1ABOA

Crystal structure of the complex of the abl tyrosine kinase sh3 domain with 3bp-1 synthetic peptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High-resolution crystal structures of tyrosine kinase SH3 domains complexed with proline-rich peptides.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (kinase/peptide)
molecule keywords ABL TYROSINE KINASE
total genus 10
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1995-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1aboA00
2PZ1A 2HCKA 4LN2A 2O9SA 4LUDA 2RNAA 5IXBA 1UDLA 2O31A 3M0UA 1OEBA 2PNIA 2DRKA 2CSIA 1SSHA 3EHQA 1NLOC 1B3QA 2LX7A 1T0JA 3KFVA 3M0PA 2YUOA 1Z9QA 1GBRA 3VS3A 5GJWB 1WLPB 1GRIA 2LMJA 2DLPA 1HD3A 1GFCA 2LJ1A 2GQIA 1UTIA 1W70A 4RTVA 5FWBA 3I5RA 2ABLA 2YT6A 4AFQC 3EG3A 2A08A 2MCNA 1PRLC 1W1FA 1AWXA 1JXMA 2FRWA 2DJQA 1UJYA 3SEMA 1BBZA 1TUDA 1IO6A 2CT3A 3VS7A 2DBMA 1V1CA 3THKA 1QLYA 1VYUA 3A98A 2CREA 1YCSB 1PWTA 2A37A 2OJ2A 1GCQA 2CSQA 4J9HA 1UHCA 4ORZA 2RF0A 1M27C 2FPDA 3TSZA 2KXDA 4J9IA 3RNJA 3VS4A 2JTEA 1TG0A 1GBQA 3R6NA 5IHIA 1PKTA 2DE0X 1JU5C 1ZX6A 4ESRA 1HJDA 2ECZA 1T0HA 1FMKA 1U3OA 2LNHB 1NYFA 2ED0A 3EG0A 2DL4A 4QT7A 1ABQA 1OPLA 2RQWA 3VS1A 2D8JA 1UE9A 1ZUKA 1I1JA 4AFZC 2AZVA 1GCPA 2EGCA 3GBQA 3M0TA 1GL5A 2J6OA 1KFZA 2BZXA 2LCSA 2DYBA 1UG1A 1AVZC 2JS0A 1AWOA 1CKBA 4GBQA 2K79A 3VS2A 5I22A 4JJBA 1I07A 2C0TA 2DX1A 1T3SA 1G83A 2DA9A 1M3CA 1MV0B 1UUEA 2LQNA 4JJCA 1KJWA 1ARKA 1QCFA 2DVJA 1UHFA 3VRZA 2J7IA 2KNBB 3QWXX 2ED1A 1X69A 5EC7A 5IH2A 2GNCA 4LUEA 1E6GA 4CC4B 1JQQA 1B07A 1WIEA 2FPFA 4CC7A 1Y0MA 2JM8A 2QDLA 1OOTA 1BU1A 1NM7A 2DM1A 2V1RA 1RLPC 2K2MA 4HVUA 1ABOA 1SRMA 2EGAA 1RUWA 2X3WD 2HEQA 2GGRA 2GBQA 4JZ3A 4E6RA 1E6HA 3EG2A 4OMPA 1KIKA 2X3XD 2C0IA 1WXBA 2I0NA 2FG0A 4JPBW 2SRCA 1NYGA 1X2QA 2M0YA 3VS6A 2KYBA 5HCKA 1TUCA 3IQLA 4OMMA 4J9CA 5IHNA 1QWFA 1H3HA 2KT1A 1KSWA 2KBTA 2KXCA 2LQWA 2KR3A 1XOVA 1X43A 4JJDA 3UA7A 2JMCA 2L3QA 2F2XA 1VYVA 1H92A 4F16A 4LNPA 3NMZC 2LJ0A 2RQTA 4FSSA 3SHWA 5L23A 3EHRA 2M51A 2RQVA 2JS2A 2KRMA 4IIOA 4OMOA 2EKHA 1VA7A 1NG2A 2XMFA 4J9BA 2DBKA 1U5SA 3TVTA 2KRNA 2YUPA 2L3SA 1WDXA 1E7OA 1YWPA 1UJ0A 4AFUC 2ROTA 4EIKA 2KGTA 4RTXA 2FPEA 2AKKA 3NPFA 3H41A 1PNJA 4M4ZA 3I5SA 2NWMA 2JXBA 5FW9A 2YSQA 1CSKA 3JV3A 2EQIA 2W10A 3H0IA 4OMQA 1PHTA 3EGUA 1K1ZA 2DL5A 2RQUA 1BB9A 5GJVB 2W0ZA 2CDTA 3H0HA 4HVWA 3I9QA 4RUGA 1PKSA 2EBPA 2DMOA 1J3TA 3REBB 3M0SA 4ZNXA 3VS5A 4HVVA 4DEXA 3M0QA 3QWYA 2K9GA 1N5ZA 3UATA 1AD5A 1ZSGA 4GLMA 2K3BA 4DEYA 1W6XA 2F2VA 1AZGB 2O88A 2ESWA 1ZUUA 1A0NB 3PE0A 2RPNA 5ECAA 2DILA 1AZEA 4AG1C 2E5KA 1Z9ZA 2YUNA 4IIMA 4HXJA 3CQTA 3RBBB 2O9VA 1H8KA 2DL3A 3O5ZA 1UFFA 2F2WA 4OMNA 2VKNA 4X1VA 2MIOA 1SHGA 1FYNA 4J9EA 1M3BA 1UECA 1GCQC 1QKWA 3PVQA 2EPDA 4J9DA 1SPKA 1HSQA 3REAB 3LH5A 4F14A 2SEMA 2D1XA 2A36A 4F17A 1UGVA 2J6KA 2L3PA 2PTKA 2AK5A 4J9GA 2KEAA 2IIMA 1RI9A 2L2PA 2DL7A 1MUZA 1YP5A 1CKAA 1M8MA 2G6FX 2LJ3A 1T3LA 2DRMA 3C0CA 1Y57A 1X6GA 4HCKA 2EYWA 2GTOA 1OPKA 2CUBA 1I0CA 1S1NA 4RTYA 1AOJA 3TSWA 2CT4A 2P4RA 1YWOA 3U23A 2LZ6B 2NUZA 2YDLA 1LCKA 1NLPC 4A63B 2FRYA 1YN8A 2KE9A 2BZYA 2HDAA 2C0OA 1M30A 1K76A 2FO0A 2RMOA 2HBWA 4CC2A 1WI7A 1K4US 1YNZA 4RTUA 1X6BA 2HSPA 2J06A 2EYYA 1JO8A 1SRLA 1U06A 2ENMA 1NEBA 2D8HA 2FEIA 2GTJA 1RLQC 1QKXA 2BTTA 1WX6A 2EVRA 1X2KA 4OMLA 2J05A 1AWJA 2EYZA 4Z88A 2AKLA 2VVKA 5IXFA 4Y92A 1WXTA 4RTZA 1ZBJA 1JEGA 3UA6A 1NEGA 2CH4W 1QWEA 2D0NA 1G2BA 2CH4A 1WFWA 3NGPA 3UF4A 2J6FA 2ROLA 2B86A 2K6DA 4KRTA 2AZSA 2JT4A 1WYXA 3FJ5A 2KT8A 4JZ4A 2RQRA 3VRYA 4D8DA 4R0KA 2BZ8A 1X27A 2DL8A 2DNUA 2CUDA 2K7AA 2DF6A 1WA7A 3M0RA 2VWFA 2JM9A 1WXUA 1K9AA 5IHKA 3I35A 3EG1A 1MV3A 4RTTA 3ULRB 2LP5A 1K0SA 2MOXA 2A28A 2V1QA 2KROA 4LE9A 3PVLA 4RTWA 5I11A 1SHFA 2H8HA 1GFDA 4Z8AA 4D8KA 1AEYA 1SEMA 2O2OA 1ZLMA 1OV3A 3ZL7C 4K11A 5FWCA 2JMAA 2EGEA 4AFSC 2OI3A 2RN8A 4WCIA 1AWWA 2KRSA 4Z89A 2KYMA 2EW3A 1ZUYA 2L0AA 1K0XA 3NHNA 1PRMC 1BK2A 1M3AA 4AG2C 4J9FA 2OAWA 4CC3A 1EFNA 2YUQA 3VS0A 1JXOA 1VYTA 2EYXA 3H0FA 2JW4A
chains in the Genus database with same CATH superfamily
3JCMP 3RKWA 1BI1A 2YWWA 3CCQT 4FW1A 4GY5A 3SWNB 1QVGS 3CBOA 4CI0C 1VQ5Q 4M75E 3RMSA 2EJFA 2XG8D 3MP6A 1B34B 2FL7A 2PNIA 3RMQA 3CCUT 3V8JA 2DRKA 3EHQA 1NLOC 2LX7A 5HKCA 4M78F 2YUOA 3X20B 3G6ET 3A8OB 1GBRA 3VS3A 5GANh 2LMJA 4ZGDB 4C8QB 2OTJQ 4YTLA 1RL2A 4FYWB 3LW5E 2LTOA 1G8XA 1SKUB 2LJ1A 2GQIA 4M7AC 5GAN2 2ZPFB 3OYBA 1W70A 2CZ1B 3I5RA 2YT6A 4J7FA 1VQ4T 2MCNA 1AWXA 5EG2A 2FRWA 1VQ5T 1N8RU 4MZTA 5LJ5h 3QO3A 3OYGA 1YJWQ 2X4XA 3V8LA 1BBZA 1VQLQ 1IO6A 3JCMc 5CKBA 5CKHA 2CREA 4QW2A 2OJ2A 3HRUA 1GCQA 2ZPGB 4Q5WA 1MHNA 4J9HA 4PFPA 3BFMA 4QVZA 1Y96A 3EGXB 1YITQ 3OYDA 2D6FA 2DTOA 1KG1A 1K9MU 5FROA 1HJDA 1QP2A 1UB4A 2E64A 3S3OA 2VUBA 1FMKA 1U3OA 2JNGA 2RK2A 1ABQA 4JRPA 2QXFA 2XK0A 4A4GA 4RMOA 4HCZA 5GANe 3KBGA 2AZVA 1GCPA 2H3JA 1GL5A 1XNIA 1VQ9T 4NL2A 3JB9D 1MMAA 4DA4A 1SF9A 1AWOA 1YHQT 1Q86U 3MEWA 1PD1A 1EIFA 4JJBA 3PT9A 3OYMA 3MP1A 1KC8C 4JJCA 3X25B 2HZYA 3H6ZA 1ARKA 1QCFA 2DVJA 1QMCA 1Q81R 1JRIA 5KE2A 3OYLA 3LWIA 3PTAA 1RAAB 1KC8R 1ZA1B 1QCNA 3MEUA 2XU8A 2EKOA 1Y0MA 3FEOA 5CR2A 2QDLA 1RLPC 4A4KA 3Q1JA 5GAOp 2HEQA 1E6HA 3EG2A 2X3XD 4E47A 2FG0A 3FDRA 4JPBW 1PSEA 1VQMT 2LQ8A 4IUVA 3TREA 2E3HA 4OMMA 4M78B 1KSWA 2KXCA 4JJDA 1ZSZA 2R57A 2LT4A 4F16A 4A4EA 1Q82R 2EJ9A 4FSSA 5GANd 3EHRA 1M90R 2V8JA 3D7SB 4LDUA 2KVQG 2EKHA 2XMFA 4J9BA 2DBKA 3JCMg 3WVEB 4PJOD 2YUPA 2L3SA 3ZBDA 5AYFA 1WDXA 3PMTA 1YWPA 5GAN6 1UJ0A 2ROTA 4MMLA 1VQNQ 2KGTA 1Y96B 1RAFB 2L89A 5DY9A 4MDWA 1PNJA 3OS1A 4OB1B 4Z02A 2JXBA 3CCLT 1CSKA 3EFSA 3EGUA 1X01A 3QXEB 3VJPA 1BB9A 2RHXA 4BY6C 2QAZA 3H0HA 2ZPEB 1TS9A 2HQHA 2EBPA 4EMHA 4ELZC 2HSEB 3REBB 3M0SA 2ZPBB 4A54A 3OA6A 2XHCA 3EFOB 4DEXA 3QWYA 2K9GA 2PVGB 3JCMb 4PJNA 3CC4T 4GLMA 3V7SA 3C12A 2GQVA 5DM7R 1W6XA 2DIQA 2F2VA 3MO8A 1AZGB 2O88A 2ESWA 4M75A 3PE0A 2RPNA 1D0ZA 3OBWA 1AZEA 3L2WA 3RIRA 1Z9ZA 3CMAQ 1HXDA 2E3IA 1FMWA 3CQTA 1Q86C 4HCCA 3RBBB 4OMFB 2O9VA 1K8AU 3CC2Q 4LDVA 3CMAT 4KGZB 2RHZA 5FRNA 3QZ5B 4ZGJB 2VKNA 4C8QA 4JLGA 3O8VA 3SWNA 2YRDA 1FYNA 4QQDA 1B34A 2EPDA 3PVQA 4DBQA 4J9DA 1XQHA 1HSQA 2A36A 2K4YA 1UGVA 3TQ7P 2J6KA 3LYIA 1OX8A 4J9GA 