1ABOA

Crystal structure of the complex of the abl tyrosine kinase sh3 domain with 3bp-1 synthetic peptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
b'NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ABL TYROSINE KINASE
publication title High-resolution crystal structures of tyrosine kinase SH3 domains complexed with proline-rich peptides.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (kinase/peptide)
total genus 10
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1995-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1aboA00
2LJ0A 1TG0A 2GQIA 2L3QA 3M0TA 1MUZA 2GNCA 2AKLA 2ENMA 4ZNXA 1PWTA 2FRYA 2V1RA 1J3TA 1PRLC 2RN8A 3QWYA 5IHNA 1HSQA 2CH4W 2XMFA 4CC2A 3TVTA 1AZGB 4AG1C 4Y92A 2L3SA 1AD5A 2EGEA 2KGTA 4A63B 2DNUA 1V1CA 3H41A 5L23A 2KR3A 3PE0A 1YWPA 2L3PA 4OMOA 1E7OA 2LZ6B 4J9CA 3THKA 1MV0B 2EW3A 5IXBA 2YUPA 3VS7A 4RTWA 4RTUA 2MCNA 2CUBA 1M27C 2EBPA 1X6GA 2J06A 4J9FA 1BK2A 1GFCA 4J9EA 4QT7A 2DBKA 1AVZC 2CT4A 1W6XA 2O31A 2CT3A 2FPEA 1ZBJA 2HCKA 2GBQA 3I5SA 2DL5A 1GRIA 3TSWA 1H92A 2MOXA 4LUEA 1M3CA 1JU5C 1UJ0A 2KRSA 2VWFA 2FEIA 2E5KA 1AWJA 1NEGA 1K0XA 1KFZA 1AEYA 3VS1A 1EFNA 4ORZA 1GFDA 3REAB 2RQUA 4IIMA 4IIOA 3VS2A 2CDTA 4RTVA 4JZ4A 2KYMA 1QWEA 1OEBA 4JPBW 2FPFA 1GCPA 3QWXX 1SSHA 4D8KA 4RUGA 2RMOA 5FWCA 2ABLA 2LQWA 1UDLA 2K79A 4LNPA 1W1FA 2DL3A 1OV3A 1W70A 1QCFA 2C0TA 1SHGA 2BZYA 1WXUA 2O2OA 3VRZA 1M8MA 1JO8A 2OI3A 3RBBB 2JTEA 4HCKA 1OPLA 1QKXA 1M30A 4ESRA 1UTIA 2O9SA 4J9DA 3EG0A 5FWBA 1GBQA 4HVWA 2DVJA 1PKSA 2DBMA 2YUNA 2CUDA 4JJCA 3A98A 4HVVA 2K3BA 1AWOA 4CC4B 2FG0A 4GLMA 4OMNA 4JJBA 4Z8AA 1UG1A 2SRCA 2A08A 4JZ3A 3R6NA 2D8HA 2JS0A 2PZ1A 2YUOA 1ZUUA 2K6DA 2H8HA 2CSQA 5EC7A 1JEGA 2F2VA 2LQNA 2AZVA 4HXJA 3C0CA 4OMPA 1A0NB 1X69A 1VYVA 4EIKA 3U23A 4AFUC 4R0KA 1YNZA 1VYTA 2LNHB 2KRNA 1I07A 2JW4A 1ABOA 2DRMA 2OAWA 2EPDA 3NMZC 1NG2A 1N5ZA 2HBWA 1XOVA 4HVUA 1NLOC 1NYFA 2L0AA 1AZEA 1WIEA 3I35A 2KEAA 4F17A 2DX1A 1RLQC 3M0RA 2HSPA 3JV3A 1NLPC 2YT6A 2V1QA 2PNIA 4LN2A 2DILA 4J9IA 2KROA 1KJWA 1ZLMA 2JMCA 2JM9A 4M4ZA 2KRMA 2J6FA 2EYZA 4J9BA 3M0UA 1X2QA 2GTOA 2YSQA 1QLYA 3CQTA 3EG1A 1UE9A 4DEYA 4OMQA 1K9AA 2NWMA 2VVKA 3NGPA 1E6HA 2JMAA 1CKBA 1Y0MA 2LP5A 2K2MA 1T0HA 1WFWA 5ECAA 1JXOA 3M0QA 2CH4A 2J7IA 2J6KA 1WXBA 2C0IA 3VS4A 3EHQA 1UJYA 1SRLA 5GJWB 2KXCA 2C0OA 3M0PA 2LMJA 2ED0A 4LE9A 1GBRA 4CC3A 1Z9QA 1UHFA 2P4RA 2ROTA 1M3AA 2I0NA 1PKTA 1PNJA 2RF0A 4E6RA 2EVRA 5GJVB 3O5ZA 1PHTA 2EYYA 2JS2A 4AFZC 2HDAA 2GGRA 3EHRA 1G2BA 1WDXA 2DJQA 3I5RA 2RQVA 1UUEA 4AFSC 2AK5A 1G83A 3REBB 4J9HA 4JJDA 2J6OA 1WXTA 5FW9A 1KSWA 1PRMC 3GBQA 3LH5A 4DEXA 1WLPB 1QKWA 3UF4A 3EGUA 2ROLA 4GBQA 4J9GA 3VS0A 2X3WD 1CKAA 2DM1A 1M3BA 4Z88A 2LX7A 2ESWA 1T0JA 3IQLA 1UECA 1Y57A 1K76A 2K9GA 1TUCA 1UHCA 4RTZA 4RTTA 1Z9ZA 1KIKA 2D0NA 1JXMA 2JM8A 3SHWA 1IO6A 2RNAA 2J05A 1ABQA 1JQQA 1BBZA 4K11A 2FO0A 3VS3A 2EQIA 2YDLA 1S1NA 3H0HA 1YN8A 2AZSA 2LJ1A 1OPKA 1K0SA 1X43A 1X2KA 1K4US 1X27A 2BZ8A 2KYBA 4Z89A 2FPDA 1ZSGA 1B3QA 1HD3A 1AWWA 1T3SA 2JT4A 5IHKA 2FRWA 3FJ5A 2DL4A 2KBTA 2LJ3A 2EYWA 3ZL7C 1VA7A 2K7AA 1SPKA 1I0CA 1UGVA 2JXBA 1VYUA 2DF6A 1WI7A 1T3LA 1WX6A 2OJ2A 2RQTA 1H8KA 4F14A 3KFVA 2O9VA 3NPFA 1GCQC 4RTXA 3H0FA 1ARKA 3UA6A 2B86A 1H3HA 2A28A 1RUWA 2BZXA 4FSSA 2DE0X 4X1VA 2X3XD 2DLPA 2CREA 2CSIA 1X6BA 3TSZA 2DL8A 2KT8A 1SHFA 1GCQA 2D8JA 5I11A 4KRTA 3RNJA 3I9QA 1QWFA 2RPNA 3EG3A 2RQWA 2A36A 2KT1A 1SEMA 3UA7A 1U5SA 3VS5A 1ZUYA 2F2WA 4F16A 5HCKA 4WCIA 1E6GA 1YCSB 1BU1A 1U06A 2SEMA 1RI9A 2ECZA 2DL7A 3UATA 3SEMA 1TUDA 2A37A 2L2PA 1I1JA 3NHNA 4LUDA 2GTJA 1RLPC 2W0ZA 1NM7A 2LCSA 2HEQA 1WA7A 3VRYA 2D1XA 3VS6A 4AG2C 3EG2A 2KXDA 2BTTA 1SRMA 2EYXA 4OMMA 1AOJA 1NEBA 1CSKA 4D8DA 1FMKA 1OOTA 5I22A 1UFFA 1NYGA 2KE9A 2AKKA 2M51A 2DRKA 2EGAA 2VKNA 3ULRB 1GL5A 2ED1A 5IXFA 5IHIA 1AWXA 2QDLA 1FYNA 2DA9A 4RTYA 2F2XA 4OMLA 1ZUKA 1HJDA 2G6FX 1WYXA 2NUZA 1LCKA 1ZX6A 1MV3A 1YP5A 2DYBA 3M0SA 2KNBB 4AFQC 1B07A 2RQRA 2W10A 2O88A 1BB9A 2YUQA 1K1ZA 3PVLA 2EGCA 2EKHA 2MIOA 1YWOA 1U3OA 2IIMA 3PVQA 2M0YA 3H0IA 4CC7A 2PTKA 5IH2A 2DMOA
chains in the Genus database with same CATH superfamily
2LJ0A 1MNEA 3HFOA 4Y28E 5M9OA 1Q82R 4QVCA 1JJ2P 2QASA 3ZBDA 4BE0A 1PWTA 2YXYA 5FU7B 2HBPA 3G6EA 1PRLC 1PM3A 1QCNA 2CH4W 2EWNA 3NTHA 1LOJA 1Y96A 3META 2EIFA 5GMKj 3UDCA 2DVEA 2EQUA 1K73C 1YWPA 2NUPB 3HTRA 4BI4A 1YCYA 3JB9H 2YUPA 3OYLA 2CUBA 3EGDA 1M27C 1UGRB 1KHIA 3JCMf 1FMWA 4NOYA 3X25B 1SSFA 3MEUA 1JRIA 4QKUA 4L6V5 4V2SA 2DBKA 2E3HA 2ZPBB 4XK8E 3V8LA 5CR2A 1VQ6T 1VIFA 1ZBJA 1UEBA 3G4SA 1UGPB 1YIJT 2K4YA 4M78D 1H92A 2CGHA 5CKHA 4HT9A 2QQBA 3OA6A 1GFDA 1OEBA 3L2WA 1KC8C 1S72T 1SSHA 3OYKA 4RMOA 3MEVA 7AT1B 2RB6A 1N9RA 4C8QE 2ABLA 2DEQA 2K79A 2DL3A 1IGQA 1YJNQ 2V8IA 3VV0A 1SHGA 2CP6A 3X24B 4M78A 3P8BB 1JJ2S 1TU0B 3HRSA 1M4ZA 2RH2A 1D1BA 2LX9A 1M8MA 2OI3A 4HCKA 1OPLA 4ME7A 3HL8A 4ZTJA 1IGUA 3R6OA 2DZ9A 3EG0A 3QJYA 5DM7R 2Y90A 4J5YA 5CKEA 3OYMA 3JB9J 1PKSA 4FYXB 4JJCA 2VUBA 3ZEHA 2K3BA 2JUFA 2FHDA 1AWOA 4FT2A 4BE1A 4OMNA 4JJBA 3UWNA 3OYNA 1ZQ1A 2JTMA 2WACA 3SWNB 4FYYB 4OB0B 1ZUUA 2K6DA 4HCCA 1G3TA 1JEGA 4II1A 4N0AA 3KUFA 4C92B 2DETA 5CK9A 4PNOA 5LJ3h 4R0KA 3NFCA 5GAMd 4M78E 5KYUB 3CC4A 1VYTA 3L42A 4OB3B 2KRNA 3CCVA 1I07A 1ABOA 5EG2A 3HRUA 1Q81C 1NG2A 3I56Q 1N5ZA 2HBWA 2QK0A 3QG1A 4HVUA 3OYJA 2DD4A 3LH0A 1B34A 1YITT 1RACB 3I35A 3M0RA 2AIRB 2HL5C 2CP2A 4A4EA 3JV3A 2YT6A 2V1QA 2OTLT 4J9IA 5FRMA 2EQMA 1XJWB 4M4ZA 2KRMA 2OTJQ 5KYXA 2LQKA 4RG2A 2K2VA 2QEXT 1QLYA 1RL2A 1OZ3A 2RO0A 1OU8A 1VQNT 1MGQA 2HL3A 4OP0A 4OB2B 5GAOn 3CCRT 1WHLA 4CI0C 1TWBA 1HXDA 2JMAA 1Y0MA 2DIQA 1FWZA 2K2MA 1WFWA 1NPPA 4F7UB 3T9NA 1OZ2A 4DBQA 3M56A 1VQ9T 4M7AE 3OSVA 5GANe 5I21A 1XTDA 1NJIU 4RCCA 2FVUA 3CPFA 3A8OB 4LE9A 1NJIR 2ZGWA 4NL3A 1VQMA 3OBWA 1YJNA 2KSSA 2EYYA 3EGXB 3G6ET 1YFNA 1VQLQ 2JS2A 3RKYA 2MAMA 4AFZC 4PJJA 2HDAA 3EHRA 1G2BA 4MDWA 2BIVA 4JJDA 1R77A 5AT1B 1WXTA 2X4XA 3JCMc 3OYEA 1KSWA 2JJ9A 4NL2A 3LH5A 3GIBA 3UF4A 4GBQA 1Q81U 2P4TA 1WHJA 4XU0A 3H6ZA 3OYHA 3SDZA 4FCYA 1D09B 4Z88A 1BI2A 1N8RC 1T0JA 3A8GB 1VQKQ 3QIIA 4M7AC 3JCMb 4RTTA 1JXMA 1QP2A 2JM8A 1YHQA 1IO6A 4E7HA 2RNAA 1W2BP 1PC0A 1WJRA 3PMTA 2J05A 1ABQA 3HHTB 1JQQA 