1ABOA

Crystal structure of the complex of the abl tyrosine kinase sh3 domain with 3bp-1 synthetic peptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High-resolution crystal structures of tyrosine kinase SH3 domains complexed with proline-rich peptides.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (kinase/peptide)
molecule keywords ABL TYROSINE KINASE
total genus 10
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1995-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1aboA00
1T3LA 4OMQA 1SRMA 3EGUA 1AOJA 1U06A 3EHQA 2J05A 1AWXA 1OPKA 4ZNXA 5GJWB 2W0ZA 2DF6A 3CQTA 1NEBA 1H92A 2K3BA 4J9BA 1NLPC 2AZSA 2LQWA 1OOTA 4LNPA 2JT4A 5FWCA 1WXTA 4LUEA 2J6OA 1M27C 2L3SA 2BTTA 2KXCA 4JZ3A 2OI3A 1SHGA 4CC4B 2FEIA 1KIKA 2DX1A 2K79A 2ROTA 1GFDA 2F2WA 1GCQC 2KR3A 3PVQA 2J6KA 2MCNA 3TSZA 1UGVA 1U3OA 3UF4A 4J9HA 1KFZA 4RTVA 2CUDA 2F2VA 1T3SA 2CSQA 2CT3A 1W6XA 2KYBA 1WXUA 1PKSA 4JPBW 3VS3A 1X6BA 2GGRA 2ROLA 2LJ0A 2KRNA 1WDXA 5L23A 2MIOA 3ULRB 4AG2C 2AKKA 2C0TA 1ZUUA 2GQIA 1AWWA 3NHNA 4OMMA 3C0CA 2G6FX 1AZGB 4Y92A 5IHNA 1ZLMA 1K0XA 3VRYA 3M0TA 1PNJA 2F2XA 1M3AA 2RQVA 1I07A 2M0YA 1HSQA 4CC2A 1K4US 4RUGA 2EQIA 2JMAA 2RQWA 2C0IA 4JJCA 1X27A 1SHFA 1GBQA 2L3QA 2GTJA 2ED1A 4M4ZA 4RTXA 2KT1A 3EG0A 1AD5A 2BZXA 5IH2A 1S1NA 3VS1A 1UE9A 3A98A 3VRZA 1UUEA 1UHCA 1EFNA 2NWMA 1VYVA 1PRMC 1WLPB 2LNHB 3EG3A 2VKNA 4HVUA 2CUBA 2LQNA 1Y57A 4RTZA 2DYBA 1QWEA 2DL5A 2I0NA 2VWFA 1K76A 1QKWA 1CKBA 1SSHA 1B3QA 3REBB 5IXFA 1BU1A 2CT4A 1PRLC 1YWOA 2ED0A 1TG0A 1UECA 4AFQC 4AG1C 3UA7A 3NPFA 3PE0A 4EIKA 3I35A 3M0SA 2DBKA 4CC3A 2DM1A 2FPDA 2VVKA 2K9GA 1XOVA 4J9EA 1RLPC 2CSIA 2DRKA 2H8HA 1QWFA 1QLYA 1FYNA 4HCKA 4Z8AA 1YN8A 1SPKA 4JZ4A 3TSWA 2DRMA 1ZBJA 3JV3A 2RF0A 1A0NB 3SEMA 2GBQA 1M8MA 2X3WD 1NM7A 2P4RA 3VS5A 1WYXA 1PWTA 2DNUA 2KBTA 1N5ZA 3U23A 2A08A 1SRLA 2DA9A 4IIOA 5FWBA 2HBWA 2AZVA 2O9SA 2J7IA 1UTIA 2YUOA 1X2QA 1ZUYA 2EKHA 2HDAA 1ABQA 1PHTA 1YWPA 1J3TA 1H3HA 3FJ5A 3H0FA 4GBQA 2FRYA 4E6RA 3QWXX 1X69A 2KYMA 1MV3A 1JU5C 1QKXA 2CREA 2PTKA 3TVTA 1ABOA 2DLPA 5GJVB 5I22A 4RTWA 2DE0X 2QDLA 3I5RA 4F17A 1U5SA 2ECZA 2KROA 4FSSA 1GCQA 2B86A 2RQTA 2RPNA 3M0PA 3VS2A 4F14A 1OEBA 2D8JA 2YDLA 1UG1A 2EYYA 2FRWA 2V1RA 1AWOA 4GLMA 1KSWA 4D8KA 2O2OA 4J9DA 2DBMA 3VS4A 2YSQA 3O5ZA 2A36A 2HCKA 1QCFA 1X43A 2A28A 2EYZA 2KEAA 5HCKA 1K1ZA 3VS0A 3I5SA 2LJ3A 2IIMA 2RNAA 2JXBA 5ECAA 2FG0A 2O31A 2E5KA 1Y0MA 5IHKA 2BZ8A 4AFZC 2JM9A 3KFVA 2LMJA 4ORZA 2X3XD 1AEYA 1YNZA 1E7OA 3EG2A 1T0JA 1UJYA 4A63B 3RBBB 1BBZA 2JM8A 3H41A 5IXBA 2SEMA 2YUQA 2KRMA 1KJWA 2KT8A 4LE9A 1GRIA 1GCPA 4OMPA 2EVRA 1M3BA 1M30A 2LJ1A 1CKAA 1ZUKA 2DILA 1BK2A 1VA7A 1W70A 3NGPA 1W1FA 2XMFA 4F16A 2FPEA 1HD3A 1WA7A 2YUNA 2LZ6B 4OMOA 1MUZA 4KRTA 1K0SA 4JJDA 4OMNA 5I11A 1AWJA 4Z88A 4ESRA 2DL8A 1GBRA 2M51A 1YCSB 2BZYA 2RN8A 4HVWA 3M0RA 2NUZA 2ESWA 4HVVA 1GL5A 4RTTA 2O88A 2PNIA 1RUWA 2K6DA 3H0IA 1MV0B 2L2PA 1UHFA 2W10A 2OAWA 1G83A 1TUDA 2DVJA 1VYTA 3M0UA 1JXMA 2EGCA 2J06A 2EW3A 2KE9A 1NEGA 2KGTA 5EC7A 4AFUC 1UDLA 2JMCA 3THKA 1ARKA 2D0NA 2EYWA 2DL3A 4X1VA 4RTYA 3M0QA 1TUCA 1AVZC 4Z89A 3GBQA 2YUPA 2RQUA 3UA6A 1WFWA 1RLQC 1JEGA 1VYUA 3REAB 1ZSGA 2C0OA 3VS6A 2JTEA 2AK5A 3SHWA 2A37A 2L0AA 4J9FA 2FPFA 1IO6A 1I0CA 2K2MA 4CC7A 1JQQA 1JXOA 2EGEA 2ENMA 2OJ2A 2V1QA 2J6FA 1JO8A 4AFSC 1UJ0A 2GTOA 2DMOA 1WIEA 3RNJA 1CSKA 2LP5A 1G2BA 4IIMA 2EYXA 2FO0A 1AZEA 2SRCA 2JS0A 2MOXA 4LN2A 1WI7A 4RTUA 3R6NA 2L3PA 2CDTA 4JJBA 1Z9ZA 2KXDA 4DEXA 2KRSA 1BB9A 1E6GA 5IHIA 1WX6A 2D1XA 4D8DA 2RMOA 2DL4A 1RI9A 4QT7A 1PKTA 4J9CA 3H0HA 3I9QA 4OMLA 1Z9QA 1WXBA 3EHRA 2EGAA 2AKLA 2O9VA 2CH4W 1OV3A 2YT6A 5FW9A 2JW4A 2RQRA 2PZ1A 3ZL7C 4R0KA 1H8KA 2KNBB 2GNCA 1NYGA 1E6HA 2CH4A 1NG2A 3IQLA 2EBPA 3EG1A 4K11A 3LH5A 1FMKA 1X6GA 1K9AA 2DL7A 3VS7A 1M3CA 2LCSA 2K7AA 2JS2A 2ABLA 1ZX6A 4J9IA 1V1CA 2HEQA 1X2KA 3PVLA 1I1JA 1GFCA 1LCKA 2DJQA 1NYFA 2HSPA 3NMZC 4WCIA 1T0HA 1UFFA 3QWYA 2EPDA 1HJDA 4DEYA 1NLOC 4J9GA 1SEMA 1YP5A 1OPLA 4HXJA 2LX7A 3UATA 2D8HA 1B07A 4LUDA
chains in the Genus database with same CATH superfamily
2DIGA 3HPWA 5L8RE 1B7TA 1VQMT 3JB9I 3EFSA 4KUIA 4ZNXA 4C92A 2RI5A 1VQOQ 2W0ZA 4PJOF 1M1GA 2LDMA 1G3WA 3OMCA 2VC8A 4ZGEB 1TOVA 2JT4A 3HSBA 5A0DA 1N9SA 4QQ6A 2RK2A 3KBGA 4OP0A 4R56A 4X9DA 3KXTA 4C8QE 1VQ9Q 2M0OA 2F5TX 3FIFA 1M1KR 2BTTA 1SHGA 1KIKA 2DXUA 3RIRA 2CGHA 2QQSA 4C0GA 2ZGWA 2MCNA 1Y96A 3OYLA 3A8LB 4J6XA 4RTVA 2CUDA 8ATCB 3JB9D 1ACMB 3CCUQ 4M78F 2PUKB 4F7UA 1YHQQ 4FW2A 4BI8B 2GGRA 2ROLA 4ZN3A 2KRNA 2HAXA 3OYJA 4M7AF 1K73U 3JCMd 2M1HA 2MIOA 2DK3A 2AKKA 3CPWS 3CCQA 5GANg 2QGFB 3I56Q 1KD1U 2RJDA 1ZLMA 1HXDA 3M0TA 1M3AA 2JTFA 2K4YA 1TH7A 5GAMj 1NBEB 3J7AF 1HSQA 3HP9A 1PD1A 2NUPA 3GIBA 2EQIA 1UGPB 3H8ZA 1GBQA 2MI6A 1VQ7A 2GTJA 1X6OA 4JLGA 4RTXA 1QQJA 3JB9J 4C8QC 1AD5A 3CCVQ 3CMAA 2BZXA 3VS1A 1YCYA 2L89A 2OTLA 3VRZA 3LWHA 3HL8A 1Q81U 4N4IA 1LPLA 1QVFA 1K73R 2GQVA 2LNHB 5CKFA 1BKBA 1MMGA 1G5VA 2DYBA 4II1A 2I0NA 2DAQA 2L8DA 1CKBA 4ELYC 2CZ0B 4PLLA 3VUZA 2ED0A 1TG0A 3OB9A 4NS5A 3UPUA 4C8QD 1OX9A 4IUPA 1Q82C 5HK3A 4EIKA 1VQ8T 3M0SA 1U1SA 2DM1A 2GFAA 3M59A 4EMKC 3QKJA 1K9MR 4EPCA 3TEEA 4JS5A 1QWFA 3PIOA 1PD0A 1C1AA 1YN8A 2XIDA 3D7SB 2PU9B 2HMAA 1NM7A 1WYXA 3J80E 3M4YA 2DTIA 3U23A 4EMHA 3C12A 1KK7A 1ZBXA 5KYWA 2AZVA 2J7IA 1UTIA 2YUOA 1IGQA 3M53A 5GANd 3S3OA 3EFOB 4DA4A 3CMAQ 2LRQA 3NTHA 2K3YA 2B8AA 4M7AD 3QHSA 4GBQA 3DB3A 4E6RA 3E9FA 3LH0A 4F7UB 2CREA 4A4GA 1KQ1A 1WHLA 4DQ2A 1ABOA 2DLPA 3RKYA 2Y4XA 5I22A 2DE0X 4F17A 4FSSA 3S6WA 4F14A 4PK4A 3JCMh 1M2OA 5D7UA 3P8BB 2YDLA 1GXIE 1UG1A 3MP1A 2QK0A 2V26A 2O2OA 3M4GA 2HSEB 4J7IA 3CCQQ 3VS4A 4M77E 2VGMA 4M7AB 2JN0A 2KEAA 1X43A 2A28A 5HCKA 4EMGA 1K1ZA 2QTVA 3VS0A 2RNAA 5CKBA 1S72A 1FMVA 3CXCA 1R0CB 1ZSZC 1Y0MA 4BI4A 3OYNA 4XU2A 3KFVA 4HA8A 3JB9F 2LMJA 4ORZA 2X3XD 3OS5A 1RAFB 1BBZA 4E7KA 2EJGA 5FROA 2KT8A 2ZPEB 4PLIA 1GCPA 2D0QB 4UC4A 2R57A 3PT9A 1M90R 2COYA 3PGGA 2O4XA 2NUPB 5GMKi 1M3BA 3CBMA 4C92D 1BK2A 4OGCA 1N8RR 1VA7A 2VYTA 4JLIA 3PMIA 5GAN2 2RB6A 1YITA 1Q7YR 2RJFA 1HD3A 3OY9A 1KQSS 2LCLA 4HCBA 2LZ6B 4OMOA 2CP6A 2YLCA 1K0SA 4OMNA 2CKKA 5I11A 3M57A 5LJ3d 4Y91A 1VQ8Q 2HQEA 4JDSA 2BZYA 4HVWA 2ESWA 4HVVA 