1ACAA

Three-dimensional structure of the complex between acyl-coenzyme a binding protein and palmitoyl-coenzyme a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
86
structure length
86
Chain Sequence
b'SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYL-COENZYME A BINDING PROTEIN
molecule tags Acyl-coenzyme a binding protein
source organism Bos taurus
publication title Three-dimensional structure of the complex between acyl-coenzyme A binding protein and palmitoyl-coenzyme A.
pubmed doi rcsb
total genus 33
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1992-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1acaA00
1HB6A 3U7DA 1HB8A 2RQ1A 4NY0A 4EKUA 2AEHA 3QIJA 3AU4A 4CYEA 2COPA 2EMSA 4HDQA 3G9WA 3FP5A 1MIZB 4F7GA 5IJMA 1J19A 1NI2A 4ZRJA 1EF1A 1H4RA 2D10A 3PVLA 2HE7A 3PZDA 3BINA 2ZPYA 2LBBA 1HBKA 2FDQA 1GC7A 1NVLA 2D2QA 2EMTA 3AU5A 4HDOA 3ZDTA 1SGHA 2I1KA 2AL6A 4YL8A 2D11A 2CQUA 3U8ZA 4DXAB 1MK7B 3FLVA 1GC6A 1ISNA 4ZRKA 1NTIA 1GG3A 2ABDA 2FJ9A 2HRJA 2J0MA 1E5WA 2CB8A 2I1JA 2J0JA 1Y19B 4P7IA 2YVCA 4ZRIA 2J0KA 3WA0A 3X23A 1ACAA 2WH5A 3EPYA 3IVFA 1MK9B 1ST7A 1MIXA
chains in the Genus database with same CATH superfamily
4TKNA 4ILGB 1HBKA 3AU5A 1VBHA 1NVLA 2D2QA 2EMTA 1VBGA 2D11A 3E9LA 2CQUA 1JDEA 4ZRKA 5JVLA 2J0JA 4P7IA 1HB6A 2RQ1A 4EKUA 4HDQA 3FP5A 2X0SA 1J19A 1NI2A 4JK9A 3E9PA 4JKHA 4ZRJA 2D10A 1KBLA 2HE7A 3PZDA 4F7GA 2LBBA 1DIKA 3ZDTA 3U8ZA 1NTIA 2ABDA 2J0MA 1E5WA 2CB8A 2YVCA 3EPYA 3IVFA 1MK9B 1ST7A 4ILJA 4JKDA 1MIXA 4YL8A 1HB8A 4NY0A 3QIJA 3AU4A 4JKAA 3G9WA 4JK7A 1EF1A 1H4RA 3BINA 2ZPYA 3SBGA 1SGHA 2I1KA 2AL6A 3E66A 3FLVA 1GC6A 2HRJA 1GG3A 2FJ9A 4ILHA 1Y19B 3WA0A 2DIKA 4JKGB 2AEHA 3U7DA 4CYEA 3E9OA 2COPA 2EMSA 4JKBA 1MIZB 3ENBA 4JKFA 5IJMA 3PVLA 1ACAA 4JKCA 4HDOA 2FDQA 1GC7A 4JK8A 4GXBA 4JKGA 4DXAB 1MK7B 2R82A 1ISNA 2I1JA 3SBTA 4ZRIA 2J0KA 3X23A 2WH5A 1GGOA 4JKEA 1KC7A
chains in the Genus database with same CATH topology
4TKNA 4ILGB 1HBKA 3AU5A 1VBHA 1NVLA 2D2QA 2EMTA 1VBGA 2D11A 3E9LA 2CQUA 1JDEA 4ZRKA 5JVLA 2J0JA 4P7IA 1HB6A 2RQ1A 4EKUA 4HDQA 3FP5A 2X0SA 1J19A 1NI2A 4JK9A 3E9PA 4JKHA 4ZRJA 2D10A 1KBLA 2HE7A 3PZDA 4F7GA 2LBBA 1DIKA 3ZDTA 3U8ZA 1NTIA 2ABDA 2J0MA 1E5WA 2CB8A 2YVCA 3EPYA 3IVFA 1MK9B 1ST7A 4ILJA 4JKDA 1MIXA 4YL8A 1HB8A 4NY0A 3QIJA 3AU4A 4JKAA 3G9WA 4JK7A 1EF1A 1H4RA 3BINA 2ZPYA 3SBGA 1SGHA 2I1KA 2AL6A 3E66A 3FLVA 1GC6A 2HRJA 1GG3A 2FJ9A 4ILHA 1Y19B 3WA0A 2DIKA 4JKGB 2AEHA 3U7DA 4CYEA 3E9OA 2COPA 2EMSA 4JKBA 1MIZB 3ENBA 4JKFA 5IJMA 3PVLA 1ACAA 4JKCA 4HDOA 2FDQA 1GC7A 4JK8A 4GXBA 4JKGA 4DXAB 1MK7B 2R82A 1ISNA 2I1JA 3SBTA 4ZRIA 2J0KA 3X23A 2WH5A 1GGOA 4JKEA 1KC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HB6 A;  3U7D A;  1HB8 A;  2RQ1 A;  4NY0 A;  4EKU A;  2AEH A;  3QIJ A;  3AU4 A;  4CYE A;  2COP A;  2EMS A;  4HDQ A;  3G9W A;  