEY A;  4ESR A;  4J9D A;  2VWF A;  2JTE A;  3SEM A;  3H41 A;  1NYF A;  2GBQ A;  2ABL A;  3NGP A;  1KSW A;  2BZY A;  1Z9Q A;  2KE9 A;  1ABQ A;  2X3W D;  2J6K A;  3EGU A;  1OEB A;  4J9H A;  4K11 A;  3PVL A;  4J9C A;  2KGT A;  2F2X A;  1KIK A;  4LNP A;  3TVT A;  4IIO A;  2FPD A;  4CC4 B;  1HSQ A;  1WA7 A;  4WCI A;  2A28 A;  5L23 A;  2CUB A;  1YCS B;  4HCK A;  2KEA A;  2NUZ A;  3UA7 A;  2KR3 A;  1UJY A;  1UDL A;  1CKB A;  3THK A;  2DYB A;  1B3Q A;  3VS0 A;  1HD3 A;  1J3T A;  4RTY A;  2L0A A;  1MV0 B;  1WYX A;  2FEI A;  1CKA A;  2OJ2 A;  2GNC A;  2YUQ A;  1K76 A;  3VS5 A;  2HCK A;  1T3L A;  4J9F A;  4AFU C;  1U5S A;  2LMJ A;  2DL4 A;  2O31 A;  2J06 A;  2FRW A;  1T3S A;  3UF4 A;  1QLY A;  1SRL A;  1JEG A;  2DL5 A;  2C0T A;  2RF0 A;  2L3S A;  2GTJ A;  1W1F A;  3NPF A;  1AZE A;  1JQQ A;  1SPK A;  2CT4 A;  2I0N A;  1ABO A;  1WX6 A;  2EGA A;  1UEC A;  1AWX A;  3RNJ A;  2P4R A;  2LJ0 A;  1M8M A;  3I9Q A;  1AZG B;  1GCQ A;  1WFW A;  2CSQ A;  1Y0M A;  4HVU A;  2LJ1 A;  2E5K A;  2DIL A;  4IIM A;  2LX7 A;  1M3C A;  1NLP C;  2HBW A;  1G83 A;  4JPB W;  2ESW A;  2O2O A;  1VYU A;  1OPL A;  2DVJ A;  3PVQ A;  2JMC A;  2KRS A;  4QT7 A;  1WXT A;  1ARK A;  1U3O A;  1GRI A;  2RQW A;  3R6N A;  2PNI A;  2EYX A;  2CH4 A;  2CRE A;  2DL3 A;  2A36 A;  1RLP C;  4RTU A;  1FYN A;  1X2Q A;  2YSQ A;  2ED0 A;  2CDT A;  2DMO A;  4J9B A;  2DNU A;  1AWO A;  2DRK A;  2FG0 A;  2KRM A;  1GL5 A;  1TUD A;  2ENM A;  3M0Q A;  3M0S A;  4RUG A;  1QWE A;  2RQT A;  1SEM A;  4X1V A;  1AWW A;  2YUP A;  1W6X A;  3EG2 A;  2O88 A;  2LJ3 A;  3EG1 A;  1V1C A;  3I35 A;  2DM1 A;  2DLP A;  2OAW A;  3M0P A;  4CC3 A;  3H0I A;  2DRM A;  2DJQ A;  1NG2 A;  1GFD A;  2CUD A;  1AOJ A;  1SSH A;  2FPE A;  2J6O A;  2W10 A;  1M27 C;  4HVW A;  2VKN A;  1B07 A;  3VS4 A;  4EIK A;  1VYV A;  1LCK A;  2EGC A;  2KRN A;  4M4Z A;  4F16 A;  1X6G A;  2PZ1 A;  4Y92 A;  1ZUU A;  1Z9Z A;  1YP5 A;  4F17 A;  1XOV A;  1YNZ A;  4R0K A;  3SHW A;  2F2V A;  4Z88 A;  2EPD A;  3FJ5 A;  1JXM A;  2JXB A;  4LN2 A;  1GFC A;  1BK2 A;  2DL7 A;  2D1X A;  1E6G A;  2M51 A;  4LUE A;  1QKX A;  1RLQ C;  4AG2 C;  2ROL A;  3I5R A;  2J05 A;  1E7O A;  4HXJ A;  