3CPWA 1VQPQ 1GL5A 4RTTA 3OYBA 1RUWA 3H0IA 1MV0B 2L2PA 4XTVA 4M78A 1OZ2A 5GAN4 2KVQG 3CXCS 2QEXQ 2KMTA 1G83A 3FJPA 4OMFB 3RESA 3CCMA 5KYXA 1VQPT 2KE9A 5EC7A 1UDLA 1ARKA 3MKDA 3SFMA 2DL3A 4FW1A 4HCCA 3RR6A 3JCMX 4Z89A 1WHKA 3CCVT 1BI1A 1RLQC 2K5FA 3EFOA 1AT1B 4DOVA 3JCMb 1RI0A 1IO6A 1KD1R 1JXOA 5D6WA 3LYIA 3X28B 5LJ5h 3JCMQ 1JO8A 2E64A 4OGEA 4GLKA 3RNJA 2LTOA 1CSKA 2EYXA 1HYOA 5GAOl 1TU0B 1DJ7B 2F5KA 2K3XA 4RTUA 2KXDA 4A54A 4DEXA 2HQHA 1U8RA 1WX6A 2DKGA 2RMOA 2JZ2A 2P4TA 3OYGA 1P92A 4J9CA 3VKIA 1WPYA 3I9QA 3URGA 3HFNA 5CKDA 1Z9QA 1YIJQ 4C5GA 2BIVA 2QG9B 3MPUB 4XU1A 5LJ3e 3EHRA 4HKEA 3OS0A 1VQ9A 1VQNA 2CH4W 4NOYA 2PZ1A 5C0MA 3VUBA 2PVGB 1NYGA 1TXQA 3IQLA 2EBPA 3EG1A 4Q5WA 2FB7A 2OX7A 2E41A 3G6EA 3CC7T 1VQOT 1BI3A 2PUOB 2KAFA 1M3CA 2EQUA 2LCSA 3J81E 1V1CA 2HEQA 1YITT 1NZ9A 1I1JA 1GFCA 1LCKA 2RJEA 5GAMf 1NPRA 2E12A 3CMEA 4M7DG 3CC4Q 1UFFA 4E2FB 1YJWQ 4DEYA 3OYFA 3CC2A 2EJFA 1PM3A 1OI1A 1UB4A 5GAOm 3QBYA 4ZGDB 5CR2A 1AOJA 1WQWA 4O5VA 2J05A 1KQSP 3OYDA 2K57A 4PL6A 1WJQA 2DF6A 1NEBA 1H92A 1W2BA 2K3BA 1Q86U 2E4HA 3CCVA 3QG1A 1OOTA 1G3SA 4LNPA 5FWCA 4L59A 3V8LA 2XU8A 4MZTA 4LUEA 2J6OA 2RJCA 3L2VA 3UWNA 2C06A 2KXCA 4JZ3A 4DOWA 2K79A 1Q7YU 3CCRT 2X4JA 4ZTJA 3CPWP 1X75C 3OQ5A 1GCQC 2KR3A 2YXYA 4N4GA 3OYKA 2J6KA 1LOJA 3TSZA 3LLRA 1RAEB 3UF4A 1KFZA 2EJ9A 3EH1A 1BI2A 2DTHA 3QZ5B 4IUTA 2CZ7B 4C92B 2YWWA 4IKFA 1PKSA 3VS3A 1X6BA 1M1KC 2DXTA 4FIBA 5L23A 2C0TA 1VQ4T 3NHNA 4OMMA 4MMKA 3C0CA 1AZGB 4Y92A 2RQVA 4ME7A 1LNXA 1M90U 1Y07A 1OX8A 1K4US 2DEUA 2C0IA 2DIQA 3LGFA 4JJCA 1M1FA 2E1HA 3ZFJA 2L3QA 4N4HA 2ED1A 4M75E 3EG0A 4J8OA 3G6ET 2XG8D 1IB8A 3CC7A 1SG5A 3A8OB 2KDSA 3A98A 4C5EA 1K8AU 3C4SA 1R8OB 3CBOA 2DEQA 1VOMA 2DETA 4KUDK 1RABB 1UUEA 1IRXA 4LD9K 2NWMA 1VYVA 4M77A 4EDUA 2YRDA 1YJNQ 3CCST 5KE2A 4ZN1A 2LQNA 1NJIR 4RTZA 2XDPA 2DL5A 3OBWA 1JB0E 1RAAB 2VWFA 1VQ5A 2XK0A 1K8AC 5CQXA 3C95A 1PRLC 1VQMQ 1VQKA 4AFQC 2NUTA 4AG1C 3NPFA 1OU9A 4QW2A 1QVFP 2LT4A 3G4SA 1YITQ 2E5QA 3HFOA 1UGRB 4J6WA 2FPDA 3JRZA 1JJ2A 1YJWT 2AIRB 3QZ9B 1QLYA 3CD6A 4HCKA 3E9GA 2RHUA 5DLQE 1SPKA 2NYSA 4JZ4A 2DRMA 2ZPGB 1ZBJA 2MWPA 2QQRA 2V8JA 3SEMA 3QYGB 2GBQA 1YI2A 4NL2A 4EMKB 2JNGA 1VQ4Q 4M78B 1Q81C 5KH6A 3PIPA 1M90C 3M54A 3MEVA 1VQ7Q 2KBTA 2D6FA 1OZ3A 1N5ZA 2A08A 3V7RA 4IIOA 2H3EB 3X20B 3PTAA 5KYYA 3AHUA 1X2QA 2CZ6B 1OU8A 3JCMJ 1S72Q 2HDAA 3RDVA 2OTJT 3OMGA 1QP2A 1WHJA 3WXMB 2ATCB 4FYWB 2KYMA 1MV3A 4M7AG 2PTKA 4RCBA 4JS4A 3I55T 5AYFA 2RH2A 8AT1B 3I5RA 1GCQA 4LDUA 2B86A 1WHMA 2RHIA 1VQ4A 3FDRA 3M0PA 3VS2A 1OEBA 2DD4A 2D8JA 3SWNB 5KYNA 2FRWA 1M9SA 2V1RA 4FU6A 2O4XB 3CCUA 1KSWA 2DJZA 1BYMA 1IXDA 2KY9A 3EAEA 2VB6A 4DBQA 2O01E 3O5ZA 2FZKB 1O9SA 2EYZA 3OYEA 2LJ3A 1ZQ1A 6AT1B 1YJ9A 3A1PA 2FG0A 5ECAA 2LT1A 5KCHA 1TTHB 1D1AA 1BIAA 2BZ8A 1JBMA 3HHTB 2JM9A 2IPOB 1VQ8A 2WSEE 3QXEB 1VQ6Q 3CMEQ 3M9QA 1XTDA 3VYHB 3EG2A 1T0JA 4A63B 2QA4Q 1BCOA 2JM8A 3A5ZB 5CKHA 1R0BG 5IXBA 2SEMA 3EG9B 2YUQA 1YJNA 4LE9A 2GFUA 1GRIA 3QSUA 1Y96B 3G6EQ 4PNOA 5GAOp 1HK9A 1ZUKA 2DILA 2P0QA 1Q86R 4QQDA 1W1FA 2XMFA 2QI2A 4B9XA 2XDDA 3MCAB 1YJNT 1VQNQ 4M77D 4F7UE 4HT8A 5FRNA 1ZSZB 1NJIU 4Y28E 4HCZA 4XU0A 2QDYB 2MF2A 3X26B 4L6V5 2EQJA 2HQXA 1I8FA 2E3IA 4C8QB 3ZBDA 1YIJT 5GMKh 4P5NA 2DL8A 2MPXC 2M51A 2RN8A 1KQSA 1BCMA 1QP3A 4FCYA 2O88A 3CD6T 4PFPA 1D0ZA 1KC8U 2OAWA 4KH1B 4Z02A 4BB7A 3FC3A 2CYZB 4KBMB 1NEGA 2KGTA 3THKA 2VGNA 2COWA 2FHDA 3M56A 4RTYA 4PJJA 1K9MC 1TUCA 3JCMe 2YUPA 4E47A 3Q1JA 4FYYB 3UA6A 3OYAA 2FZGB 1FMWA 2DXCA 5AT1B 4X9CA 3VS6A 4WTOB 2JTEA 2LC4A 3VYGA 5J39A 4J9FA 1I5LA 5A2QE 3CCQT 2OJ2A 4QQGA 5DY9A 4AFSC 1UJ0A 2PVOB 1QVGP 4M78G 2DMOA 5D6XA 5GANe 3E1SA 1YHQT 2LP5A 3MEAA 4IIMA 4M7AC 5GAMg 1AZEA 3FB9A 5FLXE 4RCCA 4XK8E 4J6YA 5M9OA 1KG1A 4M78C 4ZTFA 3GNFB 2A3LA 4HT9A 2DTOA 1RL2A 2NLUA 1BB9A 1E6GA 5IHIA 2D1XA 4D8DA 3BFMA 2EAYA 4BY6C 1RI9A 1W2BP 3H0HA 2BKDN 2QA4T 1WXBA 4A53A 2BE7D 2E65A 4XTUA 1VQ6T 2L3RA 1B34B 5GAMh 2P84A 4PJOD 3CXCP 3ZL7C 1W4SA 1UGQB 4A4HA 4EMKA 3MHXA 1E6HA 2QA4A 1MNDA 2CH4A 3JCMg 1H3ZA 3ZEHA 3QYHB 1K9AA 3JCMV 1W2BS 5GAN7 2LCCA 2D9TA 2JS2A 1ZX6A 2DYIA 4J9IA 3TU4K 1X2KA 3PVLA 2X51A 2DJQA 1BIBA 1NYFA 2HSPA 3NMZC 4WCIA 2DXBA 3V8JA 2E10A 2EPDA 3VJPA 5HKCA 1G8XA 2NUTB 3TQ7P 4M7DD 2QQ9A 4XQ3A 3L2ZA 2CP0A 4J9GA 3V7CA 1YP5A 2A0FB 4HXJA 2LX7A 3CCRQ 4ELZC 3CPFA 3EGDB 2D8HA 1B07A 5LL6S 2VXEA 3RUXA 3EGXA 3BW1A 5DLOA 1T3LA 4BI3A 3CMAT 1SRMA 2DVEA 1G3TA 1MGQA 5LJ5e 2AHJB 4J83A 1AWXA 1ZSZA 3I55Q 3BY7A 5GJWB 3CQTA 3CCJQ 2HKNA 1KQ2A 4V2SA 3QDFA 1X01A 3KUFA 3JAME 3QPHA 1YHQA 2R5AA 1WXTA 1H641 4C8QG 2A7YA 4F7UF 4PJNA 2L3SA 2IG0A 1EX4A 3SD4A 4CRIA 3TREA 4NL3A 2DX1A 4RKUE 4N0AC 2P0KA 1GFDA 2F2WA 4M75A 4F04B 3M55A 2HBPA 5J26A 4BD3A 4FYXB 5FU7B 5C6SA 1U3OA 4J9HA 3UDCA 2F2VA 4KGVB 1T3SA 2LNVA 3CD6Q 2CT3A 1W6XA 2KYBA 1JRIA 1WXUA 4JPBW 3OYYA 2LJ0A 3P8HA 1WDXA 5A0LA 4M7DC 1MMNA 4AG2C 3JSCA 5LJ3j 2G6FX 9ATCB 4M7DA 1K0XA 1M8VA 4QKUA 1PNJA 2F2XA 1F1BB 1I07A 2JJ9A 3EGDA 1WQ7A 4XU3A 2JMAA 1M2VB 2RHXA 2DZ9A 1SHFA 3E2UA 3S3MA 1EZZB 3NFCA 4KGZB 4M4ZA 3CCSA 2HZYA 2ZPFB 1PG5B 2HL3A 4C0ZA 4B9WA 2KK4A 3MP8A 5CCAA 1UHCA 1EFNA 3C94A 1WLPB 4AT1B 1MMAA 3QJ6A 3PFSA 3EG3A 1VIEA 1V76A 1Y57A 1NE8A 1YIJA 1QKWA 1PSEA 4KULA 5IXFA 1BU1A 2CT4A 4LD6A 3QDRB 1NPPA 1VQLA 1WNLA 2PVDB 3UA7A 4A4FA 5GMKl 3I35A 4TVRA 2DBKA 4CC3A 2K5IA 5IAYA 5EG2A 5GANf 2RI2A 2VVKA 3QO3A 1FWZA 2CSIA 2DRKA 2H8HA 4FSXA 1FYNA 4Z8AA 3CEYA 3I55A 4OB0B 2XDBA 3TSWA 1M2VA 2XICA 1A0NB 1IHWA 1PCXA 1M5Q1 1D3BA 3GLXA 3VS5A 1PWTA 1WHHA 2DNUA 3JCMf 4DBFA 3CCEA 3OW2A 3CCRA 3X25B 1SRLA 4PJMA 2DA9A 2HBWA 2O9SA 1UGSB 2YRVA 1ZUYA 1ABQA 2PQWA 5IN1A 1AHJB 3OYIA 1N9RA 1J3TA 3FJ5A 3CCLQ 2CS7A 3GOXA 1VQLT 1X69A 1QKXA 3TVTA 5GJVB 4RTWA 2QDLA 2RHZA 2XKOC 2DZCA 1YJWA 2KROA 2RQTA 4VUBA 4BACA 2RPNA 4PJOC 2MYSA 2EFIA 2VUBA 3MP6A 1JJ2P 1AWOA 4GLMA 1LVKA 1VUBA 1VQPA 1VQOA 4BDYA 2QYZA 3HRUA 3OYMA 4J9DA 2I2LA 3JCMc 1M1KU 2A36A 3LW5E 2WSFE 1QCFA 3META 5D6YA 2JTMA 3I5SA 2IIMA 2RM4A 1XNIA 2CP7A 5GMKe 5LJ3h 2E5KA 5IHKA 1RAHB 2YRCA 3MEWA 3RMSA 3CCLT 1YNZA 2V8KA 1E7OA 3G4ST 1UJYA 3LGLA 2ZPHB 3H41A 4M78E 4C92F 1Q82U 4QVDA 2X4WA 3F70A 1N6AA 4XAXB 4RG8A 3OS1A 2V8IA 2M9UA 1VQ5T 2EYQA 3T9NA 3QJYA 