1ACIA

L11 ribosomal protein rna binding domain, nmr, 20 structures
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
76
structure length
76
Chain Sequence
b'MTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVVED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L11 RIBOSOMAL PROTEIN
publication title Cooperative interactions of RNA and thiostrepton antibiotic with two domains of ribosomal protein L11.
pubmed doi rcsb
molecule tags Ribosomal protein
total genus 13
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1997-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1aciA00
3I56I 1VQ4I 1YIJI 1VQPI 1VQ7I 3CD6I 1YI2I 1FOWA 4IOAF 2OTJI 3J7YJ 1S72I 1ACIA 5GAHJ 3CMEI 3CF5F 3CCEI 1VQNI 5JVGF 4V19K 3CMAI 1YJWI 2QEXI 2ZJRF 2K3FA 2FOWA 3CCMI 3I55I 3CCRI 3CC4I 4IO9F 3CC7I 2OTLI 3CCLI 3CC2I 5DM7F 1YJ9I 3PIOF 5GAEJ 4IOCF 1VQKI 2ZJPF 1VQ9I 4UY8I 1HC8A 3PIPF 5GAGJ 2E35A 1VQ6I 3CCQI 3CCJI 1FOXA 2ZJQF 1VQ8I 1YJNI 1YHQI 1QA6A 2E34A 1VQ5I 5DM6F 3CCUI 1VQMI 3G6EI 1YITI 3CCVI 3DLLF 1VQLI 2NXNB 3CJTB 2H8WA 2JQ7A 3G4SI 5GADJ 3G71I 2E36A 2QA4I 1Y39A 3CCSI 1FOYA 1VQOI 1MMSA 3J7ZI
chains in the Genus database with same CATH superfamily
2WB1A 1TP4A 4CUGA 3I56I 4XRMA 2HYGD 1KONA 5CQGA 5B1AH 3MVPA 3RI4A 1SVOA 2ZXHA 5H2FC 3CD6I 2Y9YA 4FISA 2AXTC 2EFOA 3O2PE 1Z6TA 1ON2A 1LQ1A 2ZCWA 5C4XJ 3J7YJ 1IG7A 3TW6A 2FBHA 2EZLA 1CGPA 3IWFA 3TGNA 3ZOBA 3HIFA 4UVBA 1ZLKA 4YG2F 4RB0A 5EEAA 3C18A 3GTPJ 4OIPF 3ZCOA 1BW6A 2OQRA 4XR6A 4S0HB 1PUEE 2XDVA 1JT0A 2WBMA 2GXGA 1BC7C 2V6CA 2L7ZA 3CUQB 3K69A 4CCJA 3GZ5A 1BW5A 1UB9A 4FHTA 4BH9A 3CLOA 1W0TA 3HTSB 2OZ6A 4HNTA 1E0EA 3RYRA 1TT0A 3HPGA 3Q9SA 5KK1A 3JAMZ 1OISA 2CUEA 3CDHA 4TV7A 4HBLA 3TQNA 4ESFA 4D0PA 1K78B 2IPQX 3T0YA 1DDNA 3CC2I 1ORKA 2ZO4A 2RAEA 4KICA 3JRHA 4NQWB 1LE8A 3JRAA 1XN7A 3RQ4A 1MDMB 2CUJA 4CCLA 4A93J 3J81Z 2WB1N 3DKXA 5JVTA 3OYDA 1VQ6I 2H94A 4IXAA 1D5VA 1XPXA 1XB4A 3HRUA 1K6OA 3HPHA 1ZREA 2KRCA 2WY7Q 3JRDA 4KYWA 2QUFA 2ZB9A 2E1MC 1IXSB 2PJPA 5C4JJ 3ULQB 1RNLA 2XC7A 2R7TA 3L2CA 2OQGA 4D1QA 3FHZA 1YTYA 3WTSC 4ZYGA 2PQ8A 4HG2A 9ANTA 1B9NA 2D1VA 5M3FJ 3R6SA 5LBQA 3GX4X 3K0LA 3ZQLA 3ZQIA 2WV0A 1IC8A 1D3YA 1BI2A 2R5ZB 3ABUA 2Y0SN 4B44A 3BQZA 3OYCA 4PJJA 3ZQ7A 2MD5A 3JTHA 1GUUA 4YFKF 4HDVA 2LDUA 5HLTA 4KIFA 3TBIA 1S7OA 5DCFA 3HGGA 3GW2A 1FYMA 2OJED 1HKSA 2DMUA 3KYCB 4WX9A 1MMSA 2K7LA 3JRFA 3PSIA 2FRHA 2GA1A 3ZQQA 3ZMTA 3Q0VA 1X3UA 4FTHA 5HS8A 3SZGA 3HRMA 3GFIA 1FC3A 3H9QA 4F92B 3F8NA 2EV0A 2FQ4A 1G3YA 2DFIA 4KUMA 4G6DA 1A04A 1XG1A 4E7LA 3K7AJ 2JSPA 3GVAA 3H0DA 4ESJA 3L1PA 2E1CA 4A3DJ 4IOAF 3MZYA 1PUFB 2LY9A 4MQVA 1DP3A 2K4BA 1BIAA 2P0WA 4OMZA 2W1OA 2ICWG 1SFUA 1IN6A 3S3MA 3NRVA 2IT0A 4DYQA 4BEHA 2VJIA 1AOYA 3BPVA 4AYBA 3OIQA 2RREA 3PO3J 3GLXA 3IWZA 1DPUA 3WTXC 1ZRDA 3A01B 3FIWA 2XHKA 1SFOJ 2BW3A 3AAFA 2PEXA 2QKLB 1T8IA 3B73A 3TO7A 1ZGJA 4X0GA 2RKHA 5B5EC 1ZG5A 1VZ0A 2V79A 3JSOA 4F91B 2OTLI 5FB2A 2KIFA 2EBIA 1SVLA 3BR6A 3W2VA 2NVUB 2VPRA 2UUZA 5KNLA 2A6HF 4E7KA 1I3AA 3O3KA 2KPMA 4A0ZA 1QZYA 2ZJPF 4KN7X 2BZTA 3C7JA 2HYFA 2P7CB 4ZTJA 2L4AA 2CG4A 3M1EA 5F08A 2KT0A 2M30A 1SMTA 2CWEA 3NWSA 5F6FA 3LOCA 2HDCA 5FD5A 2HQAA 1Y1WJ 3MWMA 1SD6A 2FXAA 2WC2A 1C0WA 4IEJA 2JA6J 3G2BA 2EFWA 5CKTA 1USTA 5AIQA 4ESBA 4KMFA 3ZQGA 5FKOA 2Y75A 3LSPA 1YITI 3FHNA 3DLLF 1Z3YA 4LG3A 2WADA 1LVKA 4AYBN 3HRTA 4EV0A 2CQ7A 3DP7A 2R4GA 2MBFA 1FSEA 2DA1A 3FK7A 4NUBA 4OIRF 1WCMJ 3QP6A 4CO8A 4E6KG 1H88C 1B72B 2O3FA 2YU9J 2NVTJ 5ILSA 2EJRA 5LGUA 4JP0A 2K40A 1XDUA 3RZDJ 1ETWA 5FGMA 4XQFA 1S5LC 1BR4A 4UV8A 3LSTA 3PM1A 3RKYA 1UJ8A 1YIJI 3I4PA 1Z67A 1X4OA 2KHMA 1BM9A 4B8XA 3HOYJ 1R23A 3TW7A 1UG0A 3MZHA 1MBGA 4YFNF 3DTEA 2VXDA 2MH9A 1R7JA 4ZYDA 2DYRH 4A3IJ 3KLOA 5J3LA 1HDPA 3RZOJ 1A6IA 1T6SA 2OUMA 2RGVA 4U87A 4W97A 1FBSA 2FEZA 3KP5A 5LGTA 2XROA 1MJAA 1Z91A 4GXOA 3G1MA 4XOTA 4YIFA 1Z1DA 1BA5A 4L9JA 2WWYA 2DA3A 2PMHA 4KITB 2JSCA 3LWFA 1ETOA 2XGXA 3VYRB 1J9IA 3BROA 2XGDA 4QPOA 1T2KA 2A6TA 4L9VA 2FNAA 2G9WA 3PUFA 4R1HA 2HDWA 3MEXA 4PJLA 3IKVA 3U21A 1IUYA 4FETA 1RKTA 5M5YJ 1O3TA 5JI6A 2R7FA 3BG3A 3HRSA 2JTVA 4BJ5C 5M5WJ 1KYWA 1QVUA 3H3UA 4P5OA 1RC9A 2QQ8A 2VXZA 1QVTA 2QM3A 2X4HA 5K7HA 2QSHX 2KIMA 3M07A 1WJAA 1YS7A 3K70C 4BQNA 5IOZA 2XB5A 1GLNA 4MLOA 4LG0B 1DQUA 2OZUA 3HOUJ 2V9VA 3QPTA 1BI3A 3GO5A 1HKTA 3KETA 1DU0A 1JXSA 3C1DA 2R7VA 1X1BA 4KIBA 3D5SC 4Q5SF 1WVRA 3HOZJ 4BS9A 2JA2A 4CYDA 1D0XA 3JW4A 1OYWA 2Y0MA 3IH4A 4IRIA 1CF7B 4RGRA 2O0YA 2G0EA 3S14J 4P55A 3F8BA 3MN2A 1I39A 5B1BH 3VYTB 1HW5A 1U5TB 1XTAA 2OBPA 3WHBA 3S3OA 5EGOA 5F0HA 3MAJA 3HOXJ 1IRFA 3FMQA 3WE3A 2L54A 1DGWY 4GYIA 1TC3C 1L3LA 4L5EA 4DBRA 1OR7C 2H8RA 2A07F 2HPMA 4ENKA 2GQQA 1QO0D 3E0JB 3EUKL 3GCMA 4ETSA 2MYSA 2X0LA 2DN0A 3CCYA 2DLLA 4CSWA 1AWCA 2JVHA 2V4JC 3LL7A 4B3XA 4AUXA 3E5UA 4L5JA 4CXFA 1JKOC 1HDDC 1HW1A 4F7ZA 3TL4X 4I6ZA 1NH3A 2XASA 2ZKZA 1YQAA 1IRZA 2EZIA 3OYNA 3CMEI 1V54H 1TW3A 2XB0X 3UKGA 2B7EA 2HI3A 5LHHA 2LYCA 3FKJA 4V2GA 4M6YA 2ZSIB 3Q3SA 4BUPA 2X85A 2KISA 1WFXA 1X1AA 4A3CJ 3QAHA 3I64A 3WGIA 1SD4A 4XL9A 2XF7A 1BIBA 1CQTA 5DCMB 1U2WA 2DMTA 3CUQC 5L3BA 2Q0OA 1Y8QB 2HVRA 1LUJB 1W5SA 2EA4A 3OV8A 3HHHA 1GV5A 2O03A 2QBYA 2M2EA 3BC8A 4WF2A 5LEJA 3S8PA 2W00A 1J59A 4A12A 1WH7A 3JRBA 2ME0A 1YW8A 3DU6A 4L18B 2JVGA 5DM7F 4LB5A 3HL2A 2FE3A 1GV2A 2M8EA 3VPRA 2LF7A 2NOGA 2YR2A 4LK0F 2KL4A 1W5TA 2KIQA 3G3ZA 4PDKA 3TO6A 3ZGKA 1YYVA 3P9KA 3OYIA 4Y52J 1XCVA 3SZTA 3NWTA 1MH4A 3A0HC 3LQRA 3MKWB 1DU6A 4CDGA 2FX0A 1MMNA 2BBYA 2AS5F 3HGYA 2GWRA 2FJ1A 5BOXA 3WGHA 3OL3A 3WHCA 2HS5A 4ENNA 1ONVA 1XGSA 2HDDA 3FXOA 2HEOA 4AIHA 4AM3A 3HB9A 1IN7A 1Z05A 3SQNA 3CESA 4M73A 2K9MA 2JA7J 3QPSA 4XKVA 2M7AA 4I09A 4Y17A 3C2HA 2VB6A 4IHXA 1XMAA 3CDIA 1H9GA 4A3KJ 1T38A 2BGCA 4FX0A 4P9UA 3T8RA 1ZHFA 1ZQ3P 3BG9A 2K27A 3U9GA 4HLYA 1LB2A 1JTXA 1UZCA 1I1SA 2EIMH 4Y7NJ 2QSGX 2X6WA 4KJZA 2NAZA 2VLAA 5F1JA 3QYFA 3TKYA 3CQZJ 2FF4A 1KQ0A 3F6VA 1QNTA 4I0BA 1UHWA 1YX3A 1VTNC 5HODA 1N77A 3KLNA 3H9GA 5TJJA 4HX4A 2W85A 3PQKA 1T39A 2IA0A 2I10A 3AKZA 2LK2A 3CP8A 2BE5F 3BR2A 4UB6C 4IHYA 2OTJI 1E2XA 3D5RC 3E3VA 4Y13A 2BXZA 1EV7A 2D2WA 4DNCA 3RIRA 3GTGJ 5C44J 1VQNI 3K2ZA 2HGCA 1F4KA 4A0XA 3H1CA 1T0FC 1GVJA 2ISZA 5FLXZ 1FMWA 5CVRA 1XMKA 1YX5A 3R0AA 4II2A 3R61A 3KEYA 2K9NA 1HBXG 3Q0UA 3QPHA 3IC7A 4G8XA 2COMA 1V5FA 4EM0B 3MD2A 2NS8A 3N97A 3JCUC 3ABMH 5EG0B 1U9NA 4H0EA 2CRGA 1K83J 1JTYA 1XSDA 4IRGA 1I50J 1E3OC 1U6GA 5D8KB 1X3ZB 4DW6A 4Y3OA 4HX7A 1FYKA 2JMWA 1NK2P 