1ACIA

L11 ribosomal protein rna binding domain, nmr, 20 structures
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
76
structure length
76
Chain Sequence
MTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L11 RIBOSOMAL PROTEIN
publication title Cooperative interactions of RNA and thiostrepton antibiotic with two domains of ribosomal protein L11.
pubmed doi rcsb
molecule tags Ribosomal protein
total genus 13
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1997-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1aciA00
1YHQI 3CCMI 3CF5F 5DM6F 1HC8A 1VQNI 3CC4I 4IOCF 2ZJRF 5GADJ 1MMSA 3G71I 1VQLI 1YITI 2QA4I 1VQPI 2ZJQF 1VQOI 5JVGF 4V19K 2E35A 2QEXI 3CCSI 4IOAF 2E36A 5DM7F 3CD6I 3PIOF 1VQ7I 3CCRI 2H8WA 5GAHJ 1VQ8I 3CMEI 3CC7I 3CCJI 1VQMI 3CMAI 3PIPF 1VQ4I 3G4SI 3J7ZI 3CCUI 5GAGJ 2NXNB 1FOWA 3J7YJ 4IO9F 2OTLI 1VQ5I 2ZJPF 3CJTB 3CCVI 3CCQI 3CCEI 1YI2I 1VQKI 4UY8I 1VQ6I 2K3FA 2JQ7A 3CC2I 1YJWI 1S72I 2OTJI 1YIJI 3I56I 2E34A 2FOWA 1QA6A 3I55I 3G6EI 1ACIA 1YJ9I 1Y39A 3DLLF 5GAEJ 1YJNI 1FOXA 1VQ9I 1FOYA 3CCLI
chains in the Genus database with same CATH superfamily
3I3LA 2GXGA 3D5RC 2Y2ZA 5DS9A 3OYHA 2CW0F 3DPLC 4OIOF 4Y52J 4FETA 2P5VA 4HDVA 3DP7A 3H5RA 3HXLA 4Y33A 3KYLA 3OYKA 2LBFB 2MBFA 1X4PA 2EILH 4ON0A 4DBQA 2L2OA 4IOCF 5HODA 1Y6IA 1K4SA 3EPZA 5GADJ 3HZJA 4ENNA 5AIPA 4HBLA 3C2GA 2JRTA 2FEZA 4BE1A 4ZZDA 3MEXA 3LAPA 1WCMJ 2KDOA 1GDTA 1ITYA 3BTCA 4HNVA 4CYDA 3GTMJ 1FBQA 4ZJZA 1OYYA 3HTUA 3PSIA 3PL8A 3B6CA 2RKHA 4D1QA 1BOAA 4MO7A 3TMOA 2KZVA 3LNQA 4Y15A 1P7IA 1Z3XA 4XN0A 4ANJA 1L3LA 3BR5A 4AUXA 3HG9A 4MHGA 3JAMZ 5GTIC 1FBSA 2IGOA 2RGVA 2TRTA 2EBIA 3EQLF 3CMAI 4OWRB 4B1RA 1A6IA 5FRNA 3VFZA 2JA6J 3S93A 1WFXA 2KRFA 5E17F 2LLKA 3RTRA 3CMYA 2CO5A 3HPHA 5J8FA 3PM1A 1AKHB 5BOXA 2M87A 3ZGKA 4CA0A 1NH3A 1W0TA 1NTCA 1T6SA 2IGKA 4HF0A 1BOBA 2VE8A 3S3NA 1N25A 3FBIB 3HYIA 2GOMA 2ZO4A 3HM5A 3F6OA 1ZLKA 2Q0OA 2BHZA 3LA2A 2C6YA 2VJ5A 4NC7A 5BQTA 1B8IA 3H5NA 1MNDA 2K9NA 4XKCA 4L0YB 5LRRA 2L5QA 1UELB 4B47A 1YJWI 3WTSC 2E1OA 1G3YA 1X58A 3HOYJ 3V8JA 1DU0A 3Q0WA 1MBGA 2JVGA 4XRSA 4CCJA 2OTJI 2CUZA 1RR8C 5JHFA 2JA8J 4EM2A 3ERED 3BG6A 3DEWA 2M0CA 2LVSA 1UMQA 2L9VA 3M1EA 3BTIA 4HV5A 5FFXA 1Z7LA 2DT6A 5HDNA 3CLQA 1O7LA 2VBXA 3N97A 2VUMJ 5HOOA 2CWEA 2AQFA 2DDBA 4ENKA 2DOFA 2NOGA 2MD5A 2LKPA 3F6VA 1SEUA 3DU5A 1QRYA 3S1QJ 4LMYA 4MGRA 3MZ8A 4RGUA 2WAFA 3WODF 1ETVA 4A2UA 5LEJA 1H8AC 4C9YA 2P6SA 4Z2YA 4ZZLA 3L2WA 1XMAA 1ZYRF 5ICGA 1W0UA 2D1VA 1JJ6C 2VASA 3LSRA 3EUHC 5CQGA 1TLHB 4YIIA 2DN0A 2V6EA 4EV0A 3WTUC 2QSGX 4ITVA 1DU6A 4RM2A 1UHSA 2QSFX 2R3SA 3M8EA 4XLPF 3IC7A 2PEXA 3GLLA 1ETXA 4HG2A 1SFXA 1XGSA 2DFEA 5J1UA 3TEDA 1TW3A 4DW6A 2LYCA 1RKWA 3TOAA 3IAS2 1G4DA 2P0WA 3MWMA 1EA3A 1JKQC 4HEA2 5ICEA 5EG0B 5LEKA 2GXBA 2H8WA 2QKMB 2MH2A 3KZYA 1OJLA 2ZJ2A 5EJCA 4QWQA 5H6QA 4BBSJ 1QU3A 1JI8A 1HW1A 4ZYAA 2IA2A 5CKTA 2EV0A 2IP2A 3OY9A 5DD4A 2FUG2 2OJED 4LJZF 4A3CJ 2F5VA 4B09A 4P1WA 2PBIA 5FJ8J 3H3UA 3CCUI 1B59A 3FMSA 4FT8A 4IRHA 1X19A 1XX5A 4A69C 2R4GA 4L9TA 3WGGA 2OPTA 3MQ0A 3ZQGA 2R0QC 3GFLA 4KNYA 1SMYF 1MMAA 4RB1A 4ETSA 5HLHA 3CCVI 1Z0XA 3K4CA 3UR3C 1D8JA 3E0JB 3FWEA 5B66C 3LSTA 4IHYA 1QZZA 3LA7A 5DCMA 1HBXG 4G94A 4XLHA 4B3AA 5FGMA 3LSJA 3ZMVA 3U2RA 1R9TJ 4P9UA 1NG7A 2NAZA 2MYSA 1E3PA 1ZELA 1PUFA 3HSFA 1BJAA 5E3LA 1S72I 4BEHA 4I7HA 3K10A 4LOCA 5EGOA 4EVIA 1LFUP 3JRBA 4HNUA 3OSGA 1ZG5A 2EFQA 4BJ6C 1IJWC 2UWMA 1GVJA 2RNGA 1MKMA 3DWLE 1LQ1A 1XD7A 3R6SA 1IUYA 1YX5A 3RDIA 5LRSA 1Y1WJ 2IS2A 5LHGA 1T8IA 1ACIA 5DUKA 2KPMA 1QHGA 1OLTA 2JN6A 4M73A 5IYCJ 4RB2C 4IKFA 1ZR2A 1YJNI 2M0MA 4XNFA 5IT9Z 3FZVA 2GA2A 4FE7A 2IJLA 1MZBA 3GTPJ 3SQNA 1ZKGA 2AXTC 1HF0A 3FMQA 4KUMA 4UV8A 1YS6A 4R8HA 2X6WA 2WV1A 2P7VB 4WXCA 2QQ9A 3RKQA 4I76A 1I1SA 1YW8A 1B6AA 3ZQQA 2ZFWA 1KQ8A 2QCOA 3DV8A 1U5TA 3SDBA 2JJ7A 2BV6A 3KP4A 3H9GA 3GFMA 1FNNA 2EFPA 3EDPA 3F8MA 2LRDA 4KYWA 3OOPA 2L7MP 1SVLA 2ETHA 3F3XA 3FX3A 2DMPA 3LSHA 1LE8B 4PFOA 2X9DA 4DBRA 1J59A 1ZREA 4ENJA 2LSOA 2GZWA 4HF2A 1XN7A 3S16J 3CDIA 1G3SA 1O7FA 1RR7A 1X1AA 3SYTA 3JCUC 1I3AA 4RM3A 4XIDA 3OYAA 3KZZA 5GAHJ 3E7LA 2KHMA 2V6CA 1RNLA 1WH7A 2FOKA 3L2RA 1R4MB 2ECCA 5D5UB 4H4KC 5HVQC 5CJ9A 3CC7I 4FISA 1IN6A 2FNAA 1IUFA 2EFOA 3HJEA 1JGSA 5K7ZA 2CV1A 4IL6C 4XRFA 3I59B 1IRZA 2CV0A 2QF7A 3JRCA 4D5CA 2R7UA 4PDKA 5D8LB 1ZTRA 5AIQA 2OC6A 2LH9A 1XPXA 5FLVA 3PJRA 4F91B 2VC1A 2MGQA 1Y8QB 3I64A 3TDUC 2VQHA 3J7YJ 1RESA 4AYBN 1XS9A 3K1NA 2F5EA 1K4TA 1VQ5I 3CJTB 1DQUA 3H3VK 2X4HA 4RB3C 3WG7H 3FK6A 1K61A 2MG4A 4HA8A 3CUOA 2F4MB 3LFUA 4XLFA 3V7SA 5D5VB 2RDPA 2NNNA 2F5FA 3KPHA 5C4JJ 4MQVA 2DI3A 3VDXA 4D0PA 4C2TA 2LFBA 4IJAA 4RDUA 3OYEA 2LDUA 4NC6A 3ROUA 4BY1J 3VYRB 2P81A 3BTJA 5LGUA 3HSEA 5M3FJ 3G3ZA 3EYYA 4IHWA 1SVOA 2HKXA 3ESWB 3FXOA 4I09A 4OIRF 3RZDJ 2O7OA 4F92B 5E3OA 4OMZA 5HLTA 3M3YJ 1M1EB 2LC2A 3I55I 2STWA 3CUQA 2XF7A 4M6XA 2R5ZA 2NS8A 4M3BA 4EM0B 3IUOA 5K5RA 3U21A 4HOBA 1FOYA 1RZ4A 1OQYA 5BMZA 3WTYC 1DGRM 1A31A 3CF5F 3BCAA 3TO7A 2NS0A 1IRGA 2EA4A 3BZKA 3JSOA 4GFBA 1WRJA 2VT2A 1E2XA 4GXOA 4LB5A 1XCBA 3Q9SA 1HOMA 2QGUA 3PNTA 5L3GA 4N4NB 1BL0A 4XKWA 2ZBKA 2HOAA 1V55H 2M4KA 5F1JA 5HS8A 3EETA 2M2EA 4KIFA 2YU3A 3DKWA 3KEQA 3KEOA 3ABLH 4L5EA 2PMZN 1YE9A 5D5WB 2BYVE 1XCVA 1ODDA 1FP2A 3PSFA 1NK3P 1JHHA 1SD5A 1QPIA 1D0ZA 4GRIA 2X1EA 2BVMA 2D45A 1UHMA 4RB0A 3ZQHA 1U0JA 1R00A 2K5CA 1I27A 1TWHJ 1XTAA 4FX4A 2K85A 5CVRA 1ULYA 2LY1A 3GFIA 3H36A 4FQGA 1W1WE 2FQ4A 1IDZA 3BPXA 2L54A 3QPLA 1QZEA 3O6BB 2JVHA 3VYUB 4CYCB 3CJNA 2HYJA 1V3FA 1KGSA 3IAM2 4CO8A 2M1BA 4A3MJ 2IS1A 3JRFA 1PP7U 4BL0B 2O3FA 3F8BA 3TW7A 2STTA 3AG4H 2K86A 4K2EA 2L7KA 4UB8C 2CQXA 2CQQA 4C2UA 2J5PA 1ON1A 1L0OC 4PSXA 2XDVA 