2IVWA 1QCNA 3DB4A 1QVGA 1D1BA 1W70A 3OYHA 2FPEA 4KH0B 2RHYA 1QVGS 5CK9A 2LVMA 2RA2A 5GAOn 3DLLA 4FT4A 1Y71A 2YUNA 3NTIA 3H6ZA 1XJWB 4PJOA 3HTRA 5FU6B 3LWIA 5GAN5 4JJDA 3INZA 2ZZDA 3A8HB 4Z88A 4M75D 1GBRA 3JCMW 2QXFA 2CZ1B 2NUZA 4BDZA 3RMQA 5LJ5j 2VXFA 5LJ5g 1N27A 2PNIA 3CCUT 2K6DA 1UHFA 4FT2A 4M75C 2VV5A 2DVJA 4E7IA 3M0UA 3MJXA 2EGCA 1UEBA 2E6NA 4A4KA 2HL5C 4A4EA 2QGGA 4C92E 2JMCA 4JJNK 2D0NA 2EYWA 3E19A 4X1VA 3SWNA 1AVZC 1RADB 3AT1B 2QEXA 4PFZA 4LDVA 4QVCA 2RQUA 5GAOq 1WFWA 4IURA 2H3JA 5GAN6 1JEGA 3OW2S 1VYUA 1D1CA 4FL6A 4OF1A 2C0OA 1XQHA 4XTYA 2AK5A 1D09B 2L0AA 2EQMA 1JQQA 4OB1B 2V1QA 1D3BB 2GTOA 3L2UA 4ZGJB 2SRCA 1D0XA 4M78D 2JS0A 2MOXA 2ZCFB 4LN2A 3A8GB 3OYCA 1WI7A 3R6NA 2L3PA 1K73C 4JJBA 2F1LA 1Z9ZA 5LJ3g 2KRSA 2MK5A 4WF2A 1FX7A 2KSSA 4JRPA 4QT7A 2LX9A 1SF9A 3CCLA 4OMLA 1TS9A 1WHGA 1JJ2S 2LQKA 1QVFS 4B6MA 2AT1B 1YBYA 4C0DB 2KI7A 4JRQA 1Y7XA 2YHTA 2O9VA 4DBRA 2YT6A 2RQRA 4R0KA 1H8KA 5LJ5d 2CP2A 3G1JA 5CO7A 2K2VA 3ER0A 3CCJT 3QUIA 4M7AE 2OAUA 4J7FA 3LH5A 4K11A 3P8DA 3PNWC 2DL7A 1YI2T 3NTKA 2Z0WA 4M77F 2QQAA 4E7JA 1VQNT 3VV0A 4C0FA 2ZPIB 5GAOr 3QWYA 3ME9A 1S72T 2K5LA 1NLOC 1WJRA 2M02A 3I56A 1OPLA 3UATA 1SKUB 1K9MU 3EG9A 4M77C 1WZOA 4LDXA 3M58A 4OMQA 1YFNA 3EGUA 3MO8A 1U06A 3EHQA 2X4YA 2XHCA 2X4XA 5GANh 5HY6A 1OPKA 3CCMQ 2DFUA 2EIFA 3G7ZA 1KHCA 3HKSA 4J9BA 1NLPC 2AZSA 2LQWA 2VASA 1M27C 1K8AR 1ZA1B 1VQKQ 2OI3A 2ZAEA 3L1AA 4CC4B 2FEIA 3OA6A 1N8RU 2ROTA 3CCET 3PVQA 2P0PA 3FEOA 4O6JA 1UGVA 3JB9G 1KHIA 4BY6B 4JUVA 1D0YA 2RK1A 2QEXT 3DKMA 2CSQA 2Y4YA 2HKQB 2GCXA 3BE3A 3CC7Q 3ULRB 2RO0A 3EGXB 5GAMe 1VQ6A 1ZUUA 2GQIA 5KYYB 1AWWA 3OBYA 2RD1A 5IHNA 3VRYA 3S3NA 3L42A 2M0YA 5GAN8 3OS2A 1N8RC 1VQ7T 4CC2A 4RUGA 2RQWA 1KC8R 3SDZA 4XTWA 1X27A 5LJ5f 3JCMP 1EIFA 3CCEQ 3BDLA 2KT1A 2BE9B 2DERA 2OTLQ 3CCMT 2WACA 4QVZA 5KE3A 5IH2A 1S1NA 2OTLT 1UE9A 1IREB 3CCJA 1IHVA 1Q82R 4YTLA 2CP3A 3I56T 4M75F 1PRMC 5KYWB 4PKCC 2BUDA 1U1TA 1B34A 5GAMd 2VKNA 4HVUA 2CUBA 1QWEA 2MMPA 3H9NA 1K76A 4DBHA 1SSHA 1B3QA 2WSCE 3REBB 3X24B 4KGXB 1YWOA 4BE2A 3EH2A 1UECA 4M77B 3PE0A 1RAIB 5CAIA 4BE0A 5I21A 1OULA 3G4SQ 5CVIA 2K9GA 1XOVA 4RMOA 5I2SA 4J9EA 1QW1A 1RLPC 1M4ZA 2L5QA 4RG2A 1KC8C 2X9HA 1VQ9T 4XTZA 5J3BA 4MMLA 3JV3A 1KD1C 2CP5A 3O8VA 1RACB 2RF0A 4L5GA 1I81A 1M8MA 2X3WD 5KYUA 2P4RA 1OQKA 4ATOA 1TWBA 3FRNA 4PJOE 5KCOA 4IUUA 2X35A 5FWBA 1VQMA 5FU6C 1SSFA 2EKHA 1PHTA 1YWPA 4C5IA 3CC4A 1H3HA 3H0FA 2EQKA 2FRYA 3QWXX 4PJOB 2QTXA 1JU5C 3JB9H 1MMDA 2LQ8A 2FYKA 1Q7YC 3LX7A 1I4K1 4IUQA 3OSVA 4C5HA 5GAN3 3OW2P 1YJ9Q 1LJOA 1U5SA 2ECZA 2E3HA 2FL7A 4OVAA 2ZPBB 3WVDB 4MZPA 4BUGA 4GY5A 4XTXA 1ZHIA 1MHNA 2EYYA 4JRIA 3EFRA 4D8KA 5CKEA 2DBMA 2YSQA 4C8QA 1O75A 2HCKA 3RKWA 1C0MA 1FXXA 1QMCA 3R6OA 4AMCA 2JXBA 2O31A 1RAGB 2YLBA 3G71T 3GPLA 4AFZC 3SWNC 2FZCB 1AEYA 4E7SA 4E7LA 2MWOA 3FLGA 1I5OB 3RBBB 2QASA 2KRMA 2JUFA 3GP8A 1KJWA 3G71A 5I2MA 4OMPA 2EVRA 5A0GA 4ANJA 4C92G 1M30A 2LJ1A 1CKAA 3PMTA 1YI2Q 4KT0E 2E70A 3NGPA 4F16A 4C0DC 4PFOA 4PJLA 1IGUA 1WA7A 4C8QF 1C6VX 4BE1A 3UT1A 1MUZA 4KRTA 7AT1B 1PSFA 4MZMA 1TUGB 3L2RA 2MAMA 3CCSQ 4E7ZA 1AWJA 4ESRA 3HRSA 4PJOG 1QCOA 1MNEA 1YCSB 3M0RA 4M75G 2HD0A 2EWNA 2QQBA 5CIUA 2XD0A 4M7AA 1VQ5Q 3DLMA 2W10A 5GMKm 1TUDA 1VYTA 4LDYA 4MDWA 1JXMA 1Q81R 2J06A 2EW3A 4AFUC 3L2QA 4MDXA 3CC2Q 3V7SA 2DO3A 3HRTA 3M0QA 4JRKA 3RERA 3GBQA 2QAZA 4LXCA 5LJ3f 4F7UG 1VQKT 1Q95G 1WJSA 3CC2T 2RI3A 2DPPB 3SB2A 3REAB 1ZSGA 3SHWA 2A37A 3CMET 2FPFA 1I0CA 1BI0A 2K2MA 4CC7A 2OTJA 4FM4B 2G3RA 2EGEA 2ENMA 3RKXA 2J6FA 1R77A 1WIEA 1ZA2B 3GF5A 1G2BA 4OB3B 5GMKj 2FO0A 4M7DF 4IUVA 2R5MA 3MEUA 2XI9A 3GNGA 2Y90A 2F69A 2CDTA 5GANj 1TSFA 1VIFA 5HK0A 3VU3C 4C92C 1NJIC 3OSSC 4OB2B 1PC0A 3WVEB 2DL4A 1PKTA 3V8KA 5FU7C 1OYXA 4J5YA 2GF7A 3ASKA 3QIIA 4LDWA 4M77G 5KYXB 3N5BB 3TCJA 3M5AA 4CI0C 4E7HA 1IZ6A 2DD5A 3CBPA 1QVPA 4D6WA 1VQLQ 5DM7R 2EGAA 2AKLA 4M7DB 3G71Q 1OV3A 5FW9A 2JW4A 1G3YA 2KNBB 5KYUB 2GNCA 2HNIA 5IT9E 5CQYA 3A8MB 1NG2A 1Q86C 4R55A 1FMKA 1X6GA 2JOYA 2M16A 4M7DE 2JVVA 3L2WA 3VS7A 2K7AA 2ABLA 3BDUA 2FVUA 2COZA 1V29B 1T0HA 4M75B 4N0AA 2EKOA 4FYVB 2OTJQ 2R58A 1WGSA 1HJDA 4X34A 1YJ9T 5FRMA 2E6ZA 1SEMA 2KQWA 3CC4T 4LUDA
chains in the Genus database with same CATH topology
1T3LA 4OMQA 1SRMA 3EGUA 1AOJA 1U06A 3EHQA 2J05A 1AWXA 1OPKA 4ZNXA 5GJWB 2W0ZA 2DF6A 3CQTA 1NEBA 1H92A 2K3BA 4J9BA 1NLPC 2AZSA 2LQWA 1OOTA 4LNPA 2JT4A 5FWCA 1WXTA 4LUEA 2J6OA 1M27C 2L3SA 2BTTA 2KXCA 4JZ3A 2OI3A 1SHGA 4CC4B 2FEIA 1KIKA 2DX1A 2K79A 2ROTA 1GFDA 2F2WA 1GCQC 2KR3A 3PVQA 2J6KA 2MCNA 3TSZA 1UGVA 1U3OA 3UF4A 4J9HA 1KFZA 4RTVA 2CUDA 2F2VA 1T3SA 2CSQA 2CT3A 1W6XA 2KYBA 1WXUA 1PKSA 4JPBW 3VS3A 1X6BA 2GGRA 2ROLA 2LJ0A 2KRNA 1WDXA 5L23A 2MIOA 3ULRB 4AG2C 2AKKA 2C0TA 1ZUUA 2GQIA 1AWWA 3NHNA 4OMMA 3C0CA 2G6FX 1AZGB 4Y92A 5IHNA 1ZLMA 1K0XA 3VRYA 3M0TA 1PNJA 2F2XA 1M3AA 2RQVA 1I07A 2M0YA 1HSQA 4CC2A 1K4US 4RUGA 2EQIA 2JMAA 2RQWA 2C0IA 4JJCA 1X27A 1SHFA 1GBQA 2L3QA 2GTJA 2ED1A 4M4ZA 4RTXA 2KT1A 3EG0A 1AD5A 2BZXA 5IH2A 1S1NA 3VS1A 1UE9A 3A98A 3VRZA 1UUEA 1UHCA 1EFNA 2NWMA 1VYVA 1PRMC 1WLPB 2LNHB 3EG3A 2VKNA 4HVUA 2CUBA 2LQNA 1Y57A 4RTZA 2DYBA 1QWEA 2DL5A 2I0NA 2VWFA 1K76A 1QKWA 1CKBA 1SSHA 1B3QA 3REBB 5IXFA 1BU1A 2CT4A 1PRLC 1YWOA 2ED0A 1TG0A 1UECA 4AFQC 4AG1C 3UA7A 3NPFA 3PE0A 4EIKA 3I35A 3M0SA 2DBKA 4CC3A 2DM1A 2FPDA 2VVKA 2K9GA 1XOVA 4J9EA 1RLPC 2CSIA 2DRKA 2H8HA 1QWFA 1QLYA 1FYNA 4HCKA 4Z8AA 1YN8A 1SPKA 4JZ4A 3TSWA 2DRMA 1ZBJA 3JV3A 2RF0A 1A0NB 3SEMA 2GBQA 1M8MA 2X3WD 1NM7A 2P4RA 3VS5A 1WYXA 1PWTA 2DNUA 2KBTA 1N5ZA 3U23A 2A08A 1SRLA 2DA9A 4IIOA 5FWBA 2HBWA 2AZVA 2O9SA 2J7IA 1UTIA 2YUOA 1X2QA 1ZUYA 2EKHA 2HDAA 1ABQA 1PHTA 1YWPA 1J3TA 1H3HA 3FJ5A 3H0FA 4GBQA 2FRYA 4E6RA 3QWXX 1X69A 2KYMA 1MV3A 1JU5C 1QKXA 2CREA 2PTKA 3TVTA 1ABOA 2DLPA 5GJVB 5I22A 4RTWA 2DE0X 2QDLA 3I5RA 4F17A 1U5SA 2ECZA 2KROA 4FSSA 1GCQA 2B86A 2RQTA 2RPNA 3M0PA 3VS2A 4F14A 1OEBA 2D8JA 2YDLA 1UG1A 2EYYA 2FRWA 2V1RA 1AWOA 4GLMA 1KSWA 4D8KA 2O2OA 4J9DA 2DBMA 3VS4A 2YSQA 3O5ZA 2A36A 2HCKA 1QCFA 1X43A 2A28A 2EYZA 2KEAA 5HCKA 1K1ZA 3VS0A 3I5SA 2LJ3A 2IIMA 2RNAA 2JXBA 5ECAA 2FG0A 2O31A 2E5KA 1Y0MA 5IHKA 2BZ8A 4AFZC 2JM9A 3KFVA 2LMJA 4ORZA 2X3XD 