2R92J 4IOCF 4C2TA 2R5YB 4FT8A 2GIZA 2CUZA 2KIUA 3RSNA 3H5AA 3V7CA 2X48A 3PNYA 2NNNA 2P81A 1HC8A 2Y48A 5AIPA 2F4IA 4NDLA 3K70D 3ASNH 4EJOA 1R5GA 3DCFA 4KMUX 3TP3A 2OCCH 1R22A 1TWFJ 3VEPA 1FOXA 4PGGA 4CYCB 1HSJA 3OSFA 5J1RA 1ZK8A 1TQMA 1VQ8I 4O5VA 2IGNA 3MKLA 2BY1A 4BYYA 5A2QZ 3I53A 2A5YB 2M1BA 2XKOA 4A5NA 5JFRA 1W4MA 1D8JA 3FXRA 3L9FA 5EEHA 1PDNC 2VL8A 2E5ZA 2WAQN 1FEXA 1I6XA 2ZFUA 4KN4X 5CJ9A 3SEZA 4DQ2A 5HLGA 1V55H 1HCRA 1D5YA 3G73A 4IHTA 1J0RA 1F43A 2K4JA 2ELHA 5F04A 3IAS2 4ITVA 3W6KB 1RUOA 4BQAA 5E3LA 1IXRC 1OJLA 2LLKA 3GFMA 5M5XJ 2F5CA 1ODDA 1JGSA 1L0OC 4PJNA 1FZPB 1GHCA 2W25A 3OMYA 2IAIA 3RKWA 2IS2A 2P7VB 3FK6A 1SC7A 1KU3A 4BY7J 2FBKA 4E7HA 2IRFG 4O3MA 2ZXIA 2M7BA 2X6XA 3ZPLA 4A2UA 2LF8A 3W6VA 3B6CA 3GTOJ 1B4AA 1ZKGA 2X6YA 4JQFA 2DOEA 3H92A 2PJRB 2HZDA 4E7ZA 2F5DA 2Z1DA 1FOWA 3I4MJ 4D5CA 1TWAJ 4GDFA 4HF2A 1IGNA 3L2WA 4RAFA 3VYSB 4XK4A 4FASD 3PFIA 1IZ1A 2FU4A 2L9RA 4BJ6C 3GWZA 3BT9A 3K4MA 4IKFA 1OFCX 1MMAA 4WXCA 2Q2EB 2DPDA 3SZPA 1HA8A 3BQYA 3BR0A 2PI0A 2KZGA 3OYMA 2CGPA 1LDKB 3CMAI 2BOLA 2DA4A 4F3QA 4MIMA 2UWMA 1IO2A 2E2HJ 1J7KA 1UG2A 2LRDA 3K4KA 2V1DA 2CH0A 1LJ9A 1NG6A 2JJ7A 1WI3A 5E8IA 4ZYAA 3CC4I 3LSMA 2XSDC 1A36A 2IGKA 2RNGA 2DA6A 1SAUA 2M4KA 2L3DA 3WTTC 2FBIA 2IS6A 1N75A 2XVCA 1MNDA 2X9DA 3ISPA 4AVZA 3FMRA 2STWA 2EA2A 2X6OA 1XCBA 2O8XA 4WWCA 4HSTA 4ENJA 4EJUA 1SFKA 1MKMA 2D5VA 3L7WA 2VBZA 2VONA 1MBHA 2PG4A 1Y1VJ 3L2VA 4A3JJ 1WJFA 2Y30A 5HVQC 2XIGA 4UY8I 1RI7A 4JBAA 5LHIA 1R1VA 2XPUA 2CV1A 2W4SA 2X1CA 3S2DJ 1E3PA 2HXOA 2LBFB 1MSFC 2E7WA 1FOKA 3L00A 3SDGA 3ECHA 2ZNZA 2ZJQF 1BR2A 2HNHA 4M72A 2DMQA 1WZ2A 1H8AC 1YLFA 3OYGA 3HOTA 3QYBA 1WWXA 4ZDPA 4HNUA 4ZZLA 2MH2A 2DK5A 5HNHA 2P5VA 2DMNA 3OIPA 2IA1A 1TWCJ 4XLPF 2HU9A 3MKYB 2HOAA 5BPDA 2VOPA 1IDYA 1HXDA 3AG2H 1VQLI 3MQ0A 5E1WA 2VPLA 2M8GX 2L2OA 3VSKA 4M71A 2HOTA 5L3GA 2N8GA 3KE2A 3S32A 4CZZA 4LIVA 4XIDA 1S29A 1U5TC 2LP0A 1MMDA 1BN5A 2QA4I 4BAYA 3S1RJ 2VIXA 4EEFG 3EDPA 4KIGA 4M9SA 3CP2A 2ECCA 3ONQA 1YO5C 4HSRA 1A6QA 1X1CA 2QSFX 1O3QA 2XGCA 2ZC2A 1DGRM 3ERMA 1EH7A 5J6XA 2HKXA 1S3JA 2VBYA 1D1AA 2IXSA 2VASA 5K5QA 1B6AA 4RB3C 4KDPA 3V7RA 5EZGA 4LIUA 1QBJA 3TP0A 4ZDLA 2KKOA 1XC5A 2Q1ZB 4QIWN 4XSXF 2FMYA 2MLKA 4XM3A 1BI0A 2JUCA 3OWTA 5LGNA 5CLSA 2E71A 3CUOA 4I0AA 1U78A 2EPFA 2UZKA 4MO7A 3TDZC 3F23A 4RMNA 5KCMA 1SFEA 2Y2ZA 3H5RA 4C30A 3CUQA 5LHGA 2ISYA 2CQNA 1SFXA 3OYJA 2WAFA 2OPTA 3HZJA 2EFNA 2LY1A 5H6RA 2LY2A 3BDDA 1VNDA 4BE2A 1K78A 3QPLA 1Y0NA 1GVDA 3ML6A 4CCKA 2CO5A 3V7SA 1YG2A 4MTDA 4NB5A 2VC0A 3DQVC 3H36A 5LD2C 3DBHB 4L9TA 5CPRB 4CCMA 2IEKA 3CCLI 2H1KA 1Y0UA 4NBQA 4NQWA 4LJZF 1UCRA 1Z7UA 1MDMA 3OR1C 2R7OA 4BDYA 2UXXA 3M1CA 2VE9A 2CW8A 5FRNA 3ZN0A 5CVJA 3IL2A 4ZC3A 3QODA 3OS0A 2E1NA 1Y56A 3J81K 1VQ9I 1FLIA 4A69C 2E35A 4LMYA 4XRFA 2ECBA 1I6HJ 3HUGB 3HOWJ 1UHMA 3TOBA 4RGUA 5DYMA 2VC1A 3VDXA 3M8FA 1Z9CA 3JTGA 5D5VB 3BG6A 5GPCA 1J5YA 3WTUC 5H6QA 2HPIA 5EZHA 3L2QA 1R00A 3OYLA 3H0GJ 1S6LA 2AXLA 1NHAA 2LTPA 1VQMI 1IUFA 3V42A 1JGGA 1HQCA 4FE7A 2R5ZA 2CQKA 2DTRA 4QTRA 2ID6A 3F8CA 1RKWA 2VKDA 2E5NA 3D5LA 4UUVA 3AG3H 4FX4A 4EGZA 5L3DA 3KCCA 2H8WA 2DJNA 2NRAC 5E8GA 2HVQA 1MNEA 3IUOA 2DA5A 1Q1VA 2MLGA 3BJAA 2E36A 1F9NA 1XGNA 2BY2A 2FOKA 1B8IB 3GTKJ 4I01A 2A61A 3WU2C 3IKTA 3JSPA 3B02A 1O3RA 3ZRGA 2R7SA 1T56A 1BC8C 1JHHA 3FXUA 2WA0A 4I98B 1V3FA 1EA3A 2AHQA 2DQLA 2K85A 4PJMA 3W6JB 4E7IA 2IBDA 4XBFA 2QQAA 4LFUA 1P4AA 3HXLA 1PUFA 4A6DA 3E1SA 3RPQA 3P9CA 1RR7A 3PNTA 4M3BA 2ME6A 4V2FA 3NAUA 3MKZA 3CF5F 3E7LA 2DA2A 2ZBKA 1ZG3A 3PSFA 4A3EJ 1T0FA 2VQGA 1B9MA 1KYZA 5BQTA 1IJWC 2ZJ2A 5JLWA 2KJCA 3KZYA 4J01A 3PNVA 5CQEA 4R8HA 2KFDA 5K5OA 3HJEA 2VQHA 1T95A 3DTKA 1IV6A 4KFCA 4XICA 5DUIA 2JZYA 4ZJZA 4MEYF 2JPCA 2DT5A 1WQ2A 5L3FA 2CJJA 1XSVA 4D7NA 2WY8Q 2K02A 4N9HA 1APLC 4A3BJ 2V26A 3MMYB 2GIVA 1QZZA 4EJWA 1YJ9I 3WTWC 4IJAA 4IX7A 3FM5A 3KZZA 2XUBA 3IP4B 3K9TA 4UXNA 1BI1A 1JT6A 5FD6A 5FJ8J 3L2RA 2P6TA 3BJOA 1AKHB 1LFBA 2W82A 3ABTA 3BJ6A 4XLAA 3KP6A 1P2FA 4CZCA 3E5XA 3ZP5A 4HQEA 3BG5A 3QP5A 1WJEA 4G9YA 4XRSA 1HF0A 4Q48A 4KA4A 1I27A 3ZMZA 3VSLA 3AL0C 1ITYA 4U0VA 3SFZA 2XAQA 2ZMEC 4S05A 2XRNA 3KEOA 4RGXA 4RLQA 1R5ID 5BPIA 3QYEA 1X2MA 1R49A 2J5OA 5IY5H 3FXJA 3K4NA 4IRHA 1X3WB 2GOXB 2GLOA 2HTJA 2O9LA 2K9SA 3P5JA 5E3OA 4M3GA 3DKYA 3H3VK 2FA5A 3G4SI 2EV5A 4A6EA 2J5PA 3HSFA 2ESNA 1YE9A 2B0LA 4C2MJ 1ZRFA 2M9HA 1B72A 3K1PA 3ZQCA 2XF5A 1SEUA 3BWGA 2CYYA 2V6EA 1D1BA 1ERDA 3I9V2 4A3MJ 4ZZDA 2KRHA 3F3XA 2VJ5A 3LSGA 4Q47A 2CQQA 3KEQA 4KT6A 1RZ4A 5DV5A 5J4VA 4N0BA 1VQPI 3S16J 1P4XA 4GRIA 1I3QJ 5FKMA 5D5WB 2BVLA 3V8JA 3WU0A 2F5VA 3O8HA 1OYIA 1QU3A 4CHUA 1X1DA 2QBYB 3FWEA 3CJRB 4CA0A 2Y31A 5IP6A 3WTVC 2XAGA 5LRRA 4OWRB 2F5EA 4JX5A 2CW0F 4DZPA 1UAAA 4OIOF 4NC6A 3P7NA 2E19A 2M3AA 2X51A 3DXJF 3OS1A 3JRGA 4A3LJ 4RS8A 2R7RA 3FXQA 1STZA 3LSKA 3K10A 3E97A 3KYLA 1FYLA 3T5XA 4P96A 5ILVA 1XMXA 2Z5UA 3I3LA 2K9QA 5KAFC 1ZYRF 4DZJA 5BMZA 2EINH 2HXIA 1LEAA 3ZR8X 2QKMB 2CSOA 2FMLA 2W57A 5EYRA 2ZXJA 2W7NA 4ASNA 4CGZA 1S7AA 3F21A 1FT9A 3U1DA 3S17J 2LKPA 1IN8A 3LSJA 1MJ9A 1H89C 2LH9A 1N78A 1S7EA 5ERIA 4C3JJ 3QU3A 2DBBA 5IYBJ 5IP7J 5HDNA 2B9SA 2M87A 4LG0A 1PYVA 1P4WA 4BKXA 1Z0XA 4OU0A 2RV8A 4RM2A 4LLNA 2TCTA 3HSEA 3ESWB 2MC4A 1HOMA 4J00A 4EVIA 5E1XA 2ACJA 5K5RA 1OQYA 1X19A 3I59B 2EV6A 2KZVA 4E7JA 2VJ4A 2L7MP 2P8TA 2ZXWH 5HDKA 4YIRX 1CF7A 1QHHD 2XGEA 3CCUI 1E17A 1EKEA 1GXQA 3CMYA 1DPRA 2HFHA 2NOJB 1T98A 2QENA 3Q9VA 2NXNB 2QYOA 1KZHA 1U5TA 4MEXF 1R6RA 1TBXA 1KU2A 3FX3A 4P1WA 1R9TJ 2HTSA 1TT5B 4BNCA 1W7PB 3KYDB 3KX2A 2O61A 3W2AA 3EETA 3CCSI 1FY7A 1TQIA 1VQOI 1MNMC 4B09A 3FZVA 4JYKA 3LFKA 4UHTA 2C6YA 4B48A 1TWHJ 4AIDA 2EIKH 5IPAA 4F52A 1D8KA 1UELB 2VBXA 3E6BA 3GFJA 1V5EA 1ETQA 2QQBA 3DPUA 5F0FA 3TO9A 2DYSH 3GXOA 4CCOA 3OYFA 2WV1A 1ACIA 5GAHJ 2L01A 5M3MJ 4XLNF 4BBSJ 2IVMA 3M4OJ 2QQ9A 3CCEI 3WU1B 2CV2A 2OD5A 4JX6A 1OCRH 1X4PA 3GTMJ 1IF1A 2LVSA 4BDZA 1YS6A 3K1NA 3J7AY 3PO2J 2BXYA 2L0KA 2VKVA 1WHUA 2QEXI 2XAHA 4XKCA 5EF6A 3KPHA 3I58A 2F6CA 3CO7C 2K3FA 5DCMA 4RB1A 5DTDA 2FOWA 3WODF 2NS7A 2CW7A 5CVIA 4HQMA 2K9LA 2ETHA 3FXKA 2NVXJ 3DFGA 5JHFA 1IAWA 3KIOA 4EGYA 4BBRJ 2RN7A 2NYXA 2BHZA 1W0UA 2XAJA 3AFHA 3SFIA 3UNGC 5FLMJ 1R4NB 3QWLA 4MFEA 3F22A 4Q4ZF 1YRNB 2HQ5A 2HZTA 5GAEJ 3PFYA 3ZQHA 3ZQFA 1MZBA 3ELKA 1R1UA 4HPQA 1WI9A 2R7QA 3PIPF 3ZXSA 1WPKA 3NEUA 3COAC 1R4MB 2A3SA 2MSYA 4BXXJ 2QCOA 3RDIA 3GBGA 4B1RA 4C3IJ 3S1QJ 1TLHB 3RKQA 1LVAA 3J80K 4EMSA 2COBA 2TDXA 1K4SA 3BOQA 5K7ZA 