5A0LA 2YDLA 3SWNC 4NS5A 1K0SA 1X2KA 3ME9A 1QVFA 3C94A 3JB9G 3CMAA 4C92C 1B3QA 2CZ7B 1DJ7B 3X26B 1VA7A 2K7AA 1SPKA 5DY9A 3JCMd 1UGVA 2D0QB 3MCAB 2RQTA 5LL6S 4M75G 2COYA 4F14A 3G71A 3CC2T 3D7SB 1KD1C 2GF7A 2FZCB 4RTXA 3H0FA 3N5BB 3UA6A 1OYXA 1H3HA 4C0ZA 4CRIA 1RUWA 4E7ZA 2CP7A 4X1VA 4E7KA 3PIOA 2DLPA 2CSIA 1RAAB 1X6BA 3VUZA 4KH0B 1SHFA 1RAIB 2HKNA 2X4JA 1GCQA 3DB4A 4IUTA 2QA4T 2JN0A 5KYYB 1QWFA 2RQWA 5GMKm 3CCEQ 1WQ7A 4Y91A 5LJ5f 1ZUYA 1V29B 4F16A 3A8MB 3MEWA 5HCKA 1YCSB 1BU1A 3OYCA 1GXIE 1RI9A 1N8RU 2ECZA 2A37A 1I1JA 1N8RR 3CMEQ 1M2VA 1RLPC 2W0ZA 3EFOB 3QBYA 4QVZA 1NM7A 3MP1A 1D3BA 4BACA 3EG2A 3DB3A 3MPUB 2BTTA 1AT1B 2MMPA 4JS5A 3CC7Q 5FRNA 1SRMA 1NEBA 1X6OA 2L8DA 5I22A 1NYGA 2FB7A 1VIEA 2LNVA 5HK3A 2ED1A 3L1AA 2YLCA 4RTYA 4PJOB 2F2XA 1HJDA 1RABB 5LJ3f 4E7JA 1ZX6A 2KQWA 4XTYA 4C0FA 4IKFA 1YI2Q 3OYBA 5D6YA 3NTIA 4AFQC 1KD1U 1B07A 2HZYA 1Q7YU 3PGGA 5GAMe 2MIOA 2MWPA 3FLGA 3PNWC 1YWOA 5C6SA 2VGNA 1Q7YR 1S72A 1QVGA 3MP6A 3V8JA 2JZ2A 1WZOA 1NZ9A 2GQIA 1ZSZA 4N4GA 2GNCA 2PQWA 1FXXA 4M77C 4C8QG 4ZNXA 2V1RA 1J3TA 2RN8A 3HFNA 4EMKC 3O8VA 3MP8A 4QQDA 2E64A 2L3SA 1YJNT 4A63B 2DNUA 1V1CA 3PE0A 4KUIA 4KULA 1XNIA 4QQ6A 5IXBA 1WHHA 2RM4A 5CKDA 4RTUA 1IRXA 1GFCA 4GY5A 3CD6Q 1Q86C 1AVZC 3HKSA 1G3SA 2FPEA 2HCKA 1VQPQ 3CCMA 4LDXA 2HQHA 1HYOA 3QSUA 1I5OB 3BDUA 2KK4A 1QVFP 2FEIA 1YHQT 2E5KA 1ZBXA 1AEYA 1WHKA 1EFNA 4KGXB 3VS1A 4M78G 1SF9A 1QWEA 3M4YA 2FPFA 3QXEB 4D8KA 3ASKA 2RMOA 5FWCA 3MJXA 3JSCA 4XQ3A 3TQ7P 4LNPA 2OTLA 2BZYA 4MZPA 3VJPA 2KDSA 1K8AU 4XU3A 3VRZA 4PL6A 5GAN4 3RBBB 2RHIA 1K8AR 2QEXA 1M30A 2QDYB 4E47A 3CCJQ 4QQGA 1ZA1B 5FWBA 4HVWA 3CCRA 2DVJA 2YUNA 2O4XA 3PT9A 4ZGJB 1YJ9Q 2E65A 4HT8A 5GANj 1AHJB 4GLMA 3QUIA 4Z8AA 4PJOC 2SRCA 2A08A 2D8HA 2GFUA 2NUTA 2DKGA 4FW1A 3M55A 4N4HA 4HXJA 3JCMe 1X69A 5GANh 3U23A 3TREA 4X9CA 2AHJB 1YNZA 2X4WA 4J6WA 1QVFS 2A0FB 1R0CB 2OAWA 4WTOB 3F70A 4M7AF 4RCBA 1BYMA 1U1SA 4C8QA 4J83A 1AZEA 4C5EA 1VQLT 3GF5A 1WIEA 2KEAA 3BDLA 1PG5B 5KYNA 3P8DA 2HAXA 2PNIA 2VV5A 3QO3A 4JRKA 1VQOQ 3OYFA 2KROA 3OS5A 1G8XA 2CS7A 2JMCA 2XD0A 3E2UA 4XTVA 3RMQA 5GMKh 5LJ5d 3M0UA 1QW1A 2CKKA 1X2QA 4MMLA 4C92F 3I55Q 1WGSA 2YSQA 3EG1A 4OMQA 4RG8A 1UGSB 2VVKA 3JCMP 3JRZA 2QGGA 1QVGP 3QJ6A 1E6HA 6AT1B 2LP5A 1T0HA 5ECAA 2E4HA 1M9SA 1W2BA 1JXOA 3M0QA 2RI2A 4M78B 4X9DA 3LWIA 2J6KA 1WXBA 3EHQA 1UJYA 3CCSQ 3AHUA 2KXCA 2C0OA 2Y4XA 1O9SA 3JCMJ 2JVVA 4BI8B 2I0NA 1PKTA 3JCMW 1PNJA 2RF0A 2HNIA 4E6RA 2DPPB 3CC2A 3OW2A 2LC4A 2QG9B 1VQ8A 1WDXA 2DJQA 2VB6A 3LYIA 5LJ3d 1UUEA 1D0ZA 1G83A 1RADB 3CCJA 4M7DC 2E41A 5FW9A 3FDRA 3GPLA 1PRMC 3SFMA 2CZ1B 3GBQA 3JAME 2OAUA 2DIGA 4M7AD 2QA4A 4F7UF 1QKWA 3MEAA 2DK3A 2HMAA 2MK5A 1WNLA 2X3WD 2DM1A 2XKOC 2LCCA 3OYYA 2HKQB 1K73U 2LX7A 2ESWA 5FU6B 2K9GA 1TUCA 2ZPFB 4JRPA 2EJFA 1K73R 4RTZA 3SHWA 3MKDA 3G7ZA 2VXEA 2K57A 1BBZA 4C92D 5GMKi 3CCMT 4FSXA 4J8OA 1BI0A 1B34B 1MMDA 2AZSA 2LJ1A 2H3EB 1QVGS 3DKMA 4M7AA 1X27A 4JLGA 2KYBA 4Z89A 2LRQA 2FPDA 3M54A 1D0XA 1T3SA 1AWWA 3CMET 5FU7C 1ZHIA 4A4KA 3EH2A 2LJ3A 4C0GA 2XU8A 4DBHA 5KYXB 3M9QA 2RK1A 1I4K1 3E9GA 3SWNA 1VYUA 1Y7XA 1RAFB 3V8KA 1G5VA 3J7AF 1T3LA 3M53A 4JS4A 3CC7T 3S3NA 1H8KA 2XI9A 1KC8U 1OU9A 1OX9A 1IHVA 3A1PA 4C92A 1KC8R 2XICA 2DAQA 4KGZB 2BZXA 2DE0X 3PIPA 2YLBA 1MMNA 5KYUA 4KH1B 2GQVA 3C4SA 4M77F 3JCMX 5GAMj 1V76A 3TSZA 1WJSA 2VC8A 2CZ6B 2D8JA 5FLXE 3JB9I 4PFOA 1YBYA 3CPWA 2MWOA 2YWWA 3LGFA 1YI2T 3E19A 2RPNA 1VQ4Q 3EG3A 2A36A 2DO3A 4LDYA 5A0DA 4Q5WA 5GAMh 1U06A 1N6AA 1OULA 4PJMA 3MHXA 2SEMA 3HSBA 1TXQA 1M90C 1BKBA 2M16A 1TUDA 3CCQQ 2L2PA 3EG9A 3NHNA 4LUDA 2LCSA 4AMCA 3VRYA 3FIFA 2KXDA 4C92E 5GAOm 4ZGDB 2EYXA 5KYWA 4F7UA 3DLMA 1FMKA 4ZGEB 3VUBA 2C06A 2DRKA 2VKNA 2F1LA 5IN1A 3V7RA 1KK7A 3RDVA 3QDFA 1AWXA 1Q81R 1MMGA 1R0BG 2G6FX 4ZN1A 4J6XA 4BDYA 1OI1A 1YP5A 2DYBA 3M0SA 9ATCB 3H8ZA 2Z0WA 5D7UA 5CAIA 2RQRA 2W10A 4BI3A 4WF2A 3OS1A 1VQPT 1VQ6Q 1YJWQ 3CCUQ 1K1ZA 3VYHB 4M77D 5GAN2 1RAGB 2IIMA 4R56A 1K9MC 4CC7A 5IH2A 3CXCA 1N9SA 2QTXA 4JJNK 2M9UA 3M0TA 2LCLA 3OW2P 2KMTA 2G3RA 4EPCA 3I56A 2ENMA 3OBYA 4F7UE 2QGFB 1C6VX 5FROA 2FRYA 5GMKl 1OX8A 3QWYA 1HSQA 3CCLQ 5GAN8 4HCBA 3TVTA 4PJOF 1AZGB 2RI5A 4AG1C 1AD5A 2EGEA 2K5FA 2PVOB 2IVWA 5LJ5e 5J26A 4M77A 5CKFA 5L23A 2OTJA 1VQ8T 2LZ6B 4E2FB 5GAOr 3L2QA 3CEYA 4J9CA 3THKA 4EMKA 2RI3A 3CCJT 4RTWA 2DERA 2MCNA 2EBPA 3SD4A 1X6GA 2J06A 1D1AA 1BK2A 4J9FA 3QKJA 1UGQB 2EYQA 1N27A 2FL7A 2BE9B 2CT4A 2O31A 4L5GA 4C5GA 1YJ9T 2A7YA 5CQYA 4ZN3A 4JRIA 3V7SA 3I5SA 1M2VB 2DL5A 2X51A 5IAYA 1M3CA 4PK4A 1JU5C 1UJ0A 3LX7A 2BUDA 4DOVA 1TSFA 3E9FA 3C95A 1K0XA 1VQ7Q 1KFZA 1MNDA 2PVGB 2FZGB 2MF2A 1W2BS 2DTIA 3REAB 2RQUA 4IIMA 4IIOA 5LJ3e 4JPBW 1VQLA 2LVMA 3JCMh 3QWXX 3KBGA 4M77E 2LQWA 3LLRA 3RERA 1UDLA 1W1FA 1OV3A 2CYZB 3OYDA 1QCFA 3OW2S 4XU1A 5KCHA 1WXUA 2WSEE 4OB1B 1YITQ 1TTHB 2O2OA 4DBFA 2RHXA 5C0MA 5GANg 1JO8A 3FC3A 2JTEA 1M5Q1 4OGCA 4B9WA 1UTIA 4J9DA 4PJOD 1LNXA 1VQOT 2YRDA 1GBQA 1VQKA 3CPWP 3EFOA 1VQ5Q 3LW5E 4KT0E 2BKDN 3I55T 1ZSZB 2WSFE 2EJGA 4XTXA 3P8HA 4CC4B 3QYGB 2FG0A 1KD1R 1OQKA 1UG1A 3CCUA 1KQSP 5DLQE 4JZ3A 4DOWA 3R6NA 2JS0A 2PZ1A 2YUOA 4HKEA 2DXBA 4YTLA 3OYIA 2H8HA 4M7DF 2CSQA 5EC7A 1B7TA 1G3WA 2F2VA 1VQ9Q 2RK2A 2XHCA 3C0CA 4OMPA 4XTUA 1VYVA 2QYZA 3UT1A 4AT1B 4A54A 2JNGA 3M4GA 2L3RA 2LNHB 8AT1B 2R5MA 3TU4K 4M75B 2DRMA 3INZA 4OF1A 1NLOC 1KQ1A 1QVPA 2O01E 4PFZA 3G6EQ 4F17A 2DX1A 1RLQC 2BE7D 3WVDB 2LQ8A 3H9NA 4A53A 1RAHB 3QHSA 1Q95G 2GCXA 2DILA 4D6WA 1KJWA 2JM9A 2J6FA 2EYZA 5GAN6 4OMFB 3OS0A 4J9BA 1M1KC 3CCEA 3CQTA 3FRNA 4A4GA 2DZCA 2Y4YA 1SKUB 2M1HA 1TS9A 2NWMA 1Q82C 3CBPA 3EH1A 3SB2A 3CXCP 1I8FA 1Y71A 2P0KA 3CPWS 4PJOE 1X75C 1MHNA 2JOYA 3GNFB 3M57A 3G4SQ 2DXTA 3CMEA 2J7IA 3GNGA 1WHMA 3M0PA 4BY6B 1KQ2A 4CC3A 1Z9QA 3CC7A 2P4RA 2ROTA 3I56T 4M7DD 2DTHA 1QP3A 1PHTA 3CBOA 3HP9A 1WHGA 3I5RA 2D9TA 2RQVA 4AFSC 1F1BB 2FYKA 3EFRA 1VOMA 3OMCA 4PFPA 3RIRA 2RJFA 1RAEB 4F04B 5HKCA 4E7IA 2OTJT 1PD0A 1O75A 4DEXA 2F5KA 3EGUA 4JLIA 2ROLA 4J9GA 1YI2A 3VS0A 2LT1A 1CKAA 4TVRA 2VASA 2QXFA 4M7DA 5D6XA 1K76A 3FEOA 5CO7A 1JB0E 4M7AG 1UHCA 3C12A 1Z9ZA 2E3IA 3A8LB 2A3LA 1KIKA 1ZSZC 2I2LA 1Y96B 2ZPIB 4J7IA 2AT1B 2JTFA 2PUKB 2DD5A 8ATCB 2FO0A 1Q86U 2EQIA 4C8QB 1S1NA 