1AEYA 1YNZA 1E7OA 3EG2A 1T0JA 1UJYA 4A63B 3RBBB 1BBZA 2JM8A 3H41A 5IXBA 2SEMA 2YUQA 2KRMA 1KJWA 2KT8A 4LE9A 1GRIA 1GCPA 4OMPA 2EVRA 1M3BA 1M30A 2LJ1A 1CKAA 1ZUKA 2DILA 1BK2A 1VA7A 1W70A 3NGPA 1W1FA 2XMFA 4F16A 2FPEA 1HD3A 1WA7A 2YUNA 2LZ6B 4OMOA 1MUZA 4KRTA 1K0SA 4JJDA 4OMNA 5I11A 1AWJA 4Z88A 4ESRA 2DL8A 1GBRA 2M51A 1YCSB 2BZYA 2RN8A 4HVWA 3M0RA 2NUZA 2ESWA 4HVVA 1GL5A 4RTTA 2O88A 2PNIA 1RUWA 2K6DA 3H0IA 1MV0B 2L2PA 1UHFA 2W10A 2OAWA 1G83A 1TUDA 2DVJA 1VYTA 3M0UA 1JXMA 2EGCA 2J06A 2EW3A 2KE9A 1NEGA 2KGTA 5EC7A 4AFUC 1UDLA 2JMCA 3THKA 1ARKA 2D0NA 2EYWA 2DL3A 4X1VA 4RTYA 3M0QA 1TUCA 1AVZC 4Z89A 3GBQA 2YUPA 2RQUA 3UA6A 1WFWA 1RLQC 1JEGA 1VYUA 3REAB 1ZSGA 2C0OA 3VS6A 2JTEA 2AK5A 3SHWA 2A37A 2L0AA 4J9FA 2FPFA 1IO6A 1I0CA 2K2MA 4CC7A 1JQQA 1JXOA 2EGEA 2ENMA 2OJ2A 2V1QA 2J6FA 1JO8A 4AFSC 1UJ0A 2GTOA 2DMOA 1WIEA 3RNJA 1CSKA 2LP5A 1G2BA 4IIMA 2EYXA 2FO0A 1AZEA 2SRCA 2JS0A 2MOXA 4LN2A 1WI7A 4RTUA 3R6NA 2L3PA 2CDTA 4JJBA 1Z9ZA 2KXDA 4DEXA 2KRSA 1BB9A 1E6GA 5IHIA 1WX6A 2D1XA 4D8DA 2RMOA 2DL4A 1RI9A 4QT7A 1PKTA 4J9CA 3H0HA 3I9QA 4OMLA 1Z9QA 1WXBA 3EHRA 2EGAA 2AKLA 2O9VA 2CH4W 1OV3A 2YT6A 5FW9A 2JW4A 2RQRA 2PZ1A 3ZL7C 4R0KA 1H8KA 2KNBB 2GNCA 1NYGA 1E6HA 2CH4A 1NG2A 3IQLA 2EBPA 3EG1A 4K11A 3LH5A 1FMKA 1X6GA 1K9AA 2DL7A 3VS7A 1M3CA 2LCSA 2K7AA 2JS2A 2ABLA 1ZX6A 4J9IA 1V1CA 2HEQA 1X2KA 3PVLA 1I1JA 1GFCA 1LCKA 2DJQA 1NYFA 2HSPA 3NMZC 4WCIA 1T0HA 1UFFA 3QWYA 2EPDA 1HJDA 4DEYA 1NLOC 4J9GA 1SEMA 1YP5A 1OPLA 4HXJA 2LX7A 3UATA 2D8HA 1B07A 4LUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T3L A;  4OMQ A;  1SRM A;  3EGU A;  1AOJ A;  1U06 A;  3EHQ A;  2J05 A;  1AWX A;  1OPK A;  4ZNX A;  5GJW B;  2W0Z A;  2DF6 A;  3CQT A;  1NEB A;  1H92 A;  2K3B A;  4J9B A;  1NLP C;  2AZS A;  2LQW A;  1OOT A;  4LNP A;  2JT4 A;  5FWC A;  1WXT A;  4LUE A;  2J6O A;  1M27 C;  2L3S A;  2BTT A;  2KXC A;  4JZ3 A;  2OI3 A;  1SHG A;  4CC4 B;  2FEI A;  1KIK A;  2DX1 A;  2K79 A;  2ROT A;  1GFD A;  2F2W A;  1GCQ C;  2KR3 A;  3PVQ A;  2J6K A;  2MCN A;  3TSZ A;  1UGV A;  1U3O A;  3UF4 A;  4J9H A;  1KFZ A;  4RTV A;  2CUD A;  2F2V A;  1T3S A;  2CSQ A;  2CT3 A;  1W6X A;  2KYB A;  1WXU A;  1PKS A;  4JPB W;  3VS3 A;  1X6B A;  2GGR A;  2ROL A;  2LJ0 A;  2KRN A;  1WDX A;  5L23 A;  2MIO A;  3ULR B;  4AG2 C;  2AKK A;  2C0T A;  1ZUU A;  2GQI A;  1AWW A;  3NHN A;  4OMM A;  3C0C A;  2G6F X;  1AZG B;  4Y92 A;  5IHN A;  1ZLM A;  1K0X A;  3VRY A;  3M0T A;  1PNJ A;  2F2X A;  1M3A A;  2RQV A;  1I07 A;  2M0Y A;  1HSQ A;  4CC2 A;  1K4U S;  4RUG A;  2EQI A;  2JMA A;  2RQW A;  2C0I A;  4JJC A;  1X27 A;  1SHF A;  1GBQ A;  2L3Q A;  2GTJ A;  2ED1 A;  4M4Z A;  4RTX A;  2KT1 A;  3EG0 A;  1AD5 A;  2BZX A;  5IH2 A;  1S1N A;  3VS1 A;  1UE9 A;  3A98 A;  3VRZ A;  1UUE A;  1UHC A;  1EFN A;  2NWM A;  1VYV A;  1PRM C;  1WLP B;  2LNH B;  3EG3 A;  2VKN A;  4HVU A;  2CUB A;  2LQN A;  1Y57 A;  4RTZ A;  2DYB A;  1QWE A;  2DL5 A;  2I0N A;  2VWF A;  1K76 A;  1QKW A;  1CKB A;  1SSH A;  1B3Q A;  3REB B;  5IXF A;  1BU1 A;  2CT4 A;  1PRL C;  1YWO A;  2ED0 A;  1TG0 A;  1UEC A;  4AFQ C;  4AG1 C;  3UA7 A;  3NPF A;  3PE0 A;  4EIK A;  3I35 A;  3M0S A;  2DBK A;  4CC3 A;  2DM1 A;  2FPD A;  2VVK A;  2K9G A;  1XOV A;  4J9E A;  1RLP C;  2CSI A;  2DRK A;  2H8H A;  1QWF A;  1QLY A;  1FYN A;  4HCK A;  4Z8A A;  1YN8 A;  1SPK A;  4JZ4 A;  3TSW A;  2DRM A;  1ZBJ A;  3JV3 A;  2RF0 A;  1A0N B;  3SEM A;  2GBQ A;  1M8M A;  2X3W D;  1NM7 A;  2P4R A;  3VS5 A;  1WYX A;  1PWT A;  2DNU A;  2KBT A;  1N5Z A;  3U23 A;  2A08 A;  1SRL A;  2DA9 A;  4IIO A;  5FWB A;  2HBW A;  2AZV A;  2O9S A;  2J7I A;  1UTI A;  2YUO A;  1X2Q A;  1ZUY A;  2EKH A;  2HDA A;  1ABQ A;  1PHT A;  1YWP A;  1J3T A;  1H3H A;  3FJ5 A;  3H0F A;  4GBQ A;  2FRY A;  4E6R A;  3QWX X;  1X69 A;  2KYM A;  1MV3 A;  1JU5 C;  1QKX A;  2CRE A;  2PTK A;  3TVT A;  1ABO A;  2DLP A;  5GJV B;  5I22 A;  4RTW A;  2DE0 X;  2QDL A;  3I5R A;  4F17 A;  1U5S A;  2ECZ A;  2KRO A;  4FSS A;  1GCQ A;  2B86 A;  2RQT A;  2RPN A;  3M0P A;  3VS2 A;  4F14 A;  1OEB A;  2D8J A;  2YDL A;  1UG1 A;  2EYY A;  2FRW A;  2V1R A;  1AWO A;  4GLM A;  1KSW A;  4D8K A;  2O2O A;  4J9D A;  2DBM A;  3VS4 A;  2YSQ A;  3O5Z A;  2A36 A;  2HCK A;  1QCF A;  1X43 A;  2A28 A;  2EYZ A;  2KEA A;  5HCK A;  1K1Z A;  3VS0 A;  3I5S A;  2LJ3 A;  2IIM A;  2RNA A;  2JXB A;  5ECA A;  2FG0 A;  2O31 A;  2E5K A;  1Y0M A;  5IHK A;  2BZ8 A;  4AFZ C;  2JM9 A;  3KFV A;  2LMJ A;  4ORZ A;  2X3X D;  1AEY A;  1YNZ A;  1E7O A;  3EG2 A;  1T0J A;  1UJY A;  4A63 B;  3RBB B;  1BBZ A;  2JM8 A;  3H41 A;  5IXB A;  2SEM A;  2YUQ A;  2KRM A;  1KJW A;  2KT8 A;  4LE9 A;  1GRI A;  1GCP A;  4OMP A;  2EVR A;  1M3B A;  1M30 A;  2LJ1 A;  1CKA A;  1ZUK A;  2DIL A;  1BK2 A;  1VA7 A;  1W70 A;  3NGP A;  1W1F A;  2XMF A;  4F16 A;  2FPE A;  1HD3 A;  1WA7 A;  2YUN A;  2LZ6 B;  4OMO A;  1MUZ A;  4KRT A;  1K0S A;  4JJD A;  4OMN A;  5I11 A;  1AWJ A;  4Z88 A;  4ESR A;  2DL8 A;  1GBR A;  2M51 A;  1YCS B;  2BZY A;  2RN8 A;  4HVW A;  3M0R A;  2NUZ A;  2ESW A;  4HVV A;  1GL5 A;  4RTT A;  2O88 A;  2PNI A;  1RUW A;  2K6D A;  3H0I A;  1MV0 B;  2L2P A;  1UHF A;  2W10 A;  2OAW A;  1G83 A;  1TUD A;  2DVJ A;  1VYT A;  3M0U A;  1JXM A;  2EGC A;  2J06 A;  2EW3 A;  2KE9 A;  1NEG A;  2KGT A;  5EC7 A;  4AFU C;  1UDL A;  2JMC A;  3THK A;  1ARK A;  2D0N A;  2EYW A;  2DL3 A;  4X1V A;  4RTY A;  3M0Q A;  1TUC A;  1AVZ C;  4Z89 A;  3GBQ A;  2YUP A;  2RQU A;  3UA6 A;  1WFW A;  1RLQ C;  1JEG A;  1VYU A;  3REA B;  1ZSG A;  2C0O A;  3VS6 A;  2JTE A;  2AK5 A;  3SHW A;  2A37 A;  2L0A A;  4J9F A;  2FPF A;  1IO6 A;  1I0C A;  2K2M A;  4CC7 A;  1JQQ A;  1JXO A;  2EGE A;  2ENM A;  2OJ2 A;  2V1Q A;  2J6F A;  1JO8 A;  4AFS C;  1UJ0 A;  2GTO A;  2DMO A;  1WIE A;  3RNJ A;  1CSK A;  2LP5 A;  1G2B A;  4IIM A;  2EYX A;  2FO0 A;  1AZE A;  2SRC A;  2JS0 A;  2MOX A;  4LN2 A;  1WI7 A;  4RTU A;  3R6N A;  2L3P A;  2CDT A;  4JJB A;  1Z9Z A;  2KXD A;  4DEX A;  2KRS A;  1BB9 A;  1E6G A;  5IHI A;  1WX6 A;  2D1X A;  4D8D A;  2RMO A;  2DL4 A;  1RI9 A;  4QT7 A;  1PKT A;  4J9C A;  3H0H A;  3I9Q A;  4OML A;  1Z9Q A;  1WXB A;  3EHR A;  2EGA A;  2AKL A;  2O9V A;  2CH4 W;  1OV3 A;  2YT6 A;  5FW9 A;  2JW4 A;  2RQR A;  2PZ1 A;  3ZL7 C;  4R0K A;  1H8K A;  2KNB B;  2GNC A;  1NYG A;  1E6H A;  2CH4 A;  1NG2 A;  3IQL A;  2EBP A;  3EG1 A;  4K11 A;  3LH5 A;  1FMK A;  1X6G A;  1K9A A;  2DL7 A;  3VS7 A;  1M3C A;  2LCS A;  2K7A A;  2JS2 A;  2ABL A;  1ZX6 A;  4J9I A;  1V1C A;  2HEQ A;  1X2K A;  3PVL A;  1I1J A;  1GFC A;  1LCK A;  2DJQ A;  1NYF A;  2HSP A;  3NMZ C;  4WCI A;  1T0H A;  1UFF A;  3QWY A;  2EPD A;  1HJD A;  4DEY A;  1NLO C;  4J9G A;  1SEM A;  1YP5 A;  1OPL A;  4HXJ A;  2LX7 A;  3UAT A;  2D8H A;  1B07 A;  4LUD A; 