3CCQI 3RJPA 3CCEI 1R5ID 3GZ6A 5FO5A 2H1LA 1TNTA 3BZ6A 2EINH 5CVIA 4BDYA 3IH2A 1E3OC 3R4KA 3E1SA 1N78A 1Z05A 3CP2A 3JSPA 2L0KA 1T0FA 2Y69H 2YPRA 2X6XA 2P8TA 1OCTC 4Q4ZF 2W82A 3CUQC 2OF7A 5EZGA 3BT9A 3GX4X 2EZIA 2R7FA 2Y75A 5TJJA 3HL2A 3ZRGA 5L3BA 1J75A 1FEXA 3RSNA 1GXQA 5FLXK 2EQRA 3I56I 4LG0B 2I5UA 5CQEA 4Z6YA 3QOPA 5HNHA 3FIWA 2KRHA 2Q2EB 1FJLA 3RYPA 4KIGA 3T8TA 3ABMH 3G6EI 2FRHA 4IEJA 1WHUA 1D1AA 2ELJA 3H35A 1VQ9I 2E2HJ 1Z7UA 4PJLA 3R0JA 5IOZA 3IP4B 4A3GJ 2IS6A 1HSTA 1CQTA 3CF2A 4NQWA 3IKTA 3JRAA 4XSZF 2RC4A 2MFZA 2ZXHA 4A5NA 2BY1A 3F8CA 2PFBA 4M3DA 3OYNA 3N05A 2X6OA 1S29A 4ASNA 2MABA 3T1BA 3BDDA 2XGDA 3D0SA 4MFDA 4JYKA 4LB6B 3R0AA 1Z6RA 4G6QA 2DU9A 1FWZA 2MC3A 4QPQA 3JREA 3ZMTA 3GF2A 3FXQA 3MVPA 2MC4A 4CDGA 1XSDA 3EYIA 1X1CA 1ONVA 2H09A 2V9KA 4IQJA 1HLVA 1U2WA 2ZJQF 4AYBA 1I6XA 2Y9ZA 3LSMA 4XN3A 4RAZA 2BHYA 3ERMA 4IHVA 1R1TA 4V19K 2L7FP 2A6EF 4NNJA 2F4OB 4E7HA 5DUIA 3KCCA 4DYCA 2HVQA 3F22A 1XMXA 3ECOA 2V26A 1BR2A 3IV5A 1QHHD 3J81K 4LGWA 5BPDA 2B63J 1R58A 2LD5A 5LGNA 1IXRC 3GLXA 4U0WA 2E71A 3BZCA 4AWXB 1WJEA 4M3FA 2XV4S 1TQIA 2A68F 4HW0A 1F36A 4BQOA 4HNTA 2QYOA 2NXNB 2HFHA 2HQ5A 4YG2F 1TL8A 1B72B 4IX7A 1MMGA 3KYDB 4B44A 1TP4A 2DA2A 1IRXA 2Y30A 5DTDA 2JK3A 2COBA 2V1DA 3LAJA 1WJFA 2JA2A 4E7SA 4MTDA 1K78A 1HKSA 4IQ4A 4PSWA 1U3EM 2IA0A 2W84A 2LG4A 2LTPA 1IN7A 5HLGA 1R5HA 1FLIA 2HTSA 2Y48A 3QYBA 3MCZA 5FLMJ 2HYFA 2ADUA 2DA4A 3R61A 4XLNF 3VYSB 1ETKA 4D5FA 4BDZA 3OV8A 1H9TA 1WVRA 1YIJI 3AFHA 1YW7A 4XOTA 2BW3B 1V5FA 1WWXA 2QUFA 3COAC 1HW5A 1AU7A 1KU2A 3IRRA 2RAEA 1UG0A 2GBYA 4S0HB 5LHIA 3L09A 2PMZA 2JZYA 5GAEJ 1F4KA 1X1PA 4LLLA 3TQNA 3P9KA 3CCMI 1X3WB 2Z3YA 4A0YA 4Q5SF 4LITA 5L3DA 2UUZA 3I4MJ 2K27A 4BS9A 4XICA 1R23A 2K3PA 3BG3A 3MZYA 5F1RA 5KAFC 2ZFUA 2VJIA 1BJZA 4UUTA 2CMPA 1FMVA 2F2EA 1FIPA 1XMKA 4XRSG 1F5TA 3FISA 1FP1D 3IWZA 4HZFA 3RPUD 5J1RA 1KYZA 1HSJA 2VL8A 2E1MB 1WJAA 5FFZA 3L1PA 3S8PA 3S3OA 4XLEA 1SAXA 1ERDA 2DJIA 3PUFA 2M7AA 4IVNA 4LFUA 1S9HA 3W2VA 3Q5FA 1YOVB 3A4CA 1LKXA 2VPRA 1QGPA 1W4MA 2HPMA 2R7SA 3JRDA 2PI0A 2VT3A 1LFPA 4EEFG 1SD6A 3CMEI 5EDNA 1P9QC 2WTEA 4M6YA 3G73A 3BR2A 2F48A 2ZCWA 2R7XA 2A69F 2XAFA 5EYRA 1J7KA 3HUGA 4EM1A 5FRMA 2UXXA 3EUHA 1YTYA 2E5NA 3P9CA 2LKXA 2EV5A 3CJRB 3WHCA 3QU3A 4DQ2A 2QQAA 3QYEA 4A0ZA 3H9QA 1FOKA 5A2QZ 4KMUX 2ZJPF 2CUFA 2PQ8A 2OQGA 4J00A 2LREA 1DUXC 2DPDA 2GA1A 1BM9A 1X3UA 2L3DA 4C2MJ 3NWSA 2IW5A 5FKOA 3S2HJ 1D5VA 3VSLA 1EF4A 2LOOA 4I98B 1S3JA 2AHQA 2DFIA 2CH0A 2LR8A 2FXAA 3GTKJ 1FSHA 3A2KA 3H5AA 4U7BA 2EJRA 2JA7J 1MDMB 3O8HA 2F5CA 3F21A 4ESJA 4WCGA 1FMWA 1RUNA 2WAQN 3HPGA 2PJRA 2YR2A 3N4MA 1HKTA 3FXUA 4G6TB 3QODA 1WH5A 3QPHA 1SFKA 1X2MA 2HXIA 5FROA 4L18B 2XPWA 3X2QH 1LDJA 4ZYDA 3D1NI 2GOXB 2CGPA 2Z16A 1UG2A 4XR6A 4ZC3A 4MFEA 3Q9VA 5KHDA 3I4NJ 1NHAA 2JPCA 1MBJA 3FK7A 4EJWA 2RREA 4LLNA 3TDZC 2ZMEA 2ZSHB 3FXKA 5FLXZ 1XC5A 3I9V2 4A3DJ 1Z9CA 2VE9A 3VSKA 5H20A 1RPWA 2MH9A 1TT0A 4LIUA 3ZQ7A 1A36A 2KIMA 4YIRX 2BVLA 1BIAA 1I39A 1TT5B 1Q1VA 4HX8A 3SEQA 3LSPA 3CQZJ 2WWYA 1S7AA 3K1PA 2M34A 4P9FA 5JVGF 2COMA 2O0YA 3O3KA 2GIVA 1HA8A 2R7DA 1T33A 2HZTA 3SFZA 3A1YA 4HSTA 2NS7A 3I58A 3WHBA 4IOAF 1B9MA 1QZYA 4BJTA 1MGTA 3KLNA 4KT5C 4WF2A 1FC3A 3M07A 4HX7A 1NG6A 2KJCA 2XPVA 3OIPA 3R60A 4GCVA 4QLCU 5F6FA 2EFNA 3OYLA 3PNYA 3TO6A 2DAOA 1VNDA 1E17A 1G59A 2VN2A 3PIPF 4A3EJ 4YFXF 4BHCA 2DOEA 3ZQFA 5C4XJ 4QPOA 1DPUA 4LK0F 2M45A 4HYEA 1FYLA 4PUSA 3QU6A 1B1BA 3ZMUA 2A3SA 1LDDA 2VONA 2R5YA 3TW6A 3I0TA 2OCCH 1KONA 3OIOA 2DO7A 2KIFA 2Z2SB 4L5JA 1YI2I 1I5ZA 3SZTA 3ABKH 3PFIA 4EJUA 1I1GA 2DA7A 1TBXA 4AC0A 3KP6A 2L4AA 2WADA 4AD9A 2JQ7A 5F27A 4UXNA 1BI2A 1X3ZB 1X1BA 2VOPA 1JUMA 1VFCA 4UUVA 3OS1A 2R7TA 3MD2A 2IS4A 4D7NA 2BXZA 2DCEA 4DIQA 4V2GA 3WTVC 3GCMA 1B8IB 1UAAA 2H6BA 2ZXIA 3V8LA 2OV7A 1USSA 5M5XJ 2L4MA 2WBMA 2FBHA 5BS6A 3W6VA 2VPLA 2ZMEC 1HKQA 4WWCA 2RV8A 2VJJA 2O6GE 3B02A 3P5JA 3DLLF 2XGXA 4Y17A 2Q1ZB 2Z99A 3BPVA 3KEYA 3ZOBA 1IW7F 3OYCA 1H89C 2VQCA 4PZJA 4XL9A 2HVRA 3DPTA 1N75A 4EQQA 5KAIC 1U8RA 3GXOA 2ME6A 2O61A 4C3IJ 5DDGA 1BN5A 2WB1N 4ZYGA 1TWGJ 3IHUA 3LSGA 2A5YB 1U9NA 3HOZJ 1MMSA 3JRHA 3PFYA 1ZN2A 4L5IA 3FMRA 3IH3A 2VQLA 1V5GA 3J80K 1N77A 2K02A 2P5KA 1NK2P 4DJAA 1CF7A 2QA4I 3BWGA 1X1DA 3WGIA 4KDPA 2Y0SN 1VQOI 1R4NB 2JRMA 1W36D 2FX0A 4FE4A 2OBPA 1LJ9A 1UB9A 4N0BA 1ZRDA 1VZ0A 2QLZA 4UVCA 1W36C 1R6RA 1T98A 4I0AA 5TGTA 3TL4X 2DMTA 4AU7A 2XRLA 3DTKA 3ISPA 3KP7A 2V1XA 4QSHA 2R7WA 1JHFA 4UB6C 4BXUA 4M9XA 4HLYA 1D5YA 2E7XA 3Q0VA 1Y56A 3F8FA 3M8FA 1ZHFA 1WJDA 4RGXA 3CCJI 1VQMI 5K5QA 1MW7A 2WAQA 1EH8A 2HQNA 3KZIC 3BROA 1JKRC 3G4SI 1KU3A 2RVCA 4DOZA 1K6OA 3LA3A 4EGZA 2DFFA 1FIAA 3O8GA 1BI1A 5L3FA 4F93B 5C44J 3NARA 1T2KA 4BKXA 2IT0A 1A5JA 2QBYA 3G1LA 2E19A 1IDYA 3I4PA 3SXYA 1G6NA 1TQPA 4II3A 2OQRA 2K9SA 4J01A 1FY7A 2IEKA 1C0WA 1YRNA 3UKGA 3ML6A 3E5QA 4RLQA 5E1ZB 3V42A 2ZB9A 3SHFA 4DZJA 1U78A 4A6DA 2L9SA 2XUBA 4D9JA 2EB7A 3BTLA 2KMUA 4PJ0C 1IXCA 4B8XA 5D5XB 2CW8A 1RIOH 3WTWC 2FJ1A 3FDYA 2X85A 1R49A 4JX6A 2JWTA 2CS3A 4PGHA 3BR0A 1PUFB 4O6JA 1T38A 1K79A 3GO5A 2NVXJ 2AS5F 4BEHB 4E6KG 4YIFA 2VODA 1WGXA 3AKZA 2HZDA 2VKEA 5EGOB 4ENMA 1EKEA 3AL0C 3LOCA 4A3IJ 2XC7A 3L7WA 1FTTA 3BLYA 4BNCA 2XIGA 3DFGA 5IOYA 5ILVA 1JKPC 2JMWA 3K4NA 2ISYA 3ULQB 3V8KA 3RZOJ 5M5WJ 2DQLA 5B5EC 1H88C 4IHXA 3CLOA 5HS9A 4I01A 4B48A 4MLOA 5CVUA 4RAYA 2F4IA 3HHHA 1FZPB 2HOEA 4YFKF 3A01A 2ZJRF 3HIFA 2V9PA 1MBEA 4A12A 2HDDA 2WY8Q 5E1XA 1P2FA 4RLFA 2F6CA 1QNTA 1R1UA 4P5OA 5F0CA 4EGYA 1S5LC 1IV8A 1RC9A 3W2WA 4M72A 5TRDA 4FASD 2EIJH 2DOAA 1X4OA 4BH9A 4DGWB 1TZLA 2OCEA 1JUSA 2R7RA 2FU4A 2VKDA 1U5TB 4PFPA 1G8XA 5CVVA 2V9VA 3ABTA 5EEGA 2QKLB 2FMLA 4Q47A 1XGNA 2KKOA 3PO3J 4HQEA 3WE3A 4PCQA 