1ACIA

L11 ribosomal protein rna binding domain, nmr, 20 structures
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
76
structure length
76
Chain Sequence
MTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cooperative interactions of RNA and thiostrepton antibiotic with two domains of ribosomal protein L11.
pubmed doi rcsb
molecule tags Ribosomal protein
molecule keywords L11 RIBOSOMAL PROTEIN
total genus 13
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1997-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1aciA00
3CC7I 2ZJQF 1YJNI 1YI2I 1YHQI 2FOWA 2OTLI 5GADJ 1FOYA 5GAGJ 3PIOF 1VQOI 4V19K 2K3FA 1FOXA 4IOCF 3CCUI 1VQ5I 3CCQI 3J7ZI 3G6EI 1S72I 3PIPF 2QEXI 1MMSA 2QA4I 3CD6I 1YIJI 2OTJI 3CCRI 1ACIA 3G4SI 5DM7F 3CMAI 2ZJRF 3CCVI 4IOAF 3J7YJ 4IO9F 2E35A 2E34A 1VQ4I 1HC8A 1YITI 1VQ6I 3CC4I 5GAHJ 3CF5F 3G71I 3CCLI 2ZJPF 1VQ9I 2H8WA 3CCEI 1FOWA 1VQLI 1VQKI 5GAEJ 1YJ9I 2NXNB 3I55I 3CMEI 1VQ7I 5DM6F 2JQ7A 1VQPI 4UY8I 3CJTB 3CCMI 3CCSI 2E36A 3I56I 1VQMI 1YJWI 3DLLF 1QA6A 3CCJI 5JVGF 1VQNI 1Y39A 3CC2I 1VQ8I
chains in the Genus database with same CATH superfamily
2O7OA 4Y52J 3BJAA 2KHMA 2X51A 3BG6A 3JW4A 4R8HA 2LLKA 4DYQA 2WBMA 4DBRA 1OR7C 2JUGA 2RNGA 2R93J 1LQ1A 1VF9A 2PJPA 1BI0A 4JP0A 5FKOA 3BPVA 1GDTA 4PK4A 1JJ8C 5GP9A 3MZYA 2P81A 4XLNF 1PP7U 3PM1A 4U7DA 1VQMI 3H9GA 3LSKA 1SFXA 1JHHA 3BG7A 2Y0MA 4M71A 2DT6A 2BE5F 2V9PA 3ASOH 4B3AA 3TGNA 4EGYA 1O3SA 4C2MJ 2R7OA 2ZC2A 5C44J 4WWCA 5EZGA 4EQQA 4XM3A 2F48A 2PQ8A 3L09A 2MLGA 3Q9SA 4W97A 3L2CA 1A35A 3S32A 4BXFA 3CC4I 4ESJA 3B02A 1YTYA 4G7OF 1VQKI 5ILSA 3CCMI 3FDYA 1K79A 4CSWA 5EJCA 2A69F 2WY8Q 5LRSA 5GPCA 4EM1A 4BEHA 5K5RA 4HDVA 1S8NA 3BR0A 1NTCA 2EIMH 1D1CA 2BZTA 3HSFA 3E6CC 2M1BA 2H1KA 4XONA 5DDGA 3AG4H 4CCOA 1T0FC 2WWYA 1RR7A 1KZHA 1GV5A 2MW8A 4ZYDA 3PSIA 4ZTFA 5K5OA 4RAFA 3CCEI 1VQLI 2ZO4A 3OIOA 1T08B 3CCSI 1G3WA 1JUSA 4CCLA 3TQNA 5EEHA 2WAQA 4M6VA 1W0UA 1P9QC 1D5VA 3M7GA 4H4KC 1FPQA 5LLQA 2IAIA 4A5NA 3GTPJ 2LYCA 5E3MA 1ETWA 4JOMA 2LC2A 3HGYA 4IL6C 5B1AH 4V19K 4I7HA 4PFOA 3OL4A 2ACJA 5EG0B 3HB9A 5D6FA 1JE8A 1FT9A 2DFFA 1BOBA 1X3WB 3BZCA 3FM3A 3MZ8A 3V7RA 1I50J 3E5QA 1I6HJ 2DODA 4RGRA 4XLCA 5GTIC 3G71I 4M6XA 1FOWA 1U9OA 1ETOA 3MKLA 2EH3A 3U21A 3LSJA 2L54A 1D0ZA 1R5ID 4JK1X 1MBHA 3FK6A 4OIRF 4JX5A 2IRFG 2BY2A 2VC1A 1F4KA 5L3GA 1ZGWA 3F6OA 3JREA 5FRMA 4L5EA 1PUFA 4D7NA 2VT2A 1T56A 2IA0A 3WGHA 1I3AA 2HDWA 4WXCA 3SFIA 5ILUA 2FU4A 2E1MB 5ICCA 3GFLA 2MH2A 3IC7A 4G6QA 1G2HA 1TTYA 1G3YA 1SMTA 3GUDA 2DAOA 3V7SA 2Y9YA 3K70C 1U3EM 2BV6A 4X1EA 2F5VA 1A6QA 3F0CA 2ZJQF 4NC6A 2ZSIB 3ZQ7A 2DYRH 2XB0X 3HOZJ 2UXXA 2Z16A 4LIUA 1TBXA 1KU7A 4ESBA 1T39A 2LKSA 1S72I 2L9SA 2NVXJ 1F1ZA 2X6WA 2VJ5A 3FXMA 2HQNA 2R7XA 2E7XA 5F1JA 2BY0A 4U7BA 1S7AA 1XCBA 3OYJA 3I64A 3LSPA 2Q2EA 4XMYA 4IQJA 4LB5A 3BC8A 3N97A 5EDNA 1RPWA 3LWFA 1WCMJ 1Z77A 2EQRA 4F92B 1XDSA 5IOZA 1YRNB 3TDUC 1OJLA 2KP6A 5D5WB 3K70D 1BN5A 2DK8A 4WF2A 2CFXA 3HKZA 4GYIA 4M74A 2DPDA 5FB2A 2LFBA 4UVCA 1SD4A 1UCRA 4Y17A 3WTZA 2PX9A 2A3SA 1RNLA 2QSGX 2QF7A 1XTAA 4HG2A 1HA8A 3GF2A 4BHPA 5EZHA 3UKGA 4XRSA 2RNJA 1P4WA 1IUYA 3FF5A 2FE3A 3PO2J 2GIVA 3CO6C 4EJVA 3TBIA 3J7ZI 4GFBA 1BR1A 3G1LA 1IJWC 1J75A 3ZQGA 4GGGA 2NNNA 1CF7A 4OINF 2JZYA 3RYPA 2QLZA 5HLGA 1OCTC 2A5YB 4IVNA 3ABMH 1BW5A 1OQYA 3O8HA 1K7AA 3SQNA 3ZXSA 1IF1A 4YFKF 4FTHA 3P9IA 1XSXA 2F5CA 2EZHA 3HTUA 4UVBA 2RDPA 2EIJH 1UHWA 4CYDA 2DFEA 2PBIA 2NVUB 4D5CA 1ZAOA 4RBOA 4HX7A 1POGA 1JKQC 3CP8A 3L2WA 3F8MA 4BU2A 1V5FA 4I02A 1ON1A 3K4NA 1JGSA 3OR1C 3CTAA 5FLXK 3HOTA 5KAFC 1WJEA 1H0MA 2E2IJ 4BGDA 1VQ6I 4LK1F 1JXSA 3A01A 3DEUA 3QPSA 1YS7A 1KYWA 5GAEJ 3JRAA 4IRHA 5BPDA 2KMUA 2VONA 1G3SA 1U78A 3V42A 3DF8A 3H3UA 1VQ8I 1B4AA 1T98A 2ECCA 2D1VA 4FHTA 2MD5A 2L4AA 2QBYB 2RV8A 3HOVJ 3H92A 1SAUA 5TJJA 3CCQI 5L3FA 4BY1J 1J0RA 3K7AJ 1I27A 5LGNA 2XV4S 2DFHA 4XKWA 5M5YJ 3ERED 5BNGA 4II2A 3WU1B 1ZG3A 3FKIJ 3R0AA 1OLTA 3X2QH 3QQAA 1O3TA 5EG0A 1MBJA 4CUGA 3RZDJ 4CHUA 4XLPF 3LQRA 1AKHA 3SEQA 2XF5A 3DPLC 3RIRA 5LEKA 3AL0B 2QZ8A 2BBYA 2W25A 2G7HA 4MO7A 1O3QA 4CCKA 1T8IA 1OMIA 2H8RA 1DUXC 3KEOA 2GXGA 3Q0VA 2XGDA 5ICEA 1KGSA 4XBFA 1QPMA 4XKCA 2VKDA 5KCMA 4IQ4A 2OU2A 3DEWA 1VNDA 2VQHA 4GO1A 1QO0D 2VJ4A 2BEOA 1U5TA 2QCOA 2F5DA 3KYCB 1PUFB 4QTRA 4XLEA 3HPHA 4ZDLA 5DM6F 1QZEA 2E36A 4D0PA 3F21A 2M45A 1MJAA 3JRCA 2XSJC 5M5WJ 2JUCA 2MD0A 1R6RA 1TQIA 4I98B 2R92J 2X6YA 1T95A 1MIJA 3ONQA 1IXCA 2ZBKA 3PJRA 4BJ5C 4L18B 4PUSA 3ASNH 4MLOA 3G6EI 4FCYA 1SFUA 2JPBA 4EJTA 2EK5A 2LREA 1R22A 2O0YA 2PMZA 1I6XA 3H5AA 2PJRA 3WU2C 2ISZA 4FE7A 2OC6A 4LG0A 2R7VA 3GW2A 4A3DJ 1I3QJ 2K4JA 3F22A 4IHYA 4U0YA 4ZTJA 2VQCA 1ZRDA 2DA7A 2X1CA 3SZGA 2LF8A 1RUNA 1B6AA 1EH7A 1ZG5A 3VOEA 2HI3A 1VFCA 4M9XA 1O3RA 2VBZA 1OISA 3E97A 4FX0A 1Z7LA 3P5JA 1SD5A 1YX3A 2ZJRF 4BHCA 2E35A 3GZ5A 5J6XA 1ODDA 3OS0A 5C4JJ 1D1BA 1UZCA 2J5PA 2H8WA 3BDDA 3SEZA 4Q47A 3A0HC 3KIOA 4RDUA 2W48A 3L2VA 1ZQ3P 1MNDA 1EA3A 2DMPA 1Z0XA 4PCQA 5LFAA 2YX4A 2ZXIA 2KZGA 1FOYA 4A3IJ 2L7KA 4CGZA 5JLXA 3LAJA 4M72A 2W00A 1QRYA 2OBPA 1YO5C 1RRJA 3D0SA 5M3MJ 1Y6IA 5K7FA 2XKPA 2CW0F 3LFKA 1DPRA 1NK2P 1BC7C 3G73A 4LLLA 1FC3A 1FBQA 1U2WA 3K0LA 1JJ6C 5FFZA 2E7WA 3DXJF 1TLHB 1XD7A 4ASNA 1ZGJA 1Z9CA 2LKXA 2BOLA 3KP4A 4XOTA 2UUZA 1FNNA 1YIOA 1N25A 3S93A 1W7PA 1UG0A 2OD5A 3COAC 1D1AA 3S2HJ 4G6TB 1S5LC 1Z67A 3LQQA 3RDIA 1TW2A 4ENJA 1YG2A 3M8JA 4PSWA 2C6YA 2QA4I 3FIWA 3OYBA 5C4XJ 3TL4X 2R7RA 1FTTA 2F5EA 4L9JA 2Y9ZA 2CMPA 2HXIA 3AG2H 3CMMA 4A69C 4CZCA 2KIFA 5D5UB 2JA7J 4NBQA 3CJQB 3HGGA 1LUJB 2NXNB 4CDGA 4F55A 3WTUC 5IPAA 4DYCA 5KHDA 2R5ZB 2ME6A 4GRIA 1RUOA 2XUBA 3JRIA 1HKSA 4M3EA 1YS6A 4P5OA 2K85A 5CYVA 1MKMA 3DTIA 3JAMK 1V54H 1JGGA 3BJOA 4HOBA 4RAGA 5A2QK 3C1DA 1XGMA 3I58A 2EIKH 3RSNA 5KVRA 3ZMDA 2KL4A 3HIFA 2XSDC 1H9TA 1ORKA 1PVEA 2P6TA 1U0JA 2WC2A 4I09A 3ESWB 2DCEA 4XNFA 3M1CA 3OYLA 3ZP5A 2XVCA 1VQPI 1QNTA 4LLGF 2XASA 1MD0A 3VPRA 1WJFA 2PEXA 2IVMA 2MFZA 3BQZA 4BDZA 2OAZA 2FJ1A 3V8KA 2VJJA 4KUMA 3K9TA 3K1NA 3BTCA 1MGTA 4RB0A 3MN2A 4KICA 2H27A 5JR3A 1N77A 3KEYA 3I59B 3QU6A 4L0YB 2R7WA 2CGPA 3I3LA 3KZZA 4WX9A 3HSEA 3ZMVA 1QVTA 3E7LA 3QU3A 5D8LB 1W4MA 5DD8A 3V7CA 5HODA 4E7SA 2FF4A 4EJOA 3A01B 2A6EF 3WTWC 2BY1A 1SFEA 4O3MA 2QGUA 3F9KA 3BLYA 3ABTA 2EILH 2DTRA 1S7OA 1YW8A 5E17F 3UR3C 3MKYB 2CRGA 5HS8A 4S05A 1SVMA 2BW3B 3S3NA 2BW3A 1FY7A 1SD7A 4B44A 2GA1A 2L9VA 2OPTA 1UG2A 3BPXA 2ISYA 1Y1WJ 1TZLA 1FLIA 1IN7A 2VBWA 2DOFA 4N9HA 