2E34A 1TQPA 3A03A 2ZNYA 1VQ5I 4L0YB 4WXHA 2GBYA 5J4YA 5DD8A 2UXNA 2DT6A 2JRTA 2DFHA 4BACA 1POGA 4G12A 5HLIA 2XKPA 2QVOA 5L3EA 1TWGJ 4UUSA 3DV8A 1ZRCA 4RA2A 3FM3A 4NNJA 4ZDOA 4DYCA 4XLEA 5E3MA 3HM5A 3DTIA 4XKWA 3LNQA 1G3TA 1JUMA 4ON0A 3AL0B 4HEA2 1LPQA 3E6DA 4BHCA 2JA8J 2ZMEB 5E1ZB 1LEBA 4HX8A 3DEUA 3X2QH 2H6BA 5ICCA 3SJMA 2KP6A 4LLLA 2IA2A 2EFQA 2L7FP 5IT3A 1O3SA 4M6VA 3R4KA 2XPWA 2BHYA 3REOA 3C2GA 4XN0A 2DK8A 2K3PA 2BY0A 3ASOH 4UV9A 4H4KC 4Y15A 4G7HF 1R1TA 4II3A 1XD7A 4RAYA 2HKOA 4OIQF 5DDGA 1TW2A 4B4CA 2Y69H 1MD0A 4RBOA 4G6QA 3OOPA 1FTZA 1UMQA 3OY9A 3CMMA 4M6XA 2FUG2 4KNYA 2HYJA 5B3SH 1LFPA 1OYYA 3BZKA 4M9ZA 3RJPA 2R7ZJ 3F8MA 5CVUA 1ZAOA 1F36A 1G3WA 1YJWI 5FLXK 2Z9OA 3WGGA 1OCZH 3K4JA 4RDUA 1LDDA 1FTTA 4BGDA 4ZYHA 4B47A 2CQXA 3A02A 4AWXB 3NARA 1MBKA 4HYEA 3A1YA 4N4NB 2IP2A 5ICEA 4IO9F 1DUXC 5EG0A 3VOEA 1OCPA 1HW2A 1J2XA 1K4TA 2IJLA 5HOOA 5F64A 3O6BB 2R5YA 2PN6A 4AIKA 1LE8B 5IT9K 3E6MA 1O7FA 2HOEA 4ZH4F 3FISA 2ELKA 3JREA 2KLOA 2JRMA 3U2RA 1FWZA 3I71A 4MQ9F 1NK3P 1FX7A 4BQQA 1SAXA 4CYCA 2V9KA 2YX4A 2ZFWA 4HZFA 4KT5C 4D5FA 4QLCU 4PGHA 2V9PA 4BY1J 3I5UA 1ETXA 5A2QK 3H9JA 1JHFA 1XGOA 4PSWA 4FQGA 1Y8RB 1YHQI 1ETKA 1U9OA 2EZKA 3EYIA 2H1LA 4M9XA 3BR5A 4G94A 2L7KA 1IXCA 4XSZF 4IVNA 4CICA 1KU7A 1WH5A 1V5GA 2R7UA 1IN5A 2DFFA 4DBQA 2GXAA 4UVCA 4DJAA 2KJBA 3IH2A 4Z6YA 5D4RA 1NTCA 1KU9A 3ERED 4QWQA 1ULYA 3S93A 2MC3A 4U0YA 3OYHA 2NS0A 2CFOA 1FPQA 3S2HJ 2OV7A 5E79C 4E70A 4DIQA 3GEZA 1FJLA 4C3HJ 4EM2A 1O4XA 2DPUA 5F27A 3M7GA 4W1UA 4DOZA 1QPIA 3SXYA 1O57A 1RETA 2M45A 2XAFA 4XLCA 2Y0SA 2PMUA 2P5LC 1H0MA 2PJRA 1WKMA 2WAEA 2DXIA 4P9FA 2HQNA 4IHSA 1UHSA 3GMEA 4M3DA 3BZCA 2A68F 4PFOA 1V4RA 2V1NA 1ZG1A 4AD9A 1YI2I 2LNBA 4O6JA 4M3EA 4PK4A 5FRMA 4I02A 2X1EA 5IOYA 2R7XA 5J40A 1FSHA 4MNUA 1OR7A 4Z2YA 4U7BA 3FKIJ 3CJQB 3OIOA 2Q2EA 1P7JA 2H6CA 3FXMA 4XLFA 3JR9A 3RCOA 2K5CA 5TISC 2L9SA 1PP7U 4D7MA 5DS9A 2A69F 2JPBA 2O7OA 4J19A 3HDDA 5GPAA 2DFEA 5HS7A 4HNVA 3DPTA 5ICFA 4ABZA 2F4MB 4BEHB 2Z99A 1EF4A 2CUFA 4GCVA 3IRRA 3IHUA 3U1KA 3CCMI 3J7AO 4ANJA 1MMGA 2LSOA 2BW3B 3A0BC 3PQJA 2P4WA 2E1OA 5DD4A 1G3SA 2STTA 2OCEA 2AQFA 2F48A 2YS9A 3KZIC 5JR3A 2DOAA 5E3NA 3IV5A 2KDOA 3EYYA 1KQ8A 2HOSA 3K2AA 5E18F 1XS9A 1LDJA 1AA7A 5CVVA 2DOFA 5C3EJ 2R0QC 2CV0A 1P92A 3ZMDA 2MW8A 4M3FA 4R79A 2DO7A 5TGTA 4WXDA 2VKEA 2LBFA 3WTYC 3T8TA 2BEOA 5L3CA 4LITA 3B6AA 5FKNA 3PJRA 2EB7A 3HTUA 3JAMK 4HF1A 1O7LA 2CMPA 2RC4A 1P7IA 5IYDJ 1ZGWA 3DEEA 1ZELA 4UB8C 4S04A 1TNSA 2WTEA 2Q8KA 4D9JA 1VI0A 2IGOA 3EUHC 5BS6A 1A31A 1YJNI 1USSA 3M9AA 1EH8A 1TNTA 3TOAA 3BTJA 2RDPA 3VWBA 5DM6F 3HHGA 2PBIA 5HLHA 3G6EI 3ZMVA 1G59A 4A3FJ 2G7UA 4Y4RA 5DUKA 3ZMSA 3KFWX 4XN3A 2DDAA 3CJTB 3L2UA 2EIJH 3HSRA 3VB2A 3DLAA 2GM4A 2RVCA 5GADJ 3CO6C 3G71I 1MBJA 3W3CA 3EPZA 3EUAA 4IQJA 4HV6A 3QRFF 1ZN2A 1KGSA 3ABLH 3S1MJ 1MBEA 4LD5A 1K6YA 3PUBA 3FBIB 3V8LA 1TZLA 1Y39A 4MTEA 3BG7A 2KRFA 3GTQJ 2OAZA 4IPAA 3SDBA 4A3GJ 3CF2A 1K7AA 3K4CA 1EH6A 1ETVA 3HOVJ 2M0CA 3OYEA 4FE4A 1WJCA 4YELA 3FBNB 2LKSA 1LKXA 2H09A 2GZWA 3BCBA 3E6CC 3IRQA 1VQ7I 4DGWB 2L9VA 5J1UA 1G6NA 1D0ZA 2Z33A 3ZMUA 1S72I 1SVMA 1B1BA 3GZ6A 1R36A 3S3NA 1IRGA 5HDGA 1N25A 3QQAA 4PUSA 1ZTRA 5LFAA 4MHGA 2PFBA 4IQ4A 4YFXF 1JE8A 1X58A 4HDUA 2ZJRF 1IV8A 2A05A 4M74A 2NVQJ 3TDUC 3V8KA 3K4BA 3I55I 5EJCA 2UV1A 2RNJA 2OU2A 4PCQA 3HOSA 1A35A 3CC7I 2L02A 2LC2A 3VYUB 3WG9A 1DP7P 5LRSA 3D0SA 2DMPA 2LR8A 4YIIA 4CCNA 1QZEA 3KP2A 4HLXA 2B63J 3LFUA 4MFDA 5E17F 5K1YA 5E20A 2O5RA 4U88A 5J8FA 3OYKA 4F55A 3A01A 2OC6A 2PMZA 3HUGA 1SANA 2L9NA 2VODA 5GAGJ 1ZLJA 1U8RA 4F93B 1XDSA 3GLLA 1ENHA 2FD5A 1EJ9A 5FKKA 3CCJI 5J47A 2R93J 1RIOH 3OYBA 1WJBA 4EQQA 1YW7A 4XLHA 3GUDA 2QF7A 1OKRA 2DW4A 5FFXA 1GDTA 1YOVB 2W84A 3M8EA 4XNFA 6PAXA 3VFZA 3HYIA 3NQOA 4PSXA 5CYVA 1UFMA 1BJZA 1W1WE 3I0TA 3CCVI 3F9KA 3LQQA 3RPUD 2MABA 2L4MA 3ABKH 2I8DA 1FIAA 2QLZA 4U7DA 1FNNA 2QGUA 3ZN1A 4FCYA 2ESHA 2V1XA 1B8IA 5EGOB 1OCOH 2R3SA 3K6GA 4BXFA 2GAUA 4NHJA 4XMYA 4L0ZB 4EATA 5D5XB 2Z3YA 3J7ZI 5FFZA 3GFLA 3BR3A 3EQLF 1J75A 3BP8A 1GT0C 3DU5A 2YUSA 1QGPA 1ZGAA 2DU9A 1VQ4I 1MSEC 4IHWA 1PP8F 4I76A 3CZ6A 3HG9A 2IW5A 2M34A 3WTZA 5LLQA 2DTZA 2RQPA 3GZNB 3FMSA 2PMZN 1ON1A 1BL0A 2KMUA 1JUPA 2MFZA 4RM3A 1MBFA 2E2JJ 5DEQA 3DF8A 4BHPA 1OMIA 2NVYJ 5JVGF 2OA4A 2AO9A 1IDZA 4C2UA 5IYCJ 1KA8A 3M8JA 1QRYA 3LA3A 3W2WA 5KVRA 3C3WA 1BJAA 3KP7A 2M0MA 2VE8A 2YU3A 3HKZA 3M3YJ 2EQRA 1HLVA 1MGTA 4CH7A 4HA8A 2HQRA 4AIJA 4I2OA 4XOPA 1WJ5A 2IGMA 2QZ8A 3H5NA 3DBRB 1G4DA 3DPLC 2BV6A 1P6RA 2MA3A 3I54A 2W24A 4UNOA 3FDYA 1JJ6C 5IP9J 1QPMA 1PJRA 3R60A 1F1ZA 1QHGA 2ZSHB 3SYTA 2YX7A 1AKHA 1F5TA 2CS3A 4UUTA 3RKXA 3KP4A 3RYPA 2JT1A 2F2EA 1RUNA 5D4SA 3MCZA 5D5UB 4IF4A 2E1MB 1YFHA 1WSUA 1TTYA 2MG4A 2XSJC 3S2WA 3KP3A 2VN2A 2JA5J 2I5UA 2YPRA 3LSHA 4GO1A 1BOAA 1QA6A 3RPUA 4RLFA 3GTLJ 2XAUA 3Q5FA 3AG1H 5FLVA 2IS4A 3G1LA 3DBLB 2VQCA 2Y9ZA 4RB2C 2MGQA 4BE1A 3N05A 2DT7B 2P6SA 2JQ7A 4U0WA 4C9YA 3WG7H 4A0YA 2VJJA 3HKZN 2R7WA 1VFCA 2BYVE 4EM1A 3JRCA 2D45A 2BY3A 1W36C 1MIJA 2BVMA 4PZJA 1RPWA 4K2EA 3CTAA 4XKBA 1R71A 2E2IJ 2V1UA 1ZARA 2QWWA 3HBLA 4AU7A 1RR8C 1WJDA 1REPC 5F1RA 2VOOA 2FNPA 1W7PD 4AC0A 3F0CA 3S15J 3BLYA 5KHDA 3WE2A 3CJNA 4YEJA 3OOUA 3LA2A 1IRXA 3O8GA 1MH3A 4B43A 5ILUA 5FO5A 5TRDA 2FSWA 2E60A 1OLTA 1R58A 2EH3A 4RGSA 2LKXA 1JUSA 5F0CA 5BNGA 4HAMA 4G7ZF 2JUGA 1BOBA 2LOOA 4JK1X 5ICGA 4WCGA 1ZR4A 2V7FA 4I7HA 4LB6B 3GF2A 4OAYA 1NG7A 3RQIA 4EJTA 3FXLA 2CFXA 3K1MA 1B59A 3L09A 3VODA 1JJ8C 2A6EF 1MW7A 4IL6C 5KAIC 1FP2A 5H20A 4I99C 5J1YA 4HRIA 3CCRI 3IAM2 2HVSA 4GGGA 3GTJJ 1XSXA 3S1NJ 1H9TA 3JRIA 4HOBA 3J80Z 3A2KA 1X1PA 2HR3A 1WGXA 5D8LB 3BZ6A 3BPXA 3TMOA 3PIOF 1T08B 2NNYA 2VI6A 4ENMA 4X1EA 2VT2A 2ELJA 1MJBA 2KQRA 5EEGA 4NC8A 1I1GA 1K79A 1FP1D 1R5HA 3BR1A 3CCQI 2JWTA 2DQRA 2DODA 1OPCA 4UUSB 2DDBA 2LREA 3H35A 3EUHA 4A5MA 5K7FA 5ED4A 1ZR2A 5B66C 1BBYA 3I59A 5FKLA 1M1EB 2EFPA 1S8NA 2XRLA 1D0YA 4BE0A 4N9IA 1VF9A 4GYGA 2XF6A 1T33A 1IN4A 4OAZA 4HF0A 3QOPA 3LSIA 1Z7LA 4BU2A 2VUMJ 2D1HA 2JK3A 4LGWA 2OF7A 2LD5A 4HV5A 3LMMA 3LA7A 2PLYA 2ID3A 4BHBA 3RTRA 1OCCH 4BJTA 4AVPA 3A4CA 2M4GA 1A5JA 4E4HA 2K86A 2IS1A 3LAPA 4QSHA 2FQ3A 1RESA 2RQQA 5GTIC 4ZTFA 3F6OA 4X6AJ 1W7PA 2GXBA 3OYAA 3OL4A 1Y6IA 4JOMA 4RAZA 3CLQA 2WAQA 2TRTA 5EDNA 2PX9A 4YRVA 2LMDA 3MFKA 1FMVA 2EK5A 2DI3A 4WK8F 1G2HA 1Z77A 1S9HA 2Z2SB 1SD7A 1D1CA 1KQ9A 2E7XA 4LK1F 5JLXA 3D1NI 2DCEA 4EJVA 3AG4H 5D6EA 3OS2A 1ZH5A 1E3HA 3E5QA 1LNWA 1W5CC 3HEFA 2GA2A 3FF5A 