1APLC 2ICWG 1YLFA 1BBYA 1FPQA 3C1DA 1VQ8I 4R1HA 1B9NA 1TQMA 4BQNA 1PJRA 2KFDA 2Z1DA 3VODA 2XSDC 4P55A 3AG2H 2V7FA 2OUMA 4G6DA 2Q8KA 5D4SA 2LF7A 4YELA 4CXFA 4U87A 4AVPA 2NRAC 1FOWA 4MQ9F 1FYKA 3E3VA 3TBIA 3TP0A 4IRIA 1S7OA 1YQAA 5FKMA 2M8EA 3ZQIA 3WGHA 3GTQJ 1FBUA 3QAHA 3SJMA 1T56A 5DYMA 3FXRA 5CPRB 1TTYA 4O3MA 2BXYA 1WJCA 1WSUA 2YX4A 1D0YA 4XLCA 4NC8A 1ZK8A 2KIUA 3C2BA 3LSKA 1S8NA 2ID3A 2WB1A 5DEQA 2CFOA 3TKYA 1D1CA 1DGWY 4II2A 3K4LA 1XGMA 5EEAA 1Y0UA 2RQPA 4FTHA 3MZHA 3ASOH 4B4CA 2PG4A 1O3TA 3DKYA 3JRGA 4RBOA 4D7MA 4M9ZA 2CQKA 3HSRA 4E7ZA 4M3EA 4G7OF 4BHPA 3BCBA 4QIWN 4NB5A 1ZRFA 2K9QA 3ELKA 1W7PA 1I6HJ 4CGZA 5ICCA 1EH6A 2Y0SA 1V54H 4CHUA 2K9MA 3ZXSA 3GMEA 5H6RA 1IC8A 1Y39A 3A02A 5IYDJ 1BA5A 1HXDA 3OR2C 4LG3A 2PMHA 1YHQI 2TDXA 1EJ9A 2L02A 3OS0A 2R5ZB 5F0FA 2DYSH 5AONA 1H0MA 2D2WA 3BR6A 2MD0A 3JTGA 5B1AH 3CC4I 3U1DA 1LDKB 2HWVA 1GUUA 1JXSA 4BAYA 3BR3A 2VJ4A 4L9JA 1BW5A 2L7ZA 5K7FA 3LQQA 2MLGA 4I2OA 2CQNA 3CDLA 3G71I 2ESNA 3SEZA 4KICA 3IRQA 3T0YA 4BE2A 4RS8A 2EIKH 2NVUB 2EV6A 3BY6A 3BG9A 4UUSA 2ISZA 4OIQF 4NHJA 2E5ZA 2FBKA 2KISA 2QWWA 1MMNA 4GYIA 3ZQLA 1S6LA 4RAFA 1QVUA 3L00A 4HPQA 3H0DA 1MJAA 3TGNA 3QRFF 1IRFA 4C30A 3M7GA 2A5WA 1O3QA 2DT7B 1FSEA 3KYCB 4XORA 1D0XA 2K9LA 3QQAA 2X0LA 2ESHA 3J80Z 1Y1VJ 2IA1A 4OMYA 4ESFA 2ID6A 1ZARA 1MBFA 3DCFA 2YX7A 2VXDA 4JP0A 4ZTFA 4BACA 3DF8A 1V5EA 5E20A 1RRJA 2VBZA 1LB2A 3S2DJ 5IY5H 1PDNC 2W57A 2ZXWH 2VBYA 3ECHA 3E6DA 3FM3A 2W7NA 3OWTA 4UV9A 3MKZA 2IRFG 4MTEA 1ZLJA 3KX2A 4XBFA 3SFIA 3GFJA 2CV2A 3HRUA 2W48A 1Z67A 2DW4A 3BP8A 2KP6A 3T8RA 1VQKI 2V4JC 2DMQA 5LLQA 2PMUA 4KIBA 3RPUA 3OYBA 1W7PD 2B7EA 1ZGWA 4HQMA 2OAZA 4AIDA 1O3SA 1BC8C 4A3BJ 3QPTA 4IZZA 3CZ6A 2HQAA 3MFKA 3LFKA 3C3WA 3HOXJ 4AIHA 5E18F 5ILSA 3RKWA 2BOLA 1MNEA 4PJJA 3AAFA 3I5UA 3TO9A 1WJ5A 2FNPA 4HSRA 2E34A 2KJBA 2XKOA 3IL2A 5J4VA 2Z33A 1QA6A 1UFMA 3HOSA 1QO0D 1T39A 4MEXF 4M3GA 3T5XA 3I53A 2LBFA 1G3WA 4R79A 2VQGA 3CCLI 1W5TA 5B3SH 2ACJA 2B0LA 3IKVA 3HGYA 3U9GA 1UCRA 2AQEA 2AXLA 5E79C 1MSFC 4HV6A 4CH7A 1T95A 5LFAA 3OYGA 4DYRA 2XHKA 5DM6F 4NUBA 1TNSA 2TCTA 2BY2A 2K4JA 3K4JA 4Y7NJ 1HC8A 3RCOA 5JLWA 3HRTA 4RMNA 5FD5A 1PUEE 4IF4A 3S32A 4YRVA 2E2IJ 4NQWB 4IXAA 3M1CA 2X51A 1MBHA 2BBYA 1HCRA 1S7EA 3ZMDA 1R71A 1BC7C 4BBRJ 1BI3A 2KZGA 4JX4A 1JUPA 2BZTA 2W4SA 4BE0A 1LVAA 3P9IA 3ASNH 1JKOC 2FSWA 2H1KA 1JJ8C 4W1UA 2KDZA 1QBJA 1KQ0A 3HHGA 3K7AJ 2B9SA 1J9IA 4JBAA 2BEOA 2HNHA 1TWFJ 2G0EA 3CMMA 5JFRA 5JR3A 5J4YA 2GLOA 1MSEC 2HXOA 2HYGD 2M9HA 3LMMA 2EFWA 4X1EA 1XSVA 4EATA 4FCYA 3ZP5A 3WU2C 1AA7A 2KL4A 1IXSB 4OIPF 4IPAA 1AKHA 2E60A 2DJNA 3LL7A 3DEEA 3GW2A 2IGMA 4BXXJ 4HAMA 3O2PE 1LNWA 4XKVA 4A3LJ 1WQ2A 2DTZA 2ME0A 2FBIA 2OTLI 2OU2A 1BI0A 2L01A 2ELHA 4N9IA 4RGRA 2VC0A 2DTRA 1XB4A 4BHBA 1OR7C 1I50J 5FB2A 3FM5A 2VIXA 2XASA 3HEFA 2M3AA 3QP5A 2E1MC 2CYYA 5LGTA 3OS2A 2UV1A 2Y9YA 1SFEA 4OINF 3V7RA 5J47A 2R7VA 1K78B 2XB5A 4CCNA 2XSJC 3F9KA 3D5SC 3BC8A 4G12A 5J40A 2EK5A 1UJ8A 3P7NA 3WTZA 1U8BA 3TP3A 3F8NA 4MIMA 3G1OA 1OCZH 1YJ9I 3DBLB 4UVBA 4A3KJ 3H9JA 4XQFA 3NAUA 4M9SA 5J8CA 3Q3SA 3KP5A 3VWBA 1YW9A 1KU7A 5IPAA 1SC7A 2RNJA 4CICA 3WTTC 4ZDPA 1VQNI 3KIOA 5J1YA 3VYTB 1LPQA 1IG7A 4G7HF 4RGSA 4KJZA 3OYJA 2WAEA 2JSPA 3W3CA 1DPRA 4BGDA 3OSFA 4J19A 5IT3A 1DP3A 3KETA 2QQBA 2HQRA 3RKXA 2GM4A 2XAJA 5EG0A 1QVTA 3CO6C 5IP9J 1O3RA 2W1OA 1SD4A 2R7ZJ 1F1ZA 4M6VA 3GBGA 1XSXA 3RIRA 4F7ZA 1P4XA 1Z21A 2E7WA 1LUJB 1AOYA 5BPIA 3FKJA 9ANTA 3QYFA 2KLOA 4N9HA 3CCSI 1ON2A 1R36A 1USTA 4LLGF 2R93J 5E8GA 3ONQA 3HC7A 2JPBA 5CLSA 4C3HJ 3S2WA 4M74A 5KNLA 3PIOF 5J6XA 3MKWB 1VF9A 4U7DA 2EZKA 2MLKA 4Y3OA 1OMIA 4XM3A 2ELKA 5ICFA 4E4HA 1GHCA 3QP6A 2QENA 1U9OA 3W2AA 1WI3A 2O03A 4EJVA 2CFXA 3V7CA 2GAUA 5GAGJ 3HDDA 4Y4RA 2JTVA 3EUKL 3F72A 2AO9A 2H94A 1D1BA 2W00A 4DNCA 2V79A 2OA4A 3HUGB 2D5VA 2DYRH 1R7JA 2XVCA 2NNYA 2OD5A 4ZDOA 2P5LC 1Z3YA 3ABUA 1SFUA 1MBKA 4X0GA 1SVMA 4CCMA 1E0EA 4UY8I 5FKNA 2NVTJ 1OFCX 2R92J 4BQQA 2HU9A 4KN7X 3WTXC 3E6CC 2EIMH 1T08B 1BW6A 4DYQA 5F64A 1MIJA 3SZGA 1IGNA 1ETQA 4Q48A 3J81Z 1ZAOA 1J2XA 4JOMA 2DT5A 1I3QJ 1ZG3A 2WY7Q 2CQ7A 4XK4A 4A0XA 5H2FC 2ZC2A 1FOXA 2QSHX 2PJRB 3DQVC 1Z77A 4JK1X 4A5MA 5E1WA 3DTEA 3DEUA 3NRVA 2O8XA 3RKYA 2UZKA 1FYMA 2I8DA 1HW2A 1YFHA 2MSYA 5D6FA 4OAYA 5FKLA 2X1CA 1BR1A 3FHZA 3OL4A 3M4OJ 2PN6A 2XAGA 2H6CA 3E5XA 1UHWA 2FF4A 5L3CA 1MD0A 2HPIA 1MNMC 2P6TA 1OKRA 1WJBA 1LE8A 4A3FJ 2ZMEB 4A6EA 2W24A 4XSXF 1P4AA 3G1MA 4RA2A 1VQLI 3HB9A 3DBRB 1MH3A 2K4BA 1VQPI 4FHTA 1OISA 1WPKA 3I54A 3L9FA 4WXDA 4B3XA 2Y0MA 2MA3A 4L0ZB 4U0VA 2DK5A 5GPAA 2X6YA 3WG9A 1R1VA 2DDAA 3CESA 3RYRA 3B73A 1ZH5A 3ZMZA 4EJTA 2CU7A 2Z9OA 5EF6A 2L9RA 3I59A 1TWAJ 5HNFA 1ZRCA 4AVZA 1YX3A 1MMDA 3GZ5A 3A0BC 2KQRA 2KIQA 3D5LA 4CUGA 2KRCA 1IZ1A 1A6QA 1TWCJ 4WK8F 4XRMA 3H3ZA 3QWLA 4OOIA 2W25A 3VOEA 3G2BA 4AIJA 2XKPA 3BOQA 3TOBA 1ZQ3P 2O5RA 2FD5A 2IXSA 3QPSA 3J7ZI 4U88A 3K1MA 3S14J 1U6GA 3JR9A 2DK8A 3VB2A 4IO9F 1JGGA 1ETOA 5KVRA 4A3JJ 2QZ8A 2E1CA 3VEPA 1P7JA 4F52A 3GTJJ 3REOA 4ZTJA 3C2HA 1WKMA 2WV0A 5D6EA 1WI9A 3OOUA 3W6JB 5K1YA 3S17J 3MKYB 1CGPA 3OYFA 2A05A 2R5YB 2K40A 4OAZA 3CC2I 5HLIA 2A61A 3IWFA 5FD6A 2LY9A 2PJPA 4MEYF 5F04A 2EWNA 1ZGAA 3MAJA 5BNGA 2NVQJ 5E3NA 3OMYA 1IV6A 1XGOA 2NYXA 1JTYA 5D8KB 2YS9A 3SDGA 3HOTA 1A35A 1OPCA 2X48A 3OR1C 2IBDA 3HKZN 1ETYA 1OCPA 1ENHA 3ZMSA 2DLLA 5CVJA 2XF6A 2W85A 2H8RA 2N8GA 2Y31A 3ZCOA 1W5SA 4ZYEA 3RPQA 3ZQCA 2XROA 3E97A 1UZCA 3BJAA 4OU0A 1RUOA 3LQRA 5IP7J 3HRMA 3H0GJ 4LIVA 1FT9A 4L9NA 4XMYA 1REPC 4PK4A 2HI3A 4IHSA 5DCMB 2LNBA 2XGEA 2LY2A 2O9LA 1RKTA 1RETA 1FTZA 3K4BA 3PO2J 4LD5A 3DLAA 2OZUA 1Y8RB 2CUEA 4O5VA 5DCFA 1IN4A 1Y0NA 3AL0B 2HEOA 4E7IA 1XDUA 2IVMA 4HDUA 2XAHA 1YITI 5K5OA 5FKKA 