2KEAA 1Y71A 2DL7A 4C0ZA 3C0CA 4PJOF 1Y57A 1X6GA 1OPKA 5CCAA 1S1NA 4IUTA 5KYYB 1UGPB 1Q81U 3E9GA 1VQMA 3QJYA 2LZ6B 1LCKA 1K8AC 1SSFA 3CCVQ 7AT1B 4OB2B 4OB0B 5D7UA 1YN8A 2HDAA 2LCCA 3JCMW 2HBWA 3R6OA 4BD3A 4EDUA 4CC2A 3JCMJ 4RTUA 5GAOm 3ER0A 1D0XA 3CPWP 1VUBA 1Q7YR 1MMDA 2Z0WA 3DKMA 2GTJA 1RLQC 4A4FA 1KHCA 2DXCA 3CMAA 2NUPA 3E9FA 1BIBA 1X2KA 3NTHA 5IXFA 4Y92A 4E7SA 3RDVA 4J7IA 3OW2P 2PQWA 1JEGA 2OTLT 1NEGA 2CH4W 3JCMd 2CH4A 2ZGWA 1WFWA 4XU2A 2K6DA 4C92A 1G3WA 3MPUB 5I2SA 1IREB 5KYXA 4JZ4A 3VRYA 2L8DA 1YJNQ 1LOJA 3NTKA 2DKGA 2MWPA 4LD9K 2K2VA 1IHVA 4FU6A 4MDXA 1VQPQ 3OYAA 3QDRB 2E1HA 1WA7A 1VQ9A 2VWFA 3GIBA 2M9UA 4FYVB 1WXUA 3X26B 1WHHA 4JRQA 1M1FA 1MV3A 2P0PA 4C8QF 3ULRB 2LP5A 2PUKB 3JB9H 3CCMQ 2LVMA 1WHLA 5HK3A 1AT1B 1IRXA 4HA8A 3PVLA 3C95A 4E7KA 4OGEA 2VB6A 5KYWA 1SEMA 2XIDA 5A0GA 3MP8A 4QVDA 1OV3A 4RCBA 2EIFA 3HFNA 1IHWA 1IXDA 2OI3A 3CCST 2QTXA 2X35A 2B8AA 2DEQA 1TU0B 1ZUYA 4JJNK 3EGDB 2L5QA 1BK2A 2COWA 3SB2A 4AG2C 2QYZA 1VQ6Q 1VQ4A 4II1A 3DB4A 5KYNA 2OAWA 5CKEA 1YITA 3QBYA 3CXCS 2CP6A 1NPPA 2M1HA 2LT1A 5GAOl 1Y07A 1M1KU 4JRIA 2PZ1A 1PM3A 1YJWA 1RADB 2O9SA 2BUDA 5IXBA 4C92G 3VKIA 2FHDA 3M0UA 3QKJA 1VQ6T 3AT1B 3CXCP 3KFVA 2OTLA 2FZCB 2CKKA 1D3BB 1GRIA 3G71A 2DLPA 1LJOA 4ZTJA 3QDFA 3G6EA 3CCJT 1WQ7A 2OX7A 4BE1A 3S3NA 1M2VB 2BIVA 2FB7A 1PSFA 4RTVA 5GAMf 2KY9A 1PRLC 2DPPB 1JXMA 4PJMA 1MGQA 2JTFA 3L2ZA 1QVPA 1UJYA 1Q86R 1NZ9A 2IG0A 1TUDA 4J6XA 1V1CA 1M90U 2RI2A 1QLYA 4B9XA 1D3BA 1VYUA 2EQUA 1YCSB 3BY7A 2QQAA 2DIGA 1I5OB 3QUIA 2KQWA 1G5VA 2XDPA 3V7CA 4C8QG 2A7YA 1VQKT 4N4HA 1M2OA 4ORZA 3JB9F 3GLXA 4DOWA 1LVKA 2OTJT 4M75D 4M7DE 2M02A 2OTLQ 1TG0A 3PNWC 4MZMA 1GBQA 3NFCA 1OZ2A 1PKTA 2DE0X 1ZX6A 1BYMA 3MEAA 1PCXA 2ECZA 2EJGA 4JDSA 2GFUA 1VQOT 3EG0A 3CC4A 2DL4A 4QKUA 1OPLA 4Y28E 2RQWA 3CCMT 4DBRA 5J26A 1YJWT 2KK4A 3LGFA 3HP9A 1UE9A 3OYJA 1X75C 4AFZC 2EGCA 2ZCFB 1D1AA 5GAN4 2QDYB 3JCMf 2LCSA 4MMKA 2QI2A 5CQYA 1UEBA 2AIRB 2QQBA 3CPWS 3M55A 1RACB 4NS5A 2MAMA 4DOVA 2DX1A 5GANj 1TOVA 2DZCA 2DA9A 4C0FA 1G3TA 1MV0B 3CCRQ 3JCMh 3UPUA 1KJWA 5KYXB 1Q82C 3LH0A 2VXFA 1QVGA 2JZ2A 2LC4A 2J7IA 2O4XA 2ED1A 4OVAA 3MEVA 2HL5C 5J3BA 4CC4B 1IB8A 2LNVA 2LQKA 1VQ8Q 2A3LA 1M8VA 2RJDA 3CCET 1OOTA 5GAMh 1BU1A 4M75G 2V1RA 2K2MA 2HKQB 2EGAA 3CEYA 2MMPA 4MZPA 3E19A 4PJLA 2QA4Q 1WXBA 4FSXA 1X2QA 4XK8E 1YI2T 3BW1A 2LRQA 1JJ2P 1TUCA 3IQLA 1RI0A 3M57A 1QVFP 4C5IA 1NPRA 4J83A 3LGLA 2LDMA 1U1SA 2KBTA 2KT1A 2V8IA 1X43A 1K73U 1BIAA 2JMCA 3OYFA 2F2XA 1VYVA 2R58A 1YIJQ 1NJIU 3MKDA 2VGNA 3TCJA 3WXMB 4LNPA 3NMZC 4PJOG 5CQXA 1MNEA 3QYHB 5L23A 2X4JA 2F1LA 3OMGA 4OMOA 3OY9A 4AMCA 4DBFA 1NJIC 1JJ2A 1NG2A 1VQKQ 3VU3C 1U5SA 2E5QA 5LJ3e 1X6OA 4RG2A 4C0DC 3LWHA 4B6MA 4X9DA 4PLLA 4RTXA 2AKKA 3CCLQ 3H41A 1D1BA 3JCMX 4HT8A 2O01E 3QIIA 3JRZA 4C8QE 4OMQA 1WHMA 3PIOA 3RESA 4Y91A 2RQUA 1VQOQ 2LX9A 2P84A 4PJOB 2DMOA 3OSVA 2RM4A 1YIJA 3M0QA 3UATA 4M77B 2OTJA 3JCMQ 4M75B 2Y4YA 3UDCA 3JB9J 5L8RE 4R56A 3I56Q 3WVDB 2K5FA 2GFAA 2K3YA 2XKOC 4QQGA 2K5IA 3GPLA 4UC4A 4AG1C 1EZZB 3G7ZA 2PVOB 3RKYA 4M7AF 1VQMQ 4EPCA 2LCLA 2F5KA 3FB9A 5LL6S 2VXEA 1UFFA 2L3RA 3FC3A 4OMNA 4C92F 3A8MB 4M77A 2KDSA 4X1VA 2YLBA 2MIOA 4DQ2A 1BI3A 3CPFA 3HKSA 1HK9A 1NJIR 1D1CA 2DTIA 2MWOA 4J9EA 4XTYA 1UECA 4FCYA 1QP3A 5IN1A 3JAME 3CCSA 1SPKA 2SEMA 3PGGA 4L5GA 1N27A 2D1XA 4FW2A 2CZ0B 2L3PA 2NLUA 2PTKA 2L2PA 3OYKA 2KMTA 4M75F 1MUZA 3CMEQ 2DRMA 2EYWA 4JLIA 2CUBA 1I0CA 2QA4A 2DERA 5D6YA 1YWOA 3U23A 4XQ3A 2RK1A 3LX7A 4A63B 2DD4A 5GAN5 1MMNA 1YBYA 2Y90A 4L59A 3I56T 1K4US 1B7TA 1WI7A 4PLIA 1YNZA 4XTUA 2HSPA 2J06A 3OS5A 4C92E 2EYYA 1D0YA 1ZSZB 4FT2A 2ENMA 4IUUA 1NEBA 2D8HA 2QQSA 1M90C 2XDBA 2EVRA 5GAMd 2P4TA 1DJ7B 2J05A 1AWJA 2EYZA 3G1JA 2DZ9A 1N9RA 3QJ6A 4X34A 1YCYA 3JCMV 1C6VX 5CIUA 3UA6A 1QWEA 1TSFA 1QW1A 4M77G 2JT4A 3OYEA 1OYXA 3FJ5A 2KT8A 4KGVB 5CK9A 3CCJA 3CCMA 5LJ5e 2X4WA 5DLOA 3L42A 2DNUA 2CUDA 1KHIA 2K7AA 1VQLT 3M0RA 2JM9A 2VASA 5GMKi 1NE8A 3EG1A 4RTTA 3BE3A 3CBMA 5LJ3h 2KROA 4C0GA 3CCLA 1QVFS 1UGQB 5I11A 1K73C 4JS4A 1ZHIA 3OW2A 4J6WA 1ZLMA 1RAGB 5GMKj 5LJ5g 2YRVA 5FU6B 2JMAA 3TEEA 2EGEA 3VV0A 2D0QB 3QYGB 1W2BP 4AFSC 4WCIA 4WTOB 1BCMA 1WHGA 2KRSA 2L0AA 1WHKA 3NHNA 2KI7A 3OYHA 1TH7A 1YFNA 2JUFA 3A8LB 4M77D 3SFMA 3EGXA 3RR6A 4C5GA 4RKUE 2MK5A 1JXOA 4KBMB 1K8AR 2XICA 1VYTA 2EYXA 3H0FA 2JW4A 3ZFJA 2HCKA 5KCHA 4LUDA 2OAUA 3J80E 1MMGA 2H3EB 2RNAA 2E10A 3L2UA 1UDLA 2FYKA 2O31A 4E7HA 4M7AE 1VOMA 1OEBA 2QGFB 4BI4A 1EX4A 3UWNA 2E6ZA 4BI8B 2YRCA 5GJWB 1WLPB 3T9NA 2CS7A 3OSSC 4V2SA 1M2VA 3G4SA 5C0MA 2G3RA 2QEXT 4E7JA 2DVEA 1ACMB 3JCMe 1UTIA 2PUOB 5FWBA 5GAN8 1VQLA 2ABLA 5FU7C 3EG3A 2A08A 1W1FA 1VQ7T 5GANg 3EH2A 4LXCA 1YI2Q 1VQ5A 2E65A 4O6JA 4J8OA 1JB0E 1TUGB 2CT3A 2DBMA 1IGUA 3BDLA 4IUPA 1VQ8A 3KXTA 3RERA 1N9SA 1FX7A 2FVUA 1N8RR 4FL6A 1UHCA 4LDYA 2RF0A 1H641 1LNXA 3CC4Q 2KXDA 3RNJA 3QHSA 1FMVA 4J6YA 4M78D 3CD6Q 1JU5C 3EGDA 3CC2A 4M7DC 3SD4A 1T0HA 2WACA 3HFOA 3OQ5A 2DK3A 4M77E 4AT1B 1YJNA 2ED0A 2K5LA 4C92C 4EMKB 3VS1A 2D8JA 2WSEE 1YJ9A 3MCAB 1ZUKA 4PJOE 1I1JA 3J7AF 5J39A 3GBQA 1KFZA 2QQRA 2BZXA 1Y7XA 3CCRA 1UG1A 1AVZC 5KH6A 2JS0A 2RB6A 3E2UA 3CCJQ 4PL6A 2K79A 4BUGA 2NUTB 5KYWB 1I07A 1W2BS 1T3SA 4BE2A 5HK0A 2LQNA 3A1PA 2DXBA 1R0BG 2HKNA 3VRZA 2MI6A 5IH2A 5EC7A 3HTRA 2GNCA 1NBEB 1E6GA 1XJWB 3VUZA 4CC7A 2ZAEA 2QGGA 2NUPB 4KH0B 2RJCA 1I81A 2DM1A 1K9MR 4HVUA 2E6NA 1YHQQ 1RUWA 2X3WD 3M54A 2GGRA 3OYCA 5FRMA 1KIKA 1RAEB 1VQ9Q 2DEUA 2EWNA 2Y4XA 2SRCA 1NYGA 2M0YA 1W4SA 4HKEA 5HCKA 2CP0A 5IHNA 1H3HA 2LQWA 3HHTB 2KR3A 1XOVA 3UA7A 1VQKA 4HT9A 1YIJT 4E7LA 4JRKA 1H92A 4CRIA 5KYYA 1KQ2A 3CCEA 4XAXB 1OQKA 2LJ0A 3PMIA 1M5Q1 3JB9G 3RKXA 2RQTA 1VQPA 3SHWA 1YITT 3FLGA 2M51A 2JS2A 4IIOA 3VUBA 1Q95G 2YHTA 1VA7A 2ATCB 4M7DF 3M56A 4M7DD 4XU0A 3TVTA 5KYUA 1OU9A 3FJPA 1KQSP 3I55T 3QPHA 4AFUC 1BI2A 2DJZA 3LLRA 1BKBA 4P5NA 4C92D 2JJ9A 1KQ1A 2FPEA 4M78G 4M4ZA 2NWMA 2ZPIB 4N0AC 4M77F 3CC7T 1OX9A 3CXCA 1S72T 2EQIA 3M58A 4ELYC 1K1ZA 5GJVB 3DB3A 2GF7A 2CDTA 3OS2A 4HVWA 1VQ6A 1KQSA 4LDXA 4C0DB 1PKSA 1J3TA 2V8KA 2WSFE 5GAMg 4ZNXA 4LDWA 2A0FB 3SWNC 2RJFA 3EFRA 1ZSGA 3OYNA 2GCXA 4DEYA 1M1GA 3L2RA 1P92A 1A0NB 4M7DB 3CD6A 2E5KA 4IIMA 4WF2A 4E7IA 1RAHB 4OF1A 