2RA2A 4Z02A 1YN8A 2DXUA 1SG5A 5DLOA 1Q86R 3CXCS 2QAZA 2HQXA 1Q82U 5D6WA 2QQAA 3EGDB 3CCQT 2K3XA 1ZSGA 2DXCA 1HD3A 4C92G 2JT4A 3J81E 2KBTA 5KCOA 2CZ0B 2EYWA 4B6MA 3AT1B 1I0CA 1WI7A 1XQHA 3CC4Q 5GAMg 1WX6A 2OJ2A 4M75C 3CCVQ 1M1KR 2ZPGB 1C0MA 3NPFA 2O9VA 4BB7A 2KY9A 4IUVA 5L8RE 3EFSA 1ARKA 3M5AA 3EAEA 3CD6A 1PD1A 2A28A 4M7DE 3VYGA 2XDBA 1X01A 2X3XD 3WVEB 1VQPA 2CREA 4X34A 2DL8A 1KG1A 3RMSA 4EMHA 1VQKT 4FM4B 2KI7A 5GAOp 4C5HA 2PVDB 4KRTA 3RNJA 2NUPA 2MI6A 2M02A 3FB9A 2KT1A 4P5NA 1YJWT 3CCUT 1U5SA 1D0YA 1BIAA 4J7FA 4ATOA 3BW1A 4WCIA 1E6GA 3WXMB 1PSFA 5A2QE 4F7UG 2DL7A 5LJ5j 1D1CA 1IXDA 1FX7A 4PKCC 2HEQA 4DA4A 3VS6A 4PJLA 2HSEB 4BY6C 3RESA 1I81A 3CCLT 4OMMA 1AOJA 2DFUA 1CSKA 1OOTA 2WSCE 3RKWA 1VQMQ 2KE9A 2K5LA 2AKKA 2M51A 2CP3A 5J39A 2EGAA 1JBMA 1EZZB 5LJ5h 4FYWB 2DJZA 3ULRB 2VGMA 3OS2A 1YJ9A 4XTWA 1M1GA 1PSEA 5IHIA 4VUBA 2F5TX 2QDLA 1FYNA 2ZPEB 2DA9A 2IPOB 2ZCFB 1IB8A 1WQWA 2QTVA 1LCKA 4E7LA 3OMGA 5CKBA 4M7AB 5KE3A 3PFSA 3CCET 5AYFA 1NJIC 2RJEA 3A5ZB 1BB9A 3URGA 5LJ3j 2R57A 2E10A 1BI1A 1U3OA 3PVQA 4IUUA 2PTKA 3L2UA 2EKOA 2E6ZA 2R58A 3GLXA 5CCAA 1TG0A 1YHQQ 1VQ7T 2L3QA 4BD3A 1MUZA 2V8JA 2EAYA 2AKLA 2XG8D 3ER0A 4C8QC 4M77G 1QQJA 2EJ9A 4KBMB 1H641 5IHNA 2XMFA 4CC2A 2QQ9A 2D6FA 2QQRA 4Y92A 3PTAA 3CMAQ 2ATCB 2EFIA 2KGTA 1VQOA 3H41A 2CP5A 2KR3A 2OX7A 2L3PA 4OMOA 1E7OA 2ZAEA 1MV0B 5HY6A 3JCMg 2EW3A 3I55A 4OGEA 1EX4A 3VS7A 1IHWA 3G71Q 3HRTA 5GAOl 4J9EA 1VQ5T 4QT7A 1R8OB 2PU9B 4FYVB 1W6XA 2K5IA 2L89A 3DLLA 2CT3A 4UC4A 1PCXA 4O6JA 3M58A 3EG9B 2L5QA 2GBQA 1GRIA 3TSWA 1KQSA 5CIUA 1QMCA 2FZKB 2MOXA 4LUEA 3HPWA 3CCSA 2KRSA 2VWFA 5HK0A 1ACMB 1AWJA 1NEGA 3E1SA 5KYWB 4C0DB 4ORZA 1P92A 2CP0A 4M78C 3VS2A 4ELZC 2CDTA 4RTVA 4FW2A 4JZ4A 1LPLA 2KYMA 2MPXC 4J6YA 1GCPA 4FU6A 2H3JA 4RUGA 1QCOA 2LTOA 4JRQA 2XDDA 1W70A 2C0TA 2RHYA 1NBEB 5GAOq 1C1AA 2LT4A 1QKXA 4ESRA 1IREB 2K3YA 2O9SA 2EQJA 3VU3C 5GANf 4HA8A 3TCJA 4DBRA 2KVQG 3CD6T 4FIBA 2KAFA 3EGXA 1BI3A 5GMKe 4EDUA 2DBMA 3ZFJA 2CUDA 3A98A 3BFMA 4HVVA 3G1JA 4N0AC 2LDMA 1YIJQ 5FU6C 4PJOG 4HCZA 4QVDA 4FL6A 4MDXA 2QI2A 3QDRB 4KUDK 1NPRA 2P0QA 3M59A 3G4ST 2LQNA 2AZVA 3S3MA 1A0NB 4JUVA 4M77B 4EIKA 2VXFA 4DQ2A 2P84A 4AFUC 2HD0A 4LXCA 3RUXA 3JCMQ 3OYAA 1S72Q 4EMKB 2JW4A 4QW2A 2E12A 2EPDA 3NMZC 1XOVA 3NTKA 2X4YA 2XDPA 1NYFA 2L0AA 1H3ZA 1TUGB 1M90U 2RJDA 3GOXA 1TOVA 5GAN7 1M90R 2HSPA 1NLPC 3V7CA 2PUOB 3OQ5A 4LN2A 3QYHB 4O5VA 2YRCA 1ZLMA 2XIDA 1Q7YC 3JB9F 2E1HA 1VQ4A 1M1FA 2GTOA 4FT4A 1UE9A 4DEYA 2MYSA 1K9AA 1LVKA 1D3BB 3NGPA 1U1TA 4L59A 4M75F 2RHUA 4N4IA 1CKBA 3CCQA 5J3BA 3LGLA 2V26A 2B8AA 2CH4A 3CCMQ 3KXTA 1HK9A 2C0IA 4BDZA 3VS4A 2P0PA 1SRLA 5GJWB 4LDWA 2LMJA 2ED0A 5KYYA 5A0GA 1MMAA 3BY7A 1GBRA 3RR6A 4C0DC 1UHFA 3QZ9B 1M3AA 1K9MU 2EVRA 2DEUA 5GJVB 3QPHA 1JJ2A 3O5ZA 1K9MR 4ELYC 1IZ6A 4ANJA 2DYIA 2GGRA 3CC4T 2YRVA 3CCVT 2AK5A 3REBB 4J9HA 2M0OA 2J6OA 4M7DG 2VYTA 2OTLQ 1KHCA 1RI0A 1WLPB 4ZTFA 3OYGA 1BIBA 2QEXQ 1VQ6A 1YJWA 2GFAA 2E6NA 1M3BA 3VKIA 1YIJA 1VQNQ 3IQLA 1UECA 1Y57A 4LDUA 3CCRQ 3OSSC 2D0NA 2E5QA 4IUQA 3JB9D 4LD9K 4RKUE 4K11A 3X20B 5I2SA 3VS3A 3H0HA 5GAN3 4PJOA 3Q1JA 4R55A 3CCST 1OPKA 4PJNA 1EIFA 1X43A 5CVIA 1K4US 3CCLA 2BZ8A 3QZ5B 3FJPA 1K8AC 4M75D 1FMVA 2FRWA 5IHKA 3FJ5A 2DL4A 1BCOA 3L2VA 4IURA 3ZL7C 5I2MA 3X28B 3OY9A 2JXBA 2DF6A 2XK0A 2RD1A 3S6WA 1WJQA 2IG0A 4IUPA 4MZMA 4BE2A 3KFVA 1GCQC 1VQMT 2F69A 5GAMf 5KE2A 2X9HA 1NE8A 2B86A 1TH7A 4XTZA 1BCMA 2COWA 4FSSA 5KH6A 4C8QF 1UB4A 2QQSA 4M75A 2KT8A 3BE3A 5I11A 1W4SA 1G3YA 3I9QA 4LD6A 3S3OA 1VQ7A 5LJ5g 4MMKA 5CQXA 1SEMA 3UA7A 1KQSS 3RKXA 3VS5A 2F2WA 3LWHA 1M2OA 2X35A 3A8HB 4GLKA 4XU2A 3UPUA 2NLUA 2RHZA 3UATA 3SEMA 1I5LA 3PMIA 2GTJA 2YHTA 3L2ZA 1WA7A 2O4XB 2D1XA 1YITA 4AG2C 2HQEA 4PLLA 5GANd 2DTOA 3MO8A 4JDSA 2ZPHB 3OB9A 4PLIA 2EQKA 2V8KA 4D8DA 3CMAT 2R5AA 1U8RA 2E70A 3CC2Q 1UFFA 2NUTB 4M7DB 4C5IA 4EMGA 1VUBA 4XAXB 1VQ5A 4M75E 5GAN5 3CBMA 1VQ8Q 2ZZDA 3L2RA 1GL5A 5IXFA 4M78F 1M8VA 4A4HA 3J80E 4LDVA 4B9XA 5LJ3g 3G71T 5IT9E 4OMLA 1ZUKA 4E7SA 1VQNA 3GP8A 1WPYA 4KGVB 1WYXA 2NUZA 4MZTA 2QA4Q 1MV3A 1VQ4T 4BUGA 2NYSA 2KNBB 3TEEA 2O88A 4OVAA 3JCMV 4A4FA 2YUQA 1Y07A 3PVLA 2EGCA 1VQ9A 1LJOA 4C8QD 2EKHA 1M1KU 1ZA2B 2COZA 2RJCA 2M0YA 3H0IA 2DMOA
chains in the Genus database with same CATH topology
2LJ0A 1TG0A 2GQIA 2L3QA 3M0TA 1MUZA 2GNCA 2AKLA 2ENMA 4ZNXA 1PWTA 2FRYA 2V1RA 1J3TA 1PRLC 2RN8A 3QWYA 5IHNA 1HSQA 2CH4W 2XMFA 4CC2A 3TVTA 1AZGB 4AG1C 4Y92A 2L3SA 1AD5A 2EGEA 2KGTA 4A63B 2DNUA 1V1CA 3H41A 5L23A 2KR3A 3PE0A 1YWPA 2L3PA 4OMOA 1E7OA 2LZ6B 4J9CA 3THKA 1MV0B 2EW3A 5IXBA 2YUPA 3VS7A 4RTWA 4RTUA 2MCNA 2CUBA 1M27C 2EBPA 1X6GA 2J06A 4J9FA 1BK2A 1GFCA 4J9EA 4QT7A 2DBKA 1AVZC 2CT4A 1W6XA 2O31A 2CT3A 2FPEA 1ZBJA 2HCKA 2GBQA 3I5SA 2DL5A 1GRIA 3TSWA 1H92A 2MOXA 4LUEA 1M3CA 1JU5C 1UJ0A 2KRSA 2VWFA 2FEIA 2E5KA 1AWJA 1NEGA 1K0XA 1KFZA 1AEYA 3VS1A 1EFNA 4ORZA 1GFDA 3REAB 2RQUA 4IIMA 4IIOA 3VS2A 2CDTA 4RTVA 4JZ4A 2KYMA 1QWEA 1OEBA 4JPBW 2FPFA 1GCPA 3QWXX 1SSHA 4D8KA 4RUGA 2RMOA 5FWCA 2ABLA 2LQWA 1UDLA 2K79A 4LNPA 1W1FA 2DL3A 1OV3A 1W70A 1QCFA 2C0TA 1SHGA 2BZYA 1WXUA 2O2OA 3VRZA 1M8MA 1JO8A 2OI3A 3RBBB 2JTEA 4HCKA 1OPLA 1QKXA 1M30A 4ESRA 1UTIA 2O9SA 4J9DA 3EG0A 5FWBA 1GBQA 4HVWA 2DVJA 1PKSA 2DBMA 2YUNA 2CUDA 4JJCA 3A98A 4HVVA 2K3BA 1AWOA 4CC4B 2FG0A 4GLMA 4OMNA 4JJBA 4Z8AA 1UG1A 2SRCA 2A08A 4JZ3A 3R6NA 2D8HA 2JS0A 2PZ1A 2YUOA 1ZUUA 2K6DA 2H8HA 2CSQA 5EC7A 1JEGA 2F2VA 2LQNA 2AZVA 4HXJA 3C0CA 4OMPA 1A0NB 1X69A 1VYVA 4EIKA 3U23A 4AFUC 4R0KA 1YNZA 1VYTA 2LNHB 2KRNA 1I07A 2JW4A 1ABOA 2DRMA 2OAWA 2EPDA 3NMZC 1NG2A 1N5ZA 2HBWA 1XOVA 4HVUA 1NLOC 1NYFA 2L0AA 1AZEA 1WIEA 3I35A 2KEAA 4F17A 2DX1A 1RLQC 3M0RA 2HSPA 3JV3A 1NLPC 2YT6A 2V1QA 2PNIA 4LN2A 2DILA 4J9IA 2KROA 1KJWA 1ZLMA 2JMCA 2JM9A 4M4ZA 2KRMA 2J6FA 2EYZA 4J9BA 3M0UA 1X2QA 2GTOA 2YSQA 1QLYA 3CQTA 3EG1A 1UE9A 4DEYA 4OMQA 1K9AA 2NWMA 2VVKA 3NGPA 1E6HA 2JMAA 1CKBA 1Y0MA 2LP5A 2K2MA 1T0HA 1WFWA 5ECAA 1JXOA 3M0QA 2CH4A 2J7IA 2J6KA 1WXBA 2C0IA 3VS4A 3EHQA 1UJYA 1SRLA 5GJWB 2KXCA 2C0OA 3M0PA 2LMJA 2ED0A 4LE9A 1GBRA 4CC3A 1Z9QA 1UHFA 2P4RA 2ROTA 1M3AA 2I0NA 1PKTA 1PNJA 2RF0A 4E6RA 2EVRA 5GJVB 3O5ZA 1PHTA 2EYYA 2JS2A 4AFZC 2HDAA 2GGRA 