1U3EM 2A5WA 1PVEA 2DAOA 2JN6A 2M5WA 1LFUP 4PFPA 4BXUA 4NC7A 3GYHX 1X2NA 3DWLE 3LAJA 1OCTC 1FBUA 5HNFA 1HSTA 3IH3A 1U8BA 5HS9A 1Z21A 4G7OF 4V19K 4XONA 5IT9Z 2MD0A 3I4NJ 3BTLA 5JHUA 2XV4S 2LG4A 4N4OB 2X1DA 3N4MA 1Z3XA 4IHVA 2ADUA 4LLGF 2YSRA 3ECOA 1K61A 4RAGA 4OINF 3V4GA 2R7DA 5GTHC 2GOMA 1JKQC 2XPVA 1FIPA 1I5ZA 5LEKA 4OOIA 1Q1HA 4LOCA 1IW7F 4E7SA 4BL0B 1FBQA 2VBWA 3BTCA 2AQEA 5AONA 1YRNA 3P9IA 3MZ8A 3Q0WA 5J8CA 2Z16A 1JKPC 5FROA 5GP9A 1YIOA 1SD5A 3F8FA 5D6FA 1GXPA 1VQKI 2EILH 2F5FA 4Y33A 1AU7A 4IZZA 2KDZA 4G6TB 2P5KA 1RRJA 3DKWA 3LSRA 2VQLA 4OMYA 1JKRC 4XORA 3DEWA 3R0JA 4GFBA 3BTIA 1TL8A 3QOEA 3HC7A 1QQIA 3ROUA 1JI8A 3H3ZA 1XX5A 1ETYA 3OSGA 2HWVA 4BQOA 3G1OA 1WRJA 1U0JA 1XGMA 2F4OB 2VKHA 4UVAA 4HW0A 3C2BA 2CU7A 4QPQA 2EWNA 4L9NA 3PL8A 3QU6A 2LFBA 3BY6A 1HKQA 1SMYF 2L5QA 4XRSG 4DYRA 3TEDA 3OR2C 1BR1A 1AHDP 3SEQA 3F72A 2ZMEA 2VT3A 3BCAA 3CDLA 4PJ0C 3UR3C 4JX4A 3SHFA 2EZHA 2DA7A 1J09A 4B3AA 1W36D 2DJIA 2G7HA 4ZYEA 3K4LA 1G8XA 1FOYA 3T1BA 2O8KA 4KISA 1P9QC 2H27A 2W48A 1YW9A 4L5IA 2O6GE 4MGRA 1Z6RA
chains in the Genus database with same CATH topology
3I56I 1VQ4I 1YIJI 1VQPI 1VQ7I 3CD6I 1YI2I 1FOWA 4IOAF 2OTJI 3J7YJ 1S72I 1ACIA 5GAHJ 3CMEI 3CF5F 3CCEI 1VQNI 5JVGF 4V19K 3CMAI 1YJWI 2QEXI 2ZJRF 2K3FA 2FOWA 3CCMI 3I55I 3CCRI 3CC4I 4IO9F 3CC7I 2OTLI 3CCLI 3CC2I 5DM7F 1YJ9I 3PIOF 5GAEJ 4IOCF 1VQKI 2ZJPF 1VQ9I 4UY8I 1HC8A 3PIPF 5GAGJ 2E35A 1VQ6I 3CCQI 3CCJI 1FOXA 2ZJQF 1VQ8I 1YJNI 1YHQI 1QA6A 2E34A 1VQ5I 5DM6F 3CCUI 1VQMI 3G6EI 1YITI 3CCVI 3DLLF 1VQLI 2NXNB 3CJTB 2H8WA 2JQ7A 3G4SI 5GADJ 3G71I 2E36A 2QA4I 1Y39A 3CCSI 1FOYA 1VQOI 1MMSA 3J7ZI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 I;  1VQ4 I;  1YIJ I;  1VQP I;  1VQ7 I;  3CD6 I;  1YI2 I;  1FOW A;  4IOA F;  2OTJ I;  3J7Y J;  1S72 I;  1ACI A;  5GAH J;  3CME I;  3CF5 F;  3CCE I;  1VQN I;  5JVG F;  4V19 K;  3CMA I;  1YJW I;  2QEX I;  2ZJR F;  2K3F A;  2FOW A;  3CCM I;  3I55 I;  3CCR I;  3CC4 I;  4IO9 F;  3CC7 I;  2OTL I;  3CCL I;  3CC2 I;  5DM7 F;  1YJ9 I;  3PIO F;  5GAE J;  4IOC F;  1VQK I;  2ZJP F;  1VQ9 I;  4UY8 I;  1HC8 A;  3PIP F;  5GAG J;  2E35 A;  1VQ6 I;  3CCQ I;  3CCJ I;  1FOX A;  2ZJQ F;  1VQ8 I;  1YJN I;  1YHQ I;  1QA6 A;  2E34 A;  1VQ5 I;  5DM6 F;  3CCU I;  1VQM I;  3G6E I;  1YIT I;  3CCV I;  3DLL F;  1VQL I;  2NXN B;  3CJT B;  2H8W A;  2JQ7 A;  3G4S I;  5GAD J;  3G71 I;  2E36 A;  2QA4 I;  1Y39 A;  3CCS I;  1FOY A;  1VQO I;  1MMS A;  3J7Z I; 
#chains in the Genus database with same CATH topology
 2WB1 A;  1TP4 A;  4CUG A;  3I56 I;  4XRM A;  2HYG D;  1KON A;  5CQG A;  5B1A H;  3MVP A;  3RI4 A;  1SVO A;  2ZXH A;  5H2F C;  3CD6 I;  2Y9Y A;  4FIS A;  2AXT C;  2EFO A;  3O2P E;  1Z6T A;  1ON2 A;  1LQ1 A;  2ZCW A;  5C4X J;  3J7Y J;  1IG7 A;  3TW6 A;  2FBH A;  2EZL A;  1CGP A;  3IWF A;  3TGN A;  3ZOB A;  3HIF A;  4UVB A;  1ZLK A;  4YG2 F;  4RB0 A;  5EEA A;  3C18 A;  3GTP J;  4OIP F;  3ZCO A;  1BW6 A;  2OQR A;  4XR6 A;  4S0H B;  1PUE E;  2XDV A;  1JT0 A;  2WBM A;  2GXG A;  1BC7 C;  2V6C A;  2L7Z A;  3CUQ B;  3K69 A;  4CCJ A;  3GZ5 A;  1BW5 A;  1UB9 A;  4FHT A;  4BH9 A;  3CLO A;  1W0T A;  3HTS B;  2OZ6 A;  4HNT A;  1E0E A;  3RYR A;  1TT0 A;  3HPG A;  3Q9S A;  5KK1 A;  3JAM Z;  1OIS A;  2CUE A;  3CDH A;  4TV7 A;  4HBL A;  3TQN A;  4ESF A;  4D0P A;  1K78 B;  2IPQ X;  3T0Y A;  1DDN A;  3CC2 I;  1ORK A;  2ZO4 A;  2RAE A;  4KIC A;  3JRH A;  4NQW B;  1LE8 A;  3JRA A;  1XN7 A;  3RQ4 A;  1MDM B;  2CUJ A;  4CCL A;  4A93 J;  3J81 Z;  2WB1 N;  3DKX A;  5JVT A;  3OYD A;  1VQ6 I;  2H94 A;  4IXA A;  1D5V A;  1XPX A;  1XB4 A;  3HRU A;  1K6O A;  3HPH A;  1ZRE A;  2KRC A;  2WY7 Q;  3JRD A;  4KYW A;  2QUF A;  2ZB9 A;  2E1M C;  1IXS B;  2PJP A;  5C4J J;  3ULQ B;  1RNL A;  2XC7 A;  2R7T A;  3L2C A;  2OQG A;  4D1Q A;  3FHZ A;  1YTY A;  3WTS C;  4ZYG A;  2PQ8 A;  4HG2 A;  9ANT A;  1B9N A;  2D1V A;  5M3F J;  3R6S A;  5LBQ A;  3GX4 X;  3K0L A;  3ZQL A;  3ZQI A;  2WV0 A;  1IC8 A;  1D3Y A;  1BI2 A;  2R5Z B;  3ABU A;  2Y0S N;  4B44 A;  3BQZ A;  3OYC A;  4PJJ A;  3ZQ7 A;  2MD5 A;  3JTH A;  1GUU A;  4YFK F;  4HDV A;  2LDU A;  5HLT A;  4KIF A;  3TBI A;  1S7O A;  5DCF A;  3HGG A;  3GW2 A;  1FYM A;  2OJE D;  1HKS A;  2DMU A;  3KYC B;  4WX9 A;  1MMS A;  2K7L A;  3JRF A;  3PSI A;  2FRH A;  2GA1 A;  3ZQQ A;  3ZMT A;  3Q0V A;  1X3U A;  4FTH A;  5HS8 A;  3SZG A;  3HRM A;  3GFI A;  1FC3 A;  3H9Q A;  4F92 B;  3F8N A;  2EV0 A;  2FQ4 A;  1G3Y A;  2DFI A;  4KUM A;  4G6D A;  1A04 A;  1XG1 A;  4E7L A;  3K7A J;  2JSP A;  3GVA A;  3H0D A;  4ESJ A;  3L1P A;  2E1C A;  4A3D J;  4IOA F;  3MZY A;  1PUF B;  2LY9 A;  4MQV A;  1DP3 A;  2K4B A;  1BIA A;  2P0W A;  4OMZ A;  2W1O A;  2ICW G;  1SFU A;  1IN6 A;  3S3M A;  3NRV A;  2IT0 A;  4DYQ A;  4BEH A;  2VJI A;  1AOY A;  3BPV A;  4AYB A;  3OIQ A;  2RRE A;  3PO3 J;  3GLX A;  3IWZ A;  1DPU A;  3WTX C;  1ZRD A;  3A01 B;  3FIW A;  2XHK A;  1SFO J;  2BW3 A;  3AAF A;  2PEX A;  2QKL B;  1T8I A;  3B73 A;  3TO7 A;  1ZGJ A;  4X0G A;  2RKH A;  5B5E C;  1ZG5 A;  1VZ0 A;  2V79 A;  3JSO A;  4F91 B;  2OTL I;  5FB2 A;  2KIF A;  2EBI A;  1SVL A;  3BR6 A;  3W2V A;  2NVU B;  2VPR A;  2UUZ A;  5KNL A;  2A6H F;  4E7K A;  1I3A A;  3O3K A;  2KPM A;  4A0Z A;  1QZY A;  2ZJP F;  4KN7 X;  2BZT A;  3C7J A;  2HYF A;  2P7C B;  4ZTJ A;  2L4A A;  2CG4 A;  3M1E A;  5F08 A;  2KT0 A;  2M30 A;  1SMT A;  2CWE A;  3NWS A;  5F6F A;  3LOC A;  2HDC A;  5FD5 A;  2HQA A;  1Y1W J;  3MWM A;  1SD6 A;  2FXA A;  2WC2 A;  1C0W A;  4IEJ A;  2JA6 J;  3G2B A;  2EFW A;  5CKT A;  1UST A;  5AIQ A;  4ESB A;  4KMF A;  3ZQG A;  5FKO A;  2Y75 A;  3LSP A;  1YIT I;  3FHN A;  3DLL F;  1Z3Y A;  4LG3 A;  2WAD A;  1LVK A;  4AYB N;  3HRT A;  4EV0 A;  2CQ7 A;  3DP7 A;  2R4G A;  2MBF A;  1FSE A;  2DA1 A;  3FK7 A;  4NUB A;  4OIR F;  1WCM J;  3QP6 A;  4CO8 A;  4E6K G;  1H88 C;  1B72 B;  2O3F A;  2YU9 J;  2NVT J;  5ILS A;  2EJR A;  5LGU A;  4JP0 A;  2K40 A;  1XDU A;  3RZD J;  1ETW A;  5FGM A;  4XQF A;  1S5L C;  1BR4 A;  4UV8 A;  3LST A;  3PM1 A;  3RKY A;  1UJ8 A;  1YIJ I;  3I4P A;  1Z67 A;  1X4O A;  2KHM A;  1BM9 A;  4B8X A;  3HOY J;  1R23 A;  3TW7 A;  1UG0 A;  3MZH A;  1MBG A;  4YFN F;  3DTE A;  2VXD A;  2MH9 A;  1R7J A;  4ZYD A;  2DYR H;  4A3I J;  3KLO A;  5J3L A;  1HDP A;  3RZO J;  1A6I A;  1T6S A;  2OUM A;  2RGV A;  4U87 A;  4W97 A;  1FBS A;  2FEZ A;  3KP5 A;  5LGT A;  2XRO