1P4XA 2JVHA 5J1RA 3VFZA 1GV2A 4L9NA 5HNHA 2IS4A 1IN5A 1IN6A 2ESHA 1QZYA 5CVRA 2B0LA 5F0HA 5D8KB 1B59A 5J47A 3CO7C 4FE4A 3DPUA 2PG4A 3E5XA 5IP9J 3T8RA 3CC7I 3PFYA 3CD6I 4MTDA 1O57A 1WFXA 2HGCA 1VQ4I 2PI0A 4C9YA 4G7ZF 4R1HA 1HSJA 4I0AA 2TCTA 4XLHA 3RJPA 1E3PA 1GUUA 5F0CA 2DW4A 3ROUA 2ZJPF 1YYVA 3E3VA 5CKTA 2F4OB 3GO5A 4MTEA 1R36A 1WRJA 2L5QA 4UNOA 2VN2A 1V4RA 4UB8C 2NS8A 2Y2ZA 1YI2I 3IUOA 3W6KB 1F5TA 4AU7A 2LR8A 2A6TA 1IUFA 2EJRA 3B6AA 3KZYA 3W3CA 1UHSA 3OL3A 4LOCA 4BNCA 3H9JA 2R3SA 3AAFA 1LE8A 3GTMJ 4IJAA 3J7AO 2H94A 2RAEA 4Y7NJ 3VYUB 5B3SH 1Y8QB 3S17J 3LSHA 1MMDA 3VDXA 1RKWA 3KP2A 2HTJA 4LITA 2ZCWA 4U0VA 3H3VK 2JQ7A 1VTNC 5IT9K 1GVDA 4YFXF 5HDNA 2QWWA 5E1ZB 3VYSB 3F6VA 3GMEA 1YOVB 1BJZA 3G1OA 5E18F 2W4SA 2DDAA 2XPUA 2I5UA 1FIPA 1R1UA 1J09A 5FD6A 2IT0A 2EWNA 2I10A 2OZ6A 1FX7A 4A3MJ 1KA8A 4KJZA 5EEAA 2XHKA 4HSTA 2XAQA 3PUFA 3H9QA 3ABKH 3ECOA 3GCMA 3TW7A 3CMAI 3F8FA 1B9NA 1YRNA 1GXPA 2M4GA 3NARA 3IKTA 4C2UA 3A4CA 3HSRA 3O2PE 3N4MA 4O5VA 3RKQA 1HW2A 3CCYA 1IXSB 1R58A 2LBFA 2DMUA 2IGNA 5FKKA 4XKVA 2DBBA 2FX0A 3S8PA 3GLLA 5H6RA 3CUQC 2LVSA 3L7WA 4FISA 4XOPA 2JN6A 2CQ7A 1BL0A 2P5LC 2K9MA 3OR2C 1FYMA 4HSRA 2R7ZJ 2DA1A 4YG2F 2CH0A 3I71A 3CUOA 4DYRA 1MBFA 1QVUA 3QPHA 5F6FA 3K10A 4A0XA 1R1VA 2CJJA 3GWZA 1XGNA 4M9SA 4S0HB 1VI0A 3HJEA 1V5GA 2F4IA 1QA6A 1ZGAA 5H6QA 4WCGA 4OMYA 2M30A 5BS6A 2X85A 1D8JA 3U1KA 2IGOA 1ONVA 3H5NA 3PO3J 1Q1HA 4AC0A 2FNPA 3JR9A 3OSGA 2CUZA 1T33A 1ETQA 2IGMA 2K02A 3SZTA 4IEJA 2Z3YA 5M5XJ 2RREA 2DT7B 4C30A 2P5VA 3BOQA 3R61A 2CW7A 3H36A 3BP8A 2NS7A 4BQOA 1XS9A 2UZKA 3TOBA 2JA5J 1UFMA 1RZ4A 2IBDA 1SMYF 2HR3A 3WU0A 1DP3A 1YW9A 1XGSA 2P7VB 4UB6C 4AIJA 3BT9A 3H5RA 3W2AA 5D4SA 1U6GA 3F8CA 4XR6A 4YEJA 2DPUA 5L3DA 5H2FC 4ZYGA 1BI2A 2HWVA 2OCCH 2BYVE 4KIBA 3ZMZA 3MZHA 2F4MB 1L3LA 1OCRH 2NRAC 2GOMA 4IRIA 3L2UA 1JUMA 3WTTC 5IYBJ 2YX7A 2KT0A 2E60A 4KYWA 2ZXHA 1FEXA 1FJLA 1MW7A 3AG1H 1FP1D 3GTLJ 1NH3A 2ZNYA 3A0BC 4M9ZA 4XRMA 4UV9A 2E2HJ 2V1NA 3PNVA 1Y39A 4BQAA 5CLSA 1HKTA 1Z21A 3RQ4A 2ME0A 5FFXA 1LVAA 2G7UA 3IRRA 2VJIA 2VOOA 2NYXA 1RR8C 3CDIA 2AXLA 4E6KG 5TGTA 4XN0A 4XICA 4PDKA 5HNFA 2NVYJ 2K5CA 3KP7A 1I5ZA 3ISPA 3W2WA 5IYCJ 5GAHJ 3WE3A 1GVJA 2OA4A 4PJNA 4BXXJ 2WB1A 4JBAA 1TQMA 5LHGA 2CUJA 1XN7A 2LRDA 2Y75A 4A3CJ 3S1NJ 5JI6A 3OWTA 4XSXF 1LDJA 4E4HA 2HDCA 3LSGA 3OS2A 5IYDJ 1BR4A 1YHQI 2BHZA 3JTHA 1A6IA 1JT6A 2JPCA 3PUBA 2G0EA 4BDYA 5C3EJ 3CJRB 4XKBA 3VWBA 2D2WA 1BJAA 3GTKJ 5FKNA 2GWRA 2JA2A 1HDPA 1UJ8A 2ESNA 2VT3A 4AIKA 1R00A 2DT5A 2KZVA 2GXAA 1ERDA 1B1BA 2OCEA 2IJLA 3GEZA 3EQLF 3WE2A 2D5VA 3RKYA 4EGZA 3I56I 2A6HF 2Z9OA 1KU3A 3NQOA 5JHUA 5F64A 1SFKA 3FZVA 2VQGA 2RQPA 4AIHA 1K78B 2M7BA 3LFUA 5AIPA 1ZRFA 1K6OA 2FBHA 4HQMA 3MWMA 2QM3A 1RI7A 3BY6A 4AIDA 3D5LA 2FQ3A 2F2EA 2R0QC 3AG3H 1QHGA 4B3XA 5L3EA 2AS5F 5DUKA 3BCAA 4BXUA 1FYKA 4ESFA 1DPUA 1IG7A 2VODA 3PNYA 1BC8C 2MYSA 4HQEA 2HOTA 3FXKA 5E1WA 2EBIA 2O5RA 2XKOA 5AIQA 2CV2A 3HTSB 1MNEA 4HDUA 2W85A 1IRGA 1IDZA 2GA2A 3FXOA 1QPIA 1BM9A 5K1YA 2BY3A 2CUFA 1WJDA 4DOZA 3FXJA 4RA2A 4KMFA 4M3GA 2K4BA 2JT1A 1UAAA 2H1LA 4XSZF 3P9KA 1MMGA 2JTVA 2FUG2 1U8BA 1ZKGA 1A5JA 4EM0B 5TRDA 1TNTA 4Y13A 1VQ7I 3R4KA 2R5YA 4I01A 3K69A 3LA3A 1R7JA 4I99C 2M5WA 4KIGA 4Y3OA 1E3OC 2JJ7A 2O8KA 3G3ZA 5HLHA 2OTLI 4UUTA 2X4HA 4BBRJ 2VXZA 4S04A 4H0EA 1FZPB 2AXTC 3C2GA 1HLVA 4OAZA 3FXLA 1ETXA 3ZQLA 1WZ2A 1CGPA 2IXSA 1TC3C 3PQKA 4A3LJ 2MC4A 3ZMSA 3AL0C 2AHQA 1BI1A 3S1QJ 2K86A 1YQAA 3EUKL 3OIQA 3DBRB 2E1OA 4PSXA 3MKWB 1SEUA 3O3KA 3K1PA 3REOA 4M6YA 1B8IB 3BR5A 2DO7A 1ZN2A 1Z3XA 5JVGF 1XDUA 4ZH4F 4HF2A 1ZLJA 5FJ8J 1X3ZB 4A3EJ 1ZG1A 2E1MC 4PJ0C 4LG0B 4RB1A 2IS1A 2ZMEC 4HNVA 3DV8A 3KE2A 4AVZA 3GX4X 3G4SI 3IWZA 4G7HF 2X1DA 1HXDA 2E1CA 2NNYA 2V6EA 3ZCOA 1LNWA 3ZN0A 1FBUA 3UNGC 2E19A 2JVGA 3GVAA 3LA2A 4XL9A 3GTGJ 1ENHA 1OFCX 3WG9A 3WODF 1V5EA 2HVRA 2GIZA 3RPUA 5FGMA 4U0WA 2CUEA 5DTDA 1H89C 1MSEC 2M8GX 1OCCH 9ANTA 2WAEA 4RB3C 1ETVA 5IY5H 4XORA 2ICWG 1H88C 4EM2A 4MHGA 4BE1A 3WHBA 4B8XA 5DCFA 3FXQA 2OF7A 2Z2SB 1JKRC 3CF5F 2L7ZA 1K61A 4MQVA 3TO9A 2JRTA 3B6CA 2VPRA 1XB4A 1HQCA 1QU3A 4IXAA 1EH8A 3KFWX 1FWZA 4DZJA 3HM5A 1P6RA 2IP2A 1TWGJ 5GTHC 1WH5A 2KJCA 3QYBA 3SXYA 2GZWA 2K3PA 2Y31A 1SC7A 4BJ6C 2HQAA 3NWTA 2EFWA 1TNSA 1TWHJ 3WTSC 5B66C 4D1QA 3BJ6A 4XIDA 3DCFA 1FYLA 3I53A 4L9TA 3DU5A 1XPXA 2R7DA 3VSLA 1Y56A 4RLFA 3LSMA 2L7MP 1CQTA 1AA7A 3H0DA 2VBYA 2DYSH 2BVLA 5AONA 5EYRA 3GTJJ 3HHHA 3QWLA 1KQ8A 3DBHB 1LEAA 3S1RJ 1WPKA 1BOAA 2JA8J 2HQ5A 3QODA 4FX4A 1ZH5A 2OZUA 1VQ5I 2JWTA 3V8JA 2VE8A 1ZYRF 3HRSA 1AU7A 1W7PB 3M1EA 4RM3A 3VYTB 4IHWA 2W24A 4BQQA 4C3HJ 4YFNF 2VLAA 2L9NA 2ZB9A 1STZA 3GLXA 3CC2I 2KISA 3FISA 3G1MA 1WSUA 1W1WE 3CDLA 3QP5A 4J19A 3EPZA 3HG9A 1IDYA 1BIAA 1OR7A 4KN4X 4J01A 1A31A 3CQZJ 1LJ9A 1T0FA 3IRQA 5ICGA 4DGWB 5D5VB 1WQ2A 3MFKA 2EA2A 2WY7Q 1HOMA 1ETKA 4UV8A 4Z2YA 4BQNA 2AQFA 2K40A 2VIXA 1YFHA 2Y48A 4KT5C 6PAXA 1WJCA 5F0FA 5J3LA 2Q1ZB 1Y0UA 4NC7A 2ZNZA 1EKEA 1MBEA 3FMQA 5FKLA 2XROA 4OWRB 3RZOJ 3FM5A 5K5QA 2KPMA 3LMMA 2MA3A 1MJ9A 3QPLA 4DW6A 3J7YJ 5IT3A 3F8NA 1F9NA 4DBQA 1G6NA 4AVPA 2QBYA 1MJBA 4RGUA 1FOKA 2QQBA 2HOEA 2LG4A 2EFNA 4CA0A 2V26A 2X9DA 2A61A 4CYCB 2Z1DA 4U87A 1KU9A 1ZARA 3H1CA 2HKOA 4AYBA 3WTYC 4OMZA 2WV1A 1LFUP 4F93B 1HCRA 4A6DA 1S6LA 3KYDB 1GLNA 4C3IJ 2ECBA 2M2EA 1T2KA 2YU9J 3BG5A 1YJ9I 4ENKA 3SYTA 1W5TA 4PFPA 3RTRA 4PGHA 3HBLA 5EEGA 5HVQC 1DGRM 4FETA 4OIPF 1RETA 4DZPA 4X6AJ 2DMQA 3OOPA 2KFDA 2K3FA 1TWCJ 1JKOC 3ERMA 2O61A 1U9NA 3C18A 3C7JA 2VC0A 1RESA 3FMSA 3LAPA 1GT0C 5EF6A 3H35A 5BMZA 2HTSA 3G2BA 2JSCA 3ZOBA 2EZLA 2V79A 3S3MA 3ZR8X 5DCMB 3EUAA 4C3JJ 3KLOA 1APLC 1X2NA 3EYYA 1FMVA 3LSRA 2QKMB 2JK3A 3GBGA 2PJRB 4HF1A 4A6EA 1OYIA 5JVTA 4A3GJ 2P4WA 4N9IA 3M9AA 1X1DA 4IHXA 3QRFF 3HYIA 1OCPA 2FMYA 1IRXA 3TMOA 5E20A 3CCRI 3ECHA 2R7UA 4IZZA 4WK8F 3FX3A 2CU7A 2RC4A 3GZNB 2WTEA 3CP2A 2IGKA 1R1TA 4BL0B 3GFJA 1BIBA 3OYMA 3CCJI 3A2KA 4LD5A 4DJAA 2X0LA 2L01A 1R5HA 3H0GJ 3ZPLA 4KISA 4DQ2A 4M73A 2P5KA 4JYKA 5CVIA 4Q5SF 2FEZA 1TL8A 3GTQJ 4HX4A 3WGIA 4E7IA 4PGGA 2EV0A 3TP3A 2B7EA 4P96A 3OYFA 2PLYA 2G9WA 4IHTA 3E5UA 4HNTA 4G6DA 3TP0A 5B1BH 4BJTA 4RGSA 3CMEI 3D5RC 2TRTA 2EZKA 2VASA 1KQ9A 4KIFA 4P1WA 2DFIA 4RMNA 1DU6A 3HRMA 4GCVA 3M8EA 2QQAA 2DTZA 2ZXJA 1IO2A 2IA2A 4HV5A 3JRHA 4CXFA 1ZR2A 2W57A 1WJBA 4JX4A 5JFRA 3DTKA 1USSA 1WI9A 4HLXA 1ZK8A 5J40A 4EJUA 4EMSA 5LGTA 4UXNA 2X6XA 4GDFA 2EFPA 5CVVA 1J9IA 1WHUA 3H3ZA 3K4JA 1YLFA 1WI3A 3HOUJ 3JCUC 3NRVA 1SVLA 