3GNGA 2E41A 4XTWA 1XTDA 2XD0A 1AHJB 5C6SA 3G71Q 2COYA 2RHUA 1Q82U 5D6XA 3EFOA 4FT4A 1KQSS 1SG5A 1TTHB 3X24B 2AT1B 5M9OA 1H3ZA 2JVVA 3CBPA 1GCQC 3DLMA 4PFZA 2EAYA 3MHXA 2EFIA 3REAB 3LH5A 4F14A 3OB9A 3QZ9B 2RI5A 2NYSA 2CP2A 2IIMA 1RI9A 5CVIA 4XTVA 1LPLA 1YP5A 1M8MA 1T3LA 8AT1B 2RO0A 1QCOA 3P8DA 3EG9A 4PNOA 1O9SA 2GTOA 5A2QE 4FYYB 1AOJA 1M1KC 3FRNA 2CT4A 2P4RA 1OZ3A 1NLPC 4QQ6A 2C06A 1I8FA 1VQNT 2HAXA 2F5TX 1MNDA 4A4HA 1K76A 2RMOA 4HCBA 3JSCA 6AT1B 1G3YA 1X6BA 4EMGA 4D6WA 3QSUA 3NTIA 3CPWA 2KSSA 2JTMA 1VQ8T 1WJQA 2FEIA 4NOYA 2RHYA 1I5LA 4QVCA 4C8QC 2BTTA 1WX6A 4KUIA 4Z88A 1VIFA 5A0LA 2VVKA 2DD5A 1K73R 1WJSA 1ZBJA 5KE3A 3GNFB 2D0NA 2DAQA 1WPYA 2DFUA 4KRTA 1M4ZA 1UGRB 3CCVA 4XTZA 4D8DA 4R0KA 1X27A 4IURA 2QTVA 3H9NA 5GAN7 4BB7A 3CC2T 1WQWA 1K9AA 5IHKA 2ZZDA 1M1KR 2MOXA 2A28A 1BCOA 2V1QA 4LE9A 2KAFA 4KH1B 3VYGA 4RTWA 1KD1R 2H8HA 3CC7A 1AEYA 4LD6A 5GAMe 5FU6C 3L1AA 5FWCA 3EG9B 2E4HA 2RD1A 2HMAA 2RN8A 1F1BB 5AT1B 3I55A 1AWWA 4A53A 2EW3A 2CP3A 1K0XA 1PRMC 1M3AA 1YJ9Q 4IUQA 1G3SA 1IGQA 1PC0A 3M59A 5GMKe 1FWZA 4M75C 2RJEA 2YUQA 4XTXA 5GMKh 2RHIA 4M77C 4LN2A 2FZKB 4JS5A 2I2LA 3CMET 4ZTFA 2RA2A 1W2BA 5LJ5j 2CSIA 1SSHA 1B3QA 3OBYA 1T0JA 3M0PA 1Z9QA 1WNLA 4M7DA 5GAN3 3HRSA 5I2MA 4M7AD 3C94A 5LJ3d 2AHJB 4C5EA 5HY6A 1HD3A 1GFCA 5FLXE 2CZ6B 4VUBA 1N8RC 4NL3A 2CGHA 2P0KA 3UT1A 2K57A 3N5BB 3DLLA 5CKFA 3M4GA 4AFQC 2P0QA 1RAIB 4ZGEB 4RCCA 1U8RA 4PJOA 2DJQA 5GAOr 1WZOA 3SEMA 5IAYA 3PIPA 1TWBA 4O5VA 3GF5A 3VS7A 2VGMA 1VQPT 4E2FB 3THKA 3A98A 1PWTA 5I21A 3ASKA 2A37A 2HQEA 1YJ9T 1BI0A 2CSQA 3E1SA 2CYZB 3HPWA 1M27C 2FPDA 3TSZA 4J9IA 3RUXA 3VS4A 3CCSQ 2JTEA 3ZEHA 3C4SA 5KYUB 3R6NA 3G6EQ 5IHIA 1V76A 4M7DG 1KK7A 4ESRA 2RH2A 2BE9B 3M4YA 3CMEA 1FXXA 4KULA 2LNHB 1NYFA 3HSBA 4QT7A 1ZA2B 3G71T 3SDZA 1PD0A 3A5ZB 4L6V5 2DETA 2HL3A 2J6OA 2DYBA 2MF2A 4GLKA 5GMKm 1WJRA 1C1AA 1CKBA 1RABB 5CKDA 2M0OA 4GBQA 4IKFA 3VS2A 4C8QD 5I22A 2C0TA 1C0MA 2CP5A 1G83A 4JUVA 4R55A 1M3CA 4FYXB 1UUEA 3OMCA 4M78A 4ZN1A 1UHFA 1I4K1 2EYQA 1QVGP 5A0DA 3L2VA 3FIFA 2KNBB 3QWXX 4FM4B 1X69A 2K3XA 3CCUQ 4BACA 3OYYA 4LUEA 2D9TA 1JQQA 1Q7YC 1B07A 5LJ5f 3V7RA 1WIEA 2FPFA 1OULA 3CCRT 4B9WA 2JM8A 3GOXA 3CC7Q 2DO3A 2WSCE 3V8KA 2O4XB 4E7ZA 1NM7A 2QA4T 1ABOA 1SRMA 3ME9A 4M78E 3I55Q 1WGSA 4E6RA 4JZ3A 1R0CB 2PU9B 3A8HB 4OMPA 4ANJA 2NUTA 2C0IA 3URGA 2EQMA 2I0NA 1ZQ1A 3CCEQ 3VS6A 3OW2S 2KYBA 4J9CA 1QWFA 4BI3A 1VQ4Q 4OP0A 4F04B 1VQOA 2L3QA 3M9QA 2QEXQ 4BDZA 3CCUA 4KT0E 1Q7YU 5D6WA 1TXQA 1WHJA 2RQVA 2KRMA 2PVDB 3QG1A 3GP8A 2CP7A 2V26A 2IVWA 1HYOA 2KRNA 1E7OA 5GMKl 4EIKA 4BY6B 1S72Q 4N0AA 3G4SQ 1ZBXA 2MPXC 4EMKC 3NPFA 2QQ9A 4F7UF 3I5SA 5FW9A 2YSQA 3EAEA 3JV3A 3H0IA 2W10A 1PHTA 3HL8A 2DL5A 2QG9B 5GAOn 2W0ZA 4ME7A 4M7AG 2FZGB 2DXUA 2COZA 3I9QA 2ZPHB 4PKCC 4RUGA 3M5AA 1YI2A 4PJJA 1ZSZC 2HNIA 3VS5A 4HVVA 4M7AB 1N5ZA 2DXTA 1AD5A 2JOYA 1KC8U 5GAMj 3CCQA 2K3BA 2XDDA 3H8ZA 4KGXB 4TVRA 1ZUUA 3MJXA 3OS0A 4BDYA 5ECAA 2DILA 2MYSA 3EH1A 2YUNA 4HXJA 2CZ7B 4M78C 3I56A 5FU7B 1R8OB 1H8KA 2DL3A 4J5YA 5DLQE 5LJ3f 3O5ZA 2F2WA 3F70A 4M7AA 8ATCB 1SHGA 1OU8A 2JN0A 2IPOB 3KUFA 1M3BA 2EQJA 1JBMA 1QKWA 4DBHA 1VQNA 2YXYA 3S6WA 2VV5A 4F17A 1QQJA 4X9CA 1N6AA 2AK5A 2QEXA 1KD1U 2E70A 5IT9E 2VC8A 2X9HA 1YHQA 1CKAA 2G6FX 2LJ3A 3TU4K 4HCKA 4ATOA 4N4GA 4RTYA 3VYHB 2R5AA 2X4YA 3TSWA 9ATCB 4PK4A 1JJ2S 2R5MA 1VQ7Q 2QK0A 3A8GB 2NUZA 3L2QA 2YDLA 2F69A 2FRYA 2HBPA 2KE9A 2BZYA 1K9MC 2C0OA 1M30A 2VYTA 4RG8A 5GANf 2FO0A 1YJNT 1S72A 1D09B 1JO8A 1SRLA 1U06A 1U1TA 1IZ6A 1M9SA 4PJOC 2XI9A 1QKXA 2YLCA 4C92B 3OYIA 3JB9I 4OMLA 1R77A 2AKLA 4FIBA 3CD6T 1KD1C 2BE7D 3X28B 1WXTA 4RTZA 4BE0A 2EQKA 4XU1A 1UGSB 1G2BA 4F7UA 3META 3NGPA 3CCQQ 3UF4A 2J6FA 2ROLA 2B86A 3J81E 2AZSA 1WYXA 3G4ST 2QASA 5LJ3g 2RQRA 4F7UB 1VQ7A 2BZ8A 2DL8A 1VIEA 4OGCA 4PFOA 2HQXA 3S3MA 3P8HA 2BKDN 2E12A 1O75A 3CCVT 2DF6A 5KCOA 2X51A 3I35A 4XU3A 5LJ5d 2DYIA 1GXIE 4KUDK 1K0SA 3AHUA 4F7UE 3HRTA 3PFSA 5CAIA 1SHFA 2HD0A 1GFDA 4Z8AA 1OI1A 4D8KA 2DTHA 5LJ3j 2O2OA 1Q81C 3ZL7C 3M53A 2M16A 4K11A 1QVFA 4EMKA 5GAOq 4F7UG 4Z89A 2KYMA 4N4IA 1PG5B 5CO7A 4J9FA 2RI3A 1V29B 4C5HA 4ZN3A 3INZA 4CC3A 3BDUA 3P8BB 1EFNA 3VS0A 3M0TA 2GBQA 4OB3B
chains in the Genus database with same CATH topology
2PZ1A 2HCKA 4LN2A 2O9SA 4LUDA 2RNAA 5IXBA 1UDLA 2O31A 3M0UA 1OEBA 2PNIA 2DRKA 2CSIA 1SSHA 3EHQA 1NLOC 1B3QA 2LX7A 1T0JA 3KFVA 3M0PA 2YUOA 1Z9QA 1GBRA 3VS3A 5GJWB 1WLPB 1GRIA 2LMJA 2DLPA 1HD3A 1GFCA 2LJ1A 2GQIA 1UTIA 1W70A 4RTVA 5FWBA 3I5RA 2ABLA 2YT6A 4AFQC 3EG3A 2A08A 2MCNA 1PRLC 1W1FA 1AWXA 1JXMA 2FRWA 2DJQA 1UJYA 3SEMA 1BBZA 1TUDA 1IO6A 2CT3A 3VS7A 2DBMA 1V1CA 3THKA 1QLYA 1VYUA 3A98A 2CREA 1YCSB 1PWTA 2A37A 2OJ2A 1GCQA 2CSQA 4J9HA 1UHCA 4ORZA 2RF0A 1M27C 2FPDA 3TSZA 2KXDA 4J9IA 3RNJA 3VS4A 2JTEA 1TG0A 1GBQA 3R6NA 5IHIA 1PKTA 2DE0X 1JU5C 1ZX6A 4ESRA 1HJDA 2ECZA 1T0HA 1FMKA 1U3OA 2LNHB 1NYFA 2ED0A 3EG0A 2DL4A 4QT7A 1ABQA 1OPLA 2RQWA 3VS1A 2D8JA 1UE9A 1ZUKA 1I1JA 4AFZC 2AZVA 1GCPA 2EGCA 3GBQA 3M0TA 1GL5A 2J6OA 1KFZA 2BZXA 2LCSA 2DYBA 1UG1A 1AVZC 2JS0A 1AWOA 1CKBA 4GBQA 2K79A 3VS2A 5I22A 4JJBA 1I07A 2C0TA 2DX1A 1T3SA 1G83A 2DA9A 1M3CA 1MV0B 1UUEA 2LQNA 4JJCA 1KJWA 1ARKA 1QCFA 2DVJA 1UHFA 3VRZA 2J7IA 2KNBB 3QWXX 2ED1A 1X69A 5EC7A 5IH2A 2GNCA 4LUEA 1E6GA 4CC4B 1JQQA 1B07A 1WIEA 2FPFA 4CC7A 1Y0MA 2JM8A 2QDLA 1OOTA 1BU1A 1NM7A 2DM1A 2V1RA 1RLPC 2K2MA 4HVUA 1ABOA 1SRMA 2EGAA 1RUWA 2X3WD 2HEQA 2GGRA 2GBQA 4JZ3A 4E6RA 1E6HA 3EG2A 4OMPA 1KIKA 2X3XD 2C0IA 1WXBA 2I0NA 2FG0A 4JPBW 2SRCA 1NYGA 1X2QA 2M0YA 3VS6A 2KYBA 5HCKA 1TUCA 3IQLA 4OMMA 4J9CA 5IHNA 1QWFA 1H3HA 2KT1A 1KSWA 2KBTA 2KXCA 2LQWA 2KR3A 1XOVA 1X43A 4JJDA 3UA7A 2JMCA 2L3QA 2F2XA 1VYVA 1H92A 4F16A 4LNPA 3NMZC 2LJ0A 2RQTA 4FSSA 3SHWA 5L23A 3EHRA 2M51A 2RQVA 2JS2A 2KRMA 4IIOA 4OMOA 2EKHA 1VA7A 1NG2A 2XMFA 4J9BA 2DBKA 1U5SA 3TVTA 2KRNA 2YUPA 2L3SA 1WDXA 1E7OA 1YWPA 1UJ0A 4AFUC 2ROTA 4EIKA 2KGTA 4RTXA 2FPEA 2AKKA 3NPFA 3H41A 1PNJA 4M4ZA 3I5SA 2NWMA 2JXBA 5FW9A 2YSQA 1CSKA 3JV3A 2EQIA 2W10A 3H0IA 4OMQA 1PHTA 3EGUA 1K1ZA 2DL5A 2RQUA 1BB9A 5GJVB 2W0ZA 2CDTA 3H0HA 4HVWA 3I9QA 4RUGA 1PKSA 2EBPA 2DMOA 1J3TA 3REBB 3M0SA 4ZNXA 3VS5A 4HVVA 4DEXA 3M0QA 3QWYA 2K9GA 1N5ZA 