3EHRA 1G2BA 1WDXA 2DJQA 3I5RA 2RQVA 1UUEA 4AFSC 2AK5A 1G83A 3REBB 4J9HA 4JJDA 2J6OA 1WXTA 5FW9A 1KSWA 1PRMC 3GBQA 3LH5A 4DEXA 1WLPB 1QKWA 3UF4A 3EGUA 2ROLA 4GBQA 4J9GA 3VS0A 2X3WD 1CKAA 2DM1A 1M3BA 4Z88A 2LX7A 2ESWA 1T0JA 3IQLA 1UECA 1Y57A 1K76A 2K9GA 1TUCA 1UHCA 4RTZA 4RTTA 1Z9ZA 1KIKA 2D0NA 1JXMA 2JM8A 3SHWA 1IO6A 2RNAA 2J05A 1ABQA 1JQQA 1BBZA 4K11A 2FO0A 3VS3A 2EQIA 2YDLA 1S1NA 3H0HA 1YN8A 2AZSA 2LJ1A 1OPKA 1K0SA 1X43A 1X2KA 1K4US 1X27A 2BZ8A 2KYBA 4Z89A 2FPDA 1ZSGA 1B3QA 1HD3A 1AWWA 1T3SA 2JT4A 5IHKA 2FRWA 3FJ5A 2DL4A 2KBTA 2LJ3A 2EYWA 3ZL7C 1VA7A 2K7AA 1SPKA 1I0CA 1UGVA 2JXBA 1VYUA 2DF6A 1WI7A 1T3LA 1WX6A 2OJ2A 2RQTA 1H8KA 4F14A 3KFVA 2O9VA 3NPFA 1GCQC 4RTXA 3H0FA 1ARKA 3UA6A 2B86A 1H3HA 2A28A 1RUWA 2BZXA 4FSSA 2DE0X 4X1VA 2X3XD 2DLPA 2CREA 2CSIA 1X6BA 3TSZA 2DL8A 2KT8A 1SHFA 1GCQA 2D8JA 5I11A 4KRTA 3RNJA 3I9QA 1QWFA 2RPNA 3EG3A 2RQWA 2A36A 2KT1A 1SEMA 3UA7A 1U5SA 3VS5A 1ZUYA 2F2WA 4F16A 5HCKA 4WCIA 1E6GA 1YCSB 1BU1A 1U06A 2SEMA 1RI9A 2ECZA 2DL7A 3UATA 3SEMA 1TUDA 2A37A 2L2PA 1I1JA 3NHNA 4LUDA 2GTJA 1RLPC 2W0ZA 1NM7A 2LCSA 2HEQA 1WA7A 3VRYA 2D1XA 3VS6A 4AG2C 3EG2A 2KXDA 2BTTA 1SRMA 2EYXA 4OMMA 1AOJA 1NEBA 1CSKA 4D8DA 1FMKA 1OOTA 5I22A 1UFFA 1NYGA 2KE9A 2AKKA 2M51A 2DRKA 2EGAA 2VKNA 3ULRB 1GL5A 2ED1A 5IXFA 5IHIA 1AWXA 2QDLA 1FYNA 2DA9A 4RTYA 2F2XA 4OMLA 1ZUKA 1HJDA 2G6FX 1WYXA 2NUZA 1LCKA 1ZX6A 1MV3A 1YP5A 2DYBA 3M0SA 2KNBB 4AFQC 1B07A 2RQRA 2W10A 2O88A 1BB9A 2YUQA 1K1ZA 3PVLA 2EGCA 2EKHA 2MIOA 1YWOA 1U3OA 2IIMA 3PVQA 2M0YA 3H0IA 4CC7A 2PTKA 5IH2A 2DMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJ0 A;  1TG0 A;  2GQI A;  2L3Q A;  3M0T A;  1MUZ A;  2GNC A;  2AKL A;  2ENM A;  4ZNX A;  1PWT A;  2FRY A;  2V1R A;  1J3T A;  1PRL C;  2RN8 A;  3QWY A;  5IHN A;  1HSQ A;  2CH4 W;  2XMF A;  4CC2 A;  3TVT A;  1AZG B;  4AG1 C;  4Y92 A;  2L3S A;  1AD5 A;  2EGE A;  2KGT A;  4A63 B;  2DNU A;  1V1C A;  3H41 A;  5L23 A;  2KR3 A;  3PE0 A;  1YWP A;  2L3P A;  4OMO A;  1E7O A;  2LZ6 B;  4J9C A;  3THK A;  1MV0 B;  2EW3 A;  5IXB A;  2YUP A;  3VS7 A;  4RTW A;  4RTU A;  2MCN A;  2CUB A;  1M27 C;  2EBP A;  1X6G A;  2J06 A;  4J9F A;  1BK2 A;  1GFC A;  4J9E A;  4QT7 A;  2DBK A;  1AVZ C;  2CT4 A;  1W6X A;  2O31 A;  2CT3 A;  2FPE A;  1ZBJ A;  2HCK A;  2GBQ A;  3I5S A;  2DL5 A;  1GRI A;  3TSW A;  1H92 A;  2MOX A;  4LUE A;  1M3C A;  1JU5 C;  1UJ0 A;  2KRS A;  2VWF A;  2FEI A;  2E5K A;  1AWJ A;  1NEG A;  1K0X A;  1KFZ A;  1AEY A;  3VS1 A;  1EFN A;  4ORZ A;  1GFD A;  3REA B;  2RQU A;  4IIM A;  4IIO A;  3VS2 A;  2CDT A;  4RTV A;  4JZ4 A;  2KYM A;  1QWE A;  1OEB A;  4JPB W;  2FPF A;  1GCP A;  3QWX X;  1SSH A;  4D8K A;  4RUG A;  2RMO A;  5FWC A;  2ABL A;  2LQW A;  1UDL A;  2K79 A;  4LNP A;  1W1F A;  2DL3 A;  1OV3 A;  1W70 A;  1QCF A;  2C0T A;  1SHG A;  2BZY A;  1WXU A;  2O2O A;  3VRZ A;  1M8M A;  1JO8 A;  2OI3 A;  3RBB B;  2JTE A;  4HCK A;  1OPL A;  1QKX A;  1M30 A;  4ESR A;  1UTI A;  2O9S A;  4J9D A;  3EG0 A;  5FWB A;  1GBQ A;  4HVW A;  2DVJ A;  1PKS A;  2DBM A;  2YUN A;  2CUD A;  4JJC A;  3A98 A;  4HVV A;  2K3B A;  1AWO A;  4CC4 B;  2FG0 A;  4GLM A;  4OMN A;  4JJB A;  4Z8A A;  1UG1 A;  2SRC A;  2A08 A;  4JZ3 A;  3R6N A;  2D8H A;  2JS0 A;  2PZ1 A;  2YUO A;  1ZUU A;  2K6D A;  2H8H A;  2CSQ A;  5EC7 A;  1JEG A;  2F2V A;  2LQN A;  2AZV A;  4HXJ A;  3C0C A;  4OMP A;  1A0N B;  1X69 A;  1VYV A;  4EIK A;  3U23 A;  4AFU C;  4R0K A;  1YNZ A;  1VYT A;  2LNH B;  2KRN A;  1I07 A;  2JW4 A;  1ABO A;  2DRM A;  2OAW A;  2EPD A;  3NMZ C;  1NG2 A;  1N5Z A;  2HBW A;  1XOV A;  4HVU A;  1NLO C;  1NYF A;  2L0A A;  1AZE A;  1WIE A;  3I35 A;  2KEA A;  4F17 A;  2DX1 A;  1RLQ C;  3M0R A;  2HSP A;  3JV3 A;  1NLP C;  2YT6 A;  2V1Q A;  2PNI A;  4LN2 A;  2DIL A;  4J9I A;  2KRO A;  1KJW A;  1ZLM A;  2JMC A;  2JM9 A;  4M4Z A;  2KRM A;  2J6F A;  2EYZ A;  4J9B A;  3M0U A;  1X2Q A;  2GTO A;  2YSQ A;  1QLY A;  3CQT A;  3EG1 A;  1UE9 A;  4DEY A;  4OMQ A;  1K9A A;  2NWM A;  2VVK A;  3NGP A;  1E6H A;  2JMA A;  1CKB A;  1Y0M A;  2LP5 A;  2K2M A;  1T0H A;  1WFW A;  5ECA A;  1JXO A;  3M0Q A;  2CH4 A;  2J7I A;  2J6K A;  1WXB A;  2C0I A;  3VS4 A;  3EHQ A;  1UJY A;  1SRL A;  5GJW B;  2KXC A;  2C0O A;  3M0P A;  2LMJ A;  2ED0 A;  4LE9 A;  1GBR A;  4CC3 A;  1Z9Q A;  1UHF A;  2P4R A;  2ROT A;  1M3A A;  2I0N A;  1PKT A;  1PNJ A;  2RF0 A;  4E6R A;  2EVR A;  5GJV B;  3O5Z A;  1PHT A;  2EYY A;  2JS2 A;  4AFZ C;  2HDA A;  2GGR A;  3EHR A;  1G2B A;  1WDX A;  2DJQ A;  3I5R A;  2RQV A;  1UUE A;  4AFS C;  2AK5 A;  1G83 A;  3REB B;  4J9H A;  4JJD A;  2J6O A;  1WXT A;  5FW9 A;  1KSW A;  1PRM C;  3GBQ A;  3LH5 A;  4DEX A;  1WLP B;  1QKW A;  3UF4 A;  3EGU A;  2ROL A;  4GBQ A;  4J9G A;  3VS0 A;  2X3W D;  1CKA A;  2DM1 A;  1M3B A;  4Z88 A;  2LX7 A;  2ESW A;  1T0J A;  3IQL A;  1UEC A;  1Y57 A;  1K76 A;  2K9G A;  1TUC A;  1UHC A;  4RTZ A;  4RTT A;  1Z9Z A;  1KIK A;  2D0N A;  1JXM A;  2JM8 A;  3SHW A;  1IO6 A;  2RNA A;  2J05 A;  1ABQ A;  1JQQ A;  1BBZ A;  4K11 A;  2FO0 A;  3VS3 A;  2EQI A;  2YDL A;  1S1N A;  3H0H A;  1YN8 A;  2AZS A;  2LJ1 A;  1OPK A;  1K0S A;  1X43 A;  1X2K A;  1K4U S;  1X27 A;  2BZ8 A;  2KYB A;  4Z89 A;  2FPD A;  1ZSG A;  1B3Q A;  1HD3 A;  1AWW A;  1T3S A;  2JT4 A;  5IHK A;  2FRW A;  3FJ5 A;  2DL4 A;  2KBT A;  2LJ3 A;  2EYW A;  3ZL7 C;  1VA7 A;  2K7A A;  1SPK A;  1I0C A;  1UGV A;  2JXB A;  1VYU A;  2DF6 A;  1WI7 A;  1T3L A;  1WX6 A;  2OJ2 A;  2RQT A;  1H8K A;  4F14 A;  3KFV A;  2O9V A;  3NPF A;  1GCQ C;  4RTX A;  3H0F A;  1ARK A;  3UA6 A;  2B86 A;  1H3H A;  2A28 A;  1RUW A;  2BZX A;  4FSS A;  2DE0 X;  4X1V A;  2X3X D;  2DLP A;  2CRE A;  2CSI A;  1X6B A;  3TSZ A;  2DL8 A;  2KT8 A;  1SHF A;  1GCQ A;  2D8J A;  5I11 A;  4KRT A;  3RNJ A;  3I9Q A;  1QWF A;  2RPN A;  3EG3 A;  2RQW A;  2A36 A;  2KT1 A;  1SEM A;  3UA7 A;  1U5S A;  3VS5 A;  1ZUY A;  2F2W A;  4F16 A;  5HCK A;  4WCI A;  1E6G A;  1YCS B;  1BU1 A;  1U06 A;  2SEM A;  1RI9 A;  2ECZ A;  2DL7 A;  3UAT A;  3SEM A;  1TUD A;  2A37 A;  2L2P A;  1I1J A;  3NHN A;  4LUD A;  2GTJ A;  1RLP C;  2W0Z A;  1NM7 A;  2LCS A;  2HEQ A;  1WA7 A;  3VRY A;  2D1X A;  3VS6 A;  4AG2 C;  3EG2 A;  2KXD A;  2BTT A;  1SRM A;  2EYX A;  4OMM A;  1AOJ A;  1NEB A;  1CSK A;  4D8D A;  1FMK A;  1OOT A;  5I22 A;  1UFF A;  1NYG A;  2KE9 A;  2AKK A;  2M51 A;  2DRK A;  2EGA A;  2VKN A;  3ULR B;  1GL5 A;  2ED1 A;  5IXF A;  5IHI A;  1AWX A;  2QDL A;  1FYN A;  2DA9 A;  4RTY A;  2F2X A;  4OML A;  1ZUK A;  1HJD A;  2G6F X;  1WYX A;  2NUZ A;  1LCK A;  1ZX6 A;  1MV3 A;  1YP5 A;  2DYB A;  3M0S A;  2KNB B;  4AFQ C;  1B07 A;  2RQR A;  2W10 A;  2O88 A;  1BB9 A;  2YUQ A;  1K1Z A;  3PVL A;  2EGC A;  2EKH A;  2MIO A;  1YWO A;  1U3O A;  2IIM A;  3PVQ A;  2M0Y A;  3H0I A;  4CC7 A;  2PTK A;  5IH2 A;  2DMO A; 