2CQQA 1FIAA 2QSFX 3I54A 3M8FA 1FOXA 5CQEA 1V55H 4XN3A 2KRHA 2ELKA 2K27A 1AOYA 2P0WA 4MGRA 1IRZA 3ZN1A 3IL2A 3KX2A 2FD5A 1ACIA 1QGPA 2K9QA 4F7ZA 2HDDA 2XB5A 3KLNA 3FHNA 4KDPA 3U9GA 4LK0F 1H8AC 3HOXJ 5EGOA 1OCOH 5FD5A 2QYOA 3BR3A 4L5IA 4Y15A 5IP7J 2GQQA 4RB2C 2DA2A 3OY9A 4NUBA 1WJ5A 2AQEA 2L7FP 4O6JA 4BAYA 1RIOH 1S3JA 1B9MA 3K2AA 1PYVA 2DOAA 1ON2A 3SHFA 4ITVA 3DP7A 5GADJ 2ZFWA 4G12A 2ZFUA 2H09A 1EV7A 3PIOF 3LNQA 4HAMA 4A93J 3DTEA 5LHIA 3P7NA 3C2BA 2JMWA 4UUSB 1X2MA 3MEXA 3BCBA 1UB9A 4WXDA 3VODA 2O8XA 2GLOA 1R71A 2PN6A 3Q3SA 1QBJA 2EV6A 1NK3P 5ICFA 2BVMA 2WAQN 4GXOA 2PMUA 3QYFA 2IA1A 2V4JC 1X1BA 4MFDA 3ZQCA 3JRBA 1PP8F 3NAUA 4OAYA 3JAMZ 3GXOA 3OIPA 4HBLA 1P4AA 1X58A 2DJNA 1VQNI 1YW7A 3OYNA 4CCJA 4HRIA 4CCMA 2VBXA 1TQPA 2CG4A 3EUHC 2IEKA 2O9LA 4EV0A 4XK4A 3ABLH 4NNJA 4QSHA 1REPC 4LLNA 2DA5A 1YIJI 2COBA 3ZMTA 2ZXWH 2B63J 5LEJA 3A1YA 2EFQA 2OQGA 4D9JA 2Y0SN 1A36A 3T1BA 4N0BA 5IP6A 2MC3A 1LEBA 1LFPA 4G94A 4I6ZA 3D1NI 1HBXG 2NOJB 3K4CA 4MIMA 4U88A 4DIQA 2XAJA 3FWEA 2CV0A 5DCMA 1UHMA 2ID3A 3IHUA 1LE8B 4CYCA 1FTZA 3C2HA 1T38A 4UVAA 4KN7X 1DDNA 5FO5A 2JSPA 3IAM2 1SAXA 1PUEE 2VOPA 4JX6A 1G59A 4HYEA 2YS9A 1WKMA 2DLLA 1JKPC 2ZKZA 2A07F 3LL7A 5DEQA 1X3UA 1X19A 3T5XA 1LDDA 4D7MA 2Q8KA 3S1MJ 3FK7A 3DKWA 2MSYA 1R9TJ 1JHFA 4II3A 2V9VA 3GZ6A 1I1SA 2K9SA 3I0TA 1Z91A 4P55A 2GOXB 4EEFG 1O7FA 2L2OA 3RKXA 2VB6A 2L4MA 3IWFA 1OKRA 3CDHA 3PIPF 3K6GA 2HPMA 2L3DA 1ITYA 3L1PA 3M4OJ 3QPTA 3SDGA 1ZRCA 5DV5A 3DEEA 2E34A 2RN7A 1HC8A 4HX8A 1Z3YA 3OV8A 2FQ4A 5IOYA 3GFMA 2VKHA 2M8EA 4XLAA 3AKZA 1XGOA 1QHHD 2GAUA 3ZQHA 4F91B 2UWMA 2FNAA 1SD6A 4Q48A 2VQLA 4B1RA 2M4KA 1PJRA 1W36D 3KEQA 2VE9A 3HRUA 3IH2A 5E3NA 2BXYA 3BG3A 3CZ6A 4C2TA 4N4OB 3HC7A 1PDNC 3S14J 2RQQA 4B09A 3RYRA 1AHDP 3MQ0A 1P2FA 2KQRA 4BACA 1R5GA 5JLWA 5ED4A 3J80K 2CO5A 4FASD 4G8XA 3MKZA 2DJIA 3HUGA 3K4BA 2EZIA 3N05A 4OIQF 1IRFA 4BYYA 2R7QA 3TEDA 3ULQB 3R0JA 4L9VA 3FMRA 4HLYA 3ZGKA 3I4NJ 3E1SA 3I4PA 4E7HA 3RKWA 2FSWA 1USTA 1E0EA 1R4NB 4BKXA 3MD2A 2DA4A 4OU0A 1IC8A 5DYMA 4A12A 4PJLA 4BBSJ 5D5XB 5F04A 4QLCU 2O6GE 1W7PD 2EFOA 2M87A 1X1AA 1IZ1A 3KP6A 3DU6A 4I0BA 2J5OA 3CF2A 2EPFA 2XGEA 2R5ZA 3Q5FA 4MEYF 3OYGA 4PJJA 4BS9A 1DU0A 4CH7A 1NG7A 1OCZH 5HLIA 3ZMUA 3KP5A 3HL2A 4RGXA 4KMUX 5EGOB 3T0YA 4I76A 1XCVA 4NB5A 4ZYEA 2P7CB 1KYZA 3I4MJ 4IOCF 2ZSHB 2DQRA 2A5WA 2LTPA 4X0GA 4A3JJ 1H9GA 4Y33A 3I59A 4QPQA 3PSFA 1YITI 2LMDA 5H20A 2HOAA 1R4MB 2Z99A 1KU2A 3IH3A 3F3XA 1WH7A 1K78A 2NS0A 4YRVA 2VUMJ 1BBYA 3DPTA 2OQRA 1TWAJ 2QENA 1G4DA 2D45A 3LSIA 1HW1A 1S9HA 1M1EB 5J4VA 2CQKA 4IKFA 1P92A 5DS9A 2LDUA 1G8XA 2NAZA 4BHBA 4L5JA 4NHJA 1EH6A 1I1GA 1ZHFA 2BXZA 1X4PA 2A68F 2HU9A 5HDGA 1P7IA 2E1NA 3HZJA 4LMYA 4P9FA 1VQ9I 2Y30A 2XRNA 5HLTA 3KETA 5HS9A 1ULYA 4NDLA 2RKHA 2LF7A 1VZ0A 1K6YA 3K4MA 4LIVA 4QIWN 5E79C 2MBFA 4ZYHA 2CWEA 2VXDA 4M3FA 3EUHA 1VQOI 1K83J 4BUPA 3Q9VA 2XGXA 2D1HA 4MQ9F 3W2VA 5D4RA 2KIMA 2HQRA 3GYHX 2CV1A 3OYEA 5L3BA 4IF4A 4EJWA 1HKQA 3EYIA 5J1UA 4Q4ZF 1U8RA 1J59A 2CSOA 4GYGA 1IV8A 3PL8A 1JUPA 1U5TC 5J8FA 1TWFJ 4ANJA 5IT9Z 1R49A 1U5TB 4F52A 2O3FA 4B47A 4E7LA 2XF7A 1GHCA 3V4GA 1LPQA 3E0JB 3QAHA 4ZJZA 2WA0A 4ON0A 3HOWJ 2Z33A 4BH9A 2MABA 4ZDOA 5E8GA 3Q0WA 1WGXA 3K4KA 2HPIA 3CESA 1LDKB 1X1CA 1DP7P 3IKVA 3ZQQA 2HOSA 3TDZC 3HEFA 3BZKA 3DKXA 2HYGD 2EV5A 3JRGA 1F43A 3RPQA 4A5MA 1AWCA 1MH4A 2FBKA 1K4SA 2DMTA 4IHVA 2X6OA 4XRFA 3O8GA 2LY1A 1HF0A 1E17A 5FRNA 3S2WA 2OV7A 3QOEA 2KLOA 4JQFA 2LKPA 3HRTA 5CPRB 1BR2A 1QQIA 4OOIA 4TV7A 3S15J 1MH3A 4ZDPA 2AO9A 3LSTA 4RAZA 5J4YA 4HEA2 4B43A 1Z7UA 2W84A 2YR2A 2RGVA 2DOEA 1Y1VJ 2V9KA 2KDZA 1Y0NA 4UUSA 4PJMA 5FROA 5FLMJ 1FSEA 2V1DA 3BROA 2CQXA 3KCCA 2YPRA 3U1DA 4OIOF 3S16J 2R7FA 3BG9A 4WXHA 4MFEA 3TKYA 2Y69H 3CUQA 3JRFA 3OYAA 2LY2A 1D3YA 2XAUA 4DNCA 1XC5A 2MH9A 1XMKA 2Q2EB 3WTXC 1MMSA 2HXOA 3BTIA 1D0YA 2E5NA 1Y8RB 5DM7F 2X1EA 1MSFC 1TP4A 2DN0A 1HDDC 3HXLA 5FLXZ 1MDMB 4CO8A 3ELKA 5TISC 1SFOJ 1HSTA 3SFZA 3J81K 5BPIA 4Z6YA 3HUGB 3V8LA 2LBFB 1FSHA 5KAIC 5LHHA 2LK2A 4IRGA 5E8IA 2HEOA 4W1UA 3KP3A 3R6SA 1ZTRA 2DU9A 2N8GA 2M7AA 1DGWY 4HNUA 2E5ZA 2ETHA 3P9CA 1MDMA 4UUVA 1OYYA 2L0KA 1W0TA 4B48A 2XAGA 1X1PA 3S3OA 3OYCA 1IN8A 3NWSA 3ZQIA 3IH4A 3BTLA 3L2RA 2ID6A 5F1RA 5E3OA 2M3AA 1XSVA 4M3DA 5FLVA 3OOUA 2FMLA 4M3BA 2ADUA 2H6CA 2UXNA 4BY7J 4KNYA 2LY9A 1XMXA 2FA5A 2YU3A 3F8BA 4RAYA 1YJNI 3L00A 2CW8A 1L0OC 1TT5B 2V6CA 3IP4B 2ZMEB 2PFBA 3K4LA 2VPLA 2ELJA 5K7HA 2QEXI 3S2DJ 1X4OA 2XAHA 4ENMA 2EINH 3CJNA 4LFUA 4IHSA 5FKMA 3W6VA 2KIQA 3K1MA 3TO7A 4FT8A 2COMA 5D6EA 3ABUA 1V3FA 4LB6B 4ZZLA 3J81Z 4PZJA 2DI3A 1J5YA 1XMAA 2F5FA 2K9LA 2EA4A 5K7ZA 3HHGA 2KRFA 1D8KA 2CS3A 3CLOA 3PFIA 3LOCA 2HKXA 2VKVA 1EF4A 3SDBA 2STWA 2CQNA 1Z6TA 1GXQA 4KA4A 3CMYA 4HV6A 2Z5UA 2MG4A 4B4CA 5ILVA 2LD5A 2XRLA 3OSFA 2HFHA 5GAGJ 1B72B 2LP0A 5BOXA 3WG7H 1ETYA 2NVTJ 3RI4A 3VEPA 2MLKA 2VI6A 1LVKA 2LNBA 2KKOA 2H6BA 3IAS2 2GBYA 3WGGA 2VKEA 1O4XA 2EB7A 4A3KJ 4RS8A 1D5YA 2QSHX 3OYHA 1P7JA 3TOAA 1ZLKA 3C3WA 3J80Z 4A0YA 1C0WA 4FQGA 2IPQX 2L02A 2OJED 2GM4A 2B9SA 3QOPA 4AD9A 1NG6A 1Z6RA 3D5SC 1BW6A 1LB2A 3VB2A 2K9NA 1TW3A 4LG3A 2V1XA 1UELB 2R7TA 2I8DA 2R7SA 3I9V2 2M9HA 3F23A 3W6JB 3M3YJ 5ERIA 1FP2A 3JTGA 2W1OA 4J00A 1JT0A 3PQJA 3JSOA 1J7KA 3T8TA 2CYYA 5DD4A 2P6SA 3CJTB 1T6SA 4RM2A 3RPUD 4IX7A 4D5FA 2BHYA 1CF7B 1R23A 1XSDA 2MGQA 1S29A 5A2QZ 3ZRGA 3KYLA 1XX5A 1S7EA 1WWXA 4A0ZA 2HYFA 2TDXA 3QYEA 3DKYA 5LGUA 2UV1A 4IO9F 4HPQA 2KJBA 3RCOA 3WTVC 1N75A 4YELA 2W82A 1DQUA 2ELHA 4Y4RA 4AUXA 1YE9A 2DXIA 4UHTA 5E1XA 1IV6A 4I2OA 3E6DA 2HVQA 3DQVC 3PNTA 3RQIA 1FMWA 4P9UA 2YUSA 3EDPA 2XIGA 4BEHB 2GXBA 3FBNB 3WHCA 4ABZA 4CZZA 2XF6A 3KZIC 5KK1A 1YX5A 3FXUA 3MCZA 1ZR4A 2QKLB 2V1UA 2L9RA 1XG1A 4K2EA 3EETA 2E71A 1EJ9A 3MMYB 1W5SA 2LSOA 5KNLA 1UMQA 3AFHA 4E7JA 2XAFA 3BQYA 2DMNA 4CICA 2XC7A 4MNUA 1O7LA 3I55I 2WV0A 4UY8I 1W5CC 5HS7A 2DQLA 2M34A 3DLLF 1WJAA 3VSKA 2QVOA 4CCNA 1MMAA 3LA7A 2FBIA 3DFGA 4HZFA 2YSRA 3HOSA 3OYKA 3OMYA 1G3TA 5LBQA 1RC9A 2XPVA 4ZC3A 3JRDA 1IN4A 3K2ZA 3J7AY 1A04A 4BE2A 2IS6A 5CJ9A 5GPAA 3TO6A 2W7NA 3HDDA 4HW0A 3U2RA 2X48A 5DUIA 4G9YA 1LFBA 4AWXB 1HW5A 4F3QA 4YIIA 2NVQJ 2R5YB 5BQTA 2WADA 2HVSA 1MMNA 2LH9A 1IGNA 3DWLE 2HYJA 5JHFA 4N4NB 5LD2C 3FHZA 4ETSA 1D0XA 3CUQB 4NC8A 2XGCA 2FOWA 1ZELA 4MEXF 2JRMA 3E6BA 4ZYAA 1MNMC 4HA8A 4R79A 1OPCA 3TW6A 1IXRC 4KFCA 1WVRA 2STTA 4AYBN 2HS5A 1IAWA 2V7FA 1JTXA 4NQWB 4V2GA 4LJZF 3DBLB 3QP6A 3L9FA 2QUFA 5HOOA 3E6MA 3SZPA 1MBGA 1B8IA 