3UATA 1AD5A 1ZSGA 4GLMA 2K3BA 4DEYA 1W6XA 2F2VA 1AZGB 2O88A 2ESWA 1ZUUA 1A0NB 3PE0A 2RPNA 5ECAA 2DILA 1AZEA 4AG1C 2E5KA 1Z9ZA 2YUNA 4IIMA 4HXJA 3CQTA 3RBBB 2O9VA 1H8KA 2DL3A 3O5ZA 1UFFA 2F2WA 4OMNA 2VKNA 4X1VA 2MIOA 1SHGA 1FYNA 4J9EA 1M3BA 1UECA 1GCQC 1QKWA 3PVQA 2EPDA 4J9DA 1SPKA 1HSQA 3REAB 3LH5A 4F14A 2SEMA 2D1XA 2A36A 4F17A 1UGVA 2J6KA 2L3PA 2PTKA 2AK5A 4J9GA 2KEAA 2IIMA 1RI9A 2L2PA 2DL7A 1MUZA 1YP5A 1CKAA 1M8MA 2G6FX 2LJ3A 1T3LA 2DRMA 3C0CA 1Y57A 1X6GA 4HCKA 2EYWA 2GTOA 1OPKA 2CUBA 1I0CA 1S1NA 4RTYA 1AOJA 3TSWA 2CT4A 2P4RA 1YWOA 3U23A 2LZ6B 2NUZA 2YDLA 1LCKA 1NLPC 4A63B 2FRYA 1YN8A 2KE9A 2BZYA 2HDAA 2C0OA 1M30A 1K76A 2FO0A 2RMOA 2HBWA 4CC2A 1WI7A 1K4US 1YNZA 4RTUA 1X6BA 2HSPA 2J06A 2EYYA 1JO8A 1SRLA 1U06A 2ENMA 1NEBA 2D8HA 2FEIA 2GTJA 1RLQC 1QKXA 2BTTA 1WX6A 2EVRA 1X2KA 4OMLA 2J05A 1AWJA 2EYZA 4Z88A 2AKLA 2VVKA 5IXFA 4Y92A 1WXTA 4RTZA 1ZBJA 1JEGA 3UA6A 1NEGA 2CH4W 1QWEA 2D0NA 1G2BA 2CH4A 1WFWA 3NGPA 3UF4A 2J6FA 2ROLA 2B86A 2K6DA 4KRTA 2AZSA 2JT4A 1WYXA 3FJ5A 2KT8A 4JZ4A 2RQRA 3VRYA 4D8DA 4R0KA 2BZ8A 1X27A 2DL8A 2DNUA 2CUDA 2K7AA 2DF6A 1WA7A 3M0RA 2VWFA 2JM9A 1WXUA 1K9AA 5IHKA 3I35A 3EG1A 1MV3A 4RTTA 3ULRB 2LP5A 1K0SA 2MOXA 2A28A 2V1QA 2KROA 4LE9A 3PVLA 4RTWA 5I11A 1SHFA 2H8HA 1GFDA 4Z8AA 4D8KA 1AEYA 1SEMA 2O2OA 1ZLMA 1OV3A 3ZL7C 4K11A 5FWCA 2JMAA 2EGEA 4AFSC 2OI3A 2RN8A 4WCIA 1AWWA 2KRSA 4Z89A 2KYMA 2EW3A 1ZUYA 2L0AA 1K0XA 3NHNA 1PRMC 1BK2A 1M3AA 4AG2C 4J9FA 2OAWA 4CC3A 1EFNA 2YUQA 3VS0A 1JXOA 1VYTA 2EYXA 3H0FA 2JW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PZ1 A;  2HCK A;  4LN2 A;  2O9S A;  4LUD A;  2RNA A;  5IXB A;  1UDL A;  2O31 A;  3M0U A;  1OEB A;  2PNI A;  2DRK A;  2CSI A;  1SSH A;  3EHQ A;  1NLO C;  1B3Q A;  2LX7 A;  1T0J A;  3KFV A;  3M0P A;  2YUO A;  1Z9Q A;  1GBR A;  3VS3 A;  5GJW B;  1WLP B;  1GRI A;  2LMJ A;  2DLP A;  1HD3 A;  1GFC A;  2LJ1 A;  2GQI A;  1UTI A;  1W70 A;  4RTV A;  5FWB A;  3I5R A;  2ABL A;  2YT6 A;  4AFQ C;  3EG3 A;  2A08 A;  2MCN A;  1PRL C;  1W1F A;  1AWX A;  1JXM A;  2FRW A;  2DJQ A;  1UJY A;  3SEM A;  1BBZ A;  1TUD A;  1IO6 A;  2CT3 A;  3VS7 A;  2DBM A;  1V1C A;  3THK A;  1QLY A;  1VYU A;  3A98 A;  2CRE A;  1YCS B;  1PWT A;  2A37 A;  2OJ2 A;  1GCQ A;  2CSQ A;  4J9H A;  1UHC A;  4ORZ A;  2RF0 A;  1M27 C;  2FPD A;  3TSZ A;  2KXD A;  4J9I A;  3RNJ A;  3VS4 A;  2JTE A;  1TG0 A;  1GBQ A;  3R6N A;  5IHI A;  1PKT A;  2DE0 X;  1JU5 C;  1ZX6 A;  4ESR A;  1HJD A;  2ECZ A;  1T0H A;  1FMK A;  1U3O A;  2LNH B;  1NYF A;  2ED0 A;  3EG0 A;  2DL4 A;  4QT7 A;  1ABQ A;  1OPL A;  2RQW A;  3VS1 A;  2D8J A;  1UE9 A;  1ZUK A;  1I1J A;  4AFZ C;  2AZV A;  1GCP A;  2EGC A;  3GBQ A;  3M0T A;  1GL5 A;  2J6O A;  1KFZ A;  2BZX A;  2LCS A;  2DYB A;  1UG1 A;  1AVZ C;  2JS0 A;  1AWO A;  1CKB A;  4GBQ A;  2K79 A;  3VS2 A;  5I22 A;  4JJB A;  1I07 A;  2C0T A;  2DX1 A;  1T3S A;  1G83 A;  2DA9 A;  1M3C A;  1MV0 B;  1UUE A;  2LQN A;  4JJC A;  1KJW A;  1ARK A;  1QCF A;  2DVJ A;  1UHF A;  3VRZ A;  2J7I A;  2KNB B;  3QWX X;  2ED1 A;  1X69 A;  5EC7 A;  5IH2 A;  2GNC A;  4LUE A;  1E6G A;  4CC4 B;  1JQQ A;  1B07 A;  1WIE A;  2FPF A;  4CC7 A;  1Y0M A;  2JM8 A;  2QDL A;  1OOT A;  1BU1 A;  1NM7 A;  2DM1 A;  2V1R A;  1RLP C;  2K2M A;  4HVU A;  1ABO A;  1SRM A;  2EGA A;  1RUW A;  2X3W D;  2HEQ A;  2GGR A;  2GBQ A;  4JZ3 A;  4E6R A;  1E6H A;  3EG2 A;  4OMP A;  1KIK A;  2X3X D;  2C0I A;  1WXB A;  2I0N A;  2FG0 A;  4JPB W;  2SRC A;  1NYG A;  1X2Q A;  2M0Y A;  3VS6 A;  2KYB A;  5HCK A;  1TUC A;  3IQL A;  4OMM A;  4J9C A;  5IHN A;  1QWF A;  1H3H A;  2KT1 A;  1KSW A;  2KBT A;  2KXC A;  2LQW A;  2KR3 A;  1XOV A;  1X43 A;  4JJD A;  3UA7 A;  2JMC A;  2L3Q A;  2F2X A;  1VYV A;  1H92 A;  4F16 A;  4LNP A;  3NMZ C;  2LJ0 A;  2RQT A;  4FSS A;  3SHW A;  5L23 A;  3EHR A;  2M51 A;  2RQV A;  2JS2 A;  2KRM A;  4IIO A;  4OMO A;  2EKH A;  1VA7 A;  1NG2 A;  2XMF A;  4J9B A;  2DBK A;  1U5S A;  3TVT A;  2KRN A;  2YUP A;  2L3S A;  1WDX A;  1E7O A;  1YWP A;  1UJ0 A;  4AFU C;  2ROT A;  4EIK A;  2KGT A;  4RTX A;  2FPE A;  2AKK A;  3NPF A;  3H41 A;  1PNJ A;  4M4Z A;  3I5S A;  2NWM A;  2JXB A;  5FW9 A;  2YSQ A;  1CSK A;  3JV3 A;  2EQI A;  2W10 A;  3H0I A;  4OMQ A;  1PHT A;  3EGU A;  1K1Z A;  2DL5 A;  2RQU A;  1BB9 A;  5GJV B;  2W0Z A;  2CDT A;  3H0H A;  4HVW A;  3I9Q A;  4RUG A;  1PKS A;  2EBP A;  2DMO A;  1J3T A;  3REB B;  3M0S A;  4ZNX A;  3VS5 A;  4HVV A;  4DEX A;  3M0Q A;  3QWY A;  2K9G A;  1N5Z A;  3UAT A;  1AD5 A;  1ZSG A;  4GLM A;  2K3B A;  4DEY A;  1W6X A;  2F2V A;  1AZG B;  2O88 A;  2ESW A;  1ZUU A;  1A0N B;  3PE0 A;  2RPN A;  5ECA A;  2DIL A;  1AZE A;  4AG1 C;  2E5K A;  1Z9Z A;  2YUN A;  4IIM A;  4HXJ A;  3CQT A;  3RBB B;  2O9V A;  1H8K A;  2DL3 A;  3O5Z A;  1UFF A;  2F2W A;  4OMN A;  2VKN A;  4X1V A;  2MIO A;  1SHG A;  1FYN A;  4J9E A;  1M3B A;  1UEC A;  1GCQ C;  1QKW A;  3PVQ A;  2EPD A;  4J9D A;  1SPK A;  1HSQ A;  3REA B;  3LH5 A;  4F14 A;  2SEM A;  2D1X A;  2A36 A;  4F17 A;  1UGV A;  2J6K A;  2L3P A;  2PTK A;  2AK5 A;  4J9G A;  2KEA A;  2IIM A;  1RI9 A;  2L2P A;  2DL7 A;  1MUZ A;  1YP5 A;  1CKA A;  1M8M A;  2G6F X;  2LJ3 A;  1T3L A;  2DRM A;  3C0C A;  1Y57 A;  1X6G A;  4HCK A;  2EYW A;  2GTO A;  1OPK A;  2CUB A;  1I0C A;  1S1N A;  4RTY A;  1AOJ A;  3TSW A;  2CT4 A;  2P4R A;  1YWO A;  3U23 A;  2LZ6 B;  2NUZ A;  2YDL A;  1LCK A;  1NLP C;  4A63 B;  2FRY A;  1YN8 A;  2KE9 A;  2BZY A;  2HDA A;  2C0O A;  1M30 A;  1K76 A;  2FO0 A;  2RMO A;  2HBW A;  4CC2 A;  1WI7 A;  1K4U S;  1YNZ A;  4RTU A;  1X6B A;  2HSP A;  2J06 A;  2EYY A;  1JO8 A;  1SRL A;  1U06 A;  2ENM A;  1NEB A;  2D8H A;  2FEI A;  2GTJ A;  1RLQ C;  1QKX A;  2BTT A;  1WX6 A;  2EVR A;  1X2K A;  4OML A;  2J05 A;  1AWJ A;  2EYZ A;  4Z88 A;  2AKL A;  2VVK A;  5IXF A;  4Y92 A;  1WXT A;  4RTZ A;  1ZBJ A;  1JEG A;  3UA6 A;  1NEG A;  2CH4 W;  1QWE A;  2D0N A;  1G2B A;  2CH4 A;  1WFW A;  3NGP A;  3UF4 A;  2J6F A;  2ROL A;  2B86 A;  2K6D A;  4KRT A;  2AZS A;  2JT4 A;  1WYX A;  3FJ5 A;  2KT8 A;  4JZ4 A;  2RQR A;  3VRY A;  4D8D A;  4R0K A;  2BZ8 A;  1X27 A;  2DL8 A;  2DNU A;  2CUD A;  2K7A A;  2DF6 A;  1WA7 A;  3M0R A;  2VWF A;  2JM9 A;  1WXU A;  1K9A A;  5IHK A;  3I35 A;  3EG1 A;  1MV3 A;  4RTT A;  3ULR B;  2LP5 A;  1K0S A;  2MOX A;  2A28 A;  2V1Q A;  2KRO A;  4LE9 A;  3PVL A;  4RTW A;  5I11 A;  1SHF A;  2H8H A;  1GFD A;  4Z8A A;  4D8K A;  1AEY A;  1SEM A;  2O2O A;  1ZLM A;  1OV3 A;  3ZL7 C;  4K11 A;  5FWC A;  2JMA A;  2EGE A;  4AFS C;  2OI3 A;  2RN8 A;  4WCI A;  1AWW A;  2KRS A;  4Z89 A;  2KYM A;  2EW3 A;  1ZUY A;  2L0A A;  1K0X A;  3NHN A;  1PRM C;  1BK2 A;  1M3A A;  4AG2 C;  4J9F A;  2OAW A;  4CC3 A;  1EFN A;  2YUQ A;  3VS0 A;  1JXO A;  1VYT A;  2EYX A;  3H0F A;  2JW4 A; 