#chains in the Genus database with same CATH topology
 2DIG A;  3HPW A;  5L8R E;  1B7T A;  1VQM T;  3JB9 I;  3EFS A;  4KUI A;  4ZNX A;  4C92 A;  2RI5 A;  1VQO Q;  2W0Z A;  4PJO F;  1M1G A;  2LDM A;  1G3W A;  3OMC A;  2VC8 A;  4ZGE B;  1TOV A;  2JT4 A;  3HSB A;  5A0D A;  1N9S A;  4QQ6 A;  2RK2 A;  3KBG A;  4OP0 A;  4R56 A;  4X9D A;  3KXT A;  4C8Q E;  1VQ9 Q;  2M0O A;  2F5T X;  3FIF A;  1M1K R;  2BTT A;  1SHG A;  1KIK A;  2DXU A;  3RIR A;  2CGH A;  2QQS A;  4C0G A;  2ZGW A;  2MCN A;  1Y96 A;  3OYL A;  3A8L B;  4J6X A;  4RTV A;  2CUD A;  8ATC B;  3JB9 D;  1ACM B;  3CCU Q;  4M78 F;  2PUK B;  4F7U A;  1YHQ Q;  4FW2 A;  4BI8 B;  2GGR A;  2ROL A;  4ZN3 A;  2KRN A;  2HAX A;  3OYJ A;  4M7A F;  1K73 U;  3JCM d;  2M1H A;  2MIO A;  2DK3 A;  2AKK A;  3CPW S;  3CCQ A;  5GAN g;  2QGF B;  3I56 Q;  1KD1 U;  2RJD A;  1ZLM A;  1HXD A;  3M0T A;  1M3A A;  2JTF A;  2K4Y A;  1TH7 A;  5GAM j;  1NBE B;  3J7A F;  1HSQ A;  3HP9 A;  1PD1 A;  2NUP A;  3GIB A;  2EQI A;  1UGP B;  3H8Z A;  1GBQ A;  2MI6 A;  1VQ7 A;  2GTJ A;  1X6O A;  4JLG A;  4RTX A;  1QQJ A;  3JB9 J;  4C8Q C;  1AD5 A;  3CCV Q;  3CMA A;  2BZX A;  3VS1 A;  1YCY A;  2L89 A;  2OTL A;  3VRZ A;  3LWH A;  3HL8 A;  1Q81 U;  4N4I A;  1LPL A;  1QVF A;  1K73 R;  2GQV A;  2LNH B;  5CKF A;  1BKB A;  1MMG A;  1G5V A;  2DYB A;  4II1 A;  2I0N A;  2DAQ A;  2L8D A;  1CKB A;  4ELY C;  2CZ0 B;  4PLL A;  3VUZ A;  2ED0 A;  1TG0 A;  3OB9 A;  4NS5 A;  3UPU A;  4C8Q D;  1OX9 A;  4IUP A;  1Q82 C;  5HK3 A;  4EIK A;  1VQ8 T;  3M0S A;  1U1S A;  2DM1 A;  2GFA A;  3M59 A;  4EMK C;  3QKJ A;  1K9M R;  4EPC A;  3TEE A;  4JS5 A;  1QWF A;  3PIO A;  1PD0 A;  1C1A A;  1YN8 A;  2XID A;  3D7S B;  2PU9 B;  2HMA A;  1NM7 A;  1WYX A;  3J80 E;  3M4Y A;  2DTI A;  3U23 A;  4EMH A;  3C12 A;  1KK7 A;  1ZBX A;  5KYW A;  2AZV A;  2J7I A;  1UTI A;  2YUO A;  1IGQ A;  3M53 A;  5GAN d;  3S3O A;  3EFO B;  4DA4 A;  3CMA Q;  2LRQ A;  3NTH A;  2K3Y A;  2B8A A;  4M7A D;  3QHS A;  4GBQ A;  3DB3 A;  4E6R A;  3E9F A;  3LH0 A;  4F7U B;  2CRE A;  4A4G A;  1KQ1 A;  1WHL A;  4DQ2 A;  1ABO A;  2DLP A;  3RKY A;  2Y4X A;  5I22 A;  2DE0 X;  4F17 A;  4FSS A;  3S6W A;  4F14 A;  4PK4 A;  3JCM h;  1M2O A;  5D7U A;  3P8B B;  2YDL A;  1GXI E;  1UG1 A;  3MP1 A;  2QK0 A;  2V26 A;  2O2O A;  3M4G A;  2HSE B;  4J7I A;  3CCQ Q;  3VS4 A;  4M77 E;  2VGM A;  4M7A B;  2JN0 A;  2KEA A;  1X43 A;  2A28 A;  5HCK A;  4EMG A;  1K1Z A;  2QTV A;  3VS0 A;  2RNA A;  5CKB A;  1S72 A;  1FMV A;  3CXC A;  1R0C B;  1ZSZ C;  1Y0M A;  4BI4 A;  3OYN A;  4XU2 A;  3KFV A;  4HA8 A;  3JB9 F;  2LMJ A;  4ORZ A;  2X3X D;  3OS5 A;  1RAF B;  1BBZ A;  4E7K A;  2EJG A;  5FRO A;  2KT8 A;  2ZPE B;  4PLI A;  1GCP A;  2D0Q B;  4UC4 A;  2R57 A;  3PT9 A;  1M90 R;  2COY A;  3PGG A;  2O4X A;  2NUP B;  5GMK i;  1M3B A;  3CBM A;  4C92 D;  1BK2 A;  4OGC A;  1N8R R;  1VA7 A;  2VYT A;  4JLI A;  3PMI A;  5GAN 2;  2RB6 A;  1YIT A;  1Q7Y R;  2RJF A;  1HD3 A;  3OY9 A;  1KQS S;  2LCL A;  4HCB A;  2LZ6 B;  4OMO A;  2CP6 A;  2YLC A;  1K0S A;  4OMN A;  2CKK A;  5I11 A;  3M57 A;  5LJ3 d;  4Y91 A;  1VQ8 Q;  2HQE A;  4JDS A;  2BZY A;  4HVW A;  2ESW A;  4HVV A;  3CPW A;  1VQP Q;  1GL5 A;  4RTT A;  3OYB A;  1RUW A;  3H0I A;  1MV0 B;  2L2P A;  4XTV A;  4M78 A;  1OZ2 A;  5GAN 4;  2KVQ G;  3CXC S;  2QEX Q;  2KMT A;  1G83 A;  3FJP A;  4OMF B;  3RES A;  3CCM A;  5KYX A;  1VQP T;  2KE9 A;  5EC7 A;  1UDL A;  1ARK A;  3MKD A;  3SFM A;  2DL3 A;  4FW1 A;  4HCC A;  3RR6 A;  3JCM X;  4Z89 A;  1WHK A;  3CCV T;  1BI1 A;  1RLQ C;  2K5F A;  3EFO A;  1AT1 B;  4DOV A;  3JCM b;  1RI0 A;  1IO6 A;  1KD1 R;  1JXO A;  5D6W A;  3LYI A;  3X28 B;  5LJ5 h;  3JCM Q;  1JO8 A;  2E64 A;  4OGE A;  4GLK A;  3RNJ A;  2LTO A;  1CSK A;  2EYX A;  1HYO A;  5GAO l;  1TU0 B;  1DJ7 B;  2F5K A;  2K3X A;  4RTU A;  2KXD A;  4A54 A;  4DEX A;  2HQH A;  1U8R A;  1WX6 A;  2DKG A;  2RMO A;  2JZ2 A;  2P4T A;  3OYG A;  1P92 A;  4J9C A;  3VKI A;  1WPY A;  3I9Q A;  3URG A;  3HFN A;  5CKD A;  1Z9Q A;  1YIJ Q;  4C5G A;  2BIV A;  2QG9 B;  3MPU B;  4XU1 A;  5LJ3 e;  3EHR A;  4HKE A;  3OS0 A;  1VQ9 A;  1VQN A;  2CH4 W;  4NOY A;  2PZ1 A;  5C0M A;  3VUB A;  2PVG B;  1NYG A;  1TXQ A;  3IQL A;  2EBP A;  3EG1 A;  4Q5W A;  2FB7 A;  2OX7 A;  2E41 A;  3G6E A;  3CC7 T;  1VQO T;  1BI3 A;  2PUO B;  2KAF A;  1M3C A;  2EQU A;  2LCS A;  3J81 E;  1V1C A;  2HEQ A;  1YIT T;  1NZ9 A;  1I1J A;  1GFC A;  1LCK A;  2RJE A;  5GAM f;  1NPR A;  2E12 A;  3CME A;  4M7D G;  3CC4 Q;  1UFF A;  4E2F B;  1YJW Q;  4DEY A;  3OYF A;  3CC2 A;  2EJF A;  1PM3 A;  1OI1 A;  1UB4 A;  5GAO m;  3QBY A;  4ZGD B;  5CR2 A;  1AOJ A;  1WQW A;  4O5V A;  2J05 A;  1KQS P;  3OYD A;  2K57 A;  4PL6 A;  1WJQ A;  2DF6 A;  1NEB A;  1H92 A;  1W2B A;  2K3B A;  1Q86 U;  2E4H A;  3CCV A;  3QG1 A;  1OOT A;  1G3S A;  4LNP A;  5FWC A;  4L59 A;  3V8L A;  2XU8 A;  4MZT A;  4LUE A;  2J6O A;  2RJC A;  3L2V A;  3UWN A;  2C06 A;  2KXC A;  4JZ3 A;  4DOW A;  2K79 A;  1Q7Y U;  3CCR T;  2X4J A;  4ZTJ A;  3CPW P;  1X75 C;  3OQ5 A;  1GCQ C;  2KR3 A;  2YXY A;  4N4G A;  3OYK A;  2J6K A;  1LOJ A;  3TSZ A;  3LLR A;  1RAE B;  3UF4 A;  1KFZ A;  2EJ9 A;  3EH1 A;  1BI2 A;  2DTH A;  3QZ5 B;  4IUT A;  2CZ7 B;  4C92 B;  2YWW A;  4IKF A;  1PKS A;  3VS3 A;  1X6B A;  1M1K C;  2DXT A;  4FIB A;  5L23 A;  2C0T A;  1VQ4 T;  3NHN A;  4OMM A;  4MMK A;  3C0C A;  1AZG B;  4Y92 A;  2RQV A;  4ME7 A;  1LNX A;  1M90 U;  1Y07 A;  1OX8 A;  1K4U S;  2DEU A;  2C0I A;  2DIQ A;  