3F72A 1ZREA 2Y0SA 2KIUA 3KPHA 3VYRB 1J2XA 3CLQA 3ML6A 3NEUA 4QWQA 3FBIB 4E7ZA 1BA5A 3FKJA 4EVIA 5E3LA 2M0MA 1E3HA 1LKXA 2QQ8A 1Z1DA 3ZQFA 1FBSA 1W36C 5F27A 3IV5A 4A3BJ 2VL8A 4NQWA 1SANA 2DA6A 4ZZDA 1KONA 2HZDA 1Q1VA 1B72A 3CCLI 4YIFA 3HOYJ 3JSPA 4L0ZB 2O03A 5J1YA 1YJWI 3BR2A 2KDOA 4V2FA 4KT6A 2KRCA 2K7LA 3O6BB 1NHAA 2HNHA 5CVUA 3OYDA 5J8CA 4BE0A 4QPOA 1N78A 3Q0UA 4HF0A 5HDKA 4E70A 3A03A 3I5UA 2PMZN 4XQFA 3CCUI 2ZMEA 3L2QA 3OS1A 2E2JJ 2JA6J 1JI8A 2FRHA 2WAFA 1IW7F 2FXAA 4XRSG 3CCVI 2PMHA 4ENNA 1SVOA 1KQ0A 2FOKA 3OYIA 1E2XA 2OUMA 2QQ9A 5B5EC 4AM3A 1BI3A 3M07A 1TT0A 2IW5A 4RLQA 2RVCA 2CFOA 2DA3A 1F36A 4A3FJ 4LGWA 5M3FJ 2M0CA 4IPAA 1QZZA 2DK5A 4EATA 4E7KA 3MAJA 2Q0OA 3GFIA 1I39A 2F6CA 2HZTA 3HPGA 3BZ6A 3SJMA 3GTOJ 1K4TA 1OYWA 3A02A 3B73A 2IS2A 5CVJA 2DDBA 2OTJI 1MZBA 4XLFA 1JTYA 1MBKA 2WB1N 5L3CA 4IOAF 3DLAA 2LOOA 3BWGA 4A2UA 1AKHB 4KITB 5CQGA 4YIRX 2ZJ2A 2NOGA 3BR1A 3BTJA 3HKZN 2R4GA 2BGCA 2XPWA 3MVPA 2XDVA 5F08A 3FXRA 2P8TA 3BR6A 3R60A 1Z05A 1RKTA 2A05A 5LRRA
chains in the Genus database with same CATH topology
3CC7I 2ZJQF 1YJNI 1YI2I 1YHQI 2FOWA 2OTLI 5GADJ 1FOYA 5GAGJ 3PIOF 1VQOI 4V19K 2K3FA 1FOXA 4IOCF 3CCUI 1VQ5I 3CCQI 3J7ZI 3G6EI 1S72I 3PIPF 2QEXI 1MMSA 2QA4I 3CD6I 1YIJI 2OTJI 3CCRI 1ACIA 3G4SI 5DM7F 3CMAI 2ZJRF 3CCVI 4IOAF 3J7YJ 4IO9F 2E35A 2E34A 1VQ4I 1HC8A 1YITI 1VQ6I 3CC4I 5GAHJ 3CF5F 3G71I 3CCLI 2ZJPF 1VQ9I 2H8WA 3CCEI 1FOWA 1VQLI 1VQKI 5GAEJ 1YJ9I 2NXNB 3I55I 3CMEI 1VQ7I 5DM6F 2JQ7A 1VQPI 4UY8I 3CJTB 3CCMI 3CCSI 2E36A 3I56I 1VQMI 1YJWI 3DLLF 1QA6A 3CCJI 5JVGF 1VQNI 1Y39A 3CC2I 1VQ8I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 I;  2ZJQ F;  1YJN I;  1YI2 I;  1YHQ I;  2FOW A;  2OTL I;  5GAD J;  1FOY A;  5GAG J;  3PIO F;  1VQO I;  4V19 K;  2K3F A;  1FOX A;  4IOC F;  3CCU I;  1VQ5 I;  3CCQ I;  3J7Z I;  3G6E I;  1S72 I;  3PIP F;  2QEX I;  1MMS A;  2QA4 I;  3CD6 I;  1YIJ I;  2OTJ I;  3CCR I;  1ACI A;  3G4S I;  5DM7 F;  3CMA I;  2ZJR F;  3CCV I;  4IOA F;  3J7Y J;  4IO9 F;  2E35 A;  2E34 A;  1VQ4 I;  1HC8 A;  1YIT I;  1VQ6 I;  3CC4 I;  5GAH J;  3CF5 F;  3G71 I;  3CCL I;  2ZJP F;  1VQ9 I;  2H8W A;  3CCE I;  1FOW A;  1VQL I;  1VQK I;  5GAE J;  1YJ9 I;  2NXN B;  3I55 I;  3CME I;  1VQ7 I;  5DM6 F;  2JQ7 A;  1VQP I;  4UY8 I;  3CJT B;  3CCM I;  3CCS I;  2E36 A;  3I56 I;  1VQM I;  1YJW I;  3DLL F;  1QA6 A;  3CCJ I;  5JVG F;  1VQN I;  1Y39 A;  3CC2 I;  1VQ8 I; 
#chains in the Genus database with same CATH topology
 2O7O A;  4Y52 J;  3BJA A;  2KHM A;  2X51 A;  3BG6 A;  3JW4 A;  4R8H A;  2LLK A;  4DYQ A;  2WBM A;  4DBR A;  1OR7 C;  2JUG A;  2RNG A;  2R93 J;  1LQ1 A;  1VF9 A;  2PJP A;  1BI0 A;  4JP0 A;  5FKO A;  3BPV A;  1GDT A;  4PK4 A;  1JJ8 C;  5GP9 A;  3MZY A;  2P81 A;  4XLN F;  1PP7 U;  3PM1 A;  4U7D A;  1VQM I;  3H9G A;  3LSK A;  1SFX A;  1JHH A;  3BG7 A;  2Y0M A;  4M71 A;  2DT6 A;  2BE5 F;  2V9P A;  3ASO H;  4B3A A;  3TGN A;  4EGY A;  1O3S A;  4C2M J;  2R7O A;  2ZC2 A;  5C44 J;  4WWC A;  5EZG A;  4EQQ A;  4XM3 A;  2F48 A;  2PQ8 A;  3L09 A;  2MLG A;  3Q9S A;  4W97 A;  3L2C A;  1A35 A;  3S32 A;  4BXF A;  3CC4 I;  4ESJ A;  3B02 A;  1YTY A;  4G7O F;  1VQK I;  5ILS A;  3CCM I;  3FDY A;  1K79 A;  4CSW A;  5EJC A;  2A69 F;  2WY8 Q;  5LRS A;  5GPC A;  4EM1 A;  4BEH A;  5K5R A;  4HDV A;  1S8N A;  3BR0 A;  1NTC A;  2EIM H;  1D1C A;  2BZT A;  3HSF A;  3E6C C;  2M1B A;  2H1K A;  4XON A;  5DDG A;  3AG4 H;  4CCO A;  1T0F C;  2WWY A;  1RR7 A;  1KZH A;  1GV5 A;  2MW8 A;  4ZYD A;  3PSI A;  4ZTF A;  5K5O A;  4RAF A;  3CCE I;  1VQL I;  2ZO4 A;  3OIO A;  1T08 B;  3CCS I;  1G3W A;  1JUS A;  4CCL A;  3TQN A;  5EEH A;  2WAQ A;  4M6V A;  1W0U A;  1P9Q C;  1D5V A;  3M7G A;  4H4K C;  1FPQ A;  5LLQ A;  2IAI A;  4A5N A;  3GTP J;  2LYC A;  5E3M A;  1ETW A;  4JOM A;  2LC2 A;  3HGY A;  4IL6 C;  5B1A H;  4V19 K;  4I7H A;  4PFO A;  3OL4 A;  2ACJ A;  5EG0 B;  3HB9 A;  5D6F A;  1JE8 A;  1FT9 A;  2DFF A;  1BOB A;  1X3W B;  3BZC A;  3FM3 A;  3MZ8 A;  3V7R A;  1I50 J;  3E5Q A;  1I6H J;  2DOD A;  4RGR A;  4XLC A;  5GTI C;  3G71 I;  4M6X A;  1FOW A;  1U9O A;  1ETO A;  3MKL A;  2EH3 A;  3U21 A;  3LSJ A;  2L54 A;  1D0Z A;  1R5I D;  4JK1 X;  1MBH A;  3FK6 A;  4OIR F;  4JX5 A;  2IRF G;  2BY2 A;  2VC1 A;  1F4K A;  5L3G A;  1ZGW A;  3F6O A;  3JRE A;  5FRM A;  4L5E A;  1PUF A;  4D7N A;  2VT2 A;  1T56 A;  2IA0 A;  3WGH A;  1I3A A;  2HDW A;  4WXC A;  3SFI A;  5ILU A;  2FU4 A;  2E1M B;  5ICC A;  3GFL A;  2MH2 A;  3IC7 A;  4G6Q A;  1G2H A;  1TTY A;  1G3Y A;  1SMT A;  3GUD A;  2DAO A;  3V7S A;  2Y9Y A;  3K70 C;  1U3E M;  2BV6 A;  4X1E A;  2F5V A;  1A6Q A;  3F0C A;  2ZJQ F;  4NC6 A;  2ZSI B;  3ZQ7 A;  2DYR H;  2XB0 X;  3HOZ J;  2UXX A;  2Z16 A;  4LIU A;  1TBX A;  1KU7 A;  4ESB A;  1T39 A;  2LKS A;  1S72 I;  2L9S A;  2NVX J;  1F1Z A;  2X6W A;  2VJ5 A;  3FXM A;  2HQN A;  2R7X A;  2E7X A;  5F1J A;  2BY0 A;  4U7B A;  1S7A A;  1XCB A;  3OYJ A;  3I64 A;  3LSP A;  2Q2E A;  4XMY A;  4IQJ A;  4LB5 A;  3BC8 A;  3N97 A;  5EDN A;  1RPW A;  3LWF A;  1WCM J;  1Z77 A;  2EQR A;  4F92 B;  1XDS A;  5IOZ A;  1YRN B;  3TDU C;  1OJL A;  2KP6 A;  5D5W B;  3K70 D;  1BN5 A;  2DK8 A;  4WF2 A;  2CFX A;  3HKZ A;  4GYI A;  4M74 A;  2DPD A;  5FB2 A;  2LFB A;  4UVC A;  1SD4 A;  1UCR A;  4Y17 A;  3WTZ A;  2PX9 A;  2A3S A;  1RNL A;  2QSG X;  2QF7 A;  1XTA A;  4HG2 A;  1HA8 A;  3GF2 A;  4BHP A;  5EZH A;  3UKG A;  4XRS A;  2RNJ A;  1P4W A;  1IUY A;  3FF5 A;  2FE3 A;  3PO2 J;  2GIV A;  3CO6 C;  4EJV A;  3TBI A;  3J7Z I;  4GFB A;  1BR1 A;  3G1L A;  1IJW C;  1J75 A;  3ZQG A;  4GGG A;  2NNN A;  1CF7 A;  4OIN F;  2JZY A;  3RYP A;  2QLZ A;  5HLG A;  1OCT C;  2A5Y B;  4IVN A;  3ABM H;  1BW5 A;  1OQY A;  3O8H A;  1K7A A;  3SQN A;  3ZXS A;  1IF1 A;  4YFK F;  4FTH A;  3P9I A;  1XSX A;  2F5C A;  2EZH A;  3HTU A;  4UVB A;  2RDP A;  2EIJ H;  1UHW A;  4CYD A;  2DFE A;  2PBI A;  2NVU B;  4D5C A;  1ZAO A;  4RBO A;  4HX7 A;  1POG A;  1JKQ C;  3CP8 A;  3L2W A;  3F8M A;  4BU2 A;  1V5F A;  4I02 A;  1ON1 A;  3K4N A;  1JGS A;  3OR1 C;  3CTA A;  5FLX K;  3HOT A;  5KAF C;  1WJE A;  1H0M A;  2E2I J;  4BGD A;  1VQ6 I;  4LK1 F;  1JXS A;  3A01 A;  3DEU A;  3QPS A;  1YS7 A;  1KYW A;  5GAE J;  3JRA A;  4IRH A;  5BPD A;  2KMU A;  2VON A;  1G3S A;  1U78 A;  3V42 A;  3DF8 A;  3H3U A;  1VQ8 I;  1B4A A;  1T98 A;  2ECC A;  2D1V A;  4FHT A;  2MD5 A;  2L4A A;  