A;  1MJA A;  1Z91 A;  4GXO A;  3G1M A;  4XOT A;  4YIF A;  1Z1D A;  1BA5 A;  4L9J A;  2WWY A;  2DA3 A;  2PMH A;  4KIT B;  2JSC A;  3LWF A;  1ETO A;  2XGX A;  3VYR B;  1J9I A;  3BRO A;  2XGD A;  4QPO A;  1T2K A;  2A6T A;  4L9V A;  2FNA A;  2G9W A;  3PUF A;  4R1H A;  2HDW A;  3MEX A;  4PJL A;  3IKV A;  3U21 A;  1IUY A;  4FET A;  1RKT A;  5M5Y J;  1O3T A;  5JI6 A;  2R7F A;  3BG3 A;  3HRS A;  2JTV A;  4BJ5 C;  5M5W J;  1KYW A;  1QVU A;  3H3U A;  4P5O A;  1RC9 A;  2QQ8 A;  2VXZ A;  1QVT A;  2QM3 A;  2X4H A;  5K7H A;  2QSH X;  2KIM A;  3M07 A;  1WJA A;  1YS7 A;  3K70 C;  4BQN A;  5IOZ A;  2XB5 A;  1GLN A;  4MLO A;  4LG0 B;  1DQU A;  2OZU A;  3HOU J;  2V9V A;  3QPT A;  1BI3 A;  3GO5 A;  1HKT A;  3KET A;  1DU0 A;  1JXS A;  3C1D A;  2R7V A;  1X1B A;  4KIB A;  3D5S C;  4Q5S F;  1WVR A;  3HOZ J;  4BS9 A;  2JA2 A;  4CYD A;  1D0X A;  3JW4 A;  1OYW A;  2Y0M A;  3IH4 A;  4IRI A;  1CF7 B;  4RGR A;  2O0Y A;  2G0E A;  3S14 J;  4P55 A;  3F8B A;  3MN2 A;  1I39 A;  5B1B H;  3VYT B;  1HW5 A;  1U5T B;  1XTA A;  2OBP A;  3WHB A;  3S3O A;  5EGO A;  5F0H A;  3MAJ A;  3HOX J;  1IRF A;  3FMQ A;  3WE3 A;  2L54 A;  1DGW Y;  4GYI A;  1TC3 C;  1L3L A;  4L5E A;  4DBR A;  1OR7 C;  2H8R A;  2A07 F;  2HPM A;  4ENK A;  2GQQ A;  1QO0 D;  3E0J B;  3EUK L;  3GCM A;  4ETS A;  2MYS A;  2X0L A;  2DN0 A;  3CCY A;  2DLL A;  4CSW A;  1AWC A;  2JVH A;  2V4J C;  3LL7 A;  4B3X A;  4AUX A;  3E5U A;  4L5J A;  4CXF A;  1JKO C;  1HDD C;  1HW1 A;  4F7Z A;  3TL4 X;  4I6Z A;  1NH3 A;  2XAS A;  2ZKZ A;  1YQA A;  1IRZ A;  2EZI A;  3OYN A;  3CME I;  1V54 H;  1TW3 A;  2XB0 X;  3UKG A;  2B7E A;  2HI3 A;  5LHH A;  2LYC A;  3FKJ A;  4V2G A;  4M6Y A;  2ZSI B;  3Q3S A;  4BUP A;  2X85 A;  2KIS A;  1WFX A;  1X1A A;  4A3C J;  3QAH A;  3I64 A;  3WGI A;  1SD4 A;  4XL9 A;  2XF7 A;  1BIB A;  1CQT A;  5DCM B;  1U2W A;  2DMT A;  3CUQ C;  5L3B A;  2Q0O A;  1Y8Q B;  2HVR A;  1LUJ B;  1W5S A;  2EA4 A;  3OV8 A;  3HHH A;  1GV5 A;  2O03 A;  2QBY A;  2M2E A;  3BC8 A;  4WF2 A;  5LEJ A;  3S8P A;  2W00 A;  1J59 A;  4A12 A;  1WH7 A;  3JRB A;  2ME0 A;  1YW8 A;  3DU6 A;  4L18 B;  2JVG A;  5DM7 F;  4LB5 A;  3HL2 A;  2FE3 A;  1GV2 A;  2M8E A;  3VPR A;  2LF7 A;  2NOG A;  2YR2 A;  4LK0 F;  2KL4 A;  1W5T A;  2KIQ A;  3G3Z A;  4PDK A;  3TO6 A;  3ZGK A;  1YYV A;  3P9K A;  3OYI A;  4Y52 J;  1XCV A;  3SZT A;  3NWT A;  1MH4 A;  3A0H C;  3LQR A;  3MKW B;  1DU6 A;  4CDG A;  2FX0 A;  1MMN A;  2BBY A;  2AS5 F;  3HGY A;  2GWR A;  2FJ1 A;  5BOX A;  3WGH A;  3OL3 A;  3WHC A;  2HS5 A;  4ENN A;  1ONV A;  1XGS A;  2HDD A;  3FXO A;  2HEO A;  4AIH A;  4AM3 A;  3HB9 A;  1IN7 A;  1Z05 A;  3SQN A;  3CES A;  4M73 A;  2K9M A;  2JA7 J;  3QPS A;  4XKV A;  2M7A A;  4I09 A;  4Y17 A;  3C2H A;  2VB6 A;  4IHX A;  1XMA A;  3CDI A;  1H9G A;  4A3K J;  1T38 A;  2BGC A;  4FX0 A;  4P9U A;  3T8R A;  1ZHF A;  1ZQ3 P;  3BG9 A;  2K27 A;  3U9G A;  4HLY A;  1LB2 A;  1JTX A;  1UZC A;  1I1S A;  2EIM H;  4Y7N J;  2QSG X;  2X6W A;  4KJZ A;  2NAZ A;  2VLA A;  5F1J A;  3QYF A;  3TKY A;  3CQZ J;  2FF4 A;  1KQ0 A;  3F6V A;  1QNT A;  4I0B A;  1UHW A;  1YX3 A;  1VTN C;  5HOD A;  1N77 A;  3KLN A;  3H9G A;  5TJJ A;  4HX4 A;  2W85 A;  3PQK A;  1T39 A;  2IA0 A;  2I10 A;  3AKZ A;  2LK2 A;  3CP8 A;  2BE5 F;  3BR2 A;  4UB6 C;  4IHY A;  2OTJ I;  1E2X A;  3D5R C;  3E3V A;  4Y13 A;  2BXZ A;  1EV7 A;  2D2W A;  4DNC A;  3RIR A;  3GTG J;  5C44 J;  1VQN I;  3K2Z A;  2HGC A;  1F4K A;  4A0X A;  3H1C A;  1T0F C;  1GVJ A;  2ISZ A;  5FLX Z;  1FMW A;  5CVR A;  1XMK A;  1YX5 A;  3R0A A;  4II2 A;  3R61 A;  3KEY A;  2K9N A;  1HBX G;  3Q0U A;  3QPH A;  3IC7 A;  4G8X A;  2COM A;  1V5F A;  4EM0 B;  3MD2 A;  2NS8 A;  3N97 A;  3JCU C;  3ABM H;  5EG0 B;  1U9N A;  4H0E A;  2CRG A;  1K83 J;  1JTY A;  1XSD A;  4IRG A;  1I50 J;  1E3O C;  1U6G A;  5D8K B;  1X3Z B;  4DW6 A;  4Y3O A;  4HX7 A;  1FYK A;  2JMW A;  1NK2 P;  2R92 J;  4IOC F;  4C2T A;  2R5Y B;  4FT8 A;  2GIZ A;  2CUZ A;  2KIU A;  3RSN A;  3H5A A;  3V7C A;  2X48 A;  3PNY A;  2NNN A;  2P81 A;  1HC8 A;  2Y48 A;  5AIP A;  2F4I A;  4NDL A;  3K70 D;  3ASN H;  4EJO A;  1R5G A;  3DCF A;  4KMU X;  3TP3 A;  2OCC H;  1R22 A;  1TWF J;  3VEP A;  1FOX A;  4PGG A;  4CYC B;  1HSJ A;  3OSF A;  5J1R A;  1ZK8 A;  1TQM A;  1VQ8 I;  4O5V A;  2IGN A;  3MKL A;  2BY1 A;  4BYY A;  5A2Q Z;  3I53 A;  2A5Y B;  2M1B A;  2XKO A;  4A5N A;  5JFR A;  1W4M A;  1D8J A;  3FXR A;  3L9F A;  5EEH A;  1PDN C;  2VL8 A;  2E5Z A;  2WAQ N;  1FEX A;  1I6X A;  2ZFU A;  4KN4 X;  5CJ9 A;  3SEZ A;  4DQ2 A;  5HLG A;  1V55 H;  1HCR A;  1D5Y A;  3G73 A;  4IHT A;  1J0R A;  1F43 A;  2K4J A;  2ELH A;  5F04 A;  3IAS 2;  4ITV A;  3W6K B;  1RUO A;  4BQA A;  5E3L A;  1IXR C;  1OJL A;  2LLK A;  3GFM A;  5M5X J;  2F5C A;  1ODD A;  1JGS A;  1L0O C;  4PJN A;  1FZP B;  1GHC A;  2W25 A;  3OMY A;  2IAI A;  3RKW A;  2IS2 A;  2P7V B;  3FK6 A;  1SC7 A;  1KU3 A;  4BY7 J;  2FBK A;  4E7H A;  2IRF G;  4O3M A;  2ZXI A;  2M7B A;  2X6X A;  3ZPL A;  4A2U A;  2LF8 A;  3W6V A;  3B6C A;  3GTO J;  1B4A A;  1ZKG A;  2X6Y A;  4JQF A;  2DOE A;  3H92 A;  2PJR B;  2HZD A;  4E7Z A;  2F5D A;  2Z1D A;  1FOW A;  3I4M J;  4D5C A;  1TWA J;  4GDF A;  4HF2 A;  1IGN A;  3L2W A;  4RAF A;  3VYS B;  4XK4 A;  4FAS D;  3PFI A;  1IZ1 A;  2FU4 A;  2L9R A;  4BJ6 C;  3GWZ A;  3BT9 A;  3K4M A;  4IKF A;  1OFC X;  1MMA A;  4WXC A;  2Q2E B;  2DPD A;  3SZP A;  1HA8 A;  3BQY A;  3BR0 A;  2PI0 A;  2KZG A;  3OYM A;  2CGP A;  1LDK B;  3CMA I;  2BOL A;  2DA4 A;  4F3Q A;  4MIM A;  2UWM A;  1IO2 A;  2E2H J;  1J7K A;  1UG2 A;  2LRD A;  3K4K A;  2V1D A;  2CH0 A;  1LJ9 A;  1NG6 A;  2JJ7 A;  1WI3 A;  5E8I A;  4ZYA A;  3CC4 I;  3LSM A;  2XSD C;  1A36 A;  2IGK A;  2RNG A;  2DA6 A;  1SAU A;  2M4K A;  2L3D A;  3WTT C;  2FBI A;  2IS6 A;  1N75 A;  2XVC A;  1MND A;  2X9D A;  3ISP A;  4AVZ A;  3FMR A;  2STW A;  2EA2 A;  2X6O A;  1XCB A;  2O8X A;  4WWC A;  4HST A;  4ENJ A;  4EJU A;  1SFK A;  1MKM A;  2D5V A;  3L7W A;  2VBZ A;  2VON A;  1MBH A;  2PG4 A;  1Y1V J;  3L2V A;  4A3J J;  1WJF A;  2Y30 A;  5HVQ C;  2XIG A;  4UY8 I;  1RI7 A;  4JBA A;  5LHI A;  1R1V A;  2XPU A;  2CV1 A;  2W4S A;  2X1C A;  3S2D J;  1E3P A;  2HXO A;  2LBF B;  1MSF C;  2E7W A;  1FOK A;  3L00 A;  3SDG A;  3ECH A;  2ZNZ A;  2ZJQ F;  1BR2 A;  2HNH A;  4M72 A;  2DMQ A;  1WZ2 A;  1H8A C;  1YLF A;  3OYG A;  3HOT A;  3QYB A;  1WWX