#chains in the Genus database with same CATH topology
 3JCM P;  3RKW A;  1BI1 A;  2YWW A;  3CCQ T;  4FW1 A;  4GY5 A;  3SWN B;  1QVG S;  3CBO A;  4CI0 C;  1VQ5 Q;  4M75 E;  3RMS A;  2EJF A;  2XG8 D;  3MP6 A;  1B34 B;  2FL7 A;  2PNI A;  3RMQ A;  3CCU T;  3V8J A;  2DRK A;  3EHQ A;  1NLO C;  2LX7 A;  5HKC A;  4M78 F;  2YUO A;  3X20 B;  3G6E T;  3A8O B;  1GBR A;  3VS3 A;  5GAN h;  2LMJ A;  4ZGD B;  4C8Q B;  2OTJ Q;  4YTL A;  1RL2 A;  4FYW B;  3LW5 E;  2LTO A;  1G8X A;  1SKU B;  2LJ1 A;  2GQI A;  4M7A C;  5GAN 2;  2ZPF B;  3OYB A;  1W70 A;  2CZ1 B;  3I5R A;  2YT6 A;  4J7F A;  1VQ4 T;  2MCN A;  1AWX A;  5EG2 A;  2FRW A;  1VQ5 T;  1N8R U;  4MZT A;  5LJ5 h;  3QO3 A;  3OYG A;  1YJW Q;  2X4X A;  3V8L A;  1BBZ A;  1VQL Q;  1IO6 A;  3JCM c;  5CKB A;  5CKH A;  2CRE A;  4QW2 A;  2OJ2 A;  3HRU A;  1GCQ A;  2ZPG B;  4Q5W A;  1MHN A;  4J9H A;  4PFP A;  3BFM A;  4QVZ A;  1Y96 A;  3EGX B;  1YIT Q;  3OYD A;  2D6F A;  2DTO A;  1KG1 A;  1K9M U;  5FRO A;  1HJD A;  1QP2 A;  1UB4 A;  2E64 A;  3S3O A;  2VUB A;  1FMK A;  1U3O A;  2JNG A;  2RK2 A;  1ABQ A;  4JRP A;  2QXF A;  2XK0 A;  4A4G A;  4RMO A;  4HCZ A;  5GAN e;  3KBG A;  2AZV A;  1GCP A;  2H3J A;  1GL5 A;  1XNI A;  1VQ9 T;  4NL2 A;  3JB9 D;  1MMA A;  4DA4 A;  1SF9 A;  1AWO A;  1YHQ T;  1Q86 U;  3MEW A;  1PD1 A;  1EIF A;  4JJB A;  3PT9 A;  3OYM A;  3MP1 A;  1KC8 C;  4JJC A;  3X25 B;  2HZY A;  3H6Z A;  1ARK A;  1QCF A;  2DVJ A;  1QMC A;  1Q81 R;  1JRI A;  5KE2 A;  3OYL A;  3LWI A;  3PTA A;  1RAA B;  1KC8 R;  1ZA1 B;  1QCN A;  3MEU A;  2XU8 A;  2EKO A;  1Y0M A;  3FEO A;  5CR2 A;  2QDL A;  1RLP C;  4A4K A;  3Q1J A;  5GAO p;  2HEQ A;  1E6H A;  3EG2 A;  2X3X D;  4E47 A;  2FG0 A;  3FDR A;  4JPB W;  1PSE A;  1VQM T;  2LQ8 A;  4IUV A;  3TRE A;  2E3H A;  4OMM A;  4M78 B;  1KSW A;  2KXC A;  4JJD A;  1ZSZ A;  2R57 A;  2LT4 A;  4F16 A;  4A4E A;  1Q82 R;  2EJ9 A;  4FSS A;  5GAN d;  3EHR A;  1M90 R;  2V8J A;  3D7S B;  4LDU A;  2KVQ G;  2EKH A;  2XMF A;  4J9B A;  2DBK A;  3JCM g;  3WVE B;  4PJO D;  2YUP A;  2L3S A;  3ZBD A;  5AYF A;  1WDX A;  3PMT A;  1YWP A;  5GAN 6;  1UJ0 A;  2ROT A;  4MML A;  1VQN Q;  2KGT A;  1Y96 B;  1RAF B;  2L89 A;  5DY9 A;  4MDW A;  1PNJ A;  3OS1 A;  4OB1 B;  4Z02 A;  2JXB A;  3CCL T;  1CSK A;  3EFS A;  3EGU A;  1X01 A;  3QXE B;  3VJP A;  1BB9 A;  2RHX A;  4BY6 C;  2QAZ A;  3H0H A;  2ZPE B;  1TS9 A;  2HQH A;  2EBP A;  4EMH A;  4ELZ C;  2HSE B;  3REB B;  3M0S A;  2ZPB B;  4A54 A;  3OA6 A;  2XHC A;  3EFO B;  4DEX A;  3QWY A;  2K9G A;  2PVG B;  3JCM b;  4PJN A;  3CC4 T;  4GLM A;  3V7S A;  3C12 A;  2GQV A;  5DM7 R;  1W6X A;  2DIQ A;  2F2V A;  3MO8 A;  1AZG B;  2O88 A;  2ESW A;  4M75 A;  3PE0 A;  2RPN A;  1D0Z A;  3OBW A;  1AZE A;  3L2W A;  3RIR A;  1Z9Z A;  3CMA Q;  1HXD A;  2E3I A;  1FMW A;  3CQT A;  1Q86 C;  4HCC A;  3RBB B;  4OMF B;  2O9V A;  1K8A U;  3CC2 Q;  4LDV A;  3CMA T;  4KGZ B;  2RHZ A;  5FRN A;  3QZ5 B;  4ZGJ B;  2VKN A;  4C8Q A;  4JLG A;  3O8V A;  3SWN A;  2YRD A;  1FYN A;  4QQD A;  1B34 A;  2EPD A;  3PVQ A;  4DBQ A;  4J9D A;  1XQH A;  1HSQ A;  2A36 A;  2K4Y A;  1UGV A;  3TQ7 P;  2J6K A;  3LYI A;  1OX8 A;  4J9G A;  2KEA A;  1Y71 A;  2DL7 A;  4C0Z A;  3C0C A;  4PJO F;  1Y57 A;  1X6G A;  1OPK A;  5CCA A;  1S1N A;  4IUT A;  5KYY B;  1UGP B;  1Q81 U;  3E9G A;  1VQM A;  3QJY A;  2LZ6 B;  1LCK A;  1K8A C;  1SSF A;  3CCV Q;  7AT1 B;  4OB2 B;  4OB0 B;  5D7U A;  1YN8 A;  2HDA A;  2LCC A;  3JCM W;  2HBW A;  3R6O A;  4BD3 A;  4EDU A;  4CC2 A;  3JCM J;  4RTU A;  5GAO m;  3ER0 A;  1D0X A;  3CPW P;  1VUB A;  1Q7Y R;  1MMD A;  2Z0W A;  3DKM A;  2GTJ A;  1RLQ C;  4A4F A;  1KHC A;  2DXC A;  3CMA A;  2NUP A;  3E9F A;  1BIB A;  1X2K A;  3NTH A;  5IXF A;  4Y92 A;  4E7S A;  3RDV A;  4J7I A;  3OW2 P;  2PQW A;  1JEG A;  2OTL T;  1NEG A;  2CH4 W;  3JCM d;  2CH4 A;  2ZGW A;  1WFW A;  4XU2 A;  2K6D A;  4C92 A;  1G3W A;  3MPU B;  5I2S A;  1IRE B;  5KYX A;  4JZ4 A;  3VRY A;  2L8D A;  1YJN Q;  1LOJ A;  3NTK A;  2DKG A;  2MWP A;  4LD9 K;  2K2V A;  1IHV A;  4FU6 A;  4MDX A;  1VQP Q;  3OYA A;  3QDR B;  2E1H A;  1WA7 A;  1VQ9 A;  2VWF A;  3GIB A;  2M9U A;  4FYV B;  1WXU A;  3X26 B;  1WHH A;  4JRQ A;  1M1F A;  1MV3 A;  2P0P A;  4C8Q F;  3ULR B;  2LP5 A;  2PUK B;  3JB9 H;  3CCM Q;  2LVM A;  1WHL A;  5HK3 A;  1AT1 B;  1IRX A;  4HA8 A;  3PVL A;  3C95 A;  4E7K A;  4OGE A;  2VB6 A;  5KYW A;  1SEM A;  2XID A;  5A0G A;  3MP8 A;  4QVD A;  1OV3 A;  4RCB A;  2EIF A;  3HFN A;  1IHW A;  1IXD A;  2OI3 A;  3CCS T;  2QTX A;  2X35 A;  2B8A A;  2DEQ A;  1TU0 B;  1ZUY A;  4JJN K;  3EGD B;  2L5Q A;  1BK2 A;  2COW A;  3SB2 A;  4AG2 C;  2QYZ A;  1VQ6 Q;  1VQ4 A;  4II1 A;  3DB4 A;  5KYN A;  2OAW A;  5CKE A;  1YIT A;  3QBY A;  3CXC S;  2CP6 A;  1NPP A;  2M1H A;  2LT1 A;  5GAO l;  1Y07 A;  1M1K U;  4JRI A;  2PZ1 A;  1PM3 A;  1YJW A;  1RAD B;  2O9S A;  2BUD A;  5IXB A;  4C92 G;  3VKI A;  2FHD A;  3M0U A;  3QKJ A;  1VQ6 T;  3AT1 B;  3CXC P;  3KFV A;  2OTL A;  2FZC B;  2CKK A;  1D3B B;  1GRI A;  3G71 A;  2DLP A;  1LJO A;  4ZTJ A;  3QDF A;  3G6E A;  3CCJ T;  1WQ7 A;  2OX7 A;  4BE1 A;  3S3N A;  1M2V B;  2BIV A;  2FB7 A;  1PSF A;  4RTV A;  5GAM f;  2KY9 A;  1PRL C;  2DPP B;  1JXM A;  4PJM A;  1MGQ A;  2JTF A;  3L2Z A;  1QVP A;  1UJY A;  1Q86 R;  1NZ9 A;  2IG0 A;  1TUD A;  4J6X A;  1V1C A;  1M90 U;  2RI2 A;  1QLY A;  4B9X A;  1D3B A;  1VYU A;  2EQU A;  1YCS B;  3BY7 A;  2QQA A;  2DIG A;  1I5O B;  3QUI A;  2KQW A;  1G5V A;  2XDP A;  