2QBY B;  2RV8 A;  3HOV J;  3H92 A;  1SAU A;  5TJJ A;  3CCQ I;  5L3F A;  4BY1 J;  1J0R A;  3K7A J;  1I27 A;  5LGN A;  2XV4 S;  2DFH A;  4XKW A;  5M5Y J;  3ERE D;  5BNG A;  4II2 A;  3WU1 B;  1ZG3 A;  3FKI J;  3R0A A;  1OLT A;  3X2Q H;  3QQA A;  1O3T A;  5EG0 A;  1MBJ A;  4CUG A;  3RZD J;  4CHU A;  4XLP F;  3LQR A;  1AKH A;  3SEQ A;  2XF5 A;  3DPL C;  3RIR A;  5LEK A;  3AL0 B;  2QZ8 A;  2BBY A;  2W25 A;  2G7H A;  4MO7 A;  1O3Q A;  4CCK A;  1T8I A;  1OMI A;  2H8R A;  1DUX C;  3KEO A;  2GXG A;  3Q0V A;  2XGD A;  5ICE A;  1KGS A;  4XBF A;  1QPM A;  4XKC A;  2VKD A;  5KCM A;  4IQ4 A;  2OU2 A;  3DEW A;  1VND A;  2VQH A;  4GO1 A;  1QO0 D;  2VJ4 A;  2BEO A;  1U5T A;  2QCO A;  2F5D A;  3KYC B;  1PUF B;  4QTR A;  4XLE A;  3HPH A;  4ZDL A;  5DM6 F;  1QZE A;  2E36 A;  4D0P A;  3F21 A;  2M45 A;  1MJA A;  3JRC A;  2XSJ C;  5M5W J;  2JUC A;  2MD0 A;  1R6R A;  1TQI A;  4I98 B;  2R92 J;  2X6Y A;  1T95 A;  1MIJ A;  3ONQ A;  1IXC A;  2ZBK A;  3PJR A;  4BJ5 C;  4L18 B;  4PUS A;  3ASN H;  4MLO A;  3G6E I;  4FCY A;  1SFU A;  2JPB A;  4EJT A;  2EK5 A;  2LRE A;  1R22 A;  2O0Y A;  2PMZ A;  1I6X A;  3H5A A;  2PJR A;  3WU2 C;  2ISZ A;  4FE7 A;  2OC6 A;  4LG0 A;  2R7V A;  3GW2 A;  4A3D J;  1I3Q J;  2K4J A;  3F22 A;  4IHY A;  4U0Y A;  4ZTJ A;  2VQC A;  1ZRD A;  2DA7 A;  2X1C A;  3SZG A;  2LF8 A;  1RUN A;  1B6A A;  1EH7 A;  1ZG5 A;  3VOE A;  2HI3 A;  1VFC A;  4M9X A;  1O3R A;  2VBZ A;  1OIS A;  3E97 A;  4FX0 A;  1Z7L A;  3P5J A;  1SD5 A;  1YX3 A;  2ZJR F;  4BHC A;  2E35 A;  3GZ5 A;  5J6X A;  1ODD A;  3OS0 A;  5C4J J;  1D1B A;  1UZC A;  2J5P A;  2H8W A;  3BDD A;  3SEZ A;  4Q47 A;  3A0H C;  3KIO A;  4RDU A;  2W48 A;  3L2V A;  1ZQ3 P;  1MND A;  1EA3 A;  2DMP A;  1Z0X A;  4PCQ A;  5LFA A;  2YX4 A;  2ZXI A;  2KZG A;  1FOY A;  4A3I J;  2L7K A;  4CGZ A;  5JLX A;  3LAJ A;  4M72 A;  2W00 A;  1QRY A;  2OBP A;  1YO5 C;  1RRJ A;  3D0S A;  5M3M J;  1Y6I A;  5K7F A;  2XKP A;  2CW0 F;  3LFK A;  1DPR A;  1NK2 P;  1BC7 C;  3G73 A;  4LLL A;  1FC3 A;  1FBQ A;  1U2W A;  3K0L A;  1JJ6 C;  5FFZ A;  2E7W A;  3DXJ F;  1TLH B;  1XD7 A;  4ASN A;  1ZGJ A;  1Z9C A;  2LKX A;  2BOL A;  3KP4 A;  4XOT A;  2UUZ A;  1FNN A;  1YIO A;  1N25 A;  3S93 A;  1W7P A;  1UG0 A;  2OD5 A;  3COA C;  1D1A A;  3S2H J;  4G6T B;  1S5L C;  1Z67 A;  3LQQ A;  3RDI A;  1TW2 A;  4ENJ A;  1YG2 A;  3M8J A;  4PSW A;  2C6Y A;  2QA4 I;  3FIW A;  3OYB A;  5C4X J;  3TL4 X;  2R7R A;  1FTT A;  2F5E A;  4L9J A;  2Y9Z A;  2CMP A;  2HXI A;  3AG2 H;  3CMM A;  4A69 C;  4CZC A;  2KIF A;  5D5U B;  2JA7 J;  4NBQ A;  3CJQ B;  3HGG A;  1LUJ B;  2NXN B;  4CDG A;  4F55 A;  3WTU C;  5IPA A;  4DYC A;  5KHD A;  2R5Z B;  2ME6 A;  4GRI A;  1RUO A;  2XUB A;  3JRI A;  1HKS A;  4M3E A;  1YS6 A;  4P5O A;  2K85 A;  5CYV A;  1MKM A;  3DTI A;  3JAM K;  1V54 H;  1JGG A;  3BJO A;  4HOB A;  4RAG A;  5A2Q K;  3C1D A;  1XGM A;  3I58 A;  2EIK H;  3RSN A;  5KVR A;  3ZMD A;  2KL4 A;  3HIF A;  2XSD C;  1H9T A;  1ORK A;  1PVE A;  2P6T A;  1U0J A;  2WC2 A;  4I09 A;  3ESW B;  2DCE A;  4XNF A;  3M1C A;  3OYL A;  3ZP5 A;  2XVC A;  1VQP I;  1QNT A;  4LLG F;  2XAS A;  1MD0 A;  3VPR A;  1WJF A;  2PEX A;  2IVM A;  2MFZ A;  3BQZ A;  4BDZ A;  2OAZ A;  2FJ1 A;  3V8K A;  2VJJ A;  4KUM A;  3K9T A;  3K1N A;  3BTC A;  1MGT A;  4RB0 A;  3MN2 A;  4KIC A;  2H27 A;  5JR3 A;  1N77 A;  3KEY A;  3I59 B;  3QU6 A;  4L0Y B;  2R7W A;  2CGP A;  3I3L A;  3KZZ A;  4WX9 A;  3HSE A;  3ZMV A;  1QVT A;  3E7L A;  3QU3 A;  5D8L B;  1W4M A;  5DD8 A;  3V7C A;  5HOD A;  4E7S A;  2FF4 A;  4EJO A;  3A01 B;  2A6E F;  3WTW C;  2BY1 A;  1SFE A;  4O3M A;  2QGU A;  3F9K A;  3BLY A;  3ABT A;  2EIL H;  2DTR A;  1S7O A;  1YW8 A;  5E17 F;  3UR3 C;  3MKY B;  2CRG A;  5HS8 A;  4S05 A;  1SVM A;  2BW3 B;  3S3N A;  2BW3 A;  1FY7 A;  1SD7 A;  4B44 A;  2GA1 A;  2L9V A;  2OPT A;  1UG2 A;  3BPX A;  2ISY A;  1Y1W J;  1TZL A;  1FLI A;  1IN7 A;  2VBW A;  2DOF A;  4N9H A;  1P4X A;  2JVH A;  5J1R A;  3VFZ A;  1GV2 A;  4L9N A;  5HNH A;  2IS4 A;  1IN5 A;  1IN6 A;  2ESH A;  1QZY A;  5CVR A;  2B0L A;  5F0H A;  5D8K B;  1B59 A;  5J47 A;  3CO7 C;  4FE4 A;  3DPU A;  2PG4 A;  3E5X A;  5IP9 J;  3T8R A;  3CC7 I;  3PFY A;  3CD6 I;  4MTD A;  1O57 A;  1WFX A;  2HGC A;  1VQ4 I;  2PI0 A;  4C9Y A;  4G7Z F;  4R1H A;  1HSJ A;  4I0A A;  2TCT A;  4XLH A;  3RJP A;  1E3P A;  1GUU A;  5F0C A;  2DW4 A;  3ROU A;  2ZJP F;  1YYV A;  3E3V A;  5CKT A;  2F4O B;  3GO5 A;  4MTE A;  1R36 A;  1WRJ A;  2L5Q A;  4UNO A;  2VN2 A;  1V4R A;  4UB8 C;  2NS8 A;  2Y2Z A;  1YI2 I;  3IUO A;  3W6K B;  1F5T A;  4AU7 A;  2LR8 A;  2A6T A;  1IUF A;  2EJR A;  3B6A A;  3KZY A;  3W3C A;  1UHS A;  3OL3 A;  4LOC A;  4BNC A;  3H9J A;  2R3S A;  3AAF A;  1LE8 A;  3GTM J;  4IJA A;  3J7A O;  2H94 A;  2RAE A;  4Y7N J;  3VYU B;  5B3S H;  1Y8Q B;  3S17 J;  3LSH A;  1MMD A;  3VDX A;  1RKW A;  3KP2 A;  2HTJ A;  4LIT A;  2ZCW A;  4U0V A;  3H3V K;  2JQ7 A;  1VTN C;  5IT9 K;  1GVD A;  4YFX F;  5HDN A;  2QWW A;  5E1Z B;  3VYS B;  3F6V A;  3GME A;  1YOV B;  1BJZ A;  3G1O A;  5E18 F;  2W4S A;  2DDA A;  2XPU A;  2I5U A;  1FIP A;  1R1U A;  1J09 A;  5FD6 A;  2IT0 A;  2EWN A;  2I10 A;  2OZ6 A;  1FX7 A;  4A3M J;  1KA8 A;  4KJZ A;  5EEA A;  2XHK A;  4HST A;  2XAQ A;  3PUF A;  3H9Q A;  3ABK H;  3ECO A;  3GCM A;  3TW7 A;  3CMA I;  3F8F A;  1B9N A;  1YRN A;  1GXP A;  2M4G A;  3NAR A;  3IKT A;  4C2U A;  3A4C A;  3HSR A;  3O2P E;  3N4M A;  4O5V A;  3RKQ A;  1HW2 A;  3CCY A;  1IXS B;  1R58 A;  2LBF A;  2DMU A;  2IGN A;  5FKK A;  4XKV A;  2DBB A;  2FX0 A;  3S8P A;  3GLL A;  5H6R A;  3CUQ C;  2LVS A;  3L7W A;  4FIS A;  4XOP A;  2JN6 A;  2CQ7 A;  1BL0 A;  2P5L C;  2K9M A;  3OR2 C;  1FYM A;  4HSR A;  2R7Z J;  2DA1 A;  4YG2 F;  2CH0 A;  3I71 A;  3CUO A;  4DYR A;  1MBF A;  1QVU A;  3QPH A;  5F6F A;  3K10 A;  4A0X A;  1R1V A;  2CJJ A;  3GWZ A;  1XGN A;  4M9S A;  4S0H B;  1VI0 A;  3HJE A;  1V5G A;  2F4I A;  1QA6 A;  1ZGA A;  5H6Q A;  4WCG A;  4OMY A;  2M30 A;  5BS6 A;  2X85 A;  1D8J A;  3U1K A;  2IGO A;  1ONV A;  3H5N A;  3PO3 J;  1Q1H A;  4AC0 A;  2FNP A;  3JR9 A;  3OSG A;  2CUZ A;  1T33 A;  1ETQ A;  2IGM A;  2K02 A;  3SZT A;  4IEJ A;  2Z3Y A;  5M5X J;  2RRE A;  2DT7 B;  4C30 A;  2P5V A;  3BOQ A;  3R61 A;  2CW7 A;  3H36 A;  3BP8 A;  2NS7 A;  4BQO A;  1XS9 A;  2UZK A;  3TOB A;  2JA5 J;  1UFM A;  1RZ4 A;  2IBD A;  1SMY F;  