#chains in the Genus database with same CATH topology
 2LJ0 A;  1MNE A;  3HFO A;  4Y28 E;  5M9O A;  1Q82 R;  4QVC A;  1JJ2 P;  2QAS A;  3ZBD A;  4BE0 A;  1PWT A;  2YXY A;  5FU7 B;  2HBP A;  3G6E A;  1PRL C;  1PM3 A;  1QCN A;  2CH4 W;  2EWN A;  3NTH A;  1LOJ A;  1Y96 A;  3MET A;  2EIF A;  5GMK j;  3UDC A;  2DVE A;  2EQU A;  1K73 C;  1YWP A;  2NUP B;  3HTR A;  4BI4 A;  1YCY A;  3JB9 H;  2YUP A;  3OYL A;  2CUB A;  3EGD A;  1M27 C;  1UGR B;  1KHI A;  3JCM f;  1FMW A;  4NOY A;  3X25 B;  1SSF A;  3MEU A;  1JRI A;  4QKU A;  4L6V 5;  4V2S A;  2DBK A;  2E3H A;  2ZPB B;  4XK8 E;  3V8L A;  5CR2 A;  1VQ6 T;  1VIF A;  1ZBJ A;  1UEB A;  3G4S A;  1UGP B;  1YIJ T;  2K4Y A;  4M78 D;  1H92 A;  2CGH A;  5CKH A;  4HT9 A;  2QQB A;  3OA6 A;  1GFD A;  1OEB A;  3L2W A;  1KC8 C;  1S72 T;  1SSH A;  3OYK A;  4RMO A;  3MEV A;  7AT1 B;  2RB6 A;  1N9R A;  4C8Q E;  2ABL A;  2DEQ A;  2K79 A;  2DL3 A;  1IGQ A;  1YJN Q;  2V8I A;  3VV0 A;  1SHG A;  2CP6 A;  3X24 B;  4M78 A;  3P8B B;  1JJ2 S;  1TU0 B;  3HRS A;  1M4Z A;  2RH2 A;  1D1B A;  2LX9 A;  1M8M A;  2OI3 A;  4HCK A;  1OPL A;  4ME7 A;  3HL8 A;  4ZTJ A;  1IGU A;  3R6O A;  2DZ9 A;  3EG0 A;  3QJY A;  5DM7 R;  2Y90 A;  4J5Y A;  5CKE A;  3OYM A;  3JB9 J;  1PKS A;  4FYX B;  4JJC A;  2VUB A;  3ZEH A;  2K3B A;  2JUF A;  2FHD A;  1AWO A;  4FT2 A;  4BE1 A;  4OMN A;  4JJB A;  3UWN A;  3OYN A;  1ZQ1 A;  2JTM A;  2WAC A;  3SWN B;  4FYY B;  4OB0 B;  1ZUU A;  2K6D A;  4HCC A;  1G3T A;  1JEG A;  4II1 A;  4N0A A;  3KUF A;  4C92 B;  2DET A;  5CK9 A;  4PNO A;  5LJ3 h;  4R0K A;  3NFC A;  5GAM d;  4M78 E;  5KYU B;  3CC4 A;  1VYT A;  3L42 A;  4OB3 B;  2KRN A;  3CCV A;  1I07 A;  1ABO A;  5EG2 A;  3HRU A;  1Q81 C;  1NG2 A;  3I56 Q;  1N5Z A;  2HBW A;  2QK0 A;  3QG1 A;  4HVU A;  3OYJ A;  2DD4 A;  3LH0 A;  1B34 A;  1YIT T;  1RAC B;  3I35 A;  3M0R A;  2AIR B;  2HL5 C;  2CP2 A;  4A4E A;  3JV3 A;  2YT6 A;  2V1Q A;  2OTL T;  4J9I A;  5FRM A;  2EQM A;  1XJW B;  4M4Z A;  2KRM A;  2OTJ Q;  5KYX A;  2LQK A;  4RG2 A;  2K2V A;  2QEX T;  1QLY A;  1RL2 A;  1OZ3 A;  2RO0 A;  1OU8 A;  1VQN T;  1MGQ A;  2HL3 A;  4OP0 A;  4OB2 B;  5GAO n;  3CCR T;  1WHL A;  4CI0 C;  1TWB A;  1HXD A;  2JMA A;  1Y0M A;  2DIQ A;  1FWZ A;  2K2M A;  1WFW A;  1NPP A;  4F7U B;  3T9N A;  1OZ2 A;  4DBQ A;  3M56 A;  1VQ9 T;  4M7A E;  3OSV A;  5GAN e;  5I21 A;  1XTD A;  1NJI U;  4RCC A;  2FVU A;  3CPF A;  3A8O B;  4LE9 A;  1NJI R;  2ZGW A;  4NL3 A;  1VQM A;  3OBW A;  1YJN A;  2KSS A;  2EYY A;  3EGX B;  3G6E T;  1YFN A;  1VQL Q;  2JS2 A;  3RKY A;  2MAM A;  4AFZ C;  4PJJ A;  2HDA A;  3EHR A;  1G2B A;  4MDW A;  2BIV A;  4JJD A;  1R77 A;  5AT1 B;  1WXT A;  2X4X A;  3JCM c;  3OYE A;  1KSW A;  2JJ9 A;  4NL2 A;  3LH5 A;  3GIB A;  3UF4 A;  4GBQ A;  1Q81 U;  2P4T A;  1WHJ A;  4XU0 A;  3H6Z A;  3OYH A;  3SDZ A;  4FCY A;  1D09 B;  4Z88 A;  1BI2 A;  1N8R C;  1T0J A;  3A8G B;  1VQK Q;  3QII A;  4M7A C;  3JCM b;  4RTT A;  1JXM A;  1QP2 A;  2JM8 A;  1YHQ A;  1IO6 A;  4E7H A;  2RNA A;  1W2B P;  1PC0 A;  1WJR A;  3PMT A;  2J05 A;  1ABQ A;  3HHT B;  1JQQ A;  5A0L A;  2YDL A;  3SWN C;  4NS5 A;  1K0S A;  1X2K A;  3ME9 A;  1QVF A;  3C94 A;  3JB9 G;  3CMA A;  4C92 C;  1B3Q A;  2CZ7 B;  1DJ7 B;  3X26 B;  1VA7 A;  2K7A A;  1SPK A;  5DY9 A;  3JCM d;  1UGV A;  2D0Q B;  3MCA B;  2RQT A;  5LL6 S;  4M75 G;  2COY A;  4F14 A;  3G71 A;  3CC2 T;  3D7S B;  1KD1 C;  2GF7 A;  2FZC B;  4RTX A;  3H0F A;  3N5B B;  3UA6 A;  1OYX A;  1H3H A;  4C0Z A;  4CRI A;  1RUW A;  4E7Z A;  2CP7 A;  4X1V A;  4E7K A;  3PIO A;  2DLP A;  2CSI A;  1RAA B;  1X6B A;  3VUZ A;  4KH0 B;  1SHF A;  1RAI B;  2HKN A;  2X4J A;  1GCQ A;  3DB4 A;  4IUT A;  2QA4 T;  2JN0 A;  5KYY B;  1QWF A;  2RQW A;  5GMK m;  3CCE Q;  1WQ7 A;  4Y91 A;  5LJ5 f;  1ZUY A;  1V29 B;  4F16 A;  3A8M B;  3MEW A;  5HCK A;  1YCS B;  1BU1 A;  3OYC A;  1GXI E;  1RI9 A;  1N8R U;  2ECZ A;  2A37 A;  1I1J A;  1N8R R;  3CME Q;  1M2V A;  1RLP C;  2W0Z A;  3EFO B;  3QBY A;  4QVZ A;  1NM7 A;  3MP1 A;  1D3B A;  4BAC A;  3EG2 A;  3DB3 A;  3MPU B;  2BTT A;  1AT1 B;  2MMP A;  4JS5 A;  3CC7 Q;  5FRN A;  1SRM A;  1NEB A;  1X6O A;  2L8D A;  5I22 A;  1NYG A;  2FB7 A;  1VIE A;  2LNV A;  5HK3 A;  2ED1 A;  3L1A A;  2YLC A;  4RTY A;  4PJO B;  2F2X A;  1HJD A;  1RAB B;  5LJ3 f;  4E7J A;  1ZX6 A;  2KQW A;  4XTY A;  4C0F A;  4IKF A;  1YI2 Q;  3OYB A;  5D6Y A;  3NTI A;  4AFQ C;  1KD1 U;  1B07 A;  2HZY A;  1Q7Y U;  3PGG A;  5GAM e;  2MIO A;  2MWP A;  3FLG A;  3PNW C;  1YWO A;  5C6S A;  2VGN A;  1Q7Y R;  1S72 A;  1QVG A;  3MP6 A;  3V8J A;  2JZ2 A;  1WZO A;  1NZ9 A;  2GQI A;  1ZSZ A;  4N4G A;  2GNC A;  2PQW A;  1FXX A;  4M77 C;  4C8Q G;  4ZNX A;  2V1R A;  1J3T A;  2RN8 A;  3HFN A;  4EMK C;  3O8V A;  3MP8 A;  4QQD A;  2E64 A;  2L3S A;  1YJN T;  4A63 B;  2DNU A;  1V1C A;  3PE0 A;  4KUI A;  4KUL A;  1XNI A;  4QQ6 A;  5IXB A;  1WHH A;  2RM4 A;  5CKD A;  4RTU A;  1IRX A;  1GFC A;  4GY5 A;  3CD6 Q;  1Q86 C;  1AVZ C;  3HKS A;  1G3S A;  2FPE A;  2HCK A;  1VQP Q;  3CCM A;  4LDX A;  2HQH A;  1HYO A;  3QSU A;  1I5O B;  3BDU A;  2KK4 A;  1QVF P;  2FEI A;  1YHQ T;  2E5K A;  1ZBX A;  1AEY A;  1WHK A;  1EFN A;  4KGX B;  3VS1 A;  4M78 G;  1SF9 A;  1QWE A;  3M4Y A;  2FPF A;  3QXE B;  4D8K A;  3ASK A;  2RMO A;  5FWC A;  3MJX A;  3JSC A;  4XQ3 A;  3TQ7 P;  4LNP A;  2OTL A;  2BZY A;  4MZP A;  3VJP A;  2KDS A;  1K8A U;  4XU3 A;  3VRZ A;  4PL6 A;  5GAN 4;  3RBB B;  2RHI A;  1K8A R;  2QEX