A;  4ZDP A;  4HNU A;  4ZZL A;  2MH2 A;  2DK5 A;  5HNH A;  2P5V A;  2DMN A;  3OIP A;  2IA1 A;  1TWC J;  4XLP F;  2HU9 A;  3MKY B;  2HOA A;  5BPD A;  2VOP A;  1IDY A;  1HXD A;  3AG2 H;  1VQL I;  3MQ0 A;  5E1W A;  2VPL A;  2M8G X;  2L2O A;  3VSK A;  4M71 A;  2HOT A;  5L3G A;  2N8G A;  3KE2 A;  3S32 A;  4CZZ A;  4LIV A;  4XID A;  1S29 A;  1U5T C;  2LP0 A;  1MMD A;  1BN5 A;  2QA4 I;  4BAY A;  3S1R J;  2VIX A;  4EEF G;  3EDP A;  4KIG A;  4M9S A;  3CP2 A;  2ECC A;  3ONQ A;  1YO5 C;  4HSR A;  1A6Q A;  1X1C A;  2QSF X;  1O3Q A;  2XGC A;  2ZC2 A;  1DGR M;  3ERM A;  1EH7 A;  5J6X A;  2HKX A;  1S3J A;  2VBY A;  1D1A A;  2IXS A;  2VAS A;  5K5Q A;  1B6A A;  4RB3 C;  4KDP A;  3V7R A;  5EZG A;  4LIU A;  1QBJ A;  3TP0 A;  4ZDL A;  2KKO A;  1XC5 A;  2Q1Z B;  4QIW N;  4XSX F;  2FMY A;  2MLK A;  4XM3 A;  1BI0 A;  2JUC A;  3OWT A;  5LGN A;  5CLS A;  2E71 A;  3CUO A;  4I0A A;  1U78 A;  2EPF A;  2UZK A;  4MO7 A;  3TDZ C;  3F23 A;  4RMN A;  5KCM A;  1SFE A;  2Y2Z A;  3H5R A;  4C30 A;  3CUQ A;  5LHG A;  2ISY A;  2CQN A;  1SFX A;  3OYJ A;  2WAF A;  2OPT A;  3HZJ A;  2EFN A;  2LY1 A;  5H6R A;  2LY2 A;  3BDD A;  1VND A;  4BE2 A;  1K78 A;  3QPL A;  1Y0N A;  1GVD A;  3ML6 A;  4CCK A;  2CO5 A;  3V7S A;  1YG2 A;  4MTD A;  4NB5 A;  2VC0 A;  3DQV C;  3H36 A;  5LD2 C;  3DBH B;  4L9T A;  5CPR B;  4CCM A;  2IEK A;  3CCL I;  2H1K A;  1Y0U A;  4NBQ A;  4NQW A;  4LJZ F;  1UCR A;  1Z7U A;  1MDM A;  3OR1 C;  2R7O A;  4BDY A;  2UXX A;  3M1C A;  2VE9 A;  2CW8 A;  5FRN A;  3ZN0 A;  5CVJ A;  3IL2 A;  4ZC3 A;  3QOD A;  3OS0 A;  2E1N A;  1Y56 A;  3J81 K;  1VQ9 I;  1FLI A;  4A69 C;  2E35 A;  4LMY A;  4XRF A;  2ECB A;  1I6H J;  3HUG B;  3HOW J;  1UHM A;  3TOB A;  4RGU A;  5DYM A;  2VC1 A;  3VDX A;  3M8F A;  1Z9C A;  3JTG A;  5D5V B;  3BG6 A;  5GPC A;  1J5Y A;  3WTU C;  5H6Q A;  2HPI A;  5EZH A;  3L2Q A;  1R00 A;  3OYL A;  3H0G J;  1S6L A;  2AXL A;  1NHA A;  2LTP A;  1VQM I;  1IUF A;  3V42 A;  1JGG A;  1HQC A;  4FE7 A;  2R5Z A;  2CQK A;  2DTR A;  4QTR A;  2ID6 A;  3F8C A;  1RKW A;  2VKD A;  2E5N A;  3D5L A;  4UUV A;  3AG3 H;  4FX4 A;  4EGZ A;  5L3D A;  3KCC A;  2H8W A;  2DJN A;  2NRA C;  5E8G A;  2HVQ A;  1MNE A;  3IUO A;  2DA5 A;  1Q1V A;  2MLG A;  3BJA A;  2E36 A;  1F9N A;  1XGN A;  2BY2 A;  2FOK A;  1B8I B;  3GTK J;  4I01 A;  2A61 A;  3WU2 C;  3IKT A;  3JSP A;  3B02 A;  1O3R A;  3ZRG A;  2R7S A;  1T56 A;  1BC8 C;  1JHH A;  3FXU A;  2WA0 A;  4I98 B;  1V3F A;  1EA3 A;  2AHQ A;  2DQL A;  2K85 A;  4PJM A;  3W6J B;  4E7I A;  2IBD A;  4XBF A;  2QQA A;  4LFU A;  1P4A A;  3HXL A;  1PUF A;  4A6D A;  3E1S A;  3RPQ A;  3P9C A;  1RR7 A;  3PNT A;  4M3B A;  2ME6 A;  4V2F A;  3NAU A;  3MKZ A;  3CF5 F;  3E7L A;  2DA2 A;  2ZBK A;  1ZG3 A;  3PSF A;  4A3E J;  1T0F A;  2VQG A;  1B9M A;  1KYZ A;  5BQT A;  1IJW C;  2ZJ2 A;  5JLW A;  2KJC A;  3KZY A;  4J01 A;  3PNV A;  5CQE A;  4R8H A;  2KFD A;  5K5O A;  3HJE A;  2VQH A;  1T95 A;  3DTK A;  1IV6 A;  4KFC A;  4XIC A;  5DUI A;  2JZY A;  4ZJZ A;  4MEY F;  2JPC A;  2DT5 A;  1WQ2 A;  5L3F A;  2CJJ A;  1XSV A;  4D7N A;  2WY8 Q;  2K02 A;  4N9H A;  1APL C;  4A3B J;  2V26 A;  3MMY B;  2GIV A;  1QZZ A;  4EJW A;  1YJ9 I;  3WTW C;  4IJA A;  4IX7 A;  3FM5 A;  3KZZ A;  2XUB A;  3IP4 B;  3K9T A;  4UXN A;  1BI1 A;  1JT6 A;  5FD6 A;  5FJ8 J;  3L2R A;  2P6T A;  3BJO A;  1AKH B;  1LFB A;  2W82 A;  3ABT A;  3BJ6 A;  4XLA A;  3KP6 A;  1P2F A;  4CZC A;  3E5X A;  3ZP5 A;  4HQE A;  3BG5 A;  3QP5 A;  1WJE A;  4G9Y A;  4XRS A;  1HF0 A;  4Q48 A;  4KA4 A;  1I27 A;  3ZMZ A;  3VSL A;  3AL0 C;  1ITY A;  4U0V A;  3SFZ A;  2XAQ A;  2ZME C;  4S05 A;  2XRN A;  3KEO A;  4RGX A;  4RLQ A;  1R5I D;  5BPI A;  3QYE A;  1X2M A;  1R49 A;  2J5O A;  5IY5 H;  3FXJ A;  3K4N A;  4IRH A;  1X3W B;  2GOX B;  2GLO A;  2HTJ A;  2O9L A;  2K9S A;  3P5J A;  5E3O A;  4M3G A;  3DKY A;  3H3V K;  2FA5 A;  3G4S I;  2EV5 A;  4A6E A;  2J5P A;  3HSF A;  2ESN A;  1YE9 A;  2B0L A;  4C2M J;  1ZRF A;  2M9H A;  1B72 A;  3K1P A;  3ZQC A;  2XF5 A;  1SEU A;  3BWG A;  2CYY A;  2V6E A;  1D1B A;  1ERD A;  3I9V 2;  4A3M J;  4ZZD A;  2KRH A;  3F3X A;  2VJ5 A;  3LSG A;  4Q47 A;  2CQQ A;  3KEQ A;  4KT6 A;  1RZ4 A;  5DV5 A;  5J4V A;  4N0B A;  1VQP I;  3S16 J;  1P4X A;  4GRI A;  1I3Q J;  5FKM A;  5D5W B;  2BVL A;  3V8J A;  3WU0 A;  2F5V A;  3O8H A;  1OYI A;  1QU3 A;  4CHU A;  1X1D A;  2QBY B;  3FWE A;  3CJR B;  4CA0 A;  2Y31 A;  5IP6 A;  3WTV C;  2XAG A;  5LRR A;  4OWR B;  2F5E A;  4JX5 A;  2CW0 F;  4DZP A;  1UAA A;  4OIO F;  4NC6 A;  3P7N A;  2E19 A;  2M3A A;  2X51 A;  3DXJ F;  3OS1 A;  3JRG A;  4A3L J;  4RS8 A;  2R7R A;  3FXQ A;  1STZ A;  3LSK A;  3K10 A;  3E97 A;  3KYL A;  1FYL A;  3T5X A;  4P96 A;  5ILV A;  1XMX A;  2Z5U A;  3I3L A;  2K9Q A;  5KAF C;  1ZYR F;  4DZJ A;  5BMZ A;  2EIN H;  2HXI A;  1LEA A;  3ZR8 X;  2QKM B;  2CSO A;  2FML A;  2W57 A;  5EYR A;  2ZXJ A;  2W7N A;  4ASN A;  4CGZ A;  1S7A A;  3F21 A;  1FT9 A;  3U1D A;  3S17 J;  2LKP A;  1IN8 A;  3LSJ A;  1MJ9 A;  1H89 C;  2LH9 A;  1N78 A;  1S7E A;  5ERI A;  4C3J J;  3QU3 A;  2DBB A;  5IYB J;  5IP7 J;  5HDN A;  2B9S A;  2M87 A;  4LG0 A;  1PYV A;  1P4W A;  4BKX A;  1Z0X A;  4OU0 A;  2RV8 A;  4RM2 A;  4LLN A;  2TCT A;  3HSE A;  3ESW B;  2MC4 A;  1HOM A;  4J00 A;  4EVI A;  5E1X A;  2ACJ A;  5K5R A;  1OQY A;  1X19 A;  3I59 B;  2EV6 A;  2KZV A;  4E7J A;  2VJ4 A;  2L7M P;  2P8T A;  2ZXW H;  5HDK A;  4YIR X;  1CF7 A;  1QHH D;  2XGE A;  3CCU I;  1E17 A;  1EKE A;  1GXQ A;  3CMY A;  1DPR A;  2HFH A;  2NOJ B;  1T98 A;  2QEN A;  3Q9V A;  2NXN B;  2QYO A;  1KZH A;  1U5T A;  4MEX F;  1R6R A;  1TBX A;  1KU2 A;  3FX3 A;  4P1W A;  1R9T J;  2HTS A;  1TT5 B;  4BNC A;  1W7P B;  3KYD B;  3KX2 A;  2O61 A;  3W2A A;  3EET A;  3CCS I;  1FY7 A;  1TQI A;  1VQO I;  1MNM C;  4B09 A;  3FZV A;  4JYK A;  3LFK A;  4UHT A;  2C6Y A;  4B48 A;  1TWH J;  4AID A;  2EIK H;  5IPA A;  4F52 A;  1D8K A;  1UEL B;  2VBX A;  3E6B A;  3GFJ A;  1V5E A;  1ETQ A;  2QQB A;  3DPU A;  5F0F A;  3TO9 A;  2DYS H;  3GXO A;  4CCO A;  3OYF A;  2WV1 A;  1ACI A;  5GAH J;  2L01 A;  5M3M J;  4XLN F;  4BBS J;  2IVM A;  3M4O J;  2QQ9 A;  3CCE I;  3WU1 B;  2CV2 A;  2OD5 A;  4JX6 A;  1OCR H;  1X4P A;  3GTM J;  1IF1 A;  2LVS A;  4BDZ A;  1YS6 A;  3K1N A;  3J7A Y;  3PO2 J;  2BXY A;  2L0K A;  2VKV A;  1WHU A;  2QEX I;  2XAH A;  4XKC A;  5EF6 A;  3KPH A;  3I58 