2HR3 A;  3WU0 A;  1DP3 A;  1YW9 A;  1XGS A;  2P7V B;  4UB6 C;  4AIJ A;  3BT9 A;  3H5R A;  3W2A A;  5D4S A;  1U6G A;  3F8C A;  4XR6 A;  4YEJ A;  2DPU A;  5L3D A;  5H2F C;  4ZYG A;  1BI2 A;  2HWV A;  2OCC H;  2BYV E;  4KIB A;  3ZMZ A;  3MZH A;  2F4M B;  1L3L A;  1OCR H;  2NRA C;  2GOM A;  4IRI A;  3L2U A;  1JUM A;  3WTT C;  5IYB J;  2YX7 A;  2KT0 A;  2E60 A;  4KYW A;  2ZXH A;  1FEX A;  1FJL A;  1MW7 A;  3AG1 H;  1FP1 D;  3GTL J;  1NH3 A;  2ZNY A;  3A0B C;  4M9Z A;  4XRM A;  4UV9 A;  2E2H J;  2V1N A;  3PNV A;  1Y39 A;  4BQA A;  5CLS A;  1HKT A;  1Z21 A;  3RQ4 A;  2ME0 A;  5FFX A;  1LVA A;  2G7U A;  3IRR A;  2VJI A;  2VOO A;  2NYX A;  1RR8 C;  3CDI A;  2AXL A;  4E6K G;  5TGT A;  4XN0 A;  4XIC A;  4PDK A;  5HNF A;  2NVY J;  2K5C A;  3KP7 A;  1I5Z A;  3ISP A;  3W2W A;  5IYC J;  5GAH J;  3WE3 A;  1GVJ A;  2OA4 A;  4PJN A;  4BXX J;  2WB1 A;  4JBA A;  1TQM A;  5LHG A;  2CUJ A;  1XN7 A;  2LRD A;  2Y75 A;  4A3C J;  3S1N J;  5JI6 A;  3OWT A;  4XSX F;  1LDJ A;  4E4H A;  2HDC A;  3LSG A;  3OS2 A;  5IYD J;  1BR4 A;  1YHQ I;  2BHZ A;  3JTH A;  1A6I A;  1JT6 A;  2JPC A;  3PUB A;  2G0E A;  4BDY A;  5C3E J;  3CJR B;  4XKB A;  3VWB A;  2D2W A;  1BJA A;  3GTK J;  5FKN A;  2GWR A;  2JA2 A;  1HDP A;  1UJ8 A;  2ESN A;  2VT3 A;  4AIK A;  1R00 A;  2DT5 A;  2KZV A;  2GXA A;  1ERD A;  1B1B A;  2OCE A;  2IJL A;  3GEZ A;  3EQL F;  3WE2 A;  2D5V A;  3RKY A;  4EGZ A;  3I56 I;  2A6H F;  2Z9O A;  1KU3 A;  3NQO A;  5JHU A;  5F64 A;  1SFK A;  3FZV A;  2VQG A;  2RQP A;  4AIH A;  1K78 B;  2M7B A;  3LFU A;  5AIP A;  1ZRF A;  1K6O A;  2FBH A;  4HQM A;  3MWM A;  2QM3 A;  1RI7 A;  3BY6 A;  4AID A;  3D5L A;  2FQ3 A;  2F2E A;  2R0Q C;  3AG3 H;  1QHG A;  4B3X A;  5L3E A;  2AS5 F;  5DUK A;  3BCA A;  4BXU A;  1FYK A;  4ESF A;  1DPU A;  1IG7 A;  2VOD A;  3PNY A;  1BC8 C;  2MYS A;  4HQE A;  2HOT A;  3FXK A;  5E1W A;  2EBI A;  2O5R A;  2XKO A;  5AIQ A;  2CV2 A;  3HTS B;  1MNE A;  4HDU A;  2W85 A;  1IRG A;  1IDZ A;  2GA2 A;  3FXO A;  1QPI A;  1BM9 A;  5K1Y A;  2BY3 A;  2CUF A;  1WJD A;  4DOZ A;  3FXJ A;  4RA2 A;  4KMF A;  4M3G A;  2K4B A;  2JT1 A;  1UAA A;  2H1L A;  4XSZ F;  3P9K A;  1MMG A;  2JTV A;  2FUG 2;  1U8B A;  1ZKG A;  1A5J A;  4EM0 B;  5TRD A;  1TNT A;  4Y13 A;  1VQ7 I;  3R4K A;  2R5Y A;  4I01 A;  3K69 A;  3LA3 A;  1R7J A;  4I99 C;  2M5W A;  4KIG A;  4Y3O A;  1E3O C;  2JJ7 A;  2O8K A;  3G3Z A;  5HLH A;  2OTL I;  4UUT A;  2X4H A;  4BBR J;  2VXZ A;  4S04 A;  4H0E A;  1FZP B;  2AXT C;  3C2G A;  1HLV A;  4OAZ A;  3FXL A;  1ETX A;  3ZQL A;  1WZ2 A;  1CGP A;  2IXS A;  1TC3 C;  3PQK A;  4A3L J;  2MC4 A;  3ZMS A;  3AL0 C;  2AHQ A;  1BI1 A;  3S1Q J;  2K86 A;  1YQA A;  3EUK L;  3OIQ A;  3DBR B;  2E1O A;  4PSX A;  3MKW B;  1SEU A;  3O3K A;  3K1P A;  3REO A;  4M6Y A;  1B8I B;  3BR5 A;  2DO7 A;  1ZN2 A;  1Z3X A;  5JVG F;  1XDU A;  4ZH4 F;  4HF2 A;  1ZLJ A;  5FJ8 J;  1X3Z B;  4A3E J;  1ZG1 A;  2E1M C;  4PJ0 C;  4LG0 B;  4RB1 A;  2IS1 A;  2ZME C;  4HNV A;  3DV8 A;  3KE2 A;  4AVZ A;  3GX4 X;  3G4S I;  3IWZ A;  4G7H F;  2X1D A;  1HXD A;  2E1C A;  2NNY A;  2V6E A;  3ZCO A;  1LNW A;  3ZN0 A;  1FBU A;  3UNG C;  2E19 A;  2JVG A;  3GVA A;  3LA2 A;  4XL9 A;  3GTG J;  1ENH A;  1OFC X;  3WG9 A;  3WOD F;  1V5E A;  2HVR A;  2GIZ A;  3RPU A;  5FGM A;  4U0W A;  2CUE A;  5DTD A;  1H89 C;  1MSE C;  2M8G X;  1OCC H;  9ANT A;  2WAE A;  4RB3 C;  1ETV A;  5IY5 H;  4XOR A;  2ICW G;  1H88 C;  4EM2 A;  4MHG A;  4BE1 A;  3WHB A;  4B8X A;  5DCF A;  3FXQ A;  2OF7 A;  2Z2S B;  1JKR C;  3CF5 F;  2L7Z A;  1K61 A;  4MQV A;  3TO9 A;  2JRT A;  3B6C A;  2VPR A;  1XB4 A;  1HQC A;  1QU3 A;  4IXA A;  1EH8 A;  3KFW X;  1FWZ A;  4DZJ A;  3HM5 A;  1P6R A;  2IP2 A;  1TWG J;  5GTH C;  1WH5 A;  2KJC A;  3QYB A;  3SXY A;  2GZW A;  2K3P A;  2Y31 A;  1SC7 A;  4BJ6 C;  2HQA A;  3NWT A;  2EFW A;  1TNS A;  1TWH J;  3WTS C;  5B66 C;  4D1Q A;  3BJ6 A;  4XID A;  3DCF A;  1FYL A;  3I53 A;  4L9T A;  3DU5 A;  1XPX A;  2R7D A;  3VSL A;  1Y56 A;  4RLF A;  3LSM A;  2L7M P;  1CQT A;  1AA7 A;  3H0D A;  2VBY A;  2DYS H;  2BVL A;  5AON A;  5EYR A;  3GTJ J;  3HHH A;  3QWL A;  1KQ8 A;  3DBH B;  1LEA A;  3S1R J;  1WPK A;  1BOA A;  2JA8 J;  2HQ5 A;  3QOD A;  4FX4 A;  1ZH5 A;  2OZU A;  1VQ5 I;  2JWT A;  3V8J A;  2VE8 A;  1ZYR F;  3HRS A;  1AU7 A;  1W7P B;  3M1E A;  4RM3 A;  3VYT B;  4IHW A;  2W24 A;  4BQQ A;  4C3H J;  4YFN F;  2VLA A;  2L9N A;  2ZB9 A;  1STZ A;  3GLX A;  3CC2 I;  2KIS A;  3FIS A;  3G1M A;  1WSU A;  1W1W E;  3CDL A;  3QP5 A;  4J19 A;  3EPZ A;  3HG9 A;  1IDY A;  1BIA A;  1OR7 A;  4KN4 X;  4J01 A;  1A31 A;  3CQZ J;  1LJ9 A;  1T0F A;  3IRQ A;  5ICG A;  4DGW B;  5D5V B;  1WQ2 A;  3MFK A;  2EA2 A;  2WY7 Q;  1HOM A;  1ETK A;  4UV8 A;  4Z2Y A;  4BQN A;  2AQF A;  2K40 A;  2VIX A;  1YFH A;  2Y48 A;  4KT5 C;  6PAX A;  1WJC A;  5F0F A;  5J3L A;  2Q1Z B;  1Y0U A;  4NC7 A;  2ZNZ A;  1EKE A;  1MBE A;  3FMQ A;  5FKL A;  2XRO A;  4OWR B;  3RZO J;  3FM5 A;  5K5Q A;  2KPM A;  3LMM A;  2MA3 A;  1MJ9 A;  3QPL A;  4DW6 A;  3J7Y J;  5IT3 A;  3F8N A;  1F9N A;  4DBQ A;  1G6N A;  4AVP A;  2QBY A;  1MJB A;  4RGU A;  1FOK A;  2QQB A;  2HOE A;  2LG4 A;  2EFN A;  4CA0 A;  2V26 A;  2X9D A;  2A61 A;  4CYC B;  2Z1D A;  4U87 A;  1KU9 A;  1ZAR A;  3H1C A;  2HKO A;  4AYB A;  3WTY C;  4OMZ A;  2WV1 A;  1LFU P;  4F93 B;  1HCR A;  4A6D A;  1S6L A;  3KYD B;  1GLN A;  4C3I J;  2ECB A;  2M2E A;  1T2K A;  2YU9 J;  3BG5 A;  1YJ9 I;  4ENK A;  3SYT A;  1W5T A;  4PFP A;  3RTR A;  4PGH A;  3HBL A;  5EEG A;  5HVQ C;  1DGR M;  4FET A;  4OIP F;  1RET A;  4DZP A;  4X6A J;  2DMQ A;  3OOP A;  2KFD A;  2K3F A;  1TWC J;  1JKO C;  3ERM A;  2O61 A;  1U9N A;  3C18 A;  3C7J A;  2VC0 A;  1RES A;  3FMS A;  3LAP A;  1GT0 C;  5EF6 A;  3H35 A;  5BMZ A;  2HTS A;  3G2B A;  2JSC A;  3ZOB A;  2EZL A;  2V79 A;  3S3M A;  3ZR8 X;  5DCM B;  3EUA A;  4C3J J;  3KLO A;  1APL C;  1X2N A;  3EYY A;  1FMV A;  3LSR A;  2QKM B;  2JK3 A;  3GBG A;  2PJR B;  4HF1 A;  4A6E A;  1OYI A;  5JVT A;  4A3G J;  2P4W A;  4N9I A;  3M9A A;  1X1D A;  4IHX A;  3QRF F;  3HYI A;  1OCP A;  2FMY A;  1IRX A;  3TMO A;  5E20 A;  3CCR I;  3ECH A;  2R7U A;  4IZZ A;  4WK8 F;  3FX3 A;  2CU7 A;  2RC4 A;  3GZN B;  2WTE A;  3CP2 A;  2IGK A;  1R1T A;  4BL0 B;  3GFJ A;  1BIB A;  3OYM A;  3CCJ I;  3A2K A;  4LD5 A;  4DJA A;  2X0L A;  2L01 A;  1R5H A;  3H0G J;  