1ACAA

Three-dimensional structure of the complex between acyl-coenzyme a binding protein and palmitoyl-coenzyme a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
86
structure length
86
Chain Sequence
SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYL-COENZYME A BINDING PROTEIN
publication title Three-dimensional structure of the complex between acyl-coenzyme A binding protein and palmitoyl-coenzyme A.
pubmed doi rcsb
source organism Bos taurus
molecule tags Acyl-coenzyme a binding protein
total genus 33
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1992-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1acaA00
3G9WA 1GC7A 3PZDA 2RQ1A 1H4RA 2J0MA 1NI2A 3AU5A 5IJMA 3PVLA 2I1KA 3U8ZA 4EKUA 3EPYA 4NY0A 1NTIA 2I1JA 2ZPYA 2AL6A 2WH5A 1ISNA 1GC6A 1GG3A 2AEHA 1J19A 4CYEA 1Y19B 3FP5A 3WA0A 3BINA 1HBKA 1MIXA 2J0JA 1ST7A 2HE7A 1SGHA 3FLVA 3IVFA 3U7DA 1MK7B 4YL8A 4DXAB 4ZRJA 2FJ9A 3QIJA 2CB8A 3ZDTA 2YVCA 2D11A 2HRJA 2J0KA 1MK9B 1NVLA 1HB8A 4ZRKA 1ACAA 1HB6A 2ABDA 2EMSA 3AU4A 2D10A 4P7IA 1E5WA 2COPA 2CQUA 4HDQA 2D2QA 1MIZB 2FDQA 2LBBA 4ZRIA 3X23A 4F7GA 2EMTA 4HDOA 1EF1A
chains in the Genus database with same CATH superfamily
2RQ1A 3ENBA 1H4RA 4JKFA 3EPYA 4NY0A 4JKGB 1NTIA 2I1JA 2X0SA 1GC6A 2HE7A 3IVFA 1SGHA 4ZRJA 2CB8A 1KBLA 2D11A 2J0KA 3AU4A 3E9PA 2CQUA 2EMTA 1DIKA 1GC7A 3PZDA 2J0MA 3AU5A 1NI2A 4JKHA 3U8ZA 4EKUA 4ILHA 4GXBA 2ZPYA 2AL6A 3E66A 1ISNA 2AEHA 1Y19B 3BINA 1HBKA 1MIXA 3U7DA 1ST7A 4ILJA 2R82A 4YL8A 4DXAB 3SBTA 1VBGA 1HB8A 4P7IA 2COPA 4HDQA 4JKDA 2FDQA 2LBBA 4ZRIA 3X23A 4JKGA 4F7GA 4JK8A 3PVLA 2I1KA 3E9LA 4ILGB 2WH5A 1GG3A 2DIKA 4JK9A 4JKBA 3FLVA 4JK7A 4TKNA 2YVCA 2HRJA 4JKAA 4ZRKA 2EMSA 2ABDA 3SBGA 2D2QA 1JDEA 4HDOA 1EF1A 3G9WA 5IJMA 3E9OA 4CYEA 1KC7A 1J19A 3FP5A 3WA0A 1GGOA 2J0JA 1MK7B 2FJ9A 3QIJA 3ZDTA 1VBHA 1MK9B 1NVLA 1ACAA 1HB6A 2D10A 1E5WA 4JKCA 4JKEA 1MIZB 5JVLA
chains in the Genus database with same CATH topology
2RQ1A 3ENBA 1H4RA 4JKFA 3EPYA 4NY0A 4JKGB 1NTIA 2I1JA 2X0SA 1GC6A 2HE7A 3IVFA 1SGHA 4ZRJA 2CB8A 1KBLA 2D11A 2J0KA 3AU4A 3E9PA 2CQUA 2EMTA 1DIKA 1GC7A 3PZDA 2J0MA 3AU5A 1NI2A 4JKHA 3U8ZA 4EKUA 4ILHA 4GXBA 2ZPYA 2AL6A 3E66A 1ISNA 2AEHA 1Y19B 3BINA 1HBKA 1MIXA 3U7DA 1ST7A 4ILJA 2R82A 4YL8A 4DXAB 3SBTA 1VBGA 1HB8A 4P7IA 2COPA 4HDQA 4JKDA 2FDQA 2LBBA 4ZRIA 3X23A 4JKGA 4F7GA 4JK8A 3PVLA 2I1KA 3E9LA 4ILGB 2WH5A 1GG3A 2DIKA 4JK9A 4JKBA 3FLVA 4JK7A 4TKNA 2YVCA 2HRJA 4JKAA 4ZRKA 2EMSA 2ABDA 3SBGA 2D2QA 1JDEA 4HDOA 1EF1A 3G9WA 5IJMA 3E9OA 4CYEA 1KC7A 1J19A 3FP5A 3WA0A 1GGOA 2J0JA 1MK7B 2FJ9A 3QIJA 3ZDTA 1VBHA 1MK9B 1NVLA 1ACAA 1HB6A 2D10A 1E5WA 4JKCA 4JKEA 1MIZB 5JVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G9W A;  1GC7 A;  3PZD A;  2RQ1 A;  1H4R A;  2J0M A;  1NI2 A;  3AU5 A;  5IJM A;  3PVL A;  2I1K A;  3U8Z A;  4EKU A;  3EPY A;  