1ACAA

Three-dimensional structure of the complex between acyl-coenzyme a binding protein and palmitoyl-coenzyme a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
86
structure length
86
Chain Sequence
SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the complex between acyl-coenzyme A binding protein and palmitoyl-coenzyme A.
pubmed doi rcsb
source organism Bos taurus
molecule tags Acyl-coenzyme a binding protein
molecule keywords ACYL-COENZYME A BINDING PROTEIN
total genus 33
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1992-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1acaA00
1SGHA 2COPA 1MIXA 1NI2A 4YL8A 4ZRJA 4EKUA 4DXAB 2FJ9A 2CB8A 3EPYA 1EF1A 2D2QA 1HB6A 3BINA 4HDOA 4ZRIA 3U7DA 1HB8A 3AU5A 3G9WA 3WA0A 2J0MA 4F7GA 3IVFA 2J0KA 1GG3A 2D11A 1ISNA 2WH5A 1J19A 3FLVA 4NY0A 3PZDA 5IJMA 2CQUA 2HRJA 3X23A 1MK7B 1HBKA 2YVCA 3U8ZA 3QIJA 2ABDA 1ST7A 1E5WA 2EMSA 1MIZB 3FP5A 4CYEA 1GC7A 1H4RA 1ACAA 2I1KA 1NVLA 2EMTA 3ZDTA 1Y19B 2J0JA 4ZRKA 2AL6A 2AEHA 2ZPYA 1GC6A 3PVLA 1MK9B 4P7IA 2FDQA 2HE7A 2LBBA 2I1JA 1NTIA 2RQ1A 4HDQA 3AU4A 2D10A
chains in the Genus database with same CATH superfamily
1SGHA 2COPA 4ZRJA 2FJ9A 1HB6A 4JK9A 2J0MA 2J0KA 1GG3A 5IJMA 3E66A 5JVLA 4CYEA 2EMSA 1GC7A 1H4RA 1ACAA 4JKGA 2I1KA 1NVLA 4ILHA 3ZDTA 3PVLA 1MK9B 4P7IA 3SBTA 2FDQA 4JKDA 1NTIA 2D10A 1MIXA 1NI2A 2CB8A 2D2QA 3WA0A 3AU5A 4ILJA 1J19A 3FLVA 4JKCA 3X23A 2X0SA 1HBKA 4JKGB 3U8ZA 2ABDA 3E9PA 1VBHA 4JK7A 1Y19B 4JKEA 1JDEA 2AL6A 2ZPYA 4GXBA 1KC7A 4JKFA 1GGOA 4ILGB 3AU4A 3ENBA 4JKAA 4EKUA 3EPYA 3U7DA 4JKBA 4F7GA 3IVFA 2D11A 4NY0A 3PZDA 2CQUA 2HRJA 1ST7A 1E5WA 1MIZB 2DIKA 2EMTA 4ZRKA 3E9OA 2AEHA 1GC6A 4TKNA 3SBGA 2LBBA 2I1JA 4HDQA 4YL8A 4DXAB 1EF1A 3BINA 4ZRIA 4HDOA 1HB8A 3G9WA 4JKHA 1VBGA 1DIKA 1ISNA 2WH5A 4JK8A 1MK7B 2YVCA 3QIJA 3FP5A 3E9LA 2J0JA 1KBLA 2HE7A 2RQ1A 2R82A
chains in the Genus database with same CATH topology
1SGHA 2COPA 4ZRJA 2FJ9A 1HB6A 4JK9A 2J0MA 2J0KA 1GG3A 5IJMA 3E66A 5JVLA 4CYEA 2EMSA 1GC7A 1H4RA 1ACAA 4JKGA 2I1KA 1NVLA 4ILHA 3ZDTA 3PVLA 1MK9B 4P7IA 3SBTA 2FDQA 4JKDA 1NTIA 2D10A 1MIXA 1NI2A 2CB8A 2D2QA 3WA0A 3AU5A 4ILJA 1J19A 3FLVA 4JKCA 3X23A 2X0SA 1HBKA 4JKGB 3U8ZA 2ABDA 3E9PA 1VBHA 4JK7A 1Y19B 4JKEA 1JDEA 2AL6A 2ZPYA 4GXBA 1KC7A 4JKFA 1GGOA 4ILGB 3AU4A 3ENBA 4JKAA 4EKUA 3EPYA 3U7DA 4JKBA 4F7GA 3IVFA 2D11A 4NY0A 3PZDA 2CQUA 2HRJA 1ST7A 1E5WA 1MIZB 2DIKA 2EMTA 4ZRKA 3E9OA 2AEHA 1GC6A 4TKNA 3SBGA 2LBBA 2I1JA 4HDQA 4YL8A 4DXAB 1EF1A 3BINA 4ZRIA 4HDOA 1HB8A 3G9WA 4JKHA 1VBGA 1DIKA 1ISNA 2WH5A 4JK8A 1MK7B 2YVCA 3QIJA 3FP5A 3E9LA 2J0JA 1KBLA 2HE7A 2RQ1A 2R82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SGH A;  2COP A;  1MIX A;  1NI2 A;  4YL8 A;  4ZRJ A;  4EKU A;  4DXA B;  2FJ9 A;  2CB8 A;  3EPY A;  1EF1 A;  2D2Q A;  1HB6 A;  3BIN A;  4HDO A;  