4KT6A 4H0EA 4XONA 1G3TA 2CSOA 1Z1DA 2DBBA 1B4AA 2HDCA 1Q1HA 2LF8A 1GLNA 1GV2A 5HDGA 2ZSIB 6PAXA 3JW4A 3NQOA 4GGGA 3OIQA 5LBQA 4JX5A 2M4GA 1CF7B 1JT0A 3KLOA 1D3YA 4CYCA 2E36A 3CD6I 3L2QA 3CCRI 1GV5A 1GVDA 4ZYHA 2V1UA 3E6MA 4ZDLA 3K70D 2NOJB 2E2JJ 4F55A 2L9NA 4AIKA 5ERIA 4BXFA 1KA8A 3FKIJ 3J7AY 3K70C 2JT1A 5DV5A 1AWCA 3RQ4A 3K9TA 1VQ4I 4LK1F 2YU9J 2HVSA 2VBWA 3A0HC 2QM3A 2DMUA 5B1BH 1YS7A 2VXZA 4IRGA 4E7JA 5ILUA 4EMSA 1YIOA 2PX9A 2BY3A 3F23A 4X6AJ 2HOTA 1IO2A 2DA5A 4GDFA 3K6GA 3GYHX 1E3HA 2JUGA 3V4GA 3E5UA 3L2UA 3BQZA 1J5YA 2ZXJA 4AM3A 2X1DA 4QTRA 4NBQA 4KISA 2BY0A 3OYIA 5C3EJ 2QBYB 4LG0A 4I99C 1IAWA 1U5TC 5K7HA 2FQ3A 2Q2EA 2VB6A 1WZ2A 2DPUA 3K2ZA 2GXAA 2Z5UA 1DP7P 4YFNF 1YRNB 3GUDA 1HQCA 4W97A 2CRGA 1Z6TA 3PNVA 2PLYA 1JTXA 4BU2A 1A04A 2M7BA 5JHUA 1BR4A 1YYVA 4G9YA 3CCYA 2JSCA 5M5YJ 4HF1A 3K2AA 4PJMA 3GTLJ 2ZNZA 3K0LA 5ED4A 1KZHA 3S1RJ 2R7QA 1LVKA 2G7HA 2DQRA 5JLXA 2FE3A 2LMDA 3DU6A 3EUAA 5J3LA 1K83J 4XOPA 5EZHA 4I6ZA 2HOSA 3PQKA 3RQIA 2HGCA 3S3MA 2CW7A 3NWTA 5A2QK 2J5OA 4ZH4F 4I02A 2DA6A 4KMFA 3ZN0A 1YG2A 4UNOA 1K7AA 1SAUA 1ETWA 4CZCA 3BR1A 2XGCA 3KFWX 1P4WA 1IN8A 3K4MA 2DA3A 3LSIA 3HBLA 2K7LA 3JAMK 4RAGA 3KP3A 1SMTA 4IHTA 2CG4A 3DPUA 3C18A 3A01B 2G7UA 3L2VA 2IPQX 2XPUA 1AHDP 4E70A 2ZNYA 1VI0A 3CUQB 1PYVA 3OYDA 3RI4A 4L9VA 4C3JJ 2O8KA 2E35A 2QEXI 3PQJA 1D8KA 1P92A 1SFOJ 4N4OB 4NDLA 2HDWA 3FHNA 1POGA 4YEJA 3HOUJ 2DFHA 2YSRA 4UVAA 1B72A 1K6YA 5F0HA 5GP9A 4BUPA 5L3EA 1PP8F 3S15J 3CO7C 3FF5A 3MMYB 5IP6A 4ESBA 2QVOA 5JVTA 2ECBA 1W5CC 3DBHB 4S04A 2IGNA 2WC2A 1OCOH 2R7OA 4BY7J 1VTNC 3FBNB 1GT0C 3DXJF 3A03A 5GPCA 3GTGJ 2RQQA 3HKZA 1ZGJA 4XLAA 5E3MA 5CYVA 5KK1A 5D4RA 4PJNA 3UNGC 1KYWA 4GO1A 3I71A 2FMYA 2DMNA 3HGGA 4TV7A 1YO5C 1TW2A 5IYBJ 3L2CA 2P7CB 4G8XA 2EPFA 4CCKA 4V2FA 4PGGA 2DODA 4B43A 2LK2A 4HX4A 2M30A 2BW3A 1VQ6I 2EH3A 3BG7A 3ZPLA 3WU0A 4BQAA 1F9NA 3GTOJ 2KT0A 5F08A 1R22A 4KN4X 2JUCA 1J0RA 3E6BA 3GEZA 1HDPA 3IH4A 1BIBA 5HS7A 2FA5A 2GIZA 3K4KA 3GVAA 2HR3A 3AG1H 3BQYA 2HKOA 4CSWA 4HLXA 1X2NA 4F3QA 1J09A 2GWRA 3QOEA 2CJJA 3WE2A 3Q0UA 2JA5J 3B6AA 3WU1B 4HRIA 3VPRA 1R5GA 3ZN1A 5TISC 4CCOA 4ABZA 1W7PB 1KU9A 1Z91A 2E1NA 2XAQA 3H92A 1OR7A 3CDHA 1PVEA 3BG5A 4XKBA 2QQ8A 2ZKZA 2LP0A 5EEHA 1JT6A 3CTAA 5LHHA 1OYIA 1HDDC 2VKHA 3DTIA 3MKLA 3HOWJ 3OYMA 3LWFA 1STZA 3AG3H 2RN7A 1MH4A 1FX7A 1OYWA 2HTJA 2MW8A 4JQFA 3K69A 3MN2A 1EV7A 2VI6A 3J7AO 2VKVA 3HTSB 1ZG1A 1T0FC 2NVYJ 4GYGA 2DA1A 1QQIA 2BE5F 1XG1A 5DM7F 4UUSB 4BYYA 1VQ7I 1IN5A 4G7ZF 3BJOA 3FXLA 5HDKA 3GZNB 4KA4A 1ORKA 1MJBA 4KFCA 2G9WA 5JI6A 3BJ6A 1OCRH 3S1MJ 1IF1A 1JE8A 4FX0A 1G2HA 3JRIA 2M5WA 3M9AA 2H27A 5E8IA 3KP2A 3HRSA 1SD7A 4P96A 1DDNA 1LEAA 1XDSA 4Y13A 3FXMA 5M3MJ 4WX9A 2EZLA 4KITB 1LFBA 1SANA 3S1NJ 2XB0X 1O4XA 3JTHA 2EA2A 1GXPA 3HOVJ 3CP8A 2A6TA 4UHTA 4M71A 3W6KB 1RI7A 3C7JA 3NEUA 2GQQA 1MJ9A 4CCLA 2CUJA 4MNUA 1MDMA 1P6RA 2F5DA 3PUBA 4CZZA 2K3FA 2HS5A 4WXHA 3ZR8X 1QPMA 3F0CA 4I0BA 4DZPA 2VOOA 5IT9K 3SZPA 2YUSA 1TC3C 3M8JA 2XF5A 3GWZA 2DXIA 2V1NA 2EZHA 3CJQB 2IAIA 1ZR4A 4U0YA 5DD8A 2D1HA 2P4WA 4E7LA 2VLAA 2A07F 2XRNA 5LD2C 3H1CA 1H9GA 1V4RA 2LKSA 2A6HF 2OZ6A 2WA0A 4E7KA 2FOWA 3DKXA 2XAUA 1OCCH 1KQ9A 3FXJA 5KCMA 1EH7A 3KE2A 2BGCA 4EJOA 2I10A 4A93J 2UXNA 1LEBA 3OL3A 1F43A 3U1KA 4S05A 1O57A 5GTHC 4BJ5C 2M8GX
chains in the Genus database with same CATH topology
1YHQI 3CCMI 3CF5F 5DM6F 1HC8A 1VQNI 3CC4I 4IOCF 2ZJRF 5GADJ 1MMSA 3G71I 1VQLI 1YITI 2QA4I 1VQPI 2ZJQF 1VQOI 5JVGF 4V19K 2E35A 2QEXI 3CCSI 4IOAF 2E36A 5DM7F 3CD6I 3PIOF 1VQ7I 3CCRI 2H8WA 5GAHJ 1VQ8I 3CMEI 3CC7I 3CCJI 1VQMI 3CMAI 3PIPF 1VQ4I 3G4SI 3J7ZI 3CCUI 5GAGJ 2NXNB 1FOWA 3J7YJ 4IO9F 2OTLI 1VQ5I 2ZJPF 3CJTB 3CCVI 3CCQI 3CCEI 1YI2I 1VQKI 4UY8I 1VQ6I 2K3FA 2JQ7A 3CC2I 1YJWI 1S72I 2OTJI 1YIJI 3I56I 2E34A 2FOWA 1QA6A 3I55I 3G6EI 1ACIA 1YJ9I 1Y39A 3DLLF 5GAEJ 1YJNI 1FOXA 1VQ9I 1FOYA 3CCLI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHQ I;  3CCM I;  3CF5 F;  5DM6 F;  1HC8 A;  1VQN I;  3CC4 I;  4IOC F;  2ZJR F;  5GAD J;  1MMS A;  3G71 I;  1VQL I;  1YIT I;  2QA4 I;  1VQP I;  2ZJQ F;  1VQO I;  5JVG F;  4V19 K;  2E35 A;  2QEX I;  3CCS I;  4IOA F;  2E36 A;  5DM7 F;  3CD6 I;  3PIO F;  1VQ7 I;  3CCR I;  2H8W A;  5GAH J;  1VQ8 I;  3CME I;  3CC7 I;  3CCJ I;  1VQM I;  3CMA I;  3PIP F;  1VQ4 I;  3G4S I;  3J7Z I;  3CCU I;  5GAG J;  2NXN B;  1FOW A;  3J7Y J;  4IO9 F;  2OTL I;  1VQ5 I;  2ZJP F;  3CJT B;  3CCV I;  3CCQ I;  3CCE I;  1YI2 I;  1VQK I;  4UY8 I;  1VQ6 I;  2K3F A;  2JQ7 A;  3CC2 I;  1YJW I;  1S72 I;  2OTJ I;  1YIJ I;  3I56 I;  2E34 A;  2FOW A;  1QA6 A;  3I55 I;  3G6E I;  1ACI A;  1YJ9 I;  1Y39 A;  3DLL F;  5GAE J;  1YJN I;  1FOX A;  1VQ9 I;  1FOY A;  3CCL I; 
#chains in the Genus database with same CATH topology
 3I3L A;  2GXG A;  3D5R C;  2Y2Z A;  5DS9 A;  3OYH A;  2CW0 F;  3DPL C;  4OIO F;  4Y52 J;  4FET A;  2P5V A;  4HDV A;  3DP7 A;  3H5R A;  3HXL A;  4Y33 A;  3KYL A;  3OYK A;  2LBF B;  2MBF A;  1X4P A;  2EIL H;  4ON0 A;  4DBQ A;  2L2O A;  4IOC F;  5HOD A;  1Y6I A;  1K4S A;  3EPZ A;  5GAD J;  3HZJ A;  4ENN A;  5AIP A;  4HBL A;  3C2G A;  2JRT A;  2FEZ A;  4BE1 A;  4ZZD A;  3MEX A;  3LAP A;  1WCM J;  2KDO A;  1GDT A;  1ITY A;  3BTC A;  4HNV A;  4CYD A;  3GTM J;  1FBQ A;  4ZJZ A;  1OYY A;  3HTU A;  3PSI A;  3PL8 A;  3B6C A;  2RKH A;  4D1Q A;  1BOA A;  4MO7 A;  3TMO A;  2KZV A;  3LNQ A;  4Y15 A;  1P7I A;  1Z3X A;  4XN0 A;  4ANJ A;  1L3L A;  3BR5 A;  4AUX A;  3HG9 A;  4MHG A;  3JAM Z;  5GTI C;  1FBS A;  2IGO A;  2RGV A;  2TRT A;  2EBI A;  3EQL F;  3CMA I;  4OWR B;  4B1R A;  1A6I A;  5FRN A;  3VFZ A;  2JA6 J;  3S93 A;  1WFX A;  2KRF A;  5E17 F;  2LLK A;  