4NY0 A;  1NTI A;  2I1J A;  2ZPY A;  2AL6 A;  2WH5 A;  1ISN A;  1GC6 A;  1GG3 A;  2AEH A;  1J19 A;  4CYE A;  1Y19 B;  3FP5 A;  3WA0 A;  3BIN A;  1HBK A;  1MIX A;  2J0J A;  1ST7 A;  2HE7 A;  1SGH A;  3FLV A;  3IVF A;  3U7D A;  1MK7 B;  4YL8 A;  4DXA B;  4ZRJ A;  2FJ9 A;  3QIJ A;  2CB8 A;  3ZDT A;  2YVC A;  2D11 A;  2HRJ A;  2J0K A;  1MK9 B;  1NVL A;  1HB8 A;  4ZRK A;  1ACA A;  1HB6 A;  2ABD A;  2EMS A;  3AU4 A;  2D10 A;  4P7I A;  1E5W A;  2COP A;  2CQU A;  4HDQ A;  2D2Q A;  1MIZ B;  2FDQ A;  2LBB A;  4ZRI A;  3X23 A;  4F7G A;  2EMT A;  4HDO A;  1EF1 A; 
#chains in the Genus database with same CATH topology
 2RQ1 A;  3ENB A;  1H4R A;  4JKF A;  3EPY A;  4NY0 A;  4JKG B;  1NTI A;  2I1J A;  2X0S A;  1GC6 A;  2HE7 A;  3IVF A;  1SGH A;  4ZRJ A;  2CB8 A;  1KBL A;  2D11 A;  2J0K A;  3AU4 A;  3E9P A;  2CQU A;  2EMT A;  1DIK A;  1GC7 A;  3PZD A;  2J0M A;  3AU5 A;  1NI2 A;  4JKH A;  3U8Z A;  4EKU A;  4ILH A;  4GXB A;  2ZPY A;  2AL6 A;  3E66 A;  1ISN A;  2AEH A;  1Y19 B;  3BIN A;  1HBK A;  1MIX A;  3U7D A;  1ST7 A;  4ILJ A;  2R82 A;  4YL8 A;  4DXA B;  3SBT A;  1VBG A;  1HB8 A;  4P7I A;  2COP A;  4HDQ A;  4JKD A;  2FDQ A;  2LBB A;  4ZRI A;  3X23 A;  4JKG A;  4F7G A;  4JK8 A;  3PVL A;  2I1K A;  3E9L A;  4ILG B;  2WH5 A;  1GG3 A;  2DIK A;  4JK9 A;  4JKB A;  3FLV A;  4JK7 A;  4TKN A;  2YVC A;  2HRJ A;  4JKA A;  4ZRK A;  2EMS A;  2ABD A;  3SBG A;  2D2Q A;  1JDE A;  4HDO A;  1EF1 A;  3G9W A;  5IJM A;  3E9O A;  4CYE A;  1KC7 A;  1J19 A;  3FP5 A;  3WA0 A;  1GGO A;  2J0J A;  1MK7 B;  2FJ9 A;  3QIJ A;  3ZDT A;  1VBH A;  1MK9 B;  1NVL A;  1ACA A;  1HB6 A;  2D10 A;  1E5W A;  4JKC A;  4JKE A;  1MIZ B;  5JVL A; 
#chains in the Genus database with same CATH homology
 2RQ1 A;  3ENB A;  1H4R A;  4JKF A;  3EPY A;  4NY0 A;  4JKG B;  1NTI A;  2I1J A;  2X0S A;  1GC6 A;  2HE7 A;  3IVF A;  1SGH A;  4ZRJ A;  2CB8 A;  1KBL A;  2D11 A;  2J0K A;  3AU4 A;  3E9P A;  2CQU A;  2EMT A;  1DIK A;  1GC7 A;  3PZD A;  2J0M A;  3AU5 A;  1NI2 A;  4JKH A;  3U8Z A;  4EKU A;  4ILH A;  4GXB A;  2ZPY A;  2AL6 A;  3E66 A;  1ISN A;  2AEH A;  1Y19 B;  3BIN A;  1HBK A;  1MIX A;  3U7D A;  1ST7 A;  4ILJ A;  2R82 A;  4YL8 A;  4DXA B;  3SBT A;  1VBG A;  1HB8 A;  4P7I A;  2COP A;  4HDQ A;  4JKD A;  2FDQ A;  2LBB A;  4ZRI A;  3X23 A;  4JKG A;  4F7G A;  4JK8 A;  3PVL A;  2I1K A;  3E9L A;  4ILG B;  2WH5 A;  1GG3 A;  2DIK A;  4JK9 A;  4JKB A;  3FLV A;  4JK7 A;  4TKN A;  2YVC A;  2HRJ A;  4JKA A;  4ZRK A;  2EMS A;  2ABD A;  3SBG A;  2D2Q A;  1JDE A;  4HDO A;  1EF1 A;  3G9W A;  5IJM A;  3E9O A;  4CYE A;  1KC7 A;  1J19 A;  3FP5 A;  3WA0 A;  1GGO A;  2J0J A;  1MK7 B;  2FJ9 A;  3QIJ A;  3ZDT A;  1VBH A;  1MK9 B;  1NVL A;  1ACA A;  1HB6 A;  2D10 A;  1E5W A;  4JKC A;  4JKE A;  1MIZ B;  5JVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...