3V7C A;  4C8Q G;  2A7Y A;  1VQK T;  4N4H A;  1M2O A;  4ORZ A;  3JB9 F;  3GLX A;  4DOW A;  1LVK A;  2OTJ T;  4M75 D;  4M7D E;  2M02 A;  2OTL Q;  1TG0 A;  3PNW C;  4MZM A;  1GBQ A;  3NFC A;  1OZ2 A;  1PKT A;  2DE0 X;  1ZX6 A;  1BYM A;  3MEA A;  1PCX A;  2ECZ A;  2EJG A;  4JDS A;  2GFU A;  1VQO T;  3EG0 A;  3CC4 A;  2DL4 A;  4QKU A;  1OPL A;  4Y28 E;  2RQW A;  3CCM T;  4DBR A;  5J26 A;  1YJW T;  2KK4 A;  3LGF A;  3HP9 A;  1UE9 A;  3OYJ A;  1X75 C;  4AFZ C;  2EGC A;  2ZCF B;  1D1A A;  5GAN 4;  2QDY B;  3JCM f;  2LCS A;  4MMK A;  2QI2 A;  5CQY A;  1UEB A;  2AIR B;  2QQB A;  3CPW S;  3M55 A;  1RAC B;  4NS5 A;  2MAM A;  4DOV A;  2DX1 A;  5GAN j;  1TOV A;  2DZC A;  2DA9 A;  4C0F A;  1G3T A;  1MV0 B;  3CCR Q;  3JCM h;  3UPU A;  1KJW A;  5KYX B;  1Q82 C;  3LH0 A;  2VXF A;  1QVG A;  2JZ2 A;  2LC4 A;  2J7I A;  2O4X A;  2ED1 A;  4OVA A;  3MEV A;  2HL5 C;  5J3B A;  4CC4 B;  1IB8 A;  2LNV A;  2LQK A;  1VQ8 Q;  2A3L A;  1M8V A;  2RJD A;  3CCE T;  1OOT A;  5GAM h;  1BU1 A;  4M75 G;  2V1R A;  2K2M A;  2HKQ B;  2EGA A;  3CEY A;  2MMP A;  4MZP A;  3E19 A;  4PJL A;  2QA4 Q;  1WXB A;  4FSX A;  1X2Q A;  4XK8 E;  1YI2 T;  3BW1 A;  2LRQ A;  1JJ2 P;  1TUC A;  3IQL A;  1RI0 A;  3M57 A;  1QVF P;  4C5I A;  1NPR A;  4J83 A;  3LGL A;  2LDM A;  1U1S A;  2KBT A;  2KT1 A;  2V8I A;  1X43 A;  1K73 U;  1BIA A;  2JMC A;  3OYF A;  2F2X A;  1VYV A;  2R58 A;  1YIJ Q;  1NJI U;  3MKD A;  2VGN A;  3TCJ A;  3WXM B;  4LNP A;  3NMZ C;  4PJO G;  5CQX A;  1MNE A;  3QYH B;  5L23 A;  2X4J A;  2F1L A;  3OMG A;  4OMO A;  3OY9 A;  4AMC A;  4DBF A;  1NJI C;  1JJ2 A;  1NG2 A;  1VQK Q;  3VU3 C;  1U5S A;  2E5Q A;  5LJ3 e;  1X6O A;  4RG2 A;  4C0D C;  3LWH A;  4B6M A;  4X9D A;  4PLL A;  4RTX A;  2AKK A;  3CCL Q;  3H41 A;  1D1B A;  3JCM X;  4HT8 A;  2O01 E;  3QII A;  3JRZ A;  4C8Q E;  4OMQ A;  1WHM A;  3PIO A;  3RES A;  4Y91 A;  2RQU A;  1VQO Q;  2LX9 A;  2P84 A;  4PJO B;  2DMO A;  3OSV A;  2RM4 A;  1YIJ A;  3M0Q A;  3UAT A;  4M77 B;  2OTJ A;  3JCM Q;  4M75 B;  2Y4Y A;  3UDC A;  3JB9 J;  5L8R E;  4R56 A;  3I56 Q;  3WVD B;  2K5F A;  2GFA A;  2K3Y A;  2XKO C;  4QQG A;  2K5I A;  3GPL A;  4UC4 A;  4AG1 C;  1EZZ B;  3G7Z A;  2PVO B;  3RKY A;  4M7A F;  1VQM Q;  4EPC A;  2LCL A;  2F5K A;  3FB9 A;  5LL6 S;  2VXE A;  1UFF A;  2L3R A;  3FC3 A;  4OMN A;  4C92 F;  3A8M B;  4M77 A;  2KDS A;  4X1V A;  2YLB A;  2MIO A;  4DQ2 A;  1BI3 A;  3CPF A;  3HKS A;  1HK9 A;  1NJI R;  1D1C A;  2DTI A;  2MWO A;  4J9E A;  4XTY A;  1UEC A;  4FCY A;  1QP3 A;  5IN1 A;  3JAM E;  3CCS A;  1SPK A;  2SEM A;  3PGG A;  4L5G A;  1N27 A;  2D1X A;  4FW2 A;  2CZ0 B;  2L3P A;  2NLU A;  2PTK A;  2L2P A;  3OYK A;  2KMT A;  4M75 F;  1MUZ A;  3CME Q;  2DRM A;  2EYW A;  4JLI A;  2CUB A;  1I0C A;  2QA4 A;  2DER A;  5D6Y A;  1YWO A;  3U23 A;  4XQ3 A;  2RK1 A;  3LX7 A;  4A63 B;  2DD4 A;  5GAN 5;  1MMN A;  1YBY A;  2Y90 A;  4L59 A;  3I56 T;  1K4U S;  1B7T A;  1WI7 A;  4PLI A;  1YNZ A;  4XTU A;  2HSP A;  2J06 A;  3OS5 A;  4C92 E;  2EYY A;  1D0Y A;  1ZSZ B;  4FT2 A;  2ENM A;  4IUU A;  1NEB A;  2D8H A;  2QQS A;  1M90 C;  2XDB A;  2EVR A;  5GAM d;  2P4T A;  1DJ7 B;  2J05 A;  1AWJ A;  2EYZ A;  3G1J A;  2DZ9 A;  1N9R A;  3QJ6 A;  4X34 A;  1YCY A;  3JCM V;  1C6V X;  5CIU A;  3UA6 A;  1QWE A;  1TSF A;  1QW1 A;  4M77 G;  2JT4 A;  3OYE A;  1OYX A;  3FJ5 A;  2KT8 A;  4KGV B;  5CK9 A;  3CCJ A;  3CCM A;  5LJ5 e;  2X4W A;  5DLO A;  3L42 A;  2DNU A;  2CUD A;  1KHI A;  2K7A A;  1VQL T;  3M0R A;  2JM9 A;  2VAS A;  5GMK i;  1NE8 A;  3EG1 A;  4RTT A;  3BE3 A;  3CBM A;  5LJ3 h;  2KRO A;  4C0G A;  3CCL A;  1QVF S;  1UGQ B;  5I11 A;  1K73 C;  4JS4 A;  1ZHI A;  3OW2 A;  4J6W A;  1ZLM A;  1RAG B;  5GMK j;  5LJ5 g;  2YRV A;  5FU6 B;  2JMA A;  3TEE A;  2EGE A;  3VV0 A;  2D0Q B;  3QYG B;  1W2B P;  4AFS C;  4WCI A;  4WTO B;  1BCM A;  1WHG A;  2KRS A;  2L0A A;  1WHK A;  3NHN A;  2KI7 A;  3OYH A;  1TH7 A;  1YFN A;  2JUF A;  3A8L B;  4M77 D;  3SFM A;  3EGX A;  3RR6 A;  4C5G A;  4RKU E;  2MK5 A;  1JXO A;  4KBM B;  1K8A R;  2XIC A;  1VYT A;  2EYX A;  3H0F A;  2JW4 A;  3ZFJ A;  2HCK A;  5KCH A;  4LUD A;  2OAU A;  3J80 E;  1MMG A;  2H3E B;  2RNA A;  2E10 A;  3L2U A;  1UDL A;  2FYK A;  2O31 A;  4E7H A;  4M7A E;  1VOM A;  1OEB A;  2QGF B;  4BI4 A;  1EX4 A;  3UWN A;  2E6Z A;  4BI8 B;  2YRC A;  5GJW B;  1WLP B;  3T9N A;  2CS7 A;  3OSS C;  4V2S A;  1M2V A;  3G4S A;  5C0M A;  2G3R A;  2QEX T;  4E7J A;  2DVE A;  1ACM B;  3JCM e;  1UTI A;  2PUO B;  5FWB A;  5GAN 8;  1VQL A;  2ABL A;  5FU7 C;  3EG3 A;  2A08 A;  1W1F A;  1VQ7 T;  5GAN g;  3EH2 A;  4LXC A;  1YI2 Q;  1VQ5 A;  2E65 A;  4O6J A;  4J8O A;  1JB0 E;  1TUG B;  2CT3 A;  2DBM A;  1IGU A;  3BDL A;  4IUP A;  1VQ8 A;  3KXT A;  3RER A;  1N9S A;  1FX7 A;  2FVU A;  1N8R R;  4FL6 A;  1UHC A;  4LDY A;  2RF0 A;  1H64 1;  1LNX A;  3CC4 Q;  2KXD A;  3RNJ A;  3QHS A;  1FMV A;  4J6Y A;  4M78 D;  3CD6 Q;  1JU5 C;  3EGD A;  3CC2 A;  4M7D C;  3SD4 A;  1T0H A;  2WAC A;  3HFO A;  3OQ5 A;  2DK3 A;  4M77 E;  4AT1 B;  1YJN A;  2ED0 A;  2K5L A;  4C92 C;  4EMK B;  3VS1 A;  2D8J A;  2WSE E;  1YJ9 A;  3MCA B;  1ZUK A;  4PJO E;  1I1J A;  3J7A F;  5J39 A;  3GBQ A;  1KFZ A;  2QQR A;  2BZX A;  1Y7X A;  3CCR A;  1UG1 A;  1AVZ C;  5KH6 A;  2JS0 A;  2RB6 A;  3E2U A;  3CCJ Q;  4PL6 A;  2K79 A;  4BUG A;  2NUT B;  5KYW B;  1I07 A;  1W2B S;  1T3S A;  4BE2 A;  5HK0 A;  2LQN A;  3A1P A;  2DXB A;  1R0B G;  2HKN A;  3VRZ A;  2MI6 A;  5IH2 A;  5EC7 A;  3HTR A;  2GNC A;  1NBE B;  1E6G A;  1XJW B;  3VUZ A;  4CC7 A;  2ZAE A;  2QGG A;  2NUP B;  4KH0 B;  2RJC A;  1I81 A;  2DM1 A;  1K9M R;  4HVU A;  2E6N A;  1YHQ Q;  1RUW A;  2X3W D;  3M54 A;  2GGR A;  3OYC A;  5FRM A;  1KIK A;  1RAE B;  1VQ9 Q;  2DEU A;  2EWN A;  2Y4X A;  2SRC A;  1NYG A;  2M0Y A;  1W4S A;  4HKE A;  5HCK A;  2CP0 A;  5IHN A;  1H3H A;  2LQW A;  3HHT B;  2KR3 A;  1XOV A;  3UA7 A;  1VQK A;  4HT9 A;  1YIJ T;  4E7L A;  4JRK A;  1H92 A;  4CRI A;  5KYY A;  1KQ2 A;  3CCE A;  4XAX B;  1OQK A;  2LJ0 A;  3PMI A;  1M5Q 1;  3JB9 G;  3RKX A;  2RQT A;  1VQP A;  3SHW A;  1YIT T;  3FLG A;  2M51 