3RTR A;  3CMY A;  2CO5 A;  3HPH A;  5J8F A;  3PM1 A;  1AKH B;  5BOX A;  2M87 A;  3ZGK A;  4CA0 A;  1NH3 A;  1W0T A;  1NTC A;  1T6S A;  2IGK A;  4HF0 A;  1BOB A;  2VE8 A;  3S3N A;  1N25 A;  3FBI B;  3HYI A;  2GOM A;  2ZO4 A;  3HM5 A;  3F6O A;  1ZLK A;  2Q0O A;  2BHZ A;  3LA2 A;  2C6Y A;  2VJ5 A;  4NC7 A;  5BQT A;  1B8I A;  3H5N A;  1MND A;  2K9N A;  4XKC A;  4L0Y B;  5LRR A;  2L5Q A;  1UEL B;  4B47 A;  1YJW I;  3WTS C;  2E1O A;  1G3Y A;  1X58 A;  3HOY J;  3V8J A;  1DU0 A;  3Q0W A;  1MBG A;  2JVG A;  4XRS A;  4CCJ A;  2OTJ I;  2CUZ A;  1RR8 C;  5JHF A;  2JA8 J;  4EM2 A;  3ERE D;  3BG6 A;  3DEW A;  2M0C A;  2LVS A;  1UMQ A;  2L9V A;  3M1E A;  3BTI A;  4HV5 A;  5FFX A;  1Z7L A;  2DT6 A;  5HDN A;  3CLQ A;  1O7L A;  2VBX A;  3N97 A;  2VUM J;  5HOO A;  2CWE A;  2AQF A;  2DDB A;  4ENK A;  2DOF A;  2NOG A;  2MD5 A;  2LKP A;  3F6V A;  1SEU A;  3DU5 A;  1QRY A;  3S1Q J;  4LMY A;  4MGR A;  3MZ8 A;  4RGU A;  2WAF A;  3WOD F;  1ETV A;  4A2U A;  5LEJ A;  1H8A C;  4C9Y A;  2P6S A;  4Z2Y A;  4ZZL A;  3L2W A;  1XMA A;  1ZYR F;  5ICG A;  1W0U A;  2D1V A;  1JJ6 C;  2VAS A;  3LSR A;  3EUH C;  5CQG A;  1TLH B;  4YII A;  2DN0 A;  2V6E A;  4EV0 A;  3WTU C;  2QSG X;  4ITV A;  1DU6 A;  4RM2 A;  1UHS A;  2QSF X;  2R3S A;  3M8E A;  4XLP F;  3IC7 A;  2PEX A;  3GLL A;  1ETX A;  4HG2 A;  1SFX A;  1XGS A;  2DFE A;  5J1U A;  3TED A;  1TW3 A;  4DW6 A;  2LYC A;  1RKW A;  3TOA A;  3IAS 2;  1G4D A;  2P0W A;  3MWM A;  1EA3 A;  1JKQ C;  4HEA 2;  5ICE A;  5EG0 B;  5LEK A;  2GXB A;  2H8W A;  2QKM B;  2MH2 A;  3KZY A;  1OJL A;  2ZJ2 A;  5EJC A;  4QWQ A;  5H6Q A;  4BBS J;  1QU3 A;  1JI8 A;  1HW1 A;  4ZYA A;  2IA2 A;  5CKT A;  2EV0 A;  2IP2 A;  3OY9 A;  5DD4 A;  2FUG 2;  2OJE D;  4LJZ F;  4A3C J;  2F5V A;  4B09 A;  4P1W A;  2PBI A;  5FJ8 J;  3H3U A;  3CCU I;  1B59 A;  3FMS A;  4FT8 A;  4IRH A;  1X19 A;  1XX5 A;  4A69 C;  2R4G A;  4L9T A;  3WGG A;  2OPT A;  3MQ0 A;  3ZQG A;  2R0Q C;  3GFL A;  4KNY A;  1SMY F;  1MMA A;  4RB1 A;  4ETS A;  5HLH A;  3CCV I;  1Z0X A;  3K4C A;  3UR3 C;  1D8J A;  3E0J B;  3FWE A;  5B66 C;  3LST A;  4IHY A;  1QZZ A;  3LA7 A;  5DCM A;  1HBX G;  4G94 A;  4XLH A;  4B3A A;  5FGM A;  3LSJ A;  3ZMV A;  3U2R A;  1R9T J;  4P9U A;  1NG7 A;  2NAZ A;  2MYS A;  1E3P A;  1ZEL A;  1PUF A;  3HSF A;  1BJA A;  5E3L A;  1S72 I;  4BEH A;  4I7H A;  3K10 A;  4LOC A;  5EGO A;  4EVI A;  1LFU P;  3JRB A;  4HNU A;  3OSG A;  1ZG5 A;  2EFQ A;  4BJ6 C;  1IJW C;  2UWM A;  1GVJ A;  2RNG A;  1MKM A;  3DWL E;  1LQ1 A;  1XD7 A;  3R6S A;  1IUY A;  1YX5 A;  3RDI A;  5LRS A;  1Y1W J;  2IS2 A;  5LHG A;  1T8I A;  1ACI A;  5DUK A;  2KPM A;  1QHG A;  1OLT A;  2JN6 A;  4M73 A;  5IYC J;  4RB2 C;  4IKF A;  1ZR2 A;  1YJN I;  2M0M A;  4XNF A;  5IT9 Z;  3FZV A;  2GA2 A;  4FE7 A;  2IJL A;  1MZB A;  3GTP J;  3SQN A;  1ZKG A;  2AXT C;  1HF0 A;  3FMQ A;  4KUM A;  4UV8 A;  1YS6 A;  4R8H A;  2X6W A;  2WV1 A;  2P7V B;  4WXC A;  2QQ9 A;  3RKQ A;  4I76 A;  1I1S A;  1YW8 A;  1B6A A;  3ZQQ A;  2ZFW A;  1KQ8 A;  2QCO A;  3DV8 A;  1U5T A;  3SDB A;  2JJ7 A;  2BV6 A;  3KP4 A;  3H9G A;  3GFM A;  1FNN A;  2EFP A;  3EDP A;  3F8M A;  2LRD A;  4KYW A;  3OOP A;  2L7M P;  1SVL A;  2ETH A;  3F3X A;  3FX3 A;  2DMP A;  3LSH A;  1LE8 B;  4PFO A;  2X9D A;  4DBR A;  1J59 A;  1ZRE A;  4ENJ A;  2LSO A;  2GZW A;  4HF2 A;  1XN7 A;  3S16 J;  3CDI A;  1G3S A;  1O7F A;  1RR7 A;  1X1A A;  3SYT A;  3JCU C;  1I3A A;  4RM3 A;  4XID A;  3OYA A;  3KZZ A;  5GAH J;  3E7L A;  2KHM A;  2V6C A;  1RNL A;  1WH7 A;  2FOK A;  3L2R A;  1R4M B;  2ECC A;  5D5U B;  4H4K C;  5HVQ C;  5CJ9 A;  3CC7 I;  4FIS A;  1IN6 A;  2FNA A;  1IUF A;  2EFO A;  3HJE A;  1JGS A;  5K7Z A;  2CV1 A;  4IL6 C;  4XRF A;  3I59 B;  1IRZ A;  2CV0 A;  2QF7 A;  3JRC A;  4D5C A;  2R7U A;  4PDK A;  5D8L B;  1ZTR A;  5AIQ A;  2OC6 A;  2LH9 A;  1XPX A;  5FLV A;  3PJR A;  4F91 B;  2VC1 A;  2MGQ A;  1Y8Q B;  3I64 A;  3TDU C;  2VQH A;  3J7Y J;  1RES A;  4AYB N;  1XS9 A;  3K1N A;  2F5E A;  1K4T A;  1VQ5 I;  3CJT B;  1DQU A;  3H3V K;  2X4H A;  4RB3 C;  3WG7 H;  3FK6 A;  1K61 A;  2MG4 A;  4HA8 A;  3CUO A;  2F4M B;  3LFU A;  4XLF A;  3V7S A;  5D5V B;  2RDP A;  2NNN A;  2F5F A;  3KPH A;  5C4J J;  4MQV A;  2DI3 A;  3VDX A;  4D0P A;  4C2T A;  2LFB A;  4IJA A;  4RDU A;  3OYE A;  2LDU A;  4NC6 A;  3ROU A;  4BY1 J;  3VYR B;  2P81 A;  3BTJ A;  5LGU A;  3HSE A;  5M3F J;  3G3Z A;  3EYY A;  4IHW A;  1SVO A;  2HKX A;  3ESW B;  3FXO A;  4I09 A;  4OIR F;  3RZD J;  2O7O A;  4F92 B;  5E3O A;  4OMZ A;  5HLT A;  3M3Y J;  1M1E B;  2LC2 A;  3I55 I;  2STW A;  3CUQ A;  2XF7 A;  4M6X A;  2R5Z A;  2NS8 A;  4M3B A;  4EM0 B;  3IUO A;  5K5R A;  3U21 A;  4HOB A;  1FOY A;  1RZ4 A;  1OQY A;  5BMZ A;  3WTY C;  1DGR M;  1A31 A;  3CF5 F;  3BCA A;  3TO7 A;  2NS0 A;  1IRG A;  2EA4 A;  3BZK A;  3JSO A;  4GFB A;  1WRJ A;  2VT2 A;  1E2X A;  4GXO A;  4LB5 A;  1XCB A;  3Q9S A;  1HOM A;  2QGU A;  3PNT A;  5L3G A;  4N4N B;  1BL0 A;  4XKW A;  2ZBK A;  2HOA A;  1V55 H;  2M4K A;  5F1J A;  5HS8 A;  3EET A;  2M2E A;  4KIF A;  2YU3 A;  3DKW A;  3KEQ A;  3KEO A;  3ABL H;  4L5E A;  2PMZ N;  1YE9 A;  5D5W B;  2BYV E;  1XCV A;  1ODD A;  1FP2 A;  3PSF A;  1NK3 P;  1JHH A;  1SD5 A;  1QPI A;  1D0Z A;  4GRI A;  2X1E A;  2BVM A;  2D45 A;  1UHM A;  4RB0 A;  3ZQH A;  1U0J A;  1R00 A;  2K5C A;  1I27 A;  1TWH J;  1XTA A;  4FX4 A;  2K85 A;  5CVR A;  1ULY A;  2LY1 A;  3GFI A;  3H36 A;  4FQG A;  1W1W E;  2FQ4 A;  1IDZ A;  3BPX A;  2L54 A;  3QPL A;  1QZE A;  3O6B B;  2JVH A;  3VYU B;  4CYC B;  3CJN A;  2HYJ A;  1V3F A;  1KGS A;  3IAM 2;  4CO8 A;  2M1B A;  4A3M J;  