A;  2F6C A;  3CO7 C;  2K3F A;  5DCM A;  4RB1 A;  5DTD A;  2FOW A;  3WOD F;  2NS7 A;  2CW7 A;  5CVI A;  4HQM A;  2K9L A;  2ETH A;  3FXK A;  2NVX J;  3DFG A;  5JHF A;  1IAW A;  3KIO A;  4EGY A;  4BBR J;  2RN7 A;  2NYX A;  2BHZ A;  1W0U A;  2XAJ A;  3AFH A;  3SFI A;  3UNG C;  5FLM J;  1R4N B;  3QWL A;  4MFE A;  3F22 A;  4Q4Z F;  1YRN B;  2HQ5 A;  2HZT A;  5GAE J;  3PFY A;  3ZQH A;  3ZQF A;  1MZB A;  3ELK A;  1R1U A;  4HPQ A;  1WI9 A;  2R7Q A;  3PIP F;  3ZXS A;  1WPK A;  3NEU A;  3COA C;  1R4M B;  2A3S A;  2MSY A;  4BXX J;  2QCO A;  3RDI A;  3GBG A;  4B1R A;  4C3I J;  3S1Q J;  1TLH B;  3RKQ A;  1LVA A;  3J80 K;  4EMS A;  2COB A;  2TDX A;  1K4S A;  3BOQ A;  5K7Z A;  2E34 A;  1TQP A;  3A03 A;  2ZNY A;  1VQ5 I;  4L0Y B;  4WXH A;  2GBY A;  5J4Y A;  5DD8 A;  2UXN A;  2DT6 A;  2JRT A;  2DFH A;  4BAC A;  1POG A;  4G12 A;  5HLI A;  2XKP A;  2QVO A;  5L3E A;  1TWG J;  4UUS A;  3DV8 A;  1ZRC A;  4RA2 A;  3FM3 A;  4NNJ A;  4ZDO A;  4DYC A;  4XLE A;  5E3M A;  3HM5 A;  3DTI A;  4XKW A;  3LNQ A;  1G3T A;  1JUM A;  4ON0 A;  3AL0 B;  4HEA 2;  1LPQ A;  3E6D A;  4BHC A;  2JA8 J;  2ZME B;  5E1Z B;  1LEB A;  4HX8 A;  3DEU A;  3X2Q H;  2H6B A;  5ICC A;  3SJM A;  2KP6 A;  4LLL A;  2IA2 A;  2EFQ A;  2L7F P;  5IT3 A;  1O3S A;  4M6V A;  3R4K A;  2XPW A;  2BHY A;  3REO A;  3C2G A;  4XN0 A;  2DK8 A;  2K3P A;  2BY0 A;  3ASO H;  4UV9 A;  4H4K C;  4Y15 A;  4G7H F;  1R1T A;  4II3 A;  1XD7 A;  4RAY A;  2HKO A;  4OIQ F;  5DDG A;  1TW2 A;  4B4C A;  2Y69 H;  1MD0 A;  4RBO A;  4G6Q A;  3OOP A;  1FTZ A;  1UMQ A;  3OY9 A;  3CMM A;  4M6X A;  2FUG 2;  4KNY A;  2HYJ A;  5B3S H;  1LFP A;  1OYY A;  3BZK A;  4M9Z A;  3RJP A;  2R7Z J;  3F8M A;  5CVU A;  1ZAO A;  1F36 A;  1G3W A;  1YJW I;  5FLX K;  2Z9O A;  3WGG A;  1OCZ H;  3K4J A;  4RDU A;  1LDD A;  1FTT A;  4BGD A;  4ZYH A;  4B47 A;  2CQX A;  3A02 A;  4AWX B;  3NAR A;  1MBK A;  4HYE A;  3A1Y A;  4N4N B;  2IP2 A;  5ICE A;  4IO9 F;  1DUX C;  5EG0 A;  3VOE A;  1OCP A;  1HW2 A;  1J2X A;  1K4T A;  2IJL A;  5HOO A;  5F64 A;  3O6B B;  2R5Y A;  2PN6 A;  4AIK A;  1LE8 B;  5IT9 K;  3E6M A;  1O7F A;  2HOE A;  4ZH4 F;  3FIS A;  2ELK A;  3JRE A;  2KLO A;  2JRM A;  3U2R A;  1FWZ A;  3I71 A;  4MQ9 F;  1NK3 P;  1FX7 A;  4BQQ A;  1SAX A;  4CYC A;  2V9K A;  2YX4 A;  2ZFW A;  4HZF A;  4KT5 C;  4D5F A;  4QLC U;  4PGH A;  2V9P A;  4BY1 J;  3I5U A;  1ETX A;  5A2Q K;  3H9J A;  1JHF A;  1XGO A;  4PSW A;  4FQG A;  1Y8R B;  1YHQ I;  1ETK A;  1U9O A;  2EZK A;  3EYI A;  2H1L A;  4M9X A;  3BR5 A;  4G94 A;  2L7K A;  1IXC A;  4XSZ F;  4IVN A;  4CIC A;  1KU7 A;  1WH5 A;  1V5G A;  2R7U A;  1IN5 A;  2DFF A;  4DBQ A;  2GXA A;  4UVC A;  4DJA A;  2KJB A;  3IH2 A;  4Z6Y A;  5D4R A;  1NTC A;  1KU9 A;  3ERE D;  4QWQ A;  1ULY A;  3S93 A;  2MC3 A;  4U0Y A;  3OYH A;  2NS0 A;  2CFO A;  1FPQ A;  3S2H J;  2OV7 A;  5E79 C;  4E70 A;  4DIQ A;  3GEZ A;  1FJL A;  4C3H J;  4EM2 A;  1O4X A;  2DPU A;  5F27 A;  3M7G A;  4W1U A;  4DOZ A;  1QPI A;  3SXY A;  1O57 A;  1RET A;  2M45 A;  2XAF A;  4XLC A;  2Y0S A;  2PMU A;  2P5L C;  1H0M A;  2PJR A;  1WKM A;  2WAE A;  2DXI A;  4P9F A;  2HQN A;  4IHS A;  1UHS A;  3GME A;  4M3D A;  3BZC A;  2A68 F;  4PFO A;  1V4R A;  2V1N A;  1ZG1 A;  4AD9 A;  1YI2 I;  2LNB A;  4O6J A;  4M3E A;  4PK4 A;  5FRM A;  4I02 A;  2X1E A;  5IOY A;  2R7X A;  5J40 A;  1FSH A;  4MNU A;  1OR7 A;  4Z2Y A;  4U7B A;  3FKI J;  3CJQ B;  3OIO A;  2Q2E A;  1P7J A;  2H6C A;  3FXM A;  4XLF A;  3JR9 A;  3RCO A;  2K5C A;  5TIS C;  2L9S A;  1PP7 U;  4D7M A;  5DS9 A;  2A69 F;  2JPB A;  2O7O A;  4J19 A;  3HDD A;  5GPA A;  2DFE A;  5HS7 A;  4HNV A;  3DPT A;  5ICF A;  4ABZ A;  2F4M B;  4BEH B;  2Z99 A;  1EF4 A;  2CUF A;  4GCV A;  3IRR A;  3IHU A;  3U1K A;  3CCM I;  3J7A O;  4ANJ A;  1MMG A;  2LSO A;  2BW3 B;  3A0B C;  3PQJ A;  2P4W A;  2E1O A;  5DD4 A;  1G3S A;  2STT A;  2OCE A;  2AQF A;  2F48 A;  2YS9 A;  3KZI C;  5JR3 A;  2DOA A;  5E3N A;  3IV5 A;  2KDO A;  3EYY A;  1KQ8 A;  2HOS A;  3K2A A;  5E18 F;  1XS9 A;  1LDJ A;  1AA7 A;  5CVV A;  2DOF A;  5C3E J;  2R0Q C;  2CV0 A;  1P92 A;  3ZMD A;  2MW8 A;  4M3F A;  4R79 A;  2DO7 A;  5TGT A;  4WXD A;  2VKE A;  2LBF A;  3WTY C;  3T8T A;  2BEO A;  5L3C A;  4LIT A;  3B6A A;  5FKN A;  3PJR A;  2EB7 A;  3HTU A;  3JAM K;  4HF1 A;  1O7L A;  2CMP A;  2RC4 A;  1P7I A;  5IYD J;  1ZGW A;  3DEE A;  1ZEL A;  4UB8 C;  4S04 A;  1TNS A;  2WTE A;  2Q8K A;  4D9J A;  1VI0 A;  2IGO A;  3EUH C;  5BS6 A;  1A31 A;  1YJN I;  1USS A;  3M9A A;  1EH8 A;  1TNT A;  3TOA A;  3BTJ A;  2RDP A;  3VWB A;  5DM6 F;  3HHG A;  2PBI A;  5HLH A;  3G6E I;  3ZMV A;  1G59 A;  4A3F J;  2G7U A;  4Y4R A;  5DUK A;  3ZMS A;  3KFW X;  4XN3 A;  2DDA A;  3CJT B;  3L2U A;  2EIJ H;  3HSR A;  3VB2 A;  3DLA A;  2GM4 A;  2RVC A;  5GAD J;  3CO6 C;  3G71 I;  1MBJ A;  3W3C A;  3EPZ A;  3EUA A;  4IQJ A;  4HV6 A;  3QRF F;  1ZN2 A;  1KGS A;  3ABL H;  3S1M J;  1MBE A;  4LD5 A;  1K6Y A;  3PUB A;  3FBI B;  3V8L A;  1TZL A;  1Y39 A;  4MTE A;  3BG7 A;  2KRF A;  3GTQ J;  2OAZ A;  4IPA A;  3SDB A;  4A3G J;  3CF2 A;  1K7A A;  3K4C A;  1EH6 A;  1ETV A;  3HOV J;  2M0C A;  3OYE A;  4FE4 A;  1WJC A;  4YEL A;  3FBN B;  2LKS A;  1LKX A;  2H09 A;  2GZW A;  3BCB A;  3E6C C;  3IRQ A;  1VQ7 I;  4DGW B;  2L9V A;  5J1U A;  1G6N A;  1D0Z A;  2Z33 A;  3ZMU A;  1S72 I;  1SVM A;  1B1B A;  3GZ6 A;  1R36 A;  3S3N A;  1IRG A;  5HDG A;  1N25 A;  3QQA A;  4PUS A;  1ZTR A;  5LFA A;  4MHG A;  2PFB A;  4IQ4 A;  4YFX F;  1JE8 A;  1X58 A;  4HDU A;  2ZJR F;  1IV8 A;  2A05 A;  4M74 A;  2NVQ J;  3TDU C;  3V8K A;  3K4B A;  3I55 I;  5EJC A;  2UV1 A;  2RNJ A;  2OU2 A;  4PCQ A;  3HOS A;  1A35 A;  3CC7 I;  2L02 A;  2LC2 A;  3VYU B;  3WG9 A;  1DP7 P;  5LRS A;  3D0S A;  2DMP A;  2LR8 A;  4YII A;  4CCN A;  1QZE A;  3KP2 A;  4HLX A;  2B63 J;  3LFU A;  4MFD A;  5E17 F;  5K1Y A;  5E20 A;  2O5R A;  4U88 A;  5J8F A;  3OYK A;  4F55 A;  3A01 A;  2OC6 A;  2PMZ A;  3HUG A;  1SAN A;  2L9N A;  2VOD A;  5GAG J;  1ZLJ A;  1U8R A;  4F93 B;  1XDS A;  3GLL A;  1ENH A;  2FD5 A;  1EJ9 A;  5FKK A;  3CCJ I;  5J47 A;  2R93 J;  1RIO H;  3OYB A;  1WJB A;  4EQQ A;  1YW7 A;  4XLH A;  3GUD A;  2QF7 A;  1OKR A;  2DW4 A;  5FFX A;  1GDT A;  1YOV B;  2W84 A;  3M8E A;  4XNF A;  6PAX A;  3VFZ A;  3HYI A;  3NQO A;  4PSX A;  5CYV A;  1UFM A;  1BJZ A;  1W1W E;  3I0T A;  3CCV I;  3F9K A;  3LQQ A;  