A;  2JS2 A;  4IIO A;  3VUB A;  1Q95 G;  2YHT A;  1VA7 A;  2ATC B;  4M7D F;  3M56 A;  4M7D D;  4XU0 A;  3TVT A;  5KYU A;  1OU9 A;  3FJP A;  1KQS P;  3I55 T;  3QPH A;  4AFU C;  1BI2 A;  2DJZ A;  3LLR A;  1BKB A;  4P5N A;  4C92 D;  2JJ9 A;  1KQ1 A;  2FPE A;  4M78 G;  4M4Z A;  2NWM A;  2ZPI B;  4N0A C;  4M77 F;  3CC7 T;  1OX9 A;  3CXC A;  1S72 T;  2EQI A;  3M58 A;  4ELY C;  1K1Z A;  5GJV B;  3DB3 A;  2GF7 A;  2CDT A;  3OS2 A;  4HVW A;  1VQ6 A;  1KQS A;  4LDX A;  4C0D B;  1PKS A;  1J3T A;  2V8K A;  2WSF E;  5GAM g;  4ZNX A;  4LDW A;  2A0F B;  3SWN C;  2RJF A;  3EFR A;  1ZSG A;  3OYN A;  2GCX A;  4DEY A;  1M1G A;  3L2R A;  1P92 A;  1A0N B;  4M7D B;  3CD6 A;  2E5K A;  4IIM A;  4WF2 A;  4E7I A;  1RAH B;  4OF1 A;  3GNG A;  2E41 A;  4XTW A;  1XTD A;  2XD0 A;  1AHJ B;  5C6S A;  3G71 Q;  2COY A;  2RHU A;  1Q82 U;  5D6X A;  3EFO A;  4FT4 A;  1KQS S;  1SG5 A;  1TTH B;  3X24 B;  2AT1 B;  5M9O A;  1H3Z A;  2JVV A;  3CBP A;  1GCQ C;  3DLM A;  4PFZ A;  2EAY A;  3MHX A;  2EFI A;  3REA B;  3LH5 A;  4F14 A;  3OB9 A;  3QZ9 B;  2RI5 A;  2NYS A;  2CP2 A;  2IIM A;  1RI9 A;  5CVI A;  4XTV A;  1LPL A;  1YP5 A;  1M8M A;  1T3L A;  8AT1 B;  2RO0 A;  1QCO A;  3P8D A;  3EG9 A;  4PNO A;  1O9S A;  2GTO A;  5A2Q E;  4FYY B;  1AOJ A;  1M1K C;  3FRN A;  2CT4 A;  2P4R A;  1OZ3 A;  1NLP C;  4QQ6 A;  2C06 A;  1I8F A;  1VQN T;  2HAX A;  2F5T X;  1MND A;  4A4H A;  1K76 A;  2RMO A;  4HCB A;  3JSC A;  6AT1 B;  1G3Y A;  1X6B A;  4EMG A;  4D6W A;  3QSU A;  3NTI A;  3CPW A;  2KSS A;  2JTM A;  1VQ8 T;  1WJQ A;  2FEI A;  4NOY A;  2RHY A;  1I5L A;  4QVC A;  4C8Q C;  2BTT A;  1WX6 A;  4KUI A;  4Z88 A;  1VIF A;  5A0L A;  2VVK A;  2DD5 A;  1K73 R;  1WJS A;  1ZBJ A;  5KE3 A;  3GNF B;  2D0N A;  2DAQ A;  1WPY A;  2DFU A;  4KRT A;  1M4Z A;  1UGR B;  3CCV A;  4XTZ A;  4D8D A;  4R0K A;  1X27 A;  4IUR A;  2QTV A;  3H9N A;  5GAN 7;  4BB7 A;  3CC2 T;  1WQW A;  1K9A A;  5IHK A;  2ZZD A;  1M1K R;  2MOX A;  2A28 A;  1BCO A;  2V1Q A;  4LE9 A;  2KAF A;  4KH1 B;  3VYG A;  4RTW A;  1KD1 R;  2H8H A;  3CC7 A;  1AEY A;  4LD6 A;  5GAM e;  5FU6 C;  3L1A A;  5FWC A;  3EG9 B;  2E4H A;  2RD1 A;  2HMA A;  2RN8 A;  1F1B B;  5AT1 B;  3I55 A;  1AWW A;  4A53 A;  2EW3 A;  2CP3 A;  1K0X A;  1PRM C;  1M3A A;  1YJ9 Q;  4IUQ A;  1G3S A;  1IGQ A;  1PC0 A;  3M59 A;  5GMK e;  1FWZ A;  4M75 C;  2RJE A;  2YUQ A;  4XTX A;  5GMK h;  2RHI A;  4M77 C;  4LN2 A;  2FZK B;  4JS5 A;  2I2L A;  3CME T;  4ZTF A;  2RA2 A;  1W2B A;  5LJ5 j;  2CSI A;  1SSH A;  1B3Q A;  3OBY A;  1T0J A;  3M0P A;  1Z9Q A;  1WNL A;  4M7D A;  5GAN 3;  3HRS A;  5I2M A;  4M7A D;  3C94 A;  5LJ3 d;  2AHJ B;  4C5E A;  5HY6 A;  1HD3 A;  1GFC A;  5FLX E;  2CZ6 B;  4VUB A;  1N8R C;  4NL3 A;  2CGH A;  2P0K A;  3UT1 A;  2K57 A;  3N5B B;  3DLL A;  5CKF A;  3M4G A;  4AFQ C;  2P0Q A;  1RAI B;  4ZGE B;  4RCC A;  1U8R A;  4PJO A;  2DJQ A;  5GAO r;  1WZO A;  3SEM A;  5IAY A;  3PIP A;  1TWB A;  4O5V A;  3GF5 A;  3VS7 A;  2VGM A;  1VQP T;  4E2F B;  3THK A;  3A98 A;  1PWT A;  5I21 A;  3ASK A;  2A37 A;  2HQE A;  1YJ9 T;  1BI0 A;  2CSQ A;  3E1S A;  2CYZ B;  3HPW A;  1M27 C;  2FPD A;  3TSZ A;  4J9I A;  3RUX A;  3VS4 A;  3CCS Q;  2JTE A;  3ZEH A;  3C4S A;  5KYU B;  3R6N A;  3G6E Q;  5IHI A;  1V76 A;  4M7D G;  1KK7 A;  4ESR A;  2RH2 A;  2BE9 B;  3M4Y A;  3CME A;  1FXX A;  4KUL A;  2LNH B;  1NYF A;  3HSB A;  4QT7 A;  1ZA2 B;  3G71 T;  3SDZ A;  1PD0 A;  3A5Z B;  4L6V 5;  2DET A;  2HL3 A;  2J6O A;  2DYB A;  2MF2 A;  4GLK A;  5GMK m;  1WJR A;  1C1A A;  1CKB A;  1RAB B;  5CKD A;  2M0O A;  4GBQ A;  4IKF A;  3VS2 A;  4C8Q D;  5I22 A;  2C0T A;  1C0M A;  2CP5 A;  1G83 A;  4JUV A;  4R55 A;  1M3C A;  4FYX B;  1UUE A;  3OMC A;  4M78 A;  4ZN1 A;  1UHF A;  1I4K 1;  2EYQ A;  1QVG P;  5A0D A;  3L2V A;  3FIF A;  2KNB B;  3QWX X;  4FM4 B;  1X69 A;  2K3X A;  3CCU Q;  4BAC A;  3OYY A;  4LUE A;  2D9T A;  1JQQ A;  1Q7Y C;  1B07 A;  5LJ5 f;  3V7R A;  1WIE A;  2FPF A;  1OUL A;  3CCR T;  4B9W A;  2JM8 A;  3GOX A;  3CC7 Q;  2DO3 A;  2WSC E;  3V8K A;  2O4X B;  4E7Z A;  1NM7 A;  2QA4 T;  1ABO A;  1SRM A;  3ME9 A;  4M78 E;  3I55 Q;  1WGS A;  4E6R A;  4JZ3 A;  1R0C B;  2PU9 B;  3A8H B;  4OMP A;  4ANJ A;  2NUT A;  2C0I A;  3URG A;  2EQM A;  2I0N A;  1ZQ1 A;  3CCE Q;  3VS6 A;  3OW2 S;  2KYB A;  4J9C A;  1QWF A;  4BI3 A;  1VQ4 Q;  4OP0 A;  4F04 B;  1VQO A;  2L3Q A;  3M9Q A;  2QEX Q;  4BDZ A;  3CCU A;  4KT0 E;  1Q7Y U;  5D6W A;  1TXQ A;  1WHJ A;  2RQV A;  2KRM A;  2PVD B;  3QG1 A;  3GP8 A;  2CP7 A;  2V26 A;  2IVW A;  1HYO A;  2KRN A;  1E7O A;  5GMK l;  4EIK A;  4BY6 B;  1S72 Q;  4N0A A;  3G4S Q;  1ZBX A;  2MPX C;  4EMK C;  3NPF A;  2QQ9 A;  4F7U F;  3I5S A;  5FW9 A;  2YSQ A;  3EAE A;  3JV3 A;  3H0I A;  2W10 A;  1PHT A;  3HL8 A;  2DL5 A;  2QG9 B;  5GAO n;  2W0Z A;  4ME7 A;  4M7A G;  2FZG B;  2DXU A;  2COZ A;  3I9Q A;  2ZPH B;  4PKC C;  4RUG A;  3M5A A;  1YI2 A;  4PJJ A;  1ZSZ C;  2HNI A;  3VS5 A;  4HVV A;  4M7A B;  1N5Z A;  2DXT A;  1AD5 A;  2JOY A;  1KC8 U;  5GAM j;  3CCQ A;  2K3B A;  2XDD A;  3H8Z A;  4KGX B;  4TVR A;  1ZUU A;  3MJX A;  3OS0 A;  4BDY A;  5ECA A;  2DIL A;  2MYS A;  3EH1 A;  2YUN A;  4HXJ A;  2CZ7 B;  4M78 C;  3I56 A;  5FU7 B;  1R8O B;  1H8K A;  2DL3 A;  4J5Y A;  5DLQ E;  5LJ3 f;  3O5Z A;  2F2W A;  3F70 A;  4M7A A;  8ATC B;  1SHG A;  1OU8 A;  2JN0 A;  2IPO B;  3KUF A;  1M3B A;  2EQJ A;  1JBM A;  1QKW A;  4DBH A;  1VQN A;  2YXY A;  3S6W A;  2VV5 A;  4F17 A;  1QQJ A;  4X9C A;  1N6A A;  2AK5 A;  2QEX A;  1KD1 U;  2E70 A;  5IT9 E;  2VC8 A;  2X9H A;  1YHQ A;  1CKA A;  2G6F X;  2LJ3 A;  3TU4 K;  4HCK A;  4ATO A;  4N4G A;  4RTY A;  3VYH B;  2R5A A;  2X4Y A;  3TSW A;  9ATC B;  4PK4 A;  1JJ2 S;  2R5M A;  1VQ7 Q;  2QK0 A;  3A8G B;  2NUZ A;  3L2Q A;  2YDL A;  2F69 A;  2FRY A;  2HBP A;  2KE9 A;  2BZY A;  1K9M C;  2C0O A;  1M30 A;  2VYT A;  4RG8 A;  5GAN f;  2FO0 A;  1YJN T;  1S72 A;  1D09 B;  1JO8 A;  1SRL A;  1U06 A;  1U1T A;  1IZ6 A;  1M9S A;  4PJO C;  2XI9 A;  1QKX A;  2YLC A;  4C92 B;  3OYI A;  3JB9 I;  4OML A;  1R77 A;  2AKL A;  4FIB A;  3CD6 T;  1KD1 C;  2BE7 D;  3X28 B;  1WXT A;  4RTZ A;  4BE0 A;  2EQK A;  4XU1 A;  1UGS B;  1G2B A;  4F7U A;  3MET A;  3NGP A;  3CCQ Q;  3UF4 A;  2J6F A;  2ROL A;  2B86 A;  3J81 E;  2AZS A;  1WYX A;  3G4S T;  2QAS A;  5LJ3 g;  2RQR A;  4F7U B;  1VQ7 A;  2BZ8 A;  2DL8 A;  1VIE A;  4OGC A;  4PFO A;  2HQX A;  3S3M A;  3P8H A;  2BKD N;  2E12 A;  1O75 A;  3CCV T;  2DF6 A;  5KCO A;  2X51 A;  3I35 A;  4XU3 A;  5LJ5 d;  2DYI A;  1GXI E;  4KUD K;  1K0S A;  3AHU A;  4F7U E;  3HRT A;  3PFS A;  5CAI A;  1SHF A;  2HD0 A;  1GFD A;  4Z8A A;  1OI1 A;  4D8K A;  2DTH A;  5LJ3 j;  2O2O A;  1Q81 C;  3ZL7 C;  3M53 A;  2M16 A;  4K11 A;  1QVF A;  4EMK A;  5GAO q;  4F7U G;  4Z89 A;  2KYM A;  4N4I A;  1PG5 B;  5CO7 A;  4J9F A;  2RI3 A;  1V29 B;  4C5H A;  4ZN3 A;  3INZ A;  4CC3 A;  3BDU A;  3P8B B;  1EFN A;  3VS0 A;  3M0T A;  2GBQ A;  4OB3 B; 