3LGF A;  4JJC A;  1M1F A;  2E1H A;  3ZFJ A;  2L3Q A;  4N4H A;  2ED1 A;  4M75 E;  3EG0 A;  4J8O A;  3G6E T;  2XG8 D;  1IB8 A;  3CC7 A;  1SG5 A;  3A8O B;  2KDS A;  3A98 A;  4C5E A;  1K8A U;  3C4S A;  1R8O B;  3CBO A;  2DEQ A;  1VOM A;  2DET A;  4KUD K;  1RAB B;  1UUE A;  1IRX A;  4LD9 K;  2NWM A;  1VYV A;  4M77 A;  4EDU A;  2YRD A;  1YJN Q;  3CCS T;  5KE2 A;  4ZN1 A;  2LQN A;  1NJI R;  4RTZ A;  2XDP A;  2DL5 A;  3OBW A;  1JB0 E;  1RAA B;  2VWF A;  1VQ5 A;  2XK0 A;  1K8A C;  5CQX A;  3C95 A;  1PRL C;  1VQM Q;  1VQK A;  4AFQ C;  2NUT A;  4AG1 C;  3NPF A;  1OU9 A;  4QW2 A;  1QVF P;  2LT4 A;  3G4S A;  1YIT Q;  2E5Q A;  3HFO A;  1UGR B;  4J6W A;  2FPD A;  3JRZ A;  1JJ2 A;  1YJW T;  2AIR B;  3QZ9 B;  1QLY A;  3CD6 A;  4HCK A;  3E9G A;  2RHU A;  5DLQ E;  1SPK A;  2NYS A;  4JZ4 A;  2DRM A;  2ZPG B;  1ZBJ A;  2MWP A;  2QQR A;  2V8J A;  3SEM A;  3QYG B;  2GBQ A;  1YI2 A;  4NL2 A;  4EMK B;  2JNG A;  1VQ4 Q;  4M78 B;  1Q81 C;  5KH6 A;  3PIP A;  1M90 C;  3M54 A;  3MEV A;  1VQ7 Q;  2KBT A;  2D6F A;  1OZ3 A;  1N5Z A;  2A08 A;  3V7R A;  4IIO A;  2H3E B;  3X20 B;  3PTA A;  5KYY A;  3AHU A;  1X2Q A;  2CZ6 B;  1OU8 A;  3JCM J;  1S72 Q;  2HDA A;  3RDV A;  2OTJ T;  3OMG A;  1QP2 A;  1WHJ A;  3WXM B;  2ATC B;  4FYW B;  2KYM A;  1MV3 A;  4M7A G;  2PTK A;  4RCB A;  4JS4 A;  3I55 T;  5AYF A;  2RH2 A;  8AT1 B;  3I5R A;  1GCQ A;  4LDU A;  2B86 A;  1WHM A;  2RHI A;  1VQ4 A;  3FDR A;  3M0P A;  3VS2 A;  1OEB A;  2DD4 A;  2D8J A;  3SWN B;  5KYN A;  2FRW A;  1M9S A;  2V1R A;  4FU6 A;  2O4X B;  3CCU A;  1KSW A;  2DJZ A;  1BYM A;  1IXD A;  2KY9 A;  3EAE A;  2VB6 A;  4DBQ A;  2O01 E;  3O5Z A;  2FZK B;  1O9S A;  2EYZ A;  3OYE A;  2LJ3 A;  1ZQ1 A;  6AT1 B;  1YJ9 A;  3A1P A;  2FG0 A;  5ECA A;  2LT1 A;  5KCH A;  1TTH B;  1D1A A;  1BIA A;  2BZ8 A;  1JBM A;  3HHT B;  2JM9 A;  2IPO B;  1VQ8 A;  2WSE E;  3QXE B;  1VQ6 Q;  3CME Q;  3M9Q A;  1XTD A;  3VYH B;  3EG2 A;  1T0J A;  4A63 B;  2QA4 Q;  1BCO A;  2JM8 A;  3A5Z B;  5CKH A;  1R0B G;  5IXB A;  2SEM A;  3EG9 B;  2YUQ A;  1YJN A;  4LE9 A;  2GFU A;  1GRI A;  3QSU A;  1Y96 B;  3G6E Q;  4PNO A;  5GAO p;  1HK9 A;  1ZUK A;  2DIL A;  2P0Q A;  1Q86 R;  4QQD A;  1W1F A;  2XMF A;  2QI2 A;  4B9X A;  2XDD A;  3MCA B;  1YJN T;  1VQN Q;  4M77 D;  4F7U E;  4HT8 A;  5FRN A;  1ZSZ B;  1NJI U;  4Y28 E;  4HCZ A;  4XU0 A;  2QDY B;  2MF2 A;  3X26 B;  4L6V 5;  2EQJ A;  2HQX A;  1I8F A;  2E3I A;  4C8Q B;  3ZBD A;  1YIJ T;  5GMK h;  4P5N A;  2DL8 A;  2MPX C;  2M51 A;  2RN8 A;  1KQS A;  1BCM A;  1QP3 A;  4FCY A;  2O88 A;  3CD6 T;  4PFP A;  1D0Z A;  1KC8 U;  2OAW A;  4KH1 B;  4Z02 A;  4BB7 A;  3FC3 A;  2CYZ B;  4KBM B;  1NEG A;  2KGT A;  3THK A;  2VGN A;  2COW A;  2FHD A;  3M56 A;  4RTY A;  4PJJ A;  1K9M C;  1TUC A;  3JCM e;  2YUP A;  4E47 A;  3Q1J A;  4FYY B;  3UA6 A;  3OYA A;  2FZG B;  1FMW A;  2DXC A;  5AT1 B;  4X9C A;  3VS6 A;  4WTO B;  2JTE A;  2LC4 A;  3VYG A;  5J39 A;  4J9F A;  1I5L A;  5A2Q E;  3CCQ T;  2OJ2 A;  4QQG A;  5DY9 A;  4AFS C;  1UJ0 A;  2PVO B;  1QVG P;  4M78 G;  2DMO A;  5D6X A;  5GAN e;  3E1S A;  1YHQ T;  2LP5 A;  3MEA A;  4IIM A;  4M7A C;  5GAM g;  1AZE A;  3FB9 A;  5FLX E;  4RCC A;  4XK8 E;  4J6Y A;  5M9O A;  1KG1 A;  4M78 C;  4ZTF A;  3GNF B;  2A3L A;  4HT9 A;  2DTO A;  1RL2 A;  2NLU A;  1BB9 A;  1E6G A;  5IHI A;  2D1X A;  4D8D A;  3BFM A;  2EAY A;  4BY6 C;  1RI9 A;  1W2B P;  3H0H A;  2BKD N;  2QA4 T;  1WXB A;  4A53 A;  2BE7 D;  2E65 A;  4XTU A;  1VQ6 T;  2L3R A;  1B34 B;  5GAM h;  2P84 A;  4PJO D;  3CXC P;  3ZL7 C;  1W4S A;  1UGQ B;  4A4H A;  4EMK A;  3MHX A;  1E6H A;  2QA4 A;  1MND A;  2CH4 A;  3JCM g;  1H3Z A;  3ZEH A;  3QYH B;  1K9A A;  3JCM V;  1W2B S;  5GAN 7;  2LCC A;  2D9T A;  2JS2 A;  1ZX6 A;  2DYI A;  4J9I A;  3TU4 K;  1X2K A;  3PVL A;  2X51 A;  2DJQ A;  1BIB A;  1NYF A;  2HSP A;  3NMZ C;  4WCI A;  2DXB A;  3V8J A;  2E10 A;  2EPD A;  3VJP A;  5HKC A;  1G8X A;  2NUT B;  3TQ7 P;  4M7D D;  2QQ9 A;  4XQ3 A;  3L2Z A;  2CP0 A;  4J9G A;  3V7C A;  1YP5 A;  2A0F B;  4HXJ A;  2LX7 A;  3CCR Q;  4ELZ C;  3CPF A;  3EGD B;  2D8H A;  1B07 A;  5LL6 S;  2VXE A;  3RUX A;  3EGX A;  3BW1 A;  5DLO A;  1T3L A;  4BI3 A;  3CMA T;  1SRM A;  2DVE A;  1G3T A;  1MGQ A;  5LJ5 e;  2AHJ B;  4J83 A;  1AWX A;  1ZSZ A;  3I55 Q;  3BY7 A;  5GJW B;  3CQT A;  3CCJ Q;  2HKN A;  1KQ2 A;  4V2S A;  3QDF A;  1X01 A;  3KUF A;  3JAM E;  3QPH A;  1YHQ A;  2R5A A;  1WXT A;  1H64 1;  4C8Q G;  2A7Y A;  4F7U F;  4PJN A;  2L3S A;  2IG0 A;  1EX4 A;  3SD4 A;  4CRI A;  3TRE A;  4NL3 A;  2DX1 A;  4RKU E;  4N0A C;  2P0K A;  1GFD A;  2F2W A;  4M75 A;  4F04 B;  3M55 A;  2HBP A;  5J26 A;  4BD3 A;  4FYX B;  5FU7 B;  5C6S A;  1U3O A;  4J9H A;  3UDC A;  2F2V A;  4KGV B;  1T3S A;  2LNV A;  3CD6 Q;  2CT3 A;  1W6X A;  2KYB A;  1JRI A;  1WXU A;  4JPB W;  3OYY A;  2LJ0 A;  3P8H A;  1WDX A;  5A0L A;  4M7D C;  1MMN A;  4AG2 C;  3JSC A;  5LJ3 j;  2G6F X;  9ATC B;  4M7D A;  1K0X A;  1M8V A;  4QKU A;  1PNJ A;  2F2X A;  1F1B B;  1I07 A;  2JJ9 A;  3EGD A;  1WQ7 A;  4XU3 A;  2JMA A;  1M2V B;  2RHX A;  2DZ9 A;  1SHF A;  3E2U A;  3S3M A;  1EZZ B;  3NFC A;  4KGZ B;  4M4Z A;  3CCS A;  2HZY A;  2ZPF B;  1PG5 B;  2HL3 A;  4C0Z A;  4B9W A;  2KK4 A;  3MP8 A;  5CCA A;  1UHC A;  1EFN A;  3C94 A;  1WLP B;  4AT1 B;  1MMA A;  3QJ6 A;  3PFS A;  3EG3 A;  1VIE A;  1V76 A;  1Y57 A;  1NE8 A;  1YIJ A;  1QKW A;  1PSE A;  4KUL A;  5IXF A;  1BU1 A;  2CT4 A;  4LD6 A;  3QDR B;  1NPP A;  1VQL A;  1WNL A;  2PVD B;  3UA7 A;  4A4F A;  5GMK l;  3I35 A;  4TVR A;  2DBK A;  4CC3 A;  2K5I A;  5IAY A;  5EG2 A;  5GAN f;  2RI2 A;  2VVK A;  3QO3 A;  1FWZ A;  2CSI A;  2DRK A;  2H8H A;  4FSX A;  1FYN A;  4Z8A A;  3CEY A;  3I55 A;  4OB0 B;  2XDB A;  3TSW A;  1M2V A;  2XIC A;  1A0N B;  1IHW A;  1PCX A;  1M5Q 1;  1D3B A;  3GLX A;  3VS5 A;  1PWT A;  1WHH A;  2DNU A;  3JCM f;  4DBF A;  3CCE A;  3OW2 A;  3CCR A;  3X25 B;  1SRL A;  4PJM A;  2DA9 A;  2HBW A;  2O9S A;  1UGS B;  2YRV A;  1ZUY A;  1ABQ A;  2PQW A;  5IN1 A;  1AHJ B;  3OYI A;  1N9R A;  1J3T A;  3FJ5 A;  3CCL Q;  2CS7 A;  3GOX A;  1VQL T;  1X69 