2IS1 A;  3JRF A;  1PP7 U;  4BL0 B;  2O3F A;  3F8B A;  3TW7 A;  2STT A;  3AG4 H;  2K86 A;  4K2E A;  2L7K A;  4UB8 C;  2CQX A;  2CQQ A;  4C2U A;  2J5P A;  1ON1 A;  1L0O C;  4PSX A;  2XDV A;  3CCQ I;  3RJP A;  3CCE I;  1R5I D;  3GZ6 A;  5FO5 A;  2H1L A;  1TNT A;  3BZ6 A;  2EIN H;  5CVI A;  4BDY A;  3IH2 A;  1E3O C;  3R4K A;  3E1S A;  1N78 A;  1Z05 A;  3CP2 A;  3JSP A;  2L0K A;  1T0F A;  2Y69 H;  2YPR A;  2X6X A;  2P8T A;  1OCT C;  4Q4Z F;  2W82 A;  3CUQ C;  2OF7 A;  5EZG A;  3BT9 A;  3GX4 X;  2EZI A;  2R7F A;  2Y75 A;  5TJJ A;  3HL2 A;  3ZRG A;  5L3B A;  1J75 A;  1FEX A;  3RSN A;  1GXQ A;  5FLX K;  2EQR A;  3I56 I;  4LG0 B;  2I5U A;  5CQE A;  4Z6Y A;  3QOP A;  5HNH A;  3FIW A;  2KRH A;  2Q2E B;  1FJL A;  3RYP A;  4KIG A;  3T8T A;  3ABM H;  3G6E I;  2FRH A;  4IEJ A;  1WHU A;  1D1A A;  2ELJ A;  3H35 A;  1VQ9 I;  2E2H J;  1Z7U A;  4PJL A;  3R0J A;  5IOZ A;  3IP4 B;  4A3G J;  2IS6 A;  1HST A;  1CQT A;  3CF2 A;  4NQW A;  3IKT A;  3JRA A;  4XSZ F;  2RC4 A;  2MFZ A;  2ZXH A;  4A5N A;  2BY1 A;  3F8C A;  2PFB A;  4M3D A;  3OYN A;  3N05 A;  2X6O A;  1S29 A;  4ASN A;  2MAB A;  3T1B A;  3BDD A;  2XGD A;  3D0S A;  4MFD A;  4JYK A;  4LB6 B;  3R0A A;  1Z6R A;  4G6Q A;  2DU9 A;  1FWZ A;  2MC3 A;  4QPQ A;  3JRE A;  3ZMT A;  3GF2 A;  3FXQ A;  3MVP A;  2MC4 A;  4CDG A;  1XSD A;  3EYI A;  1X1C A;  1ONV A;  2H09 A;  2V9K A;  4IQJ A;  1HLV A;  1U2W A;  2ZJQ F;  4AYB A;  1I6X A;  2Y9Z A;  3LSM A;  4XN3 A;  4RAZ A;  2BHY A;  3ERM A;  4IHV A;  1R1T A;  4V19 K;  2L7F P;  2A6E F;  4NNJ A;  2F4O B;  4E7H A;  5DUI A;  3KCC A;  4DYC A;  2HVQ A;  3F22 A;  1XMX A;  3ECO A;  2V26 A;  1BR2 A;  3IV5 A;  1QHH D;  3J81 K;  4LGW A;  5BPD A;  2B63 J;  1R58 A;  2LD5 A;  5LGN A;  1IXR C;  3GLX A;  4U0W A;  2E71 A;  3BZC A;  4AWX B;  1WJE A;  4M3F A;  2XV4 S;  1TQI A;  2A68 F;  4HW0 A;  1F36 A;  4BQO A;  4HNT A;  2QYO A;  2NXN B;  2HFH A;  2HQ5 A;  4YG2 F;  1TL8 A;  1B72 B;  4IX7 A;  1MMG A;  3KYD B;  4B44 A;  1TP4 A;  2DA2 A;  1IRX A;  2Y30 A;  5DTD A;  2JK3 A;  2COB A;  2V1D A;  3LAJ A;  1WJF A;  2JA2 A;  4E7S A;  4MTD A;  1K78 A;  1HKS A;  4IQ4 A;  4PSW A;  1U3E M;  2IA0 A;  2W84 A;  2LG4 A;  2LTP A;  1IN7 A;  5HLG A;  1R5H A;  1FLI A;  2HTS A;  2Y48 A;  3QYB A;  3MCZ A;  5FLM J;  2HYF A;  2ADU A;  2DA4 A;  3R61 A;  4XLN F;  3VYS B;  1ETK A;  4D5F A;  4BDZ A;  3OV8 A;  1H9T A;  1WVR A;  1YIJ I;  3AFH A;  1YW7 A;  4XOT A;  2BW3 B;  1V5F A;  1WWX A;  2QUF A;  3COA C;  1HW5 A;  1AU7 A;  1KU2 A;  3IRR A;  2RAE A;  1UG0 A;  2GBY A;  4S0H B;  5LHI A;  3L09 A;  2PMZ A;  2JZY A;  5GAE J;  1F4K A;  1X1P A;  4LLL A;  3TQN A;  3P9K A;  3CCM I;  1X3W B;  2Z3Y A;  4A0Y A;  4Q5S F;  4LIT A;  5L3D A;  2UUZ A;  3I4M J;  2K27 A;  4BS9 A;  4XIC A;  1R23 A;  2K3P A;  3BG3 A;  3MZY A;  5F1R A;  5KAF C;  2ZFU A;  2VJI A;  1BJZ A;  4UUT A;  2CMP A;  1FMV A;  2F2E A;  1FIP A;  1XMK A;  4XRS G;  1F5T A;  3FIS A;  1FP1 D;  3IWZ A;  4HZF A;  3RPU D;  5J1R A;  1KYZ A;  1HSJ A;  2VL8 A;  2E1M B;  1WJA A;  5FFZ A;  3L1P A;  3S8P A;  3S3O A;  4XLE A;  1SAX A;  1ERD A;  2DJI A;  3PUF A;  2M7A A;  4IVN A;  4LFU A;  1S9H A;  3W2V A;  3Q5F A;  1YOV B;  3A4C A;  1LKX A;  2VPR A;  1QGP A;  1W4M A;  2HPM A;  2R7S A;  3JRD A;  2PI0 A;  2VT3 A;  1LFP A;  4EEF G;  1SD6 A;  3CME I;  5EDN A;  1P9Q C;  2WTE A;  4M6Y A;  3G73 A;  3BR2 A;  2F48 A;  2ZCW A;  2R7X A;  2A69 F;  2XAF A;  5EYR A;  1J7K A;  3HUG A;  4EM1 A;  5FRM A;  2UXX A;  3EUH A;  1YTY A;  2E5N A;  3P9C A;  2LKX A;  2EV5 A;  3CJR B;  3WHC A;  3QU3 A;  4DQ2 A;  2QQA A;  3QYE A;  4A0Z A;  3H9Q A;  1FOK A;  5A2Q Z;  4KMU X;  2ZJP F;  2CUF A;  2PQ8 A;  2OQG A;  4J00 A;  2LRE A;  1DUX C;  2DPD A;  2GA1 A;  1BM9 A;  1X3U A;  2L3D A;  4C2M J;  3NWS A;  2IW5 A;  5FKO A;  3S2H J;  1D5V A;  3VSL A;  1EF4 A;  2LOO A;  4I98 B;  1S3J A;  2AHQ A;  2DFI A;  2CH0 A;  2LR8 A;  2FXA A;  3GTK J;  1FSH A;  3A2K A;  3H5A A;  4U7B A;  2EJR A;  2JA7 J;  1MDM B;  3O8H A;  2F5C A;  3F21 A;  4ESJ A;  4WCG A;  1FMW A;  1RUN A;  2WAQ N;  3HPG A;  2PJR A;  2YR2 A;  3N4M A;  1HKT A;  3FXU A;  4G6T B;  3QOD A;  1WH5 A;  3QPH A;  1SFK A;  1X2M A;  2HXI A;  5FRO A;  4L18 B;  2XPW A;  3X2Q H;  1LDJ A;  4ZYD A;  3D1N I;  2GOX B;  2CGP A;  2Z16 A;  1UG2 A;  4XR6 A;  4ZC3 A;  4MFE A;  3Q9V A;  5KHD A;  3I4N J;  1NHA A;  2JPC A;  1MBJ A;  3FK7 A;  4EJW A;  2RRE A;  4LLN A;  3TDZ C;  2ZME A;  2ZSH B;  3FXK A;  5FLX Z;  1XC5 A;  3I9V 2;  4A3D J;  1Z9C A;  2VE9 A;  3VSK A;  5H20 A;  1RPW A;  2MH9 A;  1TT0 A;  4LIU A;  3ZQ7 A;  1A36 A;  2KIM A;  4YIR X;  2BVL A;  1BIA A;  1I39 A;  1TT5 B;  1Q1V A;  4HX8 A;  3SEQ A;  3LSP A;  3CQZ J;  2WWY A;  1S7A A;  3K1P A;  2M34 A;  4P9F A;  5JVG F;  2COM A;  2O0Y A;  3O3K A;  2GIV A;  1HA8 A;  2R7D A;  1T33 A;  2HZT A;  3SFZ A;  3A1Y A;  4HST A;  2NS7 A;  3I58 A;  3WHB A;  4IOA F;  1B9M A;  1QZY A;  4BJT A;  1MGT A;  3KLN A;  4KT5 C;  4WF2 A;  1FC3 A;  3M07 A;  4HX7 A;  1NG6 A;  2KJC A;  2XPV A;  3OIP A;  3R60 A;  4GCV A;  4QLC U;  5F6F A;  2EFN A;  3OYL A;  3PNY A;  3TO6 A;  2DAO A;  1VND A;  1E17 A;  1G59 A;  2VN2 A;  3PIP F;  4A3E J;  4YFX F;  4BHC A;  2DOE A;  3ZQF A;  5C4X J;  4QPO A;  1DPU A;  4LK0 F;  2M45 A;  4HYE A;  1FYL A;  4PUS A;  3QU6 A;  1B1B A;  3ZMU A;  2A3S A;  1LDD A;  2VON A;  2R5Y A;  3TW6 A;  3I0T A;  2OCC H;  1KON A;  3OIO A;  2DO7 A;  2KIF A;  2Z2S B;  4L5J A;  1YI2 I;  1I5Z A;  3SZT A;  3ABK H;  3PFI A;  4EJU A;  1I1G A;  2DA7 A;  1TBX A;  4AC0 A;  3KP6 A;  2L4A A;  2WAD A;  4AD9 A;  2JQ7 A;  5F27 A;  4UXN A;  1BI2 A;  1X3Z B;  1X1B A;  2VOP A;  