#chains in the Genus database with same CATH homology
 2PZ1 A;  2HCK A;  4LN2 A;  2O9S A;  4LUD A;  2RNA A;  5IXB A;  1UDL A;  2O31 A;  3M0U A;  1OEB A;  2PNI A;  2DRK A;  2CSI A;  1SSH A;  3EHQ A;  1NLO C;  1B3Q A;  2LX7 A;  1T0J A;  3KFV A;  3M0P A;  2YUO A;  1Z9Q A;  1GBR A;  3VS3 A;  5GJW B;  1WLP B;  1GRI A;  2LMJ A;  2DLP A;  1HD3 A;  1GFC A;  2LJ1 A;  2GQI A;  1UTI A;  1W70 A;  4RTV A;  5FWB A;  3I5R A;  2ABL A;  2YT6 A;  4AFQ C;  3EG3 A;  2A08 A;  2MCN A;  1PRL C;  1W1F A;  1AWX A;  1JXM A;  2FRW A;  2DJQ A;  1UJY A;  3SEM A;  1BBZ A;  1TUD A;  1IO6 A;  2CT3 A;  3VS7 A;  2DBM A;  1V1C A;  3THK A;  1QLY A;  1VYU A;  3A98 A;  2CRE A;  1YCS B;  1PWT A;  2A37 A;  2OJ2 A;  1GCQ A;  2CSQ A;  4J9H A;  1UHC A;  4ORZ A;  2RF0 A;  1M27 C;  2FPD A;  3TSZ A;  2KXD A;  4J9I A;  3RNJ A;  3VS4 A;  2JTE A;  1TG0 A;  1GBQ A;  3R6N A;  5IHI A;  1PKT A;  2DE0 X;  1JU5 C;  1ZX6 A;  4ESR A;  1HJD A;  2ECZ A;  1T0H A;  1FMK A;  1U3O A;  2LNH B;  1NYF A;  2ED0 A;  3EG0 A;  2DL4 A;  4QT7 A;  1ABQ A;  1OPL A;  2RQW A;  3VS1 A;  2D8J A;  1UE9 A;  1ZUK A;  1I1J A;  4AFZ C;  2AZV A;  1GCP A;  2EGC A;  3GBQ A;  3M0T A;  1GL5 A;  2J6O A;  1KFZ A;  2BZX A;  2LCS A;  2DYB A;  1UG1 A;  1AVZ C;  2JS0 A;  1AWO A;  1CKB A;  4GBQ A;  2K79 A;  3VS2 A;  5I22 A;  4JJB A;  1I07 A;  2C0T A;  2DX1 A;  1T3S A;  1G83 A;  2DA9 A;  1M3C A;  1MV0 B;  1UUE A;  2LQN A;  4JJC A;  1KJW A;  1ARK A;  1QCF A;  2DVJ A;  1UHF A;  3VRZ A;  2J7I A;  2KNB B;  3QWX X;  2ED1 A;  1X69 A;  5EC7 A;  5IH2 A;  2GNC A;  4LUE A;  1E6G A;  4CC4 B;  1JQQ A;  1B07 A;  1WIE A;  2FPF A;  4CC7 A;  1Y0M A;  2JM8 A;  2QDL A;  1OOT A;  1BU1 A;  1NM7 A;  2DM1 A;  2V1R A;  1RLP C;  2K2M A;  4HVU A;  1ABO A;  1SRM A;  2EGA A;  1RUW A;  2X3W D;  2HEQ A;  2GGR A;  2GBQ A;  4JZ3 A;  4E6R A;  1E6H A;  3EG2 A;  4OMP A;  1KIK A;  2X3X D;  2C0I A;  1WXB A;  2I0N A;  2FG0 A;  4JPB W;  2SRC A;  1NYG A;  1X2Q A;  2M0Y A;  3VS6 A;  2KYB A;  5HCK A;  1TUC A;  3IQL A;  4OMM A;  4J9C A;  5IHN A;  1QWF A;  1H3H A;  2KT1 A;  1KSW A;  2KBT A;  2KXC A;  2LQW A;  2KR3 A;  1XOV A;  1X43 A;  4JJD A;  3UA7 A;  2JMC A;  2L3Q A;  2F2X A;  1VYV A;  1H92 A;  4F16 A;  4LNP A;  3NMZ C;  2LJ0 A;  2RQT A;  4FSS A;  3SHW A;  5L23 A;  3EHR A;  2M51 A;  2RQV A;  2JS2 A;  2KRM A;  4IIO A;  4OMO A;  2EKH A;  1VA7 A;  1NG2 A;  2XMF A;  4J9B A;  2DBK A;  1U5S A;  3TVT A;  2KRN A;  2YUP A;  2L3S A;  1WDX A;  1E7O A;  1YWP A;  1UJ0 A;  4AFU C;  2ROT A;  4EIK A;  2KGT A;  4RTX A;  2FPE A;  2AKK A;  3NPF A;  3H41 A;  1PNJ A;  4M4Z A;  3I5S A;  2NWM A;  2JXB A;  5FW9 A;  2YSQ A;  1CSK A;  3JV3 A;  2EQI A;  2W10 A;  3H0I A;  4OMQ A;  1PHT A;  3EGU A;  1K1Z A;  2DL5 A;  2RQU A;  1BB9 A;  5GJV B;  2W0Z A;  2CDT A;  3H0H A;  4HVW A;  3I9Q A;  4RUG A;  1PKS A;  2EBP A;  2DMO A;  1J3T A;  3REB B;  3M0S A;  4ZNX A;  3VS5 A;  4HVV A;  4DEX A;  3M0Q A;  3QWY A;  2K9G A;  1N5Z A;  3UAT A;  1AD5 A;  1ZSG A;  4GLM A;  2K3B A;  4DEY A;  1W6X A;  2F2V A;  1AZG B;  2O88 A;  2ESW A;  1ZUU A;  1A0N B;  3PE0 A;  2RPN A;  5ECA A;  2DIL A;  1AZE A;  4AG1 C;  2E5K A;  1Z9Z A;  2YUN A;  4IIM A;  4HXJ A;  3CQT A;  3RBB B;  2O9V A;  1H8K A;  2DL3 A;  3O5Z A;  1UFF A;  2F2W A;  4OMN A;  2VKN A;  4X1V A;  2MIO A;  1SHG A;  1FYN A;  4J9E A;  1M3B A;  1UEC A;  1GCQ C;  1QKW A;  3PVQ A;  2EPD A;  4J9D A;  1SPK A;  1HSQ A;  3REA B;  3LH5 A;  4F14 A;  2SEM A;  2D1X A;  2A36 A;  4F17 A;  1UGV A;  2J6K A;  2L3P A;  2PTK A;  2AK5 A;  4J9G A;  2KEA A;  2IIM A;  1RI9 A;  2L2P A;  2DL7 A;  1MUZ A;  1YP5 A;  1CKA A;  1M8M A;  2G6F X;  2LJ3 A;  1T3L A;  2DRM A;  3C0C A;  1Y57 A;  1X6G A;  4HCK A;  2EYW A;  2GTO A;  1OPK A;  2CUB A;  1I0C A;  1S1N A;  4RTY A;  1AOJ A;  3TSW A;  2CT4 A;  2P4R A;  1YWO A;  3U23 A;  2LZ6 B;  2NUZ A;  2YDL A;  1LCK A;  1NLP C;  4A63 B;  2FRY A;  1YN8 A;  2KE9 A;  2BZY A;  2HDA A;  2C0O A;  1M30 A;  1K76 A;  2FO0 A;  2RMO A;  2HBW A;  4CC2 A;  1WI7 A;  1K4U S;  1YNZ A;  4RTU A;  1X6B A;  2HSP A;  2J06 A;  2EYY A;  1JO8 A;  1SRL A;  1U06 A;  2ENM A;  1NEB A;  2D8H A;  2FEI A;  2GTJ A;  1RLQ C;  1QKX A;  2BTT A;  1WX6 A;  2EVR A;  1X2K A;  4OML A;  2J05 A;  1AWJ A;  2EYZ A;  4Z88 A;  2AKL A;  2VVK A;  5IXF A;  4Y92 A;  1WXT A;  4RTZ A;  1ZBJ A;  1JEG A;  3UA6 A;  1NEG A;  2CH4 W;  1QWE A;  2D0N A;  1G2B A;  2CH4 A;  1WFW A;  3NGP A;  3UF4 A;  2J6F A;  2ROL A;  2B86 A;  2K6D A;  4KRT A;  2AZS A;  2JT4 A;  1WYX A;  3FJ5 A;  2KT8 A;  4JZ4 A;  2RQR A;  3VRY A;  4D8D A;  4R0K A;  2BZ8 A;  1X27 A;  2DL8 A;  2DNU A;  2CUD A;  2K7A A;  2DF6 A;  1WA7 A;  3M0R A;  2VWF A;  2JM9 A;  1WXU A;  1K9A A;  5IHK A;  3I35 A;  3EG1 A;  1MV3 A;  4RTT A;  3ULR B;  2LP5 A;  1K0S A;  2MOX A;  2A28 A;  2V1Q A;  2KRO A;  4LE9 A;  3PVL A;  4RTW A;  5I11 A;  1SHF A;  2H8H A;  1GFD A;  4Z8A A;  4D8K A;  1AEY A;  1SEM A;  2O2O A;  1ZLM A;  1OV3 A;  3ZL7 C;  4K11 A;  5FWC A;  2JMA A;  2EGE A;  4AFS C;  2OI3 A;  2RN8 A;  4WCI A;  1AWW A;  2KRS A;  4Z89 A;  2KYM A;  2EW3 A;  1ZUY A;  2L0A A;  1K0X A;  3NHN A;  1PRM C;  1BK2 A;  1M3A A;  4AG2 C;  4J9F A;  2OAW A;  4CC3 A;  1EFN A;  2YUQ A;  3VS0 A;  1JXO A;  1VYT A;  2EYX A;  3H0F A;  2JW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...