4ZRI A;  3U7D A;  1HB8 A;  3AU5 A;  3G9W A;  3WA0 A;  2J0M A;  4F7G A;  3IVF A;  2J0K A;  1GG3 A;  2D11 A;  1ISN A;  2WH5 A;  1J19 A;  3FLV A;  4NY0 A;  3PZD A;  5IJM A;  2CQU A;  2HRJ A;  3X23 A;  1MK7 B;  1HBK A;  2YVC A;  3U8Z A;  3QIJ A;  2ABD A;  1ST7 A;  1E5W A;  2EMS A;  1MIZ B;  3FP5 A;  4CYE A;  1GC7 A;  1H4R A;  1ACA A;  2I1K A;  1NVL A;  2EMT A;  3ZDT A;  1Y19 B;  2J0J A;  4ZRK A;  2AL6 A;  2AEH A;  2ZPY A;  1GC6 A;  3PVL A;  1MK9 B;  4P7I A;  2FDQ A;  2HE7 A;  2LBB A;  2I1J A;  1NTI A;  2RQ1 A;  4HDQ A;  3AU4 A;  2D10 A; 
#chains in the Genus database with same CATH topology
 1SGH A;  2COP A;  4ZRJ A;  2FJ9 A;  1HB6 A;  4JK9 A;  2J0M A;  2J0K A;  1GG3 A;  5IJM A;  3E66 A;  5JVL A;  4CYE A;  2EMS A;  1GC7 A;  1H4R A;  1ACA A;  4JKG A;  2I1K A;  1NVL A;  4ILH A;  3ZDT A;  3PVL A;  1MK9 B;  4P7I A;  3SBT A;  2FDQ A;  4JKD A;  1NTI A;  2D10 A;  1MIX A;  1NI2 A;  2CB8 A;  2D2Q A;  3WA0 A;  3AU5 A;  4ILJ A;  1J19 A;  3FLV A;  4JKC A;  3X23 A;  2X0S A;  1HBK A;  4JKG B;  3U8Z A;  2ABD A;  3E9P A;  1VBH A;  4JK7 A;  1Y19 B;  4JKE A;  1JDE A;  2AL6 A;  2ZPY A;  4GXB A;  1KC7 A;  4JKF A;  1GGO A;  4ILG B;  3AU4 A;  3ENB A;  4JKA A;  4EKU A;  3EPY A;  3U7D A;  4JKB A;  4F7G A;  3IVF A;  2D11 A;  4NY0 A;  3PZD A;  2CQU A;  2HRJ A;  1ST7 A;  1E5W A;  1MIZ B;  2DIK A;  2EMT A;  4ZRK A;  3E9O A;  2AEH A;  1GC6 A;  4TKN A;  3SBG A;  2LBB A;  2I1J A;  4HDQ A;  4YL8 A;  4DXA B;  1EF1 A;  3BIN A;  4ZRI A;  4HDO A;  1HB8 A;  3G9W A;  4JKH A;  1VBG A;  1DIK A;  1ISN A;  2WH5 A;  4JK8 A;  1MK7 B;  2YVC A;  3QIJ A;  3FP5 A;  3E9L A;  2J0J A;  1KBL A;  2HE7 A;  2RQ1 A;  2R82 A; 
#chains in the Genus database with same CATH homology
 1SGH A;  2COP A;  4ZRJ A;  2FJ9 A;  1HB6 A;  4JK9 A;  2J0M A;  2J0K A;  1GG3 A;  5IJM A;  3E66 A;  5JVL A;  4CYE A;  2EMS A;  1GC7 A;  1H4R A;  1ACA A;  4JKG A;  2I1K A;  1NVL A;  4ILH A;  3ZDT A;  3PVL A;  1MK9 B;  4P7I A;  3SBT A;  2FDQ A;  4JKD A;  1NTI A;  2D10 A;  1MIX A;  1NI2 A;  2CB8 A;  2D2Q A;  3WA0 A;  3AU5 A;  4ILJ A;  1J19 A;  3FLV A;  4JKC A;  3X23 A;  2X0S A;  1HBK A;  4JKG B;  3U8Z A;  2ABD A;  3E9P A;  1VBH A;  4JK7 A;  1Y19 B;  4JKE A;  1JDE A;  2AL6 A;  2ZPY A;  4GXB A;  1KC7 A;  4JKF A;  1GGO A;  4ILG B;  3AU4 A;  3ENB A;  4JKA A;  4EKU A;  3EPY A;  3U7D A;  4JKB A;  4F7G A;  3IVF A;  2D11 A;  4NY0 A;  3PZD A;  2CQU A;  2HRJ A;  1ST7 A;  1E5W A;  1MIZ B;  2DIK A;  2EMT A;  4ZRK A;  3E9O A;  2AEH A;  1GC6 A;  4TKN A;  3SBG A;  2LBB A;  2I1J A;  4HDQ A;  4YL8 A;  4DXA B;  1EF1 A;  3BIN A;  4ZRI A;  4HDO A;  1HB8 A;  3G9W A;  4JKH A;  1VBG A;  1DIK A;  1ISN A;  2WH5 A;  4JK8 A;  1MK7 B;  2YVC A;  3QIJ A;  3FP5 A;  3E9L A;  2J0J A;  1KBL A;  2HE7 A;  2RQ1 A;  2R82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...