A;  1M30 A;  2QDY B;  4E47 A;  3CCJ Q;  4QQG A;  1ZA1 B;  5FWB A;  4HVW A;  3CCR A;  2DVJ A;  2YUN A;  2O4X A;  3PT9 A;  4ZGJ B;  1YJ9 Q;  2E65 A;  4HT8 A;  5GAN j;  1AHJ B;  4GLM A;  3QUI A;  4Z8A A;  4PJO C;  2SRC A;  2A08 A;  2D8H A;  2GFU A;  2NUT A;  2DKG A;  4FW1 A;  3M55 A;  4N4H A;  4HXJ A;  3JCM e;  1X69 A;  5GAN h;  3U23 A;  3TRE A;  4X9C A;  2AHJ B;  1YNZ A;  2X4W A;  4J6W A;  1QVF S;  2A0F B;  1R0C B;  2OAW A;  4WTO B;  3F70 A;  4M7A F;  4RCB A;  1BYM A;  1U1S A;  4C8Q A;  4J83 A;  1AZE A;  4C5E A;  1VQL T;  3GF5 A;  1WIE A;  2KEA A;  3BDL A;  1PG5 B;  5KYN A;  3P8D A;  2HAX A;  2PNI A;  2VV5 A;  3QO3 A;  4JRK A;  1VQO Q;  3OYF A;  2KRO A;  3OS5 A;  1G8X A;  2CS7 A;  2JMC A;  2XD0 A;  3E2U A;  4XTV A;  3RMQ A;  5GMK h;  5LJ5 d;  3M0U A;  1QW1 A;  2CKK A;  1X2Q A;  4MML A;  4C92 F;  3I55 Q;  1WGS A;  2YSQ A;  3EG1 A;  4OMQ A;  4RG8 A;  1UGS B;  2VVK A;  3JCM P;  3JRZ A;  2QGG A;  1QVG P;  3QJ6 A;  1E6H A;  6AT1 B;  2LP5 A;  1T0H A;  5ECA A;  2E4H A;  1M9S A;  1W2B A;  1JXO A;  3M0Q A;  2RI2 A;  4M78 B;  4X9D A;  3LWI A;  2J6K A;  1WXB A;  3EHQ A;  1UJY A;  3CCS Q;  3AHU A;  2KXC A;  2C0O A;  2Y4X A;  1O9S A;  3JCM J;  2JVV A;  4BI8 B;  2I0N A;  1PKT A;  3JCM W;  1PNJ A;  2RF0 A;  2HNI A;  4E6R A;  2DPP B;  3CC2 A;  3OW2 A;  2LC4 A;  2QG9 B;  1VQ8 A;  1WDX A;  2DJQ A;  2VB6 A;  3LYI A;  5LJ3 d;  1UUE A;  1D0Z A;  1G83 A;  1RAD B;  3CCJ A;  4M7D C;  2E41 A;  5FW9 A;  3FDR A;  3GPL A;  1PRM C;  3SFM A;  2CZ1 B;  3GBQ A;  3JAM E;  2OAU A;  2DIG A;  4M7A D;  2QA4 A;  4F7U F;  1QKW A;  3MEA A;  2DK3 A;  2HMA A;  2MK5 A;  1WNL A;  2X3W D;  2DM1 A;  2XKO C;  2LCC A;  3OYY A;  2HKQ B;  1K73 U;  2LX7 A;  2ESW A;  5FU6 B;  2K9G A;  1TUC A;  2ZPF B;  4JRP A;  2EJF A;  1K73 R;  4RTZ A;  3SHW A;  3MKD A;  3G7Z A;  2VXE A;  2K57 A;  1BBZ A;  4C92 D;  5GMK i;  3CCM T;  4FSX A;  4J8O A;  1BI0 A;  1B34 B;  1MMD A;  2AZS A;  2LJ1 A;  2H3E B;  1QVG S;  3DKM A;  4M7A A;  1X27 A;  4JLG A;  2KYB A;  4Z89 A;  2LRQ A;  2FPD A;  3M54 A;  1D0X A;  1T3S A;  1AWW A;  3CME T;  5FU7 C;  1ZHI A;  4A4K A;  3EH2 A;  2LJ3 A;  4C0G A;  2XU8 A;  4DBH A;  5KYX B;  3M9Q A;  2RK1 A;  1I4K 1;  3E9G A;  3SWN A;  1VYU A;  1Y7X A;  1RAF B;  3V8K A;  1G5V A;  3J7A F;  1T3L A;  3M53 A;  4JS4 A;  3CC7 T;  3S3N A;  1H8K A;  2XI9 A;  1KC8 U;  1OU9 A;  1OX9 A;  1IHV A;  3A1P A;  4C92 A;  1KC8 R;  2XIC A;  2DAQ A;  4KGZ B;  2BZX A;  2DE0 X;  3PIP A;  2YLB A;  1MMN A;  5KYU A;  4KH1 B;  2GQV A;  3C4S A;  4M77 F;  3JCM X;  5GAM j;  1V76 A;  3TSZ A;  1WJS A;  2VC8 A;  2CZ6 B;  2D8J A;  5FLX E;  3JB9 I;  4PFO A;  1YBY A;  3CPW A;  2MWO A;  2YWW A;  3LGF A;  1YI2 T;  3E19 A;  2RPN A;  1VQ4 Q;  3EG3 A;  2A36 A;  2DO3 A;  4LDY A;  5A0D A;  4Q5W A;  5GAM h;  1U06 A;  1N6A A;  1OUL A;  4PJM A;  3MHX A;  2SEM A;  3HSB A;  1TXQ A;  1M90 C;  1BKB A;  2M16 A;  1TUD A;  3CCQ Q;  2L2P A;  3EG9 A;  3NHN A;  4LUD A;  2LCS A;  4AMC A;  3VRY A;  3FIF A;  2KXD A;  4C92 E;  5GAO m;  4ZGD B;  2EYX A;  5KYW A;  4F7U A;  3DLM A;  1FMK A;  4ZGE B;  3VUB A;  2C06 A;  2DRK A;  2VKN A;  2F1L A;  5IN1 A;  3V7R A;  1KK7 A;  3RDV A;  3QDF A;  1AWX A;  1Q81 R;  1MMG A;  1R0B G;  2G6F X;  4ZN1 A;  4J6X A;  4BDY A;  1OI1 A;  1YP5 A;  2DYB A;  3M0S A;  9ATC B;  3H8Z A;  2Z0W A;  5D7U A;  5CAI A;  2RQR A;  2W10 A;  4BI3 A;  4WF2 A;  3OS1 A;  1VQP T;  1VQ6 Q;  1YJW Q;  3CCU Q;  1K1Z A;  3VYH B;  4M77 D;  5GAN 2;  1RAG B;  2IIM A;  4R56 A;  1K9M C;  4CC7 A;  5IH2 A;  3CXC A;  1N9S A;  2QTX A;  4JJN K;  2M9U A;  3M0T A;  2LCL A;  3OW2 P;  2KMT A;  2G3R A;  4EPC A;  3I56 A;  2ENM A;  3OBY A;  4F7U E;  2QGF B;  1C6V X;  5FRO A;  2FRY A;  5GMK l;  1OX8 A;  3QWY A;  1HSQ A;  3CCL Q;  5GAN 8;  4HCB A;  3TVT A;  4PJO F;  1AZG B;  2RI5 A;  4AG1 C;  1AD5 A;  2EGE A;  2K5F A;  2PVO B;  2IVW A;  5LJ5 e;  5J26 A;  4M77 A;  5CKF A;  5L23 A;  2OTJ A;  1VQ8 T;  2LZ6 B;  4E2F B;  5GAO r;  3L2Q A;  3CEY A;  4J9C A;  3THK A;  4EMK A;  2RI3 A;  3CCJ T;  4RTW A;  2DER A;  2MCN A;  2EBP A;  3SD4 A;  1X6G A;  2J06 A;  1D1A A;  1BK2 A;  4J9F A;  3QKJ A;  1UGQ B;  2EYQ A;  1N27 A;  2FL7 A;  2BE9 B;  2CT4 A;  2O31 A;  4L5G A;  4C5G A;  1YJ9 T;  2A7Y A;  5CQY A;  4ZN3 A;  4JRI A;  3V7S A;  3I5S A;  1M2V B;  2DL5 A;  2X51 A;  5IAY A;  1M3C A;  4PK4 A;  1JU5 C;  1UJ0 A;  3LX7 A;  2BUD A;  4DOV A;  1TSF A;  3E9F A;  3C95 A;  1K0X A;  1VQ7 Q;  1KFZ A;  1MND A;  2PVG B;  2FZG B;  2MF2 A;  1W2B S;  2DTI A;  3REA B;  2RQU A;  4IIM A;  4IIO A;  5LJ3 e;  4JPB W;  1VQL A;  2LVM A;  3JCM h;  3QWX X;  3KBG A;  4M77 E;  2LQW A;  3LLR A;  3RER A;  1UDL A;  1W1F A;  1OV3 A;  2CYZ B;  3OYD A;  1QCF A;  3OW2 S;  4XU1 A;  5KCH A;  1WXU A;  2WSE E;  4OB1 B;  1YIT Q;  1TTH B;  2O2O A;  4DBF A;  2RHX A;  5C0M A;  5GAN g;  1JO8 A;  3FC3 A;  2JTE A;  1M5Q 1;  4OGC A;  4B9W A;  1UTI A;  4J9D A;  4PJO D;  1LNX A;  1VQO T;  2YRD A;  1GBQ A;  1VQK A;  3CPW P;  3EFO A;  1VQ5 Q;  3LW5 E;  4KT0 E;  2BKD N;  3I55 T;  1ZSZ B;  2WSF E;  2EJG A;  4XTX A;  3P8H A;  4CC4 B;  3QYG B;  2FG0 A;  1KD1 R;  1OQK A;  1UG1 A;  3CCU A;  1KQS P;  5DLQ E;  4JZ3 A;  4DOW A;  3R6N A;  2JS0 A;  2PZ1 A;  2YUO A;  4HKE A;  2DXB A;  4YTL A;  3OYI A;  2H8H A;  4M7D F;  2CSQ A;  5EC7 A;  1B7T A;  1G3W A;  2F2V A;  1VQ9 Q;  2RK2 A;  2XHC A;  3C0C A;  4OMP A;  4XTU A;  1VYV A;  2QYZ A;  3UT1 A;  4AT1 B;  4A54 A;  2JNG A;  3M4G A;  2L3R A;  2LNH B;  8AT1 B;  2R5M A;  3TU4 K;  4M75 B;  2DRM A;  3INZ A;  4OF1 A;  1NLO C;  1KQ1 A;  1QVP A;  2O01 E;  4PFZ A;  3G6E Q;  4F17 A;  2DX1 A;  1RLQ C;  2BE7 D;  3WVD B;  2LQ8 A;  3H9N A;  4A53 A;  1RAH B;  3QHS A;  1Q95 G;  2GCX A;  2DIL A;  4D6W A;  1KJW A;  2JM9 A;  2J6F A;  2EYZ A;  5GAN 6;  4OMF B;  3OS0 A;  4J9B A;  1M1K C;  3CCE A;  3CQT A;  3FRN A;  4A4G A;  2DZC A;  2Y4Y A;  1SKU B;  2M1H A;  1TS9 A;  2NWM A;  1Q82 C;  3CBP A;  3EH1 A;  3SB2 A;  3CXC P;  1I8F A;  1Y71 A;  2P0K A;  3CPW S;  4PJO E;  1X75 C;  1MHN A;  2JOY A;  3GNF B;  3M57 A;  3G4S Q;  2DXT A;  3CME A;  2J7I A;  3GNG A;  1WHM A;  3M0P A;  4BY6 B;  1KQ2 A;  