1JUM A;  1VFC A;  4UUV A;  3OS1 A;  2R7T A;  3MD2 A;  2IS4 A;  4D7N A;  2BXZ A;  2DCE A;  4DIQ A;  4V2G A;  3WTV C;  3GCM A;  1B8I B;  1UAA A;  2H6B A;  2ZXI A;  3V8L A;  2OV7 A;  1USS A;  5M5X J;  2L4M A;  2WBM A;  2FBH A;  5BS6 A;  3W6V A;  2VPL A;  2ZME C;  1HKQ A;  4WWC A;  2RV8 A;  2VJJ A;  2O6G E;  3B02 A;  3P5J A;  3DLL F;  2XGX A;  4Y17 A;  2Q1Z B;  2Z99 A;  3BPV A;  3KEY A;  3ZOB A;  1IW7 F;  3OYC A;  1H89 C;  2VQC A;  4PZJ A;  4XL9 A;  2HVR A;  3DPT A;  1N75 A;  4EQQ A;  5KAI C;  1U8R A;  3GXO A;  2ME6 A;  2O61 A;  4C3I J;  5DDG A;  1BN5 A;  2WB1 N;  4ZYG A;  1TWG J;  3IHU A;  3LSG A;  2A5Y B;  1U9N A;  3HOZ J;  1MMS A;  3JRH A;  3PFY A;  1ZN2 A;  4L5I A;  3FMR A;  3IH3 A;  2VQL A;  1V5G A;  3J80 K;  1N77 A;  2K02 A;  2P5K A;  1NK2 P;  4DJA A;  1CF7 A;  2QA4 I;  3BWG A;  1X1D A;  3WGI A;  4KDP A;  2Y0S N;  1VQO I;  1R4N B;  2JRM A;  1W36 D;  2FX0 A;  4FE4 A;  2OBP A;  1LJ9 A;  1UB9 A;  4N0B A;  1ZRD A;  1VZ0 A;  2QLZ A;  4UVC A;  1W36 C;  1R6R A;  1T98 A;  4I0A A;  5TGT A;  3TL4 X;  2DMT A;  4AU7 A;  2XRL A;  3DTK A;  3ISP A;  3KP7 A;  2V1X A;  4QSH A;  2R7W A;  1JHF A;  4UB6 C;  4BXU A;  4M9X A;  4HLY A;  1D5Y A;  2E7X A;  3Q0V A;  1Y56 A;  3F8F A;  3M8F A;  1ZHF A;  1WJD A;  4RGX A;  3CCJ I;  1VQM I;  5K5Q A;  1MW7 A;  2WAQ A;  1EH8 A;  2HQN A;  3KZI C;  3BRO A;  1JKR C;  3G4S I;  1KU3 A;  2RVC A;  4DOZ A;  1K6O A;  3LA3 A;  4EGZ A;  2DFF A;  1FIA A;  3O8G A;  1BI1 A;  5L3F A;  4F93 B;  5C44 J;  3NAR A;  1T2K A;  4BKX A;  2IT0 A;  1A5J A;  2QBY A;  3G1L A;  2E19 A;  1IDY A;  3I4P A;  3SXY A;  1G6N A;  1TQP A;  4II3 A;  2OQR A;  2K9S A;  4J01 A;  1FY7 A;  2IEK A;  1C0W A;  1YRN A;  3UKG A;  3ML6 A;  3E5Q A;  4RLQ A;  5E1Z B;  3V42 A;  2ZB9 A;  3SHF A;  4DZJ A;  1U78 A;  4A6D A;  2L9S A;  2XUB A;  4D9J A;  2EB7 A;  3BTL A;  2KMU A;  4PJ0 C;  1IXC A;  4B8X A;  5D5X B;  2CW8 A;  1RIO H;  3WTW C;  2FJ1 A;  3FDY A;  2X85 A;  1R49 A;  4JX6 A;  2JWT A;  2CS3 A;  4PGH A;  3BR0 A;  1PUF B;  4O6J A;  1T38 A;  1K79 A;  3GO5 A;  2NVX J;  2AS5 F;  4BEH B;  4E6K G;  4YIF A;  2VOD A;  1WGX A;  3AKZ A;  2HZD A;  2VKE A;  5EGO B;  4ENM A;  1EKE A;  3AL0 C;  3LOC A;  4A3I J;  2XC7 A;  3L7W A;  1FTT A;  3BLY A;  4BNC A;  2XIG A;  3DFG A;  5IOY A;  5ILV A;  1JKP C;  2JMW A;  3K4N A;  2ISY A;  3ULQ B;  3V8K A;  3RZO J;  5M5W J;  2DQL A;  5B5E C;  1H88 C;  4IHX A;  3CLO A;  5HS9 A;  4I01 A;  4B48 A;  4MLO A;  5CVU A;  4RAY A;  2F4I A;  3HHH A;  1FZP B;  2HOE A;  4YFK F;  3A01 A;  2ZJR F;  3HIF A;  2V9P A;  1MBE A;  4A12 A;  2HDD A;  2WY8 Q;  5E1X A;  1P2F A;  4RLF A;  2F6C A;  1QNT A;  1R1U A;  4P5O A;  5F0C A;  4EGY A;  1S5L C;  1IV8 A;  1RC9 A;  3W2W A;  4M72 A;  5TRD A;  4FAS D;  2EIJ H;  2DOA A;  1X4O A;  4BH9 A;  4DGW B;  1TZL A;  2OCE A;  1JUS A;  2R7R A;  2FU4 A;  2VKD A;  1U5T B;  4PFP A;  1G8X A;  5CVV A;  2V9V A;  3ABT A;  5EEG A;  2QKL B;  2FML A;  4Q47 A;  1XGN A;  2KKO A;  3PO3 J;  4HQE A;  3WE3 A;  4PCQ A;  1APL C;  2ICW G;  1YLF A;  1BBY A;  1FPQ A;  3C1D A;  1VQ8 I;  4R1H A;  1B9N A;  1TQM A;  4BQN A;  1PJR A;  2KFD A;  2Z1D A;  3VOD A;  2XSD C;  4P55 A;  3AG2 H;  2V7F A;  2OUM A;  4G6D A;  2Q8K A;  5D4S A;  2LF7 A;  4YEL A;  4CXF A;  4U87 A;  4AVP A;  2NRA C;  1FOW A;  4MQ9 F;  1FYK A;  3E3V A;  3TBI A;  3TP0 A;  4IRI A;  1S7O A;  1YQA A;  5FKM A;  2M8E A;  3ZQI A;  3WGH A;  3GTQ J;  1FBU A;  3QAH A;  3SJM A;  1T56 A;  5DYM A;  3FXR A;  5CPR B;  1TTY A;  4O3M A;  2BXY A;  1WJC A;  1WSU A;  2YX4 A;  1D0Y A;  4XLC A;  4NC8 A;  1ZK8 A;  2KIU A;  3C2B A;  3LSK A;  1S8N A;  2ID3 A;  2WB1 A;  5DEQ A;  2CFO A;  3TKY A;  1D1C A;  1DGW Y;  4II2 A;  3K4L A;  1XGM A;  5EEA A;  1Y0U A;  2RQP A;  4FTH A;  3MZH A;  3ASO H;  4B4C A;  2PG4 A;  1O3T A;  3DKY A;  3JRG A;  4RBO A;  4D7M A;  4M9Z A;  2CQK A;  3HSR A;  4E7Z A;  4M3E A;  4G7O F;  4BHP A;  3BCB A;  4QIW N;  4NB5 A;  1ZRF A;  2K9Q A;  3ELK A;  1W7P A;  1I6H J;  4CGZ A;  5ICC A;  1EH6 A;  2Y0S A;  1V54 H;  4CHU A;  2K9M A;  3ZXS A;  3GME A;  5H6R A;  1IC8 A;  1Y39 A;  3A02 A;  5IYD J;  1BA5 A;  1HXD A;  3OR2 C;  4LG3 A;  2PMH A;  1YHQ I;  2TDX A;  1EJ9 A;  2L02 A;  3OS0 A;  2R5Z B;  5F0F A;  2DYS H;  5AON A;  1H0M A;  2D2W A;  3BR6 A;  2MD0 A;  3JTG A;  5B1A H;  3CC4 I;  3U1D A;  1LDK B;  2HWV A;  1GUU A;  1JXS A;  4BAY A;  3BR3 A;  2VJ4 A;  4L9J A;  1BW5 A;  2L7Z A;  5K7F A;  3LQQ A;  2MLG A;  4I2O A;  2CQN A;  3CDL A;  3G71 I;  2ESN A;  3SEZ A;  4KIC A;  3IRQ A;  3T0Y A;  4BE2 A;  4RS8 A;  2EIK H;  2NVU B;  2EV6 A;  3BY6 A;  3BG9 A;  4UUS A;  2ISZ A;  4OIQ F;  4NHJ A;  2E5Z A;  2FBK A;  2KIS A;  2QWW A;  1MMN A;  4GYI A;  3ZQL A;  1S6L A;  4RAF A;  1QVU A;  3L00 A;  4HPQ A;  3H0D A;  1MJA A;  3TGN A;  3QRF F;  1IRF A;  4C30 A;  3M7G A;  2A5W A;  1O3Q A;  2DT7 B;  1FSE A;  3KYC B;  4XOR A;  1D0X A;  2K9L A;  3QQA A;  2X0L A;  2ESH A;  3J80 Z;  1Y1V J;  2IA1 A;  4OMY A;  4ESF A;  2ID6 A;  1ZAR A;  1MBF A;  3DCF A;  2YX7 A;  2VXD A;  4JP0 A;  4ZTF A;  4BAC A;  3DF8 A;  1V5E A;  5E20 A;  1RRJ A;  2VBZ A;  1LB2 A;  3S2D J;  5IY5 H;  1PDN C;  2W57 A;  2ZXW H;  2VBY A;  3ECH A;  3E6D A;  3FM3 A;  2W7N A;  3OWT A;  4UV9 A;  3MKZ A;  2IRF G;  4MTE A;  1ZLJ A;  3KX2 A;  4XBF A;  3SFI A;  3GFJ A;  2CV2 A;  3HRU A;  2W48 A;  1Z67 A;  2DW4 A;  3BP8 A;  2KP6 A;  3T8R A;  1VQK I;  2V4J C;  2DMQ A;  5LLQ A;  2PMU A;  4KIB A;  3RPU A;  3OYB A;  1W7P D;  2B7E A;  1ZGW A;  4HQM A;  2OAZ A;  4AID A;  1O3S A;  1BC8 C;  4A3B J;  3QPT A;  4IZZ A;  3CZ6 A;  2HQA A;  3MFK A;  3LFK A;  3C3W A;  3HOX J;  4AIH A;  5E18 F;  