3ZPL A;  4KIS A;  4DQ2 A;  4M73 A;  2P5K A;  4JYK A;  5CVI A;  4Q5S F;  2FEZ A;  1TL8 A;  3GTQ J;  4HX4 A;  3WGI A;  4E7I A;  4PGG A;  2EV0 A;  3TP3 A;  2B7E A;  4P96 A;  3OYF A;  2PLY A;  2G9W A;  4IHT A;  3E5U A;  4HNT A;  4G6D A;  3TP0 A;  5B1B H;  4BJT A;  4RGS A;  3CME I;  3D5R C;  2TRT A;  2EZK A;  2VAS A;  1KQ9 A;  4KIF A;  4P1W A;  2DFI A;  4RMN A;  1DU6 A;  3HRM A;  4GCV A;  3M8E A;  2QQA A;  2DTZ A;  2ZXJ A;  1IO2 A;  2IA2 A;  4HV5 A;  3JRH A;  4CXF A;  1ZR2 A;  2W57 A;  1WJB A;  4JX4 A;  5JFR A;  3DTK A;  1USS A;  1WI9 A;  4HLX A;  1ZK8 A;  5J40 A;  4EJU A;  4EMS A;  5LGT A;  4UXN A;  2X6X A;  4GDF A;  2EFP A;  5CVV A;  1J9I A;  1WHU A;  3H3Z A;  3K4J A;  1YLF A;  1WI3 A;  3HOU J;  3JCU C;  3NRV A;  1SVL A;  2CQQ A;  1FIA A;  2QSF X;  3I54 A;  3M8F A;  1FOX A;  5CQE A;  1V55 H;  4XN3 A;  2KRH A;  2ELK A;  2K27 A;  1AOY A;  2P0W A;  4MGR A;  1IRZ A;  3ZN1 A;  3IL2 A;  3KX2 A;  2FD5 A;  1ACI A;  1QGP A;  2K9Q A;  4F7Z A;  2HDD A;  2XB5 A;  3KLN A;  3FHN A;  4KDP A;  3U9G A;  4LK0 F;  1H8A C;  3HOX J;  5EGO A;  1OCO H;  5FD5 A;  2QYO A;  3BR3 A;  4L5I A;  4Y15 A;  5IP7 J;  2GQQ A;  4RB2 C;  2DA2 A;  3OY9 A;  4NUB A;  1WJ5 A;  2AQE A;  2L7F P;  4O6J A;  4BAY A;  1RIO H;  1S3J A;  1B9M A;  3K2A A;  1PYV A;  2DOA A;  1ON2 A;  3SHF A;  4ITV A;  3DP7 A;  5GAD J;  2ZFW A;  4G12 A;  2ZFU A;  2H09 A;  1EV7 A;  3PIO F;  3LNQ A;  4HAM A;  4A93 J;  3DTE A;  5LHI A;  3P7N A;  3C2B A;  2JMW A;  4UUS B;  1X2M A;  3MEX A;  3BCB A;  1UB9 A;  4WXD A;  3VOD A;  2O8X A;  2GLO A;  1R71 A;  2PN6 A;  3Q3S A;  1QBJ A;  2EV6 A;  1NK3 P;  5ICF A;  2BVM A;  2WAQ N;  4GXO A;  2PMU A;  3QYF A;  2IA1 A;  2V4J C;  1X1B A;  4MFD A;  3ZQC A;  3JRB A;  1PP8 F;  3NAU A;  4OAY A;  3JAM Z;  3GXO A;  3OIP A;  4HBL A;  1P4A A;  1X58 A;  2DJN A;  1VQN I;  1YW7 A;  3OYN A;  4CCJ A;  4HRI A;  4CCM A;  2VBX A;  1TQP A;  2CG4 A;  3EUH C;  2IEK A;  2O9L A;  4EV0 A;  4XK4 A;  3ABL H;  4NNJ A;  4QSH A;  1REP C;  4LLN A;  2DA5 A;  1YIJ I;  2COB A;  3ZMT A;  2ZXW H;  2B63 J;  5LEJ A;  3A1Y A;  2EFQ A;  2OQG A;  4D9J A;  2Y0S N;  1A36 A;  3T1B A;  4N0B A;  5IP6 A;  2MC3 A;  1LEB A;  1LFP A;  4G94 A;  4I6Z A;  3D1N I;  1HBX G;  2NOJ B;  3K4C A;  4MIM A;  4U88 A;  4DIQ A;  2XAJ A;  3FWE A;  2CV0 A;  5DCM A;  1UHM A;  2ID3 A;  3IHU A;  1LE8 B;  4CYC A;  1FTZ A;  3C2H A;  1T38 A;  4UVA A;  4KN7 X;  1DDN A;  5FO5 A;  2JSP A;  3IAM 2;  1SAX A;  1PUE E;  2VOP A;  4JX6 A;  1G59 A;  4HYE A;  2YS9 A;  1WKM A;  2DLL A;  1JKP C;  2ZKZ A;  2A07 F;  3LL7 A;  5DEQ A;  1X3U A;  1X19 A;  3T5X A;  1LDD A;  4D7M A;  2Q8K A;  3S1M J;  3FK7 A;  3DKW A;  2MSY A;  1R9T J;  1JHF A;  4II3 A;  2V9V A;  3GZ6 A;  1I1S A;  2K9S A;  3I0T A;  1Z91 A;  4P55 A;  2GOX B;  4EEF G;  1O7F A;  2L2O A;  3RKX A;  2VB6 A;  2L4M A;  3IWF A;  1OKR A;  3CDH A;  3PIP F;  3K6G A;  2HPM A;  2L3D A;  1ITY A;  3L1P A;  3M4O J;  3QPT A;  3SDG A;  1ZRC A;  5DV5 A;  3DEE A;  2E34 A;  2RN7 A;  1HC8 A;  4HX8 A;  1Z3Y A;  3OV8 A;  2FQ4 A;  5IOY A;  3GFM A;  2VKH A;  2M8E A;  4XLA A;  3AKZ A;  1XGO A;  1QHH D;  2GAU A;  3ZQH A;  4F91 B;  2UWM A;  2FNA A;  1SD6 A;  4Q48 A;  2VQL A;  4B1R A;  2M4K A;  1PJR A;  1W36 D;  3KEQ A;  2VE9 A;  3HRU A;  3IH2 A;  5E3N A;  2BXY A;  3BG3 A;  3CZ6 A;  4C2T A;  4N4O B;  3HC7 A;  1PDN C;  3S14 J;  2RQQ A;  4B09 A;  3RYR A;  1AHD P;  3MQ0 A;  1P2F A;  2KQR A;  4BAC A;  1R5G A;  5JLW A;  5ED4 A;  3J80 K;  2CO5 A;  4FAS D;  4G8X A;  3MKZ A;  2DJI A;  3HUG A;  3K4B A;  2EZI A;  3N05 A;  4OIQ F;  1IRF A;  4BYY A;  2R7Q A;  3TED A;  3ULQ B;  3R0J A;  4L9V A;  3FMR A;  4HLY A;  3ZGK A;  3I4N J;  3E1S A;  3I4P A;  4E7H A;  3RKW A;  2FSW A;  1UST A;  1E0E A;  1R4N B;  4BKX A;  3MD2 A;  2DA4 A;  4OU0 A;  1IC8 A;  5DYM A;  4A12 A;  4PJL A;  4BBS J;  5D5X B;  5F04 A;  4QLC U;  2O6G E;  1W7P D;  2EFO A;  2M87 A;  1X1A A;  1IZ1 A;  3KP6 A;  3DU6 A;  4I0B A;  2J5O A;  3CF2 A;  2EPF A;  2XGE A;  2R5Z A;  3Q5F A;  4MEY F;  3OYG A;  4PJJ A;  4BS9 A;  1DU0 A;  4CH7 A;  1NG7 A;  1OCZ H;  5HLI A;  3ZMU A;  3KP5 A;  3HL2 A;  4RGX A;  4KMU X;  5EGO B;  3T0Y A;  4I76 A;  1XCV A;  4NB5 A;  4ZYE A;  2P7C B;  1KYZ A;  3I4M J;  4IOC F;  2ZSH B;  2DQR A;  2A5W A;  2LTP A;  4X0G A;  4A3J J;  1H9G A;  4Y33 A;  3I59 A;  4QPQ A;  3PSF A;  1YIT I;  2LMD A;  5H20 A;  2HOA A;  1R4M B;  2Z99 A;  1KU2 A;  3IH3 A;  3F3X A;  1WH7 A;  1K78 A;  2NS0 A;  4YRV A;  2VUM J;  1BBY A;  3DPT A;  2OQR A;  1TWA J;  2QEN A;  1G4D A;  2D45 A;  3LSI A;  1HW1 A;  1S9H A;  1M1E B;  5J4V A;  2CQK A;  4IKF A;  1P92 A;  5DS9 A;  2LDU A;  1G8X A;  2NAZ A;  4BHB A;  4L5J A;  4NHJ A;  1EH6 A;  1I1G A;  1ZHF A;  2BXZ A;  1X4P A;  2A68 F;  2HU9 A;  5HDG A;  1P7I A;  2E1N A;  3HZJ A;  4LMY A;  4P9F A;  1VQ9 I;  2Y30 A;  2XRN A;  5HLT A;  3KET A;  5HS9 A;  1ULY A;  4NDL A;  2RKH A;  2LF7 A;  1VZ0 A;  1K6Y A;  3K4M A;  4LIV A;  4QIW N;  5E79 C;  2MBF A;  4ZYH A;  2CWE A;  2VXD A;  4M3F A;  3EUH A;  1VQO I;  1K83 J;  4BUP A;  3Q9V A;  2XGX A;  2D1H A;  4MQ9 F;  3W2V A;  5D4R A;  2KIM A;  2HQR A;  3GYH X;  2CV1 A;  3OYE A;  5L3B A;  4IF4 A;  4EJW A;  1HKQ A;  3EYI A;  5J1U A;  4Q4Z F;  1U8R A;  1J59 A;  2CSO A;  4GYG A;  1IV8 A;  3PL8 A;  1JUP A;  1U5T C;  5J8F A;  1TWF J;  4ANJ A;  5IT9 Z;  1R49 A;  1U5T B;  4F52 A;  2O3F A;  4B47 A;  4E7L A;  2XF7 A;  1GHC A;  3V4G A;  1LPQ A;  3E0J B;  3QAH A;  4ZJZ A;  2WA0 A;  4ON0 A;  3HOW J;  2Z33 A;  4BH9 A;  2MAB A;  4ZDO A;  5E8G A;  3Q0W A;  1WGX A;  3K4K A;  2HPI A;  3CES A;  1LDK B;  1X1C A;  1DP7 P;  3IKV A;  3ZQQ A;  2HOS A;  3TDZ C;  3HEF A;  3BZK A;  3DKX A;  2HYG D;  2EV5 A;  3JRG A;  1F43 A;  3RPQ A;  4A5M A;  1AWC A;  1MH4 A;  2FBK A;  1K4S A;  2DMT A;  4IHV A;  2X6O A;  4XRF A;  3O8G A;  2LY1 A;  1HF0 A;  1E17 A;  5FRN A;  3S2W A;  2OV7 A;  3QOE A;  2KLO A;  4JQF A;  2LKP A;  3HRT A;  5CPR B;  1BR2 A;  1QQI A;  4OOI A;  4TV7 A;  3S15 J;  1MH3 A;  4ZDP A;  2AO9 A;  3LST A;  4RAZ A;  5J4Y A;  4HEA 2;  4B43 A;  1Z7U A;  2W84 A;  2YR2 A;  2RGV A;  2DOE A;  1Y1V J;  2V9K A;  2KDZ A;  1Y0N A;  4UUS A;  4PJM A;  5FRO A;  5FLM J;  1FSE A;  2V1D A;  3BRO A;  2CQX A;  3KCC A;  2YPR A;  3U1D A;  4OIO F;  3S16 J;  2R7F A;  3BG9 A;  4WXH A;  4MFE A;  3TKY A;  2Y69 H;  3CUQ A;  3JRF A;  3OYA A;  2LY2 A;  1D3Y A;  2XAU A;  4DNC A;  