4CC3 A;  1Z9Q A;  3CC7 A;  2P4R A;  2ROT A;  3I56 T;  4M7D D;  2DTH A;  1QP3 A;  1PHT A;  3CBO A;  3HP9 A;  1WHG A;  3I5R A;  2D9T A;  2RQV A;  4AFS C;  1F1B B;  2FYK A;  3EFR A;  1VOM A;  3OMC A;  4PFP A;  3RIR A;  2RJF A;  1RAE B;  4F04 B;  5HKC A;  4E7I A;  2OTJ T;  1PD0 A;  1O75 A;  4DEX A;  2F5K A;  3EGU A;  4JLI A;  2ROL A;  4J9G A;  1YI2 A;  3VS0 A;  2LT1 A;  1CKA A;  4TVR A;  2VAS A;  2QXF A;  4M7D A;  5D6X A;  1K76 A;  3FEO A;  5CO7 A;  1JB0 E;  4M7A G;  1UHC A;  3C12 A;  1Z9Z A;  2E3I A;  3A8L B;  2A3L A;  1KIK A;  1ZSZ C;  2I2L A;  1Y96 B;  2ZPI B;  4J7I A;  2AT1 B;  2JTF A;  2PUK B;  2DD5 A;  8ATC B;  2FO0 A;  1Q86 U;  2EQI A;  4C8Q B;  1S1N A;  2RA2 A;  4Z02 A;  1YN8 A;  2DXU A;  1SG5 A;  5DLO A;  1Q86 R;  3CXC S;  2QAZ A;  2HQX A;  1Q82 U;  5D6W A;  2QQA A;  3EGD B;  3CCQ T;  2K3X A;  1ZSG A;  2DXC A;  1HD3 A;  4C92 G;  2JT4 A;  3J81 E;  2KBT A;  5KCO A;  2CZ0 B;  2EYW A;  4B6M A;  3AT1 B;  1I0C A;  1WI7 A;  1XQH A;  3CC4 Q;  5GAM g;  1WX6 A;  2OJ2 A;  4M75 C;  3CCV Q;  1M1K R;  2ZPG B;  1C0M A;  3NPF A;  2O9V A;  4BB7 A;  2KY9 A;  4IUV A;  5L8R E;  3EFS A;  1ARK A;  3M5A A;  3EAE A;  3CD6 A;  1PD1 A;  2A28 A;  4M7D E;  3VYG A;  2XDB A;  1X01 A;  2X3X D;  3WVE B;  1VQP A;  2CRE A;  4X34 A;  2DL8 A;  1KG1 A;  3RMS A;  4EMH A;  1VQK T;  4FM4 B;  2KI7 A;  5GAO p;  4C5H A;  2PVD B;  4KRT A;  3RNJ A;  2NUP A;  2MI6 A;  2M02 A;  3FB9 A;  2KT1 A;  4P5N A;  1YJW T;  3CCU T;  1U5S A;  1D0Y A;  1BIA A;  4J7F A;  4ATO A;  3BW1 A;  4WCI A;  1E6G A;  3WXM B;  1PSF A;  5A2Q E;  4F7U G;  2DL7 A;  5LJ5 j;  1D1C A;  1IXD A;  1FX7 A;  4PKC C;  2HEQ A;  4DA4 A;  3VS6 A;  4PJL A;  2HSE B;  4BY6 C;  3RES A;  1I81 A;  3CCL T;  4OMM A;  1AOJ A;  2DFU A;  1CSK A;  1OOT A;  2WSC E;  3RKW A;  1VQM Q;  2KE9 A;  2K5L A;  2AKK A;  2M51 A;  2CP3 A;  5J39 A;  2EGA A;  1JBM A;  1EZZ B;  5LJ5 h;  4FYW B;  2DJZ A;  3ULR B;  2VGM A;  3OS2 A;  1YJ9 A;  4XTW A;  1M1G A;  1PSE A;  5IHI A;  4VUB A;  2F5T X;  2QDL A;  1FYN A;  2ZPE B;  2DA9 A;  2IPO B;  2ZCF B;  1IB8 A;  1WQW A;  2QTV A;  1LCK A;  4E7L A;  3OMG A;  5CKB A;  4M7A B;  5KE3 A;  3PFS A;  3CCE T;  5AYF A;  1NJI C;  2RJE A;  3A5Z B;  1BB9 A;  3URG A;  5LJ3 j;  2R57 A;  2E10 A;  1BI1 A;  1U3O A;  3PVQ A;  4IUU A;  2PTK A;  3L2U A;  2EKO A;  2E6Z A;  2R58 A;  3GLX A;  5CCA A;  1TG0 A;  1YHQ Q;  1VQ7 T;  2L3Q A;  4BD3 A;  1MUZ A;  2V8J A;  2EAY A;  2AKL A;  2XG8 D;  3ER0 A;  4C8Q C;  4M77 G;  1QQJ A;  2EJ9 A;  4KBM B;  1H64 1;  5IHN A;  2XMF A;  4CC2 A;  2QQ9 A;  2D6F A;  2QQR A;  4Y92 A;  3PTA A;  3CMA Q;  2ATC B;  2EFI A;  2KGT A;  1VQO A;  3H41 A;  2CP5 A;  2KR3 A;  2OX7 A;  2L3P A;  4OMO A;  1E7O A;  2ZAE A;  1MV0 B;  5HY6 A;  3JCM g;  2EW3 A;  3I55 A;  4OGE A;  1EX4 A;  3VS7 A;  1IHW A;  3G71 Q;  3HRT A;  5GAO l;  4J9E A;  1VQ5 T;  4QT7 A;  1R8O B;  2PU9 B;  4FYV B;  1W6X A;  2K5I A;  2L89 A;  3DLL A;  2CT3 A;  4UC4 A;  1PCX A;  4O6J A;  3M58 A;  3EG9 B;  2L5Q A;  2GBQ A;  1GRI A;  3TSW A;  1KQS A;  5CIU A;  1QMC A;  2FZK B;  2MOX A;  4LUE A;  3HPW A;  3CCS A;  2KRS A;  2VWF A;  5HK0 A;  1ACM B;  1AWJ A;  1NEG A;  3E1S A;  5KYW B;  4C0D B;  4ORZ A;  1P92 A;  2CP0 A;  4M78 C;  3VS2 A;  4ELZ C;  2CDT A;  4RTV A;  4FW2 A;  4JZ4 A;  1LPL A;  2KYM A;  2MPX C;  4J6Y A;  1GCP A;  4FU6 A;  2H3J A;  4RUG A;  1QCO A;  2LTO A;  4JRQ A;  2XDD A;  1W70 A;  2C0T A;  2RHY A;  1NBE B;  5GAO q;  1C1A A;  2LT4 A;  1QKX A;  4ESR A;  1IRE B;  2K3Y A;  2O9S A;  2EQJ A;  3VU3 C;  5GAN f;  4HA8 A;  3TCJ A;  4DBR A;  2KVQ G;  3CD6 T;  4FIB A;  2KAF A;  3EGX A;  1BI3 A;  5GMK e;  4EDU A;  2DBM A;  3ZFJ A;  2CUD A;  3A98 A;  3BFM A;  4HVV A;  3G1J A;  4N0A C;  2LDM A;  1YIJ Q;  5FU6 C;  4PJO G;  4HCZ A;  4QVD A;  4FL6 A;  4MDX A;  2QI2 A;  3QDR B;  4KUD K;  1NPR A;  2P0Q A;  3M59 A;  3G4S T;  2LQN A;  2AZV A;  3S3M A;  1A0N B;  4JUV A;  4M77 B;  4EIK A;  2VXF A;  4DQ2 A;  2P84 A;  4AFU C;  2HD0 A;  4LXC A;  3RUX A;  3JCM Q;  3OYA A;  1S72 Q;  4EMK B;  2JW4 A;  4QW2 A;  2E12 A;  2EPD A;  3NMZ C;  1XOV A;  3NTK A;  2X4Y A;  2XDP A;  1NYF A;  2L0A A;  1H3Z A;  1TUG B;  1M90 U;  2RJD A;  3GOX A;  1TOV A;  5GAN 7;  1M90 R;  2HSP A;  1NLP C;  3V7C A;  2PUO B;  3OQ5 A;  4LN2 A;  3QYH B;  4O5V A;  2YRC A;  1ZLM A;  2XID A;  1Q7Y C;  3JB9 F;  2E1H A;  1VQ4 A;  1M1F A;  2GTO A;  4FT4 A;  1UE9 A;  4DEY A;  2MYS A;  1K9A A;  1LVK A;  1D3B B;  3NGP A;  1U1T A;  4L59 A;  4M75 F;  2RHU A;  4N4I A;  1CKB A;  3CCQ A;  5J3B A;  3LGL A;  2V26 A;  2B8A A;  2CH4 A;  3CCM Q;  3KXT A;  1HK9 A;  2C0I A;  4BDZ A;  3VS4 A;  2P0P A;  1SRL A;  5GJW B;  4LDW A;  2LMJ A;  2ED0 A;  5KYY A;  5A0G A;  1MMA A;  3BY7 A;  1GBR A;  3RR6 A;  4C0D C;  1UHF A;  3QZ9 B;  1M3A A;  1K9M U;  2EVR A;  2DEU A;  5GJV B;  3QPH A;  1JJ2 A;  3O5Z A;  1K9M R;  4ELY C;  1IZ6 A;  4ANJ A;  2DYI A;  2GGR A;  3CC4 T;  2YRV A;  3CCV T;  2AK5 A;  3REB B;  4J9H A;  2M0O A;  2J6O A;  4M7D G;  2VYT A;  2OTL Q;  1KHC A;  1RI0 A;  1WLP B;  4ZTF A;  3OYG A;  1BIB A;  2QEX Q;  1VQ6 A;  1YJW A;  2GFA A;  2E6N A;  1M3B A;  3VKI A;  1YIJ A;  1VQN Q;  3IQL A;  1UEC A;  1Y57 A;  4LDU A;  3CCR Q;  3OSS C;  2D0N A;  2E5Q A;  4IUQ A;  3JB9 D;  4LD9 K;  4RKU E;  4K11 A;  3X20 B;  5I2S A;  3VS3 A;  3H0H A;  5GAN 3;  4PJO A;  3Q1J A;  4R55 A;  3CCS T;  1OPK A;  4PJN A;  1EIF A;  1X43 A;  5CVI A;  1K4U S;  3CCL A;  2BZ8 A;  3QZ5 B;  3FJP A;  1K8A C;  4M75 D;  1FMV A;  2FRW A;  5IHK A;  3FJ5 A;  2DL4 A;  1BCO A;  3L2V A;  4IUR A;  3ZL7 C;  5I2M A;  3X28 B;  3OY9 A;  2JXB A;  2DF6 A;  2XK0 A;  2RD1 A;  3S6W A;  1WJQ A;  2IG0 A;  4IUP A;  4MZM A;  4BE2 A;  3KFV A;  1GCQ C;  1VQM T;  2F69 A;  5GAM f;  5KE2 A;  2X9H A;  1NE8 A;  2B86 A;  1TH7 A;  4XTZ A;  1BCM A;  2COW A;  4FSS A;  5KH6 A;  4C8Q F;  1UB4 A;  2QQS A;  4M75 A;  2KT8 A;  3BE3 A;  5I11 A;  1W4S A;  1G3Y A;  3I9Q A;  4LD6 A;  3S3O A;  1VQ7 A;  5LJ5 g;  4MMK A;  5CQX A;  1SEM A;  3UA7 A;  1KQS S;  3RKX A;  3VS5 A;  2F2W A;  3LWH A;  1M2O A;  2X35 A;  3A8H B;  4GLK A;  4XU2 A;  3UPU A;  2NLU A;  2RHZ A;  3UAT A;  3SEM A;  1I5L A;  3PMI A;  2GTJ A;  2YHT A;  3L2Z A;  1WA7 A;  2O4X B;  2D1X A;  1YIT A;  4AG2 C;  2HQE A;  4PLL A;  5GAN d;  2DTO A;  3MO8 A;  4JDS A;  2ZPH B;  3OB9 A;  4PLI A;  2EQK A;  2V8K A;  4D8D A;  3CMA T;  2R5A A;  1U8R A;  2E70 A;  3CC2 Q;  1UFF A;  2NUT B;  4M7D B;  4C5I A;  4EMG A;  1VUB A;  4XAX B;  1VQ5 A;  4M75 E;  5GAN 5;  3CBM A;  1VQ8 Q;  2ZZD A;  3L2R A;  1GL5 A;  5IXF A;  4M78 F;  1M8V A;  4A4H A;  3J80 E;  4LDV A;  4B9X A;  5LJ3 g;  3G71 T;  5IT9 E;  4OML A;  1ZUK A;  4E7S A;  1VQN A;  3GP8 A;  1WPY A;  4KGV B;  1WYX A;  2NUZ A;  4MZT A;  2QA4 Q;  1MV3 A;  1VQ4 T;  4BUG A;  2NYS A;  2KNB B;  3TEE A;  2O88 A;  4OVA A;  3JCM V;  4A4F A;  2YUQ A;  1Y07 A;  3PVL A;  2EGC A;  1VQ9 A;  1LJO A;  4C8Q D;  2EKH A;  1M1K U;  1ZA2 B;  2COZ A;  2RJC A;  2M0Y A;  3H0I A;  2DMO A; 