A;  1QKX A;  3TVT A;  5GJV B;  4RTW A;  2QDL A;  2RHZ A;  2XKO C;  2DZC A;  1YJW A;  2KRO A;  2RQT A;  4VUB A;  4BAC A;  2RPN A;  4PJO C;  2MYS A;  2EFI A;  2VUB A;  3MP6 A;  1JJ2 P;  1AWO A;  4GLM A;  1LVK A;  1VUB A;  1VQP A;  1VQO A;  4BDY A;  2QYZ A;  3HRU A;  3OYM A;  4J9D A;  2I2L A;  3JCM c;  1M1K U;  2A36 A;  3LW5 E;  2WSF E;  1QCF A;  3MET A;  5D6Y A;  2JTM A;  3I5S A;  2IIM A;  2RM4 A;  1XNI A;  2CP7 A;  5GMK e;  5LJ3 h;  2E5K A;  5IHK A;  1RAH B;  2YRC A;  3MEW A;  3RMS A;  3CCL T;  1YNZ A;  2V8K A;  1E7O A;  3G4S T;  1UJY A;  3LGL A;  2ZPH B;  3H41 A;  4M78 E;  4C92 F;  1Q82 U;  4QVD A;  2X4W A;  3F70 A;  1N6A A;  4XAX B;  4RG8 A;  3OS1 A;  2V8I A;  2M9U A;  1VQ5 T;  2EYQ A;  3T9N A;  3QJY A;  2IVW A;  1QCN A;  3DB4 A;  1QVG A;  1D1B A;  1W70 A;  3OYH A;  2FPE A;  4KH0 B;  2RHY A;  1QVG S;  5CK9 A;  2LVM A;  2RA2 A;  5GAO n;  3DLL A;  4FT4 A;  1Y71 A;  2YUN A;  3NTI A;  3H6Z A;  1XJW B;  4PJO A;  3HTR A;  5FU6 B;  3LWI A;  5GAN 5;  4JJD A;  3INZ A;  2ZZD A;  3A8H B;  4Z88 A;  4M75 D;  1GBR A;  3JCM W;  2QXF A;  2CZ1 B;  2NUZ A;  4BDZ A;  3RMQ A;  5LJ5 j;  2VXF A;  5LJ5 g;  1N27 A;  2PNI A;  3CCU T;  2K6D A;  1UHF A;  4FT2 A;  4M75 C;  2VV5 A;  2DVJ A;  4E7I A;  3M0U A;  3MJX A;  2EGC A;  1UEB A;  2E6N A;  4A4K A;  2HL5 C;  4A4E A;  2QGG A;  4C92 E;  2JMC A;  4JJN K;  2D0N A;  2EYW A;  3E19 A;  4X1V A;  3SWN A;  1AVZ C;  1RAD B;  3AT1 B;  2QEX A;  4PFZ A;  4LDV A;  4QVC A;  2RQU A;  5GAO q;  1WFW A;  4IUR A;  2H3J A;  5GAN 6;  1JEG A;  3OW2 S;  1VYU A;  1D1C A;  4FL6 A;  4OF1 A;  2C0O A;  1XQH A;  4XTY A;  2AK5 A;  1D09 B;  2L0A A;  2EQM A;  1JQQ A;  4OB1 B;  2V1Q A;  1D3B B;  2GTO A;  3L2U A;  4ZGJ B;  2SRC A;  1D0X A;  4M78 D;  2JS0 A;  2MOX A;  2ZCF B;  4LN2 A;  3A8G B;  3OYC A;  1WI7 A;  3R6N A;  2L3P A;  1K73 C;  4JJB A;  2F1L A;  1Z9Z A;  5LJ3 g;  2KRS A;  2MK5 A;  4WF2 A;  1FX7 A;  2KSS A;  4JRP A;  4QT7 A;  2LX9 A;  1SF9 A;  3CCL A;  4OML A;  1TS9 A;  1WHG A;  1JJ2 S;  2LQK A;  1QVF S;  4B6M A;  2AT1 B;  1YBY A;  4C0D B;  2KI7 A;  4JRQ A;  1Y7X A;  2YHT A;  2O9V A;  4DBR A;  2YT6 A;  2RQR A;  4R0K A;  1H8K A;  5LJ5 d;  2CP2 A;  3G1J A;  5CO7 A;  2K2V A;  3ER0 A;  3CCJ T;  3QUI A;  4M7A E;  2OAU A;  4J7F A;  3LH5 A;  4K11 A;  3P8D A;  3PNW C;  2DL7 A;  1YI2 T;  3NTK A;  2Z0W A;  4M77 F;  2QQA A;  4E7J A;  1VQN T;  3VV0 A;  4C0F A;  2ZPI B;  5GAO r;  3QWY A;  3ME9 A;  1S72 T;  2K5L A;  1NLO C;  1WJR A;  2M02 A;  3I56 A;  1OPL A;  3UAT A;  1SKU B;  1K9M U;  3EG9 A;  4M77 C;  1WZO A;  4LDX A;  3M58 A;  4OMQ A;  1YFN A;  3EGU A;  3MO8 A;  1U06 A;  3EHQ A;  2X4Y A;  2XHC A;  2X4X A;  5GAN h;  5HY6 A;  1OPK A;  3CCM Q;  2DFU A;  2EIF A;  3G7Z A;  1KHC A;  3HKS A;  4J9B A;  1NLP C;  2AZS A;  2LQW A;  2VAS A;  1M27 C;  1K8A R;  1ZA1 B;  1VQK Q;  2OI3 A;  2ZAE A;  3L1A A;  4CC4 B;  2FEI A;  3OA6 A;  1N8R U;  2ROT A;  3CCE T;  3PVQ A;  2P0P A;  3FEO A;  4O6J A;  1UGV A;  3JB9 G;  1KHI A;  4BY6 B;  4JUV A;  1D0Y A;  2RK1 A;  2QEX T;  3DKM A;  2CSQ A;  2Y4Y A;  2HKQ B;  2GCX A;  3BE3 A;  3CC7 Q;  3ULR B;  2RO0 A;  3EGX B;  5GAM e;  1VQ6 A;  1ZUU A;  2GQI A;  5KYY B;  1AWW A;  3OBY A;  2RD1 A;  5IHN A;  3VRY A;  3S3N A;  3L42 A;  2M0Y A;  5GAN 8;  3OS2 A;  1N8R C;  1VQ7 T;  4CC2 A;  4RUG A;  2RQW A;  1KC8 R;  3SDZ A;  4XTW A;  1X27 A;  5LJ5 f;  3JCM P;  1EIF A;  3CCE Q;  3BDL A;  2KT1 A;  2BE9 B;  2DER A;  2OTL Q;  3CCM T;  2WAC A;  4QVZ A;  5KE3 A;  5IH2 A;  1S1N A;  2OTL T;  1UE9 A;  1IRE B;  3CCJ A;  1IHV A;  1Q82 R;  4YTL A;  2CP3 A;  3I56 T;  4M75 F;  1PRM C;  5KYW B;  4PKC C;  2BUD A;  1U1T A;  1B34 A;  5GAM d;  2VKN A;  4HVU A;  2CUB A;  1QWE A;  2MMP A;  3H9N A;  1K76 A;  4DBH A;  1SSH A;  1B3Q A;  2WSC E;  3REB B;  3X24 B;  4KGX B;  1YWO A;  4BE2 A;  3EH2 A;  1UEC A;  4M77 B;  3PE0 A;  1RAI B;  5CAI A;  4BE0 A;  5I21 A;  1OUL A;  3G4S Q;  5CVI A;  2K9G A;  1XOV A;  4RMO A;  5I2S A;  4J9E A;  1QW1 A;  1RLP C;  1M4Z A;  2L5Q A;  4RG2 A;  1KC8 C;  2X9H A;  1VQ9 T;  4XTZ A;  5J3B A;  4MML A;  3JV3 A;  1KD1 C;  2CP5 A;  3O8V A;  1RAC B;  2RF0 A;  4L5G A;  1I81 A;  1M8M A;  2X3W D;  5KYU A;  2P4R A;  1OQK A;  4ATO A;  1TWB A;  3FRN A;  4PJO E;  5KCO A;  4IUU A;  2X35 A;  5FWB A;  1VQM A;  5FU6 C;  1SSF A;  2EKH A;  1PHT A;  1YWP A;  4C5I A;  3CC4 A;  1H3H A;  3H0F A;  2EQK A;  2FRY A;  3QWX X;  4PJO B;  2QTX A;  1JU5 C;  3JB9 H;  1MMD A;  2LQ8 A;  2FYK A;  1Q7Y C;  3LX7 A;  1I4K 1;  4IUQ A;  3OSV A;  4C5H A;  5GAN 3;  3OW2 P;  1YJ9 Q;  1LJO A;  1U5S A;  2ECZ A;  2E3H A;  2FL7 A;  4OVA A;  2ZPB B;  3WVD B;  4MZP A;  4BUG A;  4GY5 A;  4XTX A;  1ZHI A;  1MHN A;  2EYY A;  4JRI A;  3EFR A;  4D8K A;  5CKE A;  2DBM A;  2YSQ A;  4C8Q A;  1O75 A;  2HCK A;  3RKW A;  1C0M A;  1FXX A;  1QMC A;  3R6O A;  4AMC A;  2JXB A;  2O31 A;  1RAG B;  2YLB A;  3G71 T;  3GPL A;  4AFZ C;  3SWN C;  2FZC B;  1AEY A;  4E7S A;  4E7L A;  2MWO A;  3FLG A;  1I5O B;  3RBB B;  2QAS A;  2KRM A;  2JUF A;  3GP8 A;  1KJW A;  3G71 A;  5I2M A;  4OMP A;  2EVR A;  5A0G A;  4ANJ A;  4C92 G;  1M30 A;  2LJ1 A;  1CKA A;  3PMT A;  1YI2 Q;  4KT0 E;  2E70 A;  3NGP A;  4F16 A;  4C0D C;  4PFO A;  4PJL A;  1IGU A;  1WA7 A;  4C8Q F;  1C6V X;  4BE1 A;  3UT1 A;  1MUZ A;  4KRT A;  7AT1 B;  1PSF A;  4MZM A;  1TUG B;  3L2R A;  2MAM A;  3CCS Q;  4E7Z A;  1AWJ A;  4ESR A;  3HRS A;  4PJO G;  1QCO A;  1MNE A;  1YCS B;  3M0R A;  4M75 G;  2HD0 A;  2EWN A;  2QQB A;  5CIU A;  2XD0 A;  4M7A A;  1VQ5 Q;  3DLM A;  2W10 A;  5GMK m;  1TUD A;  1VYT A;  4LDY A;  4MDW A;  1JXM A;  1Q81 R;  2J06 A;  2EW3 A;  4AFU C;  3L2Q A;  4MDX A;  3CC2 Q;  3V7S A;  2DO3 A;  3HRT A;  3M0Q A;  4JRK A;  3RER A;  3GBQ A;  2QAZ A;  4LXC A;  5LJ3 f;  4F7U G;  1VQK T;  1Q95 G;  1WJS A;  3CC2 T;  2RI3 A;  2DPP B;  3SB2 A;  3REA B;  1ZSG A;  3SHW A;  2A37 A;  3CME T;  2FPF A;  1I0C A;  1BI0 A;  2K2M A;  4CC7 A;  2OTJ A;  4FM4 B;  2G3R A;  2EGE A;  2ENM A;  3RKX A;  2J6F A;  1R77 A;  1WIE A;  1ZA2 B;  3GF5 A;  1G2B A;  4OB3 B;  5GMK j;  2FO0 A;  4M7D F;  4IUV A;  2R5M A;  3MEU A;  2XI9 A;  3GNG A;  2Y90 A;  2F69 A;  2CDT A;  5GAN j;  1TSF A;  1VIF A;  5HK0 A;  3VU3 C;  4C92 C;  1NJI C;  3OSS C;  4OB2 B;  1PC0 A;  3WVE B;  2DL4 A;  1PKT A;  3V8K A;  5FU7 C;  1OYX A;  4J5Y A;  2GF7 A;  3ASK A;  3QII A;  4LDW A;  4M77 G;  5KYX B;  3N5B B;  3TCJ A;  3M5A A;  4CI0 C;  4E7H A;  1IZ6 A;  2DD5 A;  3CBP A;  1QVP A;  4D6W A;  1VQL Q;  5DM7 R;  2EGA A;  2AKL A;  4M7D B;  3G71 Q;  1OV3 A;  5FW9 A;  2JW4 A;  1G3Y A;  2KNB B;  5KYU B;  2GNC A;  2HNI A;  5IT9 E;  5CQY A;  3A8M B;  1NG2 A;  1Q86 C;  4R55 A;  1FMK A;  1X6G A;  2JOY A;  2M16 A;  4M7D E;  2JVV A;  3L2W A;  3VS7 A;  2K7A A;  2ABL A;  3BDU A;  2FVU A;  2COZ A;  1V29 B;  1T0H A;  4M75 B;  4N0A A;  2EKO A;  4FYV B;  2OTJ Q;  2R58 A;  1WGS A;  1HJD A;  4X34 A;  1YJ9 T;  5FRM A;  2E6Z A;  1SEM A;  2KQW A;  3CC4 T;  4LUD A; 