3FP5 A;  1MIZ B;  4F7G A;  5IJM A;  1J19 A;  1NI2 A;  4ZRJ A;  1EF1 A;  1H4R A;  2D10 A;  3PVL A;  2HE7 A;  3PZD A;  3BIN A;  2ZPY A;  2LBB A;  1HBK A;  2FDQ A;  1GC7 A;  1NVL A;  2D2Q A;  2EMT A;  3AU5 A;  4HDO A;  3ZDT A;  1SGH A;  2I1K A;  2AL6 A;  4YL8 A;  2D11 A;  2CQU A;  3U8Z A;  4DXA B;  1MK7 B;  3FLV A;  1GC6 A;  1ISN A;  4ZRK A;  1NTI A;  1GG3 A;  2ABD A;  2FJ9 A;  2HRJ A;  2J0M A;  1E5W A;  2CB8 A;  2I1J A;  2J0J A;  1Y19 B;  4P7I A;  2YVC A;  4ZRI A;  2J0K A;  3WA0 A;  3X23 A;  1ACA A;  2WH5 A;  3EPY A;  3IVF A;  1MK9 B;  1ST7 A;  1MIX A; 
#chains in the Genus database with same CATH topology
 4TKN A;  4ILG B;  1HBK A;  3AU5 A;  1VBH A;  1NVL A;  2D2Q A;  2EMT A;  1VBG A;  2D11 A;  3E9L A;  2CQU A;  1JDE A;  4ZRK A;  5JVL A;  2J0J A;  4P7I A;  1HB6 A;  2RQ1 A;  4EKU A;  4HDQ A;  3FP5 A;  2X0S A;  1J19 A;  1NI2 A;  4JK9 A;  3E9P A;  4JKH A;  4ZRJ A;  2D10 A;  1KBL A;  2HE7 A;  3PZD A;  4F7G A;  2LBB A;  1DIK A;  3ZDT A;  3U8Z A;  1NTI A;  2ABD A;  2J0M A;  1E5W A;  2CB8 A;  2YVC A;  3EPY A;  3IVF A;  1MK9 B;  1ST7 A;  4ILJ A;  4JKD A;  1MIX A;  4YL8 A;  1HB8 A;  4NY0 A;  3QIJ A;  3AU4 A;  4JKA A;  3G9W A;  4JK7 A;  1EF1 A;  1H4R A;  3BIN A;  2ZPY A;  3SBG A;  1SGH A;  2I1K A;  2AL6 A;  3E66 A;  3FLV A;  1GC6 A;  2HRJ A;  1GG3 A;  2FJ9 A;  4ILH A;  1Y19 B;  3WA0 A;  2DIK A;  4JKG B;  2AEH A;  3U7D A;  4CYE A;  3E9O A;  2COP A;  2EMS A;  4JKB A;  1MIZ B;  3ENB A;  4JKF A;  5IJM A;  3PVL A;  1ACA A;  4JKC A;  4HDO A;  2FDQ A;  1GC7 A;  4JK8 A;  4GXB A;  4JKG A;  4DXA B;  1MK7 B;  2R82 A;  1ISN A;  2I1J A;  3SBT A;  4ZRI A;  2J0K A;  3X23 A;  2WH5 A;  1GGO A;  4JKE A;  1KC7 A; 
#chains in the Genus database with same CATH homology
 4TKN A;  4ILG B;  1HBK A;  3AU5 A;  1VBH A;  1NVL A;  2D2Q A;  2EMT A;  1VBG A;  2D11 A;  3E9L A;  2CQU A;  1JDE A;  4ZRK A;  5JVL A;  2J0J A;  4P7I A;  1HB6 A;  2RQ1 A;  4EKU A;  4HDQ A;  3FP5 A;  2X0S A;  1J19 A;  1NI2 A;  4JK9 A;  3E9P A;  4JKH A;  4ZRJ A;  2D10 A;  1KBL A;  2HE7 A;  3PZD A;  4F7G A;  2LBB A;  1DIK A;  3ZDT A;  3U8Z A;  1NTI A;  2ABD A;  2J0M A;  1E5W A;  2CB8 A;  2YVC A;  3EPY A;  3IVF A;  1MK9 B;  1ST7 A;  4ILJ A;  4JKD A;  1MIX A;  4YL8 A;  1HB8 A;  4NY0 A;  3QIJ A;  3AU4 A;  4JKA A;  3G9W A;  4JK7 A;  1EF1 A;  1H4R A;  3BIN A;  2ZPY A;  3SBG A;  1SGH A;  2I1K A;  2AL6 A;  3E66 A;  3FLV A;  1GC6 A;  2HRJ A;  1GG3 A;  2FJ9 A;  4ILH A;  1Y19 B;  3WA0 A;  2DIK A;  4JKG B;  2AEH A;  3U7D A;  4CYE A;  3E9O A;  2COP A;  2EMS A;  4JKB A;  1MIZ B;  3ENB A;  4JKF A;  5IJM A;  3PVL A;  1ACA A;  4JKC A;  4HDO A;  2FDQ A;  1GC7 A;  4JK8 A;  4GXB A;  4JKG A;  4DXA B;  1MK7 B;  2R82 A;  1ISN A;  2I1J A;  3SBT A;  4ZRI A;  2J0K A;  3X23 A;  2WH5 A;  1GGO A;  4JKE A;  1KC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...