1XC5 A;  2MH9 A;  1XMK A;  2Q2E B;  3WTX C;  1MMS A;  2HXO A;  3BTI A;  1D0Y A;  2E5N A;  1Y8R B;  5DM7 F;  2X1E A;  1MSF C;  1TP4 A;  2DN0 A;  1HDD C;  3HXL A;  5FLX Z;  1MDM B;  4CO8 A;  3ELK A;  5TIS C;  1SFO J;  1HST A;  3SFZ A;  3J81 K;  5BPI A;  4Z6Y A;  3HUG B;  3V8L A;  2LBF B;  1FSH A;  5KAI C;  5LHH A;  2LK2 A;  4IRG A;  5E8I A;  2HEO A;  4W1U A;  3KP3 A;  3R6S A;  1ZTR A;  2DU9 A;  2N8G A;  2M7A A;  1DGW Y;  4HNU A;  2E5Z A;  2ETH A;  3P9C A;  1MDM A;  4UUV A;  1OYY A;  2L0K A;  1W0T A;  4B48 A;  2XAG A;  1X1P A;  3S3O A;  3OYC A;  1IN8 A;  3NWS A;  3ZQI A;  3IH4 A;  3BTL A;  3L2R A;  2ID6 A;  5F1R A;  5E3O A;  2M3A A;  1XSV A;  4M3D A;  5FLV A;  3OOU A;  2FML A;  4M3B A;  2ADU A;  2H6C A;  2UXN A;  4BY7 J;  4KNY A;  2LY9 A;  1XMX A;  2FA5 A;  2YU3 A;  3F8B A;  4RAY A;  1YJN I;  3L00 A;  2CW8 A;  1L0O C;  1TT5 B;  2V6C A;  3IP4 B;  2ZME B;  2PFB A;  3K4L A;  2VPL A;  2ELJ A;  5K7H A;  2QEX I;  3S2D J;  1X4O A;  2XAH A;  4ENM A;  2EIN H;  3CJN A;  4LFU A;  4IHS A;  5FKM A;  3W6V A;  2KIQ A;  3K1M A;  3TO7 A;  4FT8 A;  2COM A;  5D6E A;  3ABU A;  1V3F A;  4LB6 B;  4ZZL A;  3J81 Z;  4PZJ A;  2DI3 A;  1J5Y A;  1XMA A;  2F5F A;  2K9L A;  2EA4 A;  5K7Z A;  3HHG A;  2KRF A;  1D8K A;  2CS3 A;  3CLO A;  3PFI A;  3LOC A;  2HKX A;  2VKV A;  1EF4 A;  3SDB A;  2STW A;  2CQN A;  1Z6T A;  1GXQ A;  4KA4 A;  3CMY A;  4HV6 A;  2Z5U A;  2MG4 A;  4B4C A;  5ILV A;  2LD5 A;  2XRL A;  3OSF A;  2HFH A;  5GAG J;  1B72 B;  2LP0 A;  5BOX A;  3WG7 H;  1ETY A;  2NVT J;  3RI4 A;  3VEP A;  2MLK A;  2VI6 A;  1LVK A;  2LNB A;  2KKO A;  2H6B A;  3IAS 2;  2GBY A;  3WGG A;  2VKE A;  1O4X A;  2EB7 A;  4A3K J;  4RS8 A;  1D5Y A;  2QSH X;  3OYH A;  1P7J A;  3TOA A;  1ZLK A;  3C3W A;  3J80 Z;  4A0Y A;  1C0W A;  4FQG A;  2IPQ X;  2L02 A;  2OJE D;  2GM4 A;  2B9S A;  3QOP A;  4AD9 A;  1NG6 A;  1Z6R A;  3D5S C;  1BW6 A;  1LB2 A;  3VB2 A;  2K9N A;  1TW3 A;  4LG3 A;  2V1X A;  1UEL B;  2R7T A;  2I8D A;  2R7S A;  3I9V 2;  2M9H A;  3F23 A;  3W6J B;  3M3Y J;  5ERI A;  1FP2 A;  3JTG A;  2W1O A;  4J00 A;  1JT0 A;  3PQJ A;  3JSO A;  1J7K A;  3T8T A;  2CYY A;  5DD4 A;  2P6S A;  3CJT B;  1T6S A;  4RM2 A;  3RPU D;  4IX7 A;  4D5F A;  2BHY A;  1CF7 B;  1R23 A;  1XSD A;  2MGQ A;  1S29 A;  5A2Q Z;  3ZRG A;  3KYL A;  1XX5 A;  1S7E A;  1WWX A;  4A0Z A;  2HYF A;  2TDX A;  3QYE A;  3DKY A;  5LGU A;  2UV1 A;  4IO9 F;  4HPQ A;  2KJB A;  3RCO A;  3WTV C;  1N75 A;  4YEL A;  2W82 A;  1DQU A;  2ELH A;  4Y4R A;  4AUX A;  1YE9 A;  2DXI A;  4UHT A;  5E1X A;  1IV6 A;  4I2O A;  3E6D A;  2HVQ A;  3DQV C;  3PNT A;  3RQI A;  1FMW A;  4P9U A;  2YUS A;  3EDP A;  2XIG A;  4BEH B;  2GXB A;  3FBN B;  3WHC A;  4ABZ A;  4CZZ A;  2XF6 A;  3KZI C;  5KK1 A;  1YX5 A;  3FXU A;  3MCZ A;  1ZR4 A;  2QKL B;  2V1U A;  2L9R A;  1XG1 A;  4K2E A;  3EET A;  2E71 A;  1EJ9 A;  3MMY B;  1W5S A;  2LSO A;  5KNL A;  1UMQ A;  3AFH A;  4E7J A;  2XAF A;  3BQY A;  2DMN A;  4CIC A;  2XC7 A;  4MNU A;  1O7L A;  3I55 I;  2WV0 A;  4UY8 I;  1W5C C;  5HS7 A;  2DQL A;  2M34 A;  3DLL F;  1WJA A;  3VSK A;  2QVO A;  4CCN A;  1MMA A;  3LA7 A;  2FBI A;  3DFG A;  4HZF A;  2YSR A;  3HOS A;  3OYK A;  3OMY A;  1G3T A;  5LBQ A;  1RC9 A;  2XPV A;  4ZC3 A;  3JRD A;  1IN4 A;  3K2Z A;  3J7A Y;  1A04 A;  4BE2 A;  2IS6 A;  5CJ9 A;  5GPA A;  3TO6 A;  2W7N A;  3HDD A;  4HW0 A;  3U2R A;  2X48 A;  5DUI A;  4G9Y A;  1LFB A;  4AWX B;  1HW5 A;  4F3Q A;  4YII A;  2NVQ J;  2R5Y B;  5BQT A;  2WAD A;  2HVS A;  1MMN A;  2LH9 A;  1IGN A;  3DWL E;  2HYJ A;  5JHF A;  4N4N B;  5LD2 C;  3FHZ A;  4ETS A;  1D0X A;  3CUQ B;  4NC8 A;  2XGC A;  2FOW A;  1ZEL A;  4MEX F;  2JRM A;  3E6B A;  4ZYA A;  1MNM C;  4HA8 A;  4R79 A;  1OPC A;  3TW6 A;  1IXR C;  4KFC A;  1WVR A;  2STT A;  4AYB N;  2HS5 A;  1IAW A;  2V7F A;  1JTX A;  4NQW B;  4V2G A;  4LJZ F;  3DBL B;  3QP6 A;  3L9F A;  2QUF A;  5HOO A;  3E6M A;  3SZP A;  1MBG A;  1B8I A;  3F72 A;  1ZRE A;  2Y0S A;  2KIU A;  3KPH A;  3VYR B;  1J2X A;  3CLQ A;  3ML6 A;  3NEU A;  4QWQ A;  3FBI B;  4E7Z A;  1BA5 A;  3FKJ A;  4EVI A;  5E3L A;  2M0M A;  1E3H A;  1LKX A;  2QQ8 A;  1Z1D A;  3ZQF A;  1FBS A;  1W36 C;  5F27 A;  3IV5 A;  4A3B J;  2VL8 A;  4NQW A;  1SAN A;  2DA6 A;  4ZZD A;  1KON A;  2HZD A;  1Q1V A;  1B72 A;  3CCL I;  4YIF A;  3HOY J;  3JSP A;  4L0Z B;  2O03 A;  5J1Y A;  1YJW I;  3BR2 A;  2KDO A;  4V2F A;  4KT6 A;  2KRC A;  2K7L A;  3O6B B;  1NHA A;  2HNH A;  5CVU A;  3OYD A;  5J8C A;  4BE0 A;  4QPO A;  1N78 A;  3Q0U A;  4HF0 A;  5HDK A;  4E70 A;  3A03 A;  3I5U A;  2PMZ N;  4XQF A;  3CCU I;  2ZME A;  3L2Q A;  3OS1 A;  2E2J J;  2JA6 J;  1JI8 A;  2FRH A;  2WAF A;  1IW7 F;  2FXA A;  4XRS G;  3CCV I;  2PMH A;  4ENN A;  1SVO A;  1KQ0 A;  2FOK A;  3OYI A;  1E2X A;  2OUM A;  2QQ9 A;  5B5E C;  4AM3 A;  1BI3 A;  3M07 A;  1TT0 A;  2IW5 A;  4RLQ A;  2RVC A;  2CFO A;  2DA3 A;  1F36 A;  4A3F J;  4LGW A;  5M3F J;  2M0C A;  4IPA A;  1QZZ A;  2DK5 A;  4EAT A;  4E7K A;  3MAJ A;  2Q0O A;  3GFI A;  1I39 A;  2F6C A;  2HZT A;  3HPG A;  3BZ6 A;  3SJM A;  3GTO J;  1K4T A;  1OYW A;  3A02 A;  3B73 A;  2IS2 A;  5CVJ A;  2DDB A;  2OTJ I;  1MZB A;  4XLF A;  1JTY A;  1MBK A;  2WB1 N;  5L3C A;  4IOA F;  3DLA A;  2LOO A;  3BWG A;  4A2U A;  1AKH B;  4KIT B;  5CQG A;  4YIR X;  2ZJ2 A;  2NOG A;  3BR1 A;  3BTJ A;  3HKZ N;  2R4G A;  2BGC A;  2XPW A;  3MVP A;  2XDV A;  5F08 A;  3FXR A;  2P8T A;  3BR6 A;  3R60 A;  1Z05 A;  1RKT A;  2A05 A;  5LRR A; 
#chains in the Genus database with same CATH homology
 3CC7 I;  2ZJQ F;  1YJN I;  1YI2 I;  1YHQ I;  2FOW A;  2OTL I;  5GAD J;  1FOY A;  5GAG J;  3PIO F;  1VQO I;  4V19 K;  2K3F A;  1FOX A;  4IOC F;  3CCU I;  1VQ5 I;  3CCQ I;  3J7Z I;  3G6E I;  1S72 I;  3PIP F;  2QEX I;  1MMS A;  2QA4 I;  3CD6 I;  1YIJ I;  2OTJ I;  3CCR I;  1ACI A;  3G4S I;  5DM7 F;  3CMA I;  2ZJR F;  3CCV I;  4IOA F;  3J7Y J;  4IO9 F;  2E35 A;  2E34 A;  1VQ4 I;  1HC8 A;  1YIT I;  1VQ6 I;  3CC4 I;  5GAH J;  3CF5 F;  3G71 I;  3CCL I;  2ZJP F;  1VQ9 I;  2H8W A;  3CCE I;  1FOW A;  1VQL I;  1VQK I;  5GAE J;  1YJ9 I;  2NXN B;  3I55 I;  3CME I;  1VQ7 I;  5DM6 F;  2JQ7 A;  1VQP I;  4UY8 I;  3CJT B;  3CCM I;  3CCS I;  2E36 A;  3I56 I;  1VQM I;  1YJW I;  3DLL F;  1QA6 A;  3CCJ I;  5JVG F;  1VQN I;  1Y39 A;  3CC2 I;  1VQ8 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...