4Z8A A;  1UHF A;  2RMO A;  2RN8 A;  2AZV A;  1YN8 A;  2CSI A;  1IO6 A;  1K9A A;  1ZX6 A;  2JT4 A;  2JS2 A;  2JM8 A;  4JZ4 A;  2PTK A;  1PKS A;  2K9G A;  1NYG A;  1UHC A;  1X27 A;  4JJD A;  3GBQ A;  1I0C A;  5FW9 A;  2KXC A;  4DEX A;  3C0C A;  2DE0 X;  3H0H A;  5I11 A;  3TSW A;  4OMM A;  1OPK A;  2L3Q A;  2RNA A;  3EG3 A;  3M0R A;  3VS2 A;  2C0I A;  2FPF A;  1WIE A;  1E6H A;  1OV3 A;  2V1Q A;  1NLO C;  2K6D A;  4FSS A;  2K7A A;  1PHT A;  1GBR A;  4J9G A;  2DBM A;  2A08 A;  2YUN A;  5IXF A;  2O9V A;  3QWX X;  2NWM A;  2LQN A;  4DEY A;  3VRZ A;  4J9I A;  3ZL7 C;  1MUZ A;  4OMQ A;  2SEM A;  1JU5 C;  4RTT A;  5IXB A;  1VA7 A;  3KFV A;  3U23 A;  3UA6 A;  4AFQ C;  2MCN A;  2EYW A;  2RQV A;  3REA B;  3RBB B;  2XMF A;  2YDL A;  2AKK A;  2EBP A;  2D8J A;  4JJB A;  1UGV A;  1JXO A;  4J9E A;  1VYT A;  2JS0 A;  4GBQ A;  4ORZ A;  4JJC A;  1X2K A;  3QWY A;  1X6B A;  2HEQ A;  1M30 A;  1PRM C;  2J7I A;  5FWB A;  4RTW A;  2BZX A;  5ECA A;  4D8D A;  3O5Z A;  4OMO A;  3H0F A;  3VS7 A;  2X3X D;  1H92 A;  2YUO A;  1OOT A;  1I1J A;  1UE9 A;  1S1N A;  1M3B A;  2SRC A;  1SHG A;  2V1R A;  2EYZ A;  4F14 A;  2KT8 A;  3NMZ C;  1ZLM A;  2KNB B;  2EQI A;  3NHN A;  3PE0 A;  1YWO A;  1A0N B;  2LNH B;  2VVK A;  2L2P A;  3A98 A;  1AVZ C;  3EHQ A;  1K0S A;  2CT3 A;  2C0O A;  2W0Z A;  1KJW A;  1T0J A;  1CSK A;  2DX1 A;  2HSP A;  2H8H A;  2EYY A;  1BB9 A;  4A63 B;  4CC2 A;  3EHR A;  2HDA A;  1QCF A;  2BZ8 A;  1WI7 A;  4Z89 A;  5IHI A;  2OI3 A;  5I22 A;  1K0X A;  4LUD A;  1WXB A;  1N5Z A;  1RI9 A;  3JV3 A;  4D8K A;  3M0U A;  3VRY A;  1MV3 A;  2ECZ A;  1AD5 A;  4LE9 A;  3REB B;  1NM7 A;  2CH4 W;  2RQU A;  2DA9 A;  2RPN A;  3CQT A;  1TG0 A;  2GGR A;  2AKL A;  1JO8 A;  1FMK A;  1I07 A;  2MOX A;  3I5S A;  1GBQ A;  4HVV A;  2GQI A;  2YT6 A;  2K3B A;  2EKH A;  2KYM A;  4E6R A;  4ZNX A;  1U06 A;  1SRM A;  2JM9 A;  1AWJ A;  1PRL C;  2QDL A;  1Y57 A;  1HJD A;  2KT1 A;  2FRY A;  4AFS C;  2LCS A;  3UAT A;  5IH2 A;  1NEG A;  1UJ0 A;  2F2W A;  5GJV B;  1ZUK A;  2J6F A;  3TSZ A;  1UTI A;  1ZUY A;  1QKW A;  3VS6 A;  2O9S A;  4CC7 A;  1X43 A;  2D0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...