3RPU D;  2MAB A;  2L4M A;  3ABK H;  2I8D A;  1FIA A;  2QLZ A;  4U7D A;  1FNN A;  2QGU A;  3ZN1 A;  4FCY A;  2ESH A;  2V1X A;  1B8I A;  5EGO B;  1OCO H;  2R3S A;  3K6G A;  4BXF A;  2GAU A;  4NHJ A;  4XMY A;  4L0Z B;  4EAT A;  5D5X B;  2Z3Y A;  3J7Z I;  5FFZ A;  3GFL A;  3BR3 A;  3EQL F;  1J75 A;  3BP8 A;  1GT0 C;  3DU5 A;  2YUS A;  1QGP A;  1ZGA A;  2DU9 A;  1VQ4 I;  1MSE C;  4IHW A;  1PP8 F;  4I76 A;  3CZ6 A;  3HG9 A;  2IW5 A;  2M34 A;  3WTZ A;  5LLQ A;  2DTZ A;  2RQP A;  3GZN B;  3FMS A;  2PMZ N;  1ON1 A;  1BL0 A;  2KMU A;  1JUP A;  2MFZ A;  4RM3 A;  1MBF A;  2E2J J;  5DEQ A;  3DF8 A;  4BHP A;  1OMI A;  2NVY J;  5JVG F;  2OA4 A;  2AO9 A;  1IDZ A;  4C2U A;  5IYC J;  1KA8 A;  3M8J A;  1QRY A;  3LA3 A;  3W2W A;  5KVR A;  3C3W A;  1BJA A;  3KP7 A;  2M0M A;  2VE8 A;  2YU3 A;  3HKZ A;  3M3Y J;  2EQR A;  1HLV A;  1MGT A;  4CH7 A;  4HA8 A;  2HQR A;  4AIJ A;  4I2O A;  4XOP A;  1WJ5 A;  2IGM A;  2QZ8 A;  3H5N A;  3DBR B;  1G4D A;  3DPL C;  2BV6 A;  1P6R A;  2MA3 A;  3I54 A;  2W24 A;  4UNO A;  3FDY A;  1JJ6 C;  5IP9 J;  1QPM A;  1PJR A;  3R60 A;  1F1Z A;  1QHG A;  2ZSH B;  3SYT A;  2YX7 A;  1AKH A;  1F5T A;  2CS3 A;  4UUT A;  3RKX A;  3KP4 A;  3RYP A;  2JT1 A;  2F2E A;  1RUN A;  5D4S A;  3MCZ A;  5D5U B;  4IF4 A;  2E1M B;  1YFH A;  1WSU A;  1TTY A;  2MG4 A;  2XSJ C;  3S2W A;  3KP3 A;  2VN2 A;  2JA5 J;  2I5U A;  2YPR A;  3LSH A;  4GO1 A;  1BOA A;  1QA6 A;  3RPU A;  4RLF A;  3GTL J;  2XAU A;  3Q5F A;  3AG1 H;  5FLV A;  2IS4 A;  3G1L A;  3DBL B;  2VQC A;  2Y9Z A;  4RB2 C;  2MGQ A;  4BE1 A;  3N05 A;  2DT7 B;  2P6S A;  2JQ7 A;  4U0W A;  4C9Y A;  3WG7 H;  4A0Y A;  2VJJ A;  3HKZ N;  2R7W A;  1VFC A;  2BYV E;  4EM1 A;  3JRC A;  2D45 A;  2BY3 A;  1W36 C;  1MIJ A;  2BVM A;  4PZJ A;  1RPW A;  4K2E A;  3CTA A;  4XKB A;  1R71 A;  2E2I J;  2V1U A;  1ZAR A;  2QWW A;  3HBL A;  4AU7 A;  1RR8 C;  1WJD A;  1REP C;  5F1R A;  2VOO A;  2FNP A;  1W7P D;  4AC0 A;  3F0C A;  3S15 J;  3BLY A;  5KHD A;  3WE2 A;  3CJN A;  4YEJ A;  3OOU A;  3LA2 A;  1IRX A;  3O8G A;  1MH3 A;  4B43 A;  5ILU A;  5FO5 A;  5TRD A;  2FSW A;  2E60 A;  1OLT A;  1R58 A;  2EH3 A;  4RGS A;  2LKX A;  1JUS A;  5F0C A;  5BNG A;  4HAM A;  4G7Z F;  2JUG A;  1BOB A;  2LOO A;  4JK1 X;  5ICG A;  4WCG A;  1ZR4 A;  2V7F A;  4I7H A;  4LB6 B;  3GF2 A;  4OAY A;  1NG7 A;  3RQI A;  4EJT A;  3FXL A;  2CFX A;  3K1M A;  1B59 A;  3L09 A;  3VOD A;  1JJ8 C;  2A6E F;  1MW7 A;  4IL6 C;  5KAI C;  1FP2 A;  5H20 A;  4I99 C;  5J1Y A;  4HRI A;  3CCR I;  3IAM 2;  2HVS A;  4GGG A;  3GTJ J;  1XSX A;  3S1N J;  1H9T A;  3JRI A;  4HOB A;  3J80 Z;  3A2K A;  1X1P A;  2HR3 A;  1WGX A;  5D8L B;  3BZ6 A;  3BPX A;  3TMO A;  3PIO F;  1T08 B;  2NNY A;  2VI6 A;  4ENM A;  4X1E A;  2VT2 A;  2ELJ A;  1MJB A;  2KQR A;  5EEG A;  4NC8 A;  1I1G A;  1K79 A;  1FP1 D;  1R5H A;  3BR1 A;  3CCQ I;  2JWT A;  2DQR A;  2DOD A;  1OPC A;  4UUS B;  2DDB A;  2LRE A;  3H35 A;  3EUH A;  4A5M A;  5K7F A;  5ED4 A;  1ZR2 A;  5B66 C;  1BBY A;  3I59 A;  5FKL A;  1M1E B;  2EFP A;  1S8N A;  2XRL A;  1D0Y A;  4BE0 A;  4N9I A;  1VF9 A;  4GYG A;  2XF6 A;  1T33 A;  1IN4 A;  4OAZ A;  4HF0 A;  3QOP A;  3LSI A;  1Z7L A;  4BU2 A;  2VUM J;  2D1H A;  2JK3 A;  4LGW A;  2OF7 A;  2LD5 A;  4HV5 A;  3LMM A;  3LA7 A;  2PLY A;  2ID3 A;  4BHB A;  3RTR A;  1OCC H;  4BJT A;  4AVP A;  3A4C A;  2M4G A;  1A5J A;  4E4H A;  2K86 A;  2IS1 A;  3LAP A;  4QSH A;  2FQ3 A;  1RES A;  2RQQ A;  5GTI C;  4ZTF A;  3F6O A;  4X6A J;  1W7P A;  2GXB A;  3OYA A;  3OL4 A;  1Y6I A;  4JOM A;  4RAZ A;  3CLQ A;  2WAQ A;  2TRT A;  5EDN A;  2PX9 A;  4YRV A;  2LMD A;  3MFK A;  1FMV A;  2EK5 A;  2DI3 A;  4WK8 F;  1G2H A;  1Z77 A;  1S9H A;  2Z2S B;  1SD7 A;  1D1C A;  1KQ9 A;  2E7X A;  4LK1 F;  5JLX A;  3D1N I;  2DCE A;  4EJV A;  3AG4 H;  5D6E A;  3OS2 A;  1ZH5 A;  1E3H A;  3E5Q A;  1LNW A;  1W5C C;  3HEF A;  2GA2 A;  3FF5 A;  1U3E M;  2A5W A;  1PVE A;  2DAO A;  2JN6 A;  2M5W A;  1LFU P;  4PFP A;  4BXU A;  4NC7 A;  3GYH X;  1X2N A;  3DWL E;  3LAJ A;  1OCT C;  1FBU A;  5HNF A;  1HST A;  3IH3 A;  1U8B A;  5HS9 A;  1Z21 A;  4G7O F;  4V19 K;  4XON A;  5IT9 Z;  2MD0 A;  3I4N J;  3BTL A;  5JHU A;  2XV4 S;  2LG4 A;  4N4O B;  2X1D A;  3N4M A;  1Z3X A;  4IHV A;  2ADU A;  4LLG F;  2YSR A;  3ECO A;  1K61 A;  4RAG A;  4OIN F;  3V4G A;  2R7D A;  5GTH C;  2GOM A;  1JKQ C;  2XPV A;  1FIP A;  1I5Z A;  5LEK A;  4OOI A;  1Q1H A;  4LOC A;  1IW7 F;  4E7S A;  4BL0 B;  1FBQ A;  2VBW A;  3BTC A;  2AQE A;  5AON A;  1YRN A;  3P9I A;  3MZ8 A;  3Q0W A;  5J8C A;  2Z16 A;  1JKP C;  5FRO A;  5GP9 A;  1YIO A;  1SD5 A;  3F8F A;  5D6F A;  1GXP A;  1VQK I;  2EIL H;  2F5F A;  4Y33 A;  1AU7 A;  4IZZ A;  2KDZ A;  4G6T B;  2P5K A;  1RRJ A;  3DKW A;  3LSR A;  2VQL A;  4OMY A;  1JKR C;  4XOR A;  3DEW A;  3R0J A;  4GFB A;  3BTI A;  1TL8 A;  3QOE A;  3HC7 A;  1QQI A;  3ROU A;  1JI8 A;  3H3Z A;  1XX5 A;  1ETY A;  3OSG A;  2HWV A;  4BQO A;  3G1O A;  1WRJ A;  1U0J A;  1XGM A;  2F4O B;  2VKH A;  4UVA A;  4HW0 A;  3C2B A;  2CU7 A;  4QPQ A;  2EWN A;  4L9N A;  3PL8 A;  3QU6 A;  2LFB A;  3BY6 A;  1HKQ A;  1SMY F;  2L5Q A;  4XRS G;  4DYR A;  3TED A;  3OR2 C;  1BR1 A;  1AHD P;  3SEQ A;  3F72 A;  2ZME A;  2VT3 A;  3BCA A;  3CDL A;  4PJ0 C;  3UR3 C;  4JX4 A;  3SHF A;  2EZH A;  2DA7 A;  1J09 A;  4B3A A;  1W36 D;  2DJI A;  2G7H A;  4ZYE A;  3K4L A;  1G8X A;  1FOY A;  3T1B A;  2O8K A;  4KIS A;  1P9Q C;  2H27 A;  2W48 A;  1YW9 A;  4L5I A;  2O6G E;  4MGR A;  1Z6R A; 
#chains in the Genus database with same CATH homology
 3I56 I;  1VQ4 I;  1YIJ I;  1VQP I;  1VQ7 I;  3CD6 I;  1YI2 I;  1FOW A;  4IOA F;  2OTJ I;  3J7Y J;  1S72 I;  1ACI A;  5GAH J;  3CME I;  3CF5 F;  3CCE I;  1VQN I;  5JVG F;  4V19 K;  3CMA I;  1YJW I;  2QEX I;  2ZJR F;  2K3F A;  2FOW A;  3CCM I;  3I55 I;  3CCR I;  3CC4 I;  4IO9 F;  3CC7 I;  2OTL I;  3CCL I;  3CC2 I;  5DM7 F;  1YJ9 I;  3PIO F;  5GAE J;  4IOC F;  1VQK I;  2ZJP F;  1VQ9 I;  4UY8 I;  1HC8 A;  3PIP F;  5GAG J;  2E35 A;  1VQ6 I;  3CCQ I;  3CCJ I;  1FOX A;  2ZJQ F;  1VQ8 I;  1YJN I;  1YHQ I;  1QA6 A;  2E34 A;  1VQ5 I;  5DM6 F;  3CCU I;  1VQM I;  3G6E I;  1YIT I;  3CCV I;  3DLL F;  1VQL I;  2NXN B;  3CJT B;  2H8W A;  2JQ7 A;  3G4S I;  5GAD J;  3G71 I;  2E36 A;  2QA4 I;  1Y39 A;  3CCS I;  1FOY A;  1VQO I;  1MMS A;  3J7Z I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...