#chains in the Genus database with same CATH homology
 2LJ0 A;  1TG0 A;  2GQI A;  2L3Q A;  3M0T A;  1MUZ A;  2GNC A;  2AKL A;  2ENM A;  4ZNX A;  1PWT A;  2FRY A;  2V1R A;  1J3T A;  1PRL C;  2RN8 A;  3QWY A;  5IHN A;  1HSQ A;  2CH4 W;  2XMF A;  4CC2 A;  3TVT A;  1AZG B;  4AG1 C;  4Y92 A;  2L3S A;  1AD5 A;  2EGE A;  2KGT A;  4A63 B;  2DNU A;  1V1C A;  3H41 A;  5L23 A;  2KR3 A;  3PE0 A;  1YWP A;  2L3P A;  4OMO A;  1E7O A;  2LZ6 B;  4J9C A;  3THK A;  1MV0 B;  2EW3 A;  5IXB A;  2YUP A;  3VS7 A;  4RTW A;  4RTU A;  2MCN A;  2CUB A;  1M27 C;  2EBP A;  1X6G A;  2J06 A;  4J9F A;  1BK2 A;  1GFC A;  4J9E A;  4QT7 A;  2DBK A;  1AVZ C;  2CT4 A;  1W6X A;  2O31 A;  2CT3 A;  2FPE A;  1ZBJ A;  2HCK A;  2GBQ A;  3I5S A;  2DL5 A;  1GRI A;  3TSW A;  1H92 A;  2MOX A;  4LUE A;  1M3C A;  1JU5 C;  1UJ0 A;  2KRS A;  2VWF A;  2FEI A;  2E5K A;  1AWJ A;  1NEG A;  1K0X A;  1KFZ A;  1AEY A;  3VS1 A;  1EFN A;  4ORZ A;  1GFD A;  3REA B;  2RQU A;  4IIM A;  4IIO A;  3VS2 A;  2CDT A;  4RTV A;  4JZ4 A;  2KYM A;  1QWE A;  1OEB A;  4JPB W;  2FPF A;  1GCP A;  3QWX X;  1SSH A;  4D8K A;  4RUG A;  2RMO A;  5FWC A;  2ABL A;  2LQW A;  1UDL A;  2K79 A;  4LNP A;  1W1F A;  2DL3 A;  1OV3 A;  1W70 A;  1QCF A;  2C0T A;  1SHG A;  2BZY A;  1WXU A;  2O2O A;  3VRZ A;  1M8M A;  1JO8 A;  2OI3 A;  3RBB B;  2JTE A;  4HCK A;  1OPL A;  1QKX A;  1M30 A;  4ESR A;  1UTI A;  2O9S A;  4J9D A;  3EG0 A;  5FWB A;  1GBQ A;  4HVW A;  2DVJ A;  1PKS A;  2DBM A;  2YUN A;  2CUD A;  4JJC A;  3A98 A;  4HVV A;  2K3B A;  1AWO A;  4CC4 B;  2FG0 A;  4GLM A;  4OMN A;  4JJB A;  4Z8A A;  1UG1 A;  2SRC A;  2A08 A;  4JZ3 A;  3R6N A;  2D8H A;  2JS0 A;  2PZ1 A;  2YUO A;  1ZUU A;  2K6D A;  2H8H A;  2CSQ A;  5EC7 A;  1JEG A;  2F2V A;  2LQN A;  2AZV A;  4HXJ A;  3C0C A;  4OMP A;  1A0N B;  1X69 A;  1VYV A;  4EIK A;  3U23 A;  4AFU C;  4R0K A;  1YNZ A;  1VYT A;  2LNH B;  2KRN A;  1I07 A;  2JW4 A;  1ABO A;  2DRM A;  2OAW A;  2EPD A;  3NMZ C;  1NG2 A;  1N5Z A;  2HBW A;  1XOV A;  4HVU A;  1NLO C;  1NYF A;  2L0A A;  1AZE A;  1WIE A;  3I35 A;  2KEA A;  4F17 A;  2DX1 A;  1RLQ C;  3M0R A;  2HSP A;  3JV3 A;  1NLP C;  2YT6 A;  2V1Q A;  2PNI A;  4LN2 A;  2DIL A;  4J9I A;  2KRO A;  1KJW A;  1ZLM A;  2JMC A;  2JM9 A;  4M4Z A;  2KRM A;  2J6F A;  2EYZ A;  4J9B A;  3M0U A;  1X2Q A;  2GTO A;  2YSQ A;  1QLY A;  3CQT A;  3EG1 A;  1UE9 A;  4DEY A;  4OMQ A;  1K9A A;  2NWM A;  2VVK A;  3NGP A;  1E6H A;  2JMA A;  1CKB A;  1Y0M A;  2LP5 A;  2K2M A;  1T0H A;  1WFW A;  5ECA A;  1JXO A;  3M0Q A;  2CH4 A;  2J7I A;  2J6K A;  1WXB A;  2C0I A;  3VS4 A;  3EHQ A;  1UJY A;  1SRL A;  5GJW B;  2KXC A;  2C0O A;  3M0P A;  2LMJ A;  2ED0 A;  4LE9 A;  1GBR A;  4CC3 A;  1Z9Q A;  1UHF A;  2P4R A;  2ROT A;  1M3A A;  2I0N A;  1PKT A;  1PNJ A;  2RF0 A;  4E6R A;  2EVR A;  5GJV B;  3O5Z A;  1PHT A;  2EYY A;  2JS2 A;  4AFZ C;  2HDA A;  2GGR A;  3EHR A;  1G2B A;  1WDX A;  2DJQ A;  3I5R A;  2RQV A;  1UUE A;  4AFS C;  2AK5 A;  1G83 A;  3REB B;  4J9H A;  4JJD A;  2J6O A;  1WXT A;  5FW9 A;  1KSW A;  1PRM C;  3GBQ A;  3LH5 A;  4DEX A;  1WLP B;  1QKW A;  3UF4 A;  3EGU A;  2ROL A;  4GBQ A;  4J9G A;  3VS0 A;  2X3W D;  1CKA A;  2DM1 A;  1M3B A;  4Z88 A;  2LX7 A;  2ESW A;  1T0J A;  3IQL A;  1UEC A;  1Y57 A;  1K76 A;  2K9G A;  1TUC A;  1UHC A;  4RTZ A;  4RTT A;  1Z9Z A;  1KIK A;  2D0N A;  1JXM A;  2JM8 A;  3SHW A;  1IO6 A;  2RNA A;  2J05 A;  1ABQ A;  1JQQ A;  1BBZ A;  4K11 A;  2FO0 A;  3VS3 A;  2EQI A;  2YDL A;  1S1N A;  3H0H A;  1YN8 A;  2AZS A;  2LJ1 A;  1OPK A;  1K0S A;  1X43 A;  1X2K A;  1K4U S;  1X27 A;  2BZ8 A;  2KYB A;  4Z89 A;  2FPD A;  1ZSG A;  1B3Q A;  1HD3 A;  1AWW A;  1T3S A;  2JT4 A;  5IHK A;  2FRW A;  3FJ5 A;  2DL4 A;  2KBT A;  2LJ3 A;  2EYW A;  3ZL7 C;  1VA7 A;  2K7A A;  1SPK A;  1I0C A;  1UGV A;  2JXB A;  1VYU A;  2DF6 A;  1WI7 A;  1T3L A;  1WX6 A;  2OJ2 A;  2RQT A;  1H8K A;  4F14 A;  3KFV A;  2O9V A;  3NPF A;  1GCQ C;  4RTX A;  3H0F A;  1ARK A;  3UA6 A;  2B86 A;  1H3H A;  2A28 A;  1RUW A;  2BZX A;  4FSS A;  2DE0 X;  4X1V A;  2X3X D;  2DLP A;  2CRE A;  2CSI A;  1X6B A;  3TSZ A;  2DL8 A;  2KT8 A;  1SHF A;  1GCQ A;  2D8J A;  5I11 A;  4KRT A;  3RNJ A;  3I9Q A;  1QWF A;  2RPN A;  3EG3 A;  2RQW A;  2A36 A;  2KT1 A;  1SEM A;  3UA7 A;  1U5S A;  3VS5 A;  1ZUY A;  2F2W A;  4F16 A;  5HCK A;  4WCI A;  1E6G A;  1YCS B;  1BU1 A;  1U06 A;  2SEM A;  1RI9 A;  2ECZ A;  2DL7 A;  3UAT A;  3SEM A;  1TUD A;  2A37 A;  2L2P A;  1I1J A;  3NHN A;  4LUD A;  2GTJ A;  1RLP C;  2W0Z A;  1NM7 A;  2LCS A;  2HEQ A;  1WA7 A;  3VRY A;  2D1X A;  3VS6 A;  4AG2 C;  3EG2 A;  2KXD A;  2BTT A;  1SRM A;  2EYX A;  4OMM A;  1AOJ A;  1NEB A;  1CSK A;  4D8D A;  1FMK A;  1OOT A;  5I22 A;  1UFF A;  1NYG A;  2KE9 A;  2AKK A;  2M51 A;  2DRK A;  2EGA A;  2VKN A;  3ULR B;  1GL5 A;  2ED1 A;  5IXF A;  5IHI A;  1AWX A;  2QDL A;  1FYN A;  2DA9 A;  4RTY A;  2F2X A;  4OML A;  1ZUK A;  1HJD A;  2G6F X;  1WYX A;  2NUZ A;  1LCK A;  1ZX6 A;  1MV3 A;  1YP5 A;  2DYB A;  3M0S A;  2KNB B;  4AFQ C;  1B07 A;  2RQR A;  2W10 A;  2O88 A;  1BB9 A;  2YUQ A;  1K1Z A;  3PVL A;  2EGC A;  2EKH A;  2MIO A;  1YWO A;  1U3O A;  2IIM A;  3PVQ A;  2M0Y A;  3H0I A;  4CC7 A;  2PTK A;  5IH2 A;  2DMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...