#chains in the Genus database with same CATH homology
 1T3L A;  4OMQ A;  1SRM A;  3EGU A;  1AOJ A;  1U06 A;  3EHQ A;  2J05 A;  1AWX A;  1OPK A;  4ZNX A;  5GJW B;  2W0Z A;  2DF6 A;  3CQT A;  1NEB A;  1H92 A;  2K3B A;  4J9B A;  1NLP C;  2AZS A;  2LQW A;  1OOT A;  4LNP A;  2JT4 A;  5FWC A;  1WXT A;  4LUE A;  2J6O A;  1M27 C;  2L3S A;  2BTT A;  2KXC A;  4JZ3 A;  2OI3 A;  1SHG A;  4CC4 B;  2FEI A;  1KIK A;  2DX1 A;  2K79 A;  2ROT A;  1GFD A;  2F2W A;  1GCQ C;  2KR3 A;  3PVQ A;  2J6K A;  2MCN A;  3TSZ A;  1UGV A;  1U3O A;  3UF4 A;  4J9H A;  1KFZ A;  4RTV A;  2CUD A;  2F2V A;  1T3S A;  2CSQ A;  2CT3 A;  1W6X A;  2KYB A;  1WXU A;  1PKS A;  4JPB W;  3VS3 A;  1X6B A;  2GGR A;  2ROL A;  2LJ0 A;  2KRN A;  1WDX A;  5L23 A;  2MIO A;  3ULR B;  4AG2 C;  2AKK A;  2C0T A;  1ZUU A;  2GQI A;  1AWW A;  3NHN A;  4OMM A;  3C0C A;  2G6F X;  1AZG B;  4Y92 A;  5IHN A;  1ZLM A;  1K0X A;  3VRY A;  3M0T A;  1PNJ A;  2F2X A;  1M3A A;  2RQV A;  1I07 A;  2M0Y A;  1HSQ A;  4CC2 A;  1K4U S;  4RUG A;  2EQI A;  2JMA A;  2RQW A;  2C0I A;  4JJC A;  1X27 A;  1SHF A;  1GBQ A;  2L3Q A;  2GTJ A;  2ED1 A;  4M4Z A;  4RTX A;  2KT1 A;  3EG0 A;  1AD5 A;  2BZX A;  5IH2 A;  1S1N A;  3VS1 A;  1UE9 A;  3A98 A;  3VRZ A;  1UUE A;  1UHC A;  1EFN A;  2NWM A;  1VYV A;  1PRM C;  1WLP B;  2LNH B;  3EG3 A;  2VKN A;  4HVU A;  2CUB A;  2LQN A;  1Y57 A;  4RTZ A;  2DYB A;  1QWE A;  2DL5 A;  2I0N A;  2VWF A;  1K76 A;  1QKW A;  1CKB A;  1SSH A;  1B3Q A;  3REB B;  5IXF A;  1BU1 A;  2CT4 A;  1PRL C;  1YWO A;  2ED0 A;  1TG0 A;  1UEC A;  4AFQ C;  4AG1 C;  3UA7 A;  3NPF A;  3PE0 A;  4EIK A;  3I35 A;  3M0S A;  2DBK A;  4CC3 A;  2DM1 A;  2FPD A;  2VVK A;  2K9G A;  1XOV A;  4J9E A;  1RLP C;  2CSI A;  2DRK A;  2H8H A;  1QWF A;  1QLY A;  1FYN A;  4HCK A;  4Z8A A;  1YN8 A;  1SPK A;  4JZ4 A;  3TSW A;  2DRM A;  1ZBJ A;  3JV3 A;  2RF0 A;  1A0N B;  3SEM A;  2GBQ A;  1M8M A;  2X3W D;  1NM7 A;  2P4R A;  3VS5 A;  1WYX A;  1PWT A;  2DNU A;  2KBT A;  1N5Z A;  3U23 A;  2A08 A;  1SRL A;  2DA9 A;  4IIO A;  5FWB A;  2HBW A;  2AZV A;  2O9S A;  2J7I A;  1UTI A;  2YUO A;  1X2Q A;  1ZUY A;  2EKH A;  2HDA A;  1ABQ A;  1PHT A;  1YWP A;  1J3T A;  1H3H A;  3FJ5 A;  3H0F A;  4GBQ A;  2FRY A;  4E6R A;  3QWX X;  1X69 A;  2KYM A;  1MV3 A;  1JU5 C;  1QKX A;  2CRE A;  2PTK A;  3TVT A;  1ABO A;  2DLP A;  5GJV B;  5I22 A;  4RTW A;  2DE0 X;  2QDL A;  3I5R A;  4F17 A;  1U5S A;  2ECZ A;  2KRO A;  4FSS A;  1GCQ A;  2B86 A;  2RQT A;  2RPN A;  3M0P A;  3VS2 A;  4F14 A;  1OEB A;  2D8J A;  2YDL A;  1UG1 A;  2EYY A;  2FRW A;  2V1R A;  1AWO A;  4GLM A;  1KSW A;  4D8K A;  2O2O A;  4J9D A;  2DBM A;  3VS4 A;  2YSQ A;  3O5Z A;  2A36 A;  2HCK A;  1QCF A;  1X43 A;  2A28 A;  2EYZ A;  2KEA A;  5HCK A;  1K1Z A;  3VS0 A;  3I5S A;  2LJ3 A;  2IIM A;  2RNA A;  2JXB A;  5ECA A;  2FG0 A;  2O31 A;  2E5K A;  1Y0M A;  5IHK A;  2BZ8 A;  4AFZ C;  2JM9 A;  3KFV A;  2LMJ A;  4ORZ A;  2X3X D;  1AEY A;  1YNZ A;  1E7O A;  3EG2 A;  1T0J A;  1UJY A;  4A63 B;  3RBB B;  1BBZ A;  2JM8 A;  3H41 A;  5IXB A;  2SEM A;  2YUQ A;  2KRM A;  1KJW A;  2KT8 A;  4LE9 A;  1GRI A;  1GCP A;  4OMP A;  2EVR A;  1M3B A;  1M30 A;  2LJ1 A;  1CKA A;  1ZUK A;  2DIL A;  1BK2 A;  1VA7 A;  1W70 A;  3NGP A;  1W1F A;  2XMF A;  4F16 A;  2FPE A;  1HD3 A;  1WA7 A;  2YUN A;  2LZ6 B;  4OMO A;  1MUZ A;  4KRT A;  1K0S A;  4JJD A;  4OMN A;  5I11 A;  1AWJ A;  4Z88 A;  4ESR A;  2DL8 A;  1GBR A;  2M51 A;  1YCS B;  2BZY A;  2RN8 A;  4HVW A;  3M0R A;  2NUZ A;  2ESW A;  4HVV A;  1GL5 A;  4RTT A;  2O88 A;  2PNI A;  1RUW A;  2K6D A;  3H0I A;  1MV0 B;  2L2P A;  1UHF A;  2W10 A;  2OAW A;  1G83 A;  1TUD A;  2DVJ A;  1VYT A;  3M0U A;  1JXM A;  2EGC A;  2J06 A;  2EW3 A;  2KE9 A;  1NEG A;  2KGT A;  5EC7 A;  4AFU C;  1UDL A;  2JMC A;  3THK A;  1ARK A;  2D0N A;  2EYW A;  2DL3 A;  4X1V A;  4RTY A;  3M0Q A;  1TUC A;  1AVZ C;  4Z89 A;  3GBQ A;  2YUP A;  2RQU A;  3UA6 A;  1WFW A;  1RLQ C;  1JEG A;  1VYU A;  3REA B;  1ZSG A;  2C0O A;  3VS6 A;  2JTE A;  2AK5 A;  3SHW A;  2A37 A;  2L0A A;  4J9F A;  2FPF A;  1IO6 A;  1I0C A;  2K2M A;  4CC7 A;  1JQQ A;  1JXO A;  2EGE A;  2ENM A;  2OJ2 A;  2V1Q A;  2J6F A;  1JO8 A;  4AFS C;  1UJ0 A;  2GTO A;  2DMO A;  1WIE A;  3RNJ A;  1CSK A;  2LP5 A;  1G2B A;  4IIM A;  2EYX A;  2FO0 A;  1AZE A;  2SRC A;  2JS0 A;  2MOX A;  4LN2 A;  1WI7 A;  4RTU A;  3R6N A;  2L3P A;  2CDT A;  4JJB A;  1Z9Z A;  2KXD A;  4DEX A;  2KRS A;  1BB9 A;  1E6G A;  5IHI A;  1WX6 A;  2D1X A;  4D8D A;  2RMO A;  2DL4 A;  1RI9 A;  4QT7 A;  1PKT A;  4J9C A;  3H0H A;  3I9Q A;  4OML A;  1Z9Q A;  1WXB A;  3EHR A;  2EGA A;  2AKL A;  2O9V A;  2CH4 W;  1OV3 A;  2YT6 A;  5FW9 A;  2JW4 A;  2RQR A;  2PZ1 A;  3ZL7 C;  4R0K A;  1H8K A;  2KNB B;  2GNC A;  1NYG A;  1E6H A;  2CH4 A;  1NG2 A;  3IQL A;  2EBP A;  3EG1 A;  4K11 A;  3LH5 A;  1FMK A;  1X6G A;  1K9A A;  2DL7 A;  3VS7 A;  1M3C A;  2LCS A;  2K7A A;  2JS2 A;  2ABL A;  1ZX6 A;  4J9I A;  1V1C A;  2HEQ A;  1X2K A;  3PVL A;  1I1J A;  1GFC A;  1LCK A;  2DJQ A;  1NYF A;  2HSP A;  3NMZ C;  4WCI A;  1T0H A;  1UFF A;  3QWY A;  2EPD A;  1HJD A;  4DEY A;  1NLO C;  4J9G A;  1SEM A;  1YP5 A;  1OPL A;  4HXJ A;  2LX7 A;  3UAT A;  2D8H A;  1B07 A;  4LUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...