5ILS A;  3RKW A;  2BOL A;  1MNE A;  4PJJ A;  3AAF A;  3I5U A;  3TO9 A;  1WJ5 A;  2FNP A;  4HSR A;  2E34 A;  2KJB A;  2XKO A;  3IL2 A;  5J4V A;  2Z33 A;  1QA6 A;  1UFM A;  3HOS A;  1QO0 D;  1T39 A;  4MEX F;  4M3G A;  3T5X A;  3I53 A;  2LBF A;  1G3W A;  4R79 A;  2VQG A;  3CCL I;  1W5T A;  5B3S H;  2ACJ A;  2B0L A;  3IKV A;  3HGY A;  3U9G A;  1UCR A;  2AQE A;  2AXL A;  5E79 C;  1MSF C;  4HV6 A;  4CH7 A;  1T95 A;  5LFA A;  3OYG A;  4DYR A;  2XHK A;  5DM6 F;  4NUB A;  1TNS A;  2TCT A;  2BY2 A;  2K4J A;  3K4J A;  4Y7N J;  1HC8 A;  3RCO A;  5JLW A;  3HRT A;  4RMN A;  5FD5 A;  1PUE E;  4IF4 A;  3S32 A;  4YRV A;  2E2I J;  4NQW B;  4IXA A;  3M1C A;  2X51 A;  1MBH A;  2BBY A;  1HCR A;  1S7E A;  3ZMD A;  1R71 A;  1BC7 C;  4BBR J;  1BI3 A;  2KZG A;  4JX4 A;  1JUP A;  2BZT A;  2W4S A;  4BE0 A;  1LVA A;  3P9I A;  3ASN H;  1JKO C;  2FSW A;  2H1K A;  1JJ8 C;  4W1U A;  2KDZ A;  1QBJ A;  1KQ0 A;  3HHG A;  3K7A J;  2B9S A;  1J9I A;  4JBA A;  2BEO A;  2HNH A;  1TWF J;  2G0E A;  3CMM A;  5JFR A;  5JR3 A;  5J4Y A;  2GLO A;  1MSE C;  2HXO A;  2HYG D;  2M9H A;  3LMM A;  2EFW A;  4X1E A;  1XSV A;  4EAT A;  4FCY A;  3ZP5 A;  3WU2 C;  1AA7 A;  2KL4 A;  1IXS B;  4OIP F;  4IPA A;  1AKH A;  2E60 A;  2DJN A;  3LL7 A;  3DEE A;  3GW2 A;  2IGM A;  4BXX J;  4HAM A;  3O2P E;  1LNW A;  4XKV A;  4A3L J;  1WQ2 A;  2DTZ A;  2ME0 A;  2FBI A;  2OTL I;  2OU2 A;  1BI0 A;  2L01 A;  2ELH A;  4N9I A;  4RGR A;  2VC0 A;  2DTR A;  1XB4 A;  4BHB A;  1OR7 C;  1I50 J;  5FB2 A;  3FM5 A;  2VIX A;  2XAS A;  3HEF A;  2M3A A;  3QP5 A;  2E1M C;  2CYY A;  5LGT A;  3OS2 A;  2UV1 A;  2Y9Y A;  1SFE A;  4OIN F;  3V7R A;  5J47 A;  2R7V A;  1K78 B;  2XB5 A;  4CCN A;  2XSJ C;  3F9K A;  3D5S C;  3BC8 A;  4G12 A;  5J40 A;  2EK5 A;  1UJ8 A;  3P7N A;  3WTZ A;  1U8B A;  3TP3 A;  3F8N A;  4MIM A;  3G1O A;  1OCZ H;  1YJ9 I;  3DBL B;  4UVB A;  4A3K J;  3H9J A;  4XQF A;  3NAU A;  4M9S A;  5J8C A;  3Q3S A;  3KP5 A;  3VWB A;  1YW9 A;  1KU7 A;  5IPA A;  1SC7 A;  2RNJ A;  4CIC A;  3WTT C;  4ZDP A;  1VQN I;  3KIO A;  5J1Y A;  3VYT B;  1LPQ A;  1IG7 A;  4G7H F;  4RGS A;  4KJZ A;  3OYJ A;  2WAE A;  2JSP A;  3W3C A;  1DPR A;  4BGD A;  3OSF A;  4J19 A;  5IT3 A;  1DP3 A;  3KET A;  2QQB A;  2HQR A;  3RKX A;  2GM4 A;  2XAJ A;  5EG0 A;  1QVT A;  3CO6 C;  5IP9 J;  1O3R A;  2W1O A;  1SD4 A;  2R7Z J;  1F1Z A;  4M6V A;  3GBG A;  1XSX A;  3RIR A;  4F7Z A;  1P4X A;  1Z21 A;  2E7W A;  1LUJ B;  1AOY A;  5BPI A;  3FKJ A;  9ANT A;  3QYF A;  2KLO A;  4N9H A;  3CCS I;  1ON2 A;  1R36 A;  1UST A;  4LLG F;  2R93 J;  5E8G A;  3ONQ A;  3HC7 A;  2JPB A;  5CLS A;  4C3H J;  3S2W A;  4M74 A;  5KNL A;  3PIO F;  5J6X A;  3MKW B;  1VF9 A;  4U7D A;  2EZK A;  2MLK A;  4Y3O A;  1OMI A;  4XM3 A;  2ELK A;  5ICF A;  4E4H A;  1GHC A;  3QP6 A;  2QEN A;  1U9O A;  3W2A A;  1WI3 A;  2O03 A;  4EJV A;  2CFX A;  3V7C A;  2GAU A;  5GAG J;  3HDD A;  4Y4R A;  2JTV A;  3EUK L;  3F72 A;  2AO9 A;  2H94 A;  1D1B A;  2W00 A;  4DNC A;  2V79 A;  2OA4 A;  3HUG B;  2D5V A;  2DYR H;  1R7J A;  2XVC A;  2NNY A;  2OD5 A;  4ZDO A;  2P5L C;  1Z3Y A;  3ABU A;  1SFU A;  1MBK A;  4X0G A;  1SVM A;  4CCM A;  1E0E A;  4UY8 I;  5FKN A;  2NVT J;  1OFC X;  2R92 J;  4BQQ A;  2HU9 A;  4KN7 X;  3WTX C;  3E6C C;  2EIM H;  1T08 B;  1BW6 A;  4DYQ A;  5F64 A;  1MIJ A;  3SZG A;  1IGN A;  1ETQ A;  4Q48 A;  3J81 Z;  1ZAO A;  1J2X A;  4JOM A;  2DT5 A;  1I3Q J;  1ZG3 A;  2WY7 Q;  2CQ7 A;  4XK4 A;  4A0X A;  5H2F C;  2ZC2 A;  1FOX A;  2QSH X;  2PJR B;  3DQV C;  1Z77 A;  4JK1 X;  4A5M A;  5E1W A;  3DTE A;  3DEU A;  3NRV A;  2O8X A;  3RKY A;  2UZK A;  1FYM A;  2I8D A;  1HW2 A;  1YFH A;  2MSY A;  5D6F A;  4OAY A;  5FKL A;  2X1C A;  1BR1 A;  3FHZ A;  3OL4 A;  3M4O J;  2PN6 A;  2XAG A;  2H6C A;  3E5X A;  1UHW A;  2FF4 A;  5L3C A;  1MD0 A;  2HPI A;  1MNM C;  2P6T A;  1OKR A;  1WJB A;  1LE8 A;  4A3F J;  2ZME B;  4A6E A;  2W24 A;  4XSX F;  1P4A A;  3G1M A;  4RA2 A;  1VQL I;  3HB9 A;  3DBR B;  1MH3 A;  2K4B A;  1VQP I;  4FHT A;  1OIS A;  1WPK A;  3I54 A;  3L9F A;  4WXD A;  4B3X A;  2Y0M A;  2MA3 A;  4L0Z B;  4U0V A;  2DK5 A;  5GPA A;  2X6Y A;  3WG9 A;  1R1V A;  2DDA A;  3CES A;  3RYR A;  3B73 A;  1ZH5 A;  3ZMZ A;  4EJT A;  2CU7 A;  2Z9O A;  5EF6 A;  2L9R A;  3I59 A;  1TWA J;  5HNF A;  1ZRC A;  4AVZ A;  1YX3 A;  1MMD A;  3GZ5 A;  3A0B C;  2KQR A;  2KIQ A;  3D5L A;  4CUG A;  2KRC A;  1IZ1 A;  1A6Q A;  1TWC J;  4WK8 F;  4XRM A;  3H3Z A;  3QWL A;  4OOI A;  2W25 A;  3VOE A;  3G2B A;  4AIJ A;  2XKP A;  3BOQ A;  3TOB A;  1ZQ3 P;  2O5R A;  2FD5 A;  2IXS A;  3QPS A;  3J7Z I;  4U88 A;  3K1M A;  3S14 J;  1U6G A;  3JR9 A;  2DK8 A;  3VB2 A;  4IO9 F;  1JGG A;  1ETO A;  5KVR A;  4A3J J;  2QZ8 A;  2E1C A;  3VEP A;  1P7J A;  4F52 A;  3GTJ J;  3REO A;  4ZTJ A;  3C2H A;  1WKM A;  2WV0 A;  5D6E A;  1WI9 A;  3OOU A;  3W6J B;  5K1Y A;  3S17 J;  3MKY B;  1CGP A;  3OYF A;  2A05 A;  2R5Y B;  2K40 A;  4OAZ A;  3CC2 I;  5HLI A;  2A61 A;  3IWF A;  5FD6 A;  2LY9 A;  2PJP A;  4MEY F;  5F04 A;  2EWN A;  1ZGA A;  3MAJ A;  5BNG A;  2NVQ J;  5E3N A;  3OMY A;  1IV6 A;  1XGO A;  2NYX A;  1JTY A;  5D8K B;  2YS9 A;  3SDG A;  3HOT A;  1A35 A;  1OPC A;  2X48 A;  3OR1 C;  2IBD A;  3HKZ N;  1ETY A;  1OCP A;  1ENH A;  3ZMS A;  2DLL A;  5CVJ A;  2XF6 A;  2W85 A;  2H8R A;  2N8G A;  2Y31 A;  3ZCO A;  1W5S A;  4ZYE A;  3RPQ A;  3ZQC A;  2XRO A;  3E97 A;  1UZC A;  3BJA A;  4OU0 A;  1RUO A;  3LQR A;  5IP7 J;  3HRM A;  3H0G J;  4LIV A;  1FT9 A;  4L9N A;  4XMY A;  1REP C;  4PK4 A;  2HI3 A;  4IHS A;  5DCM B;  2LNB A;  2XGE A;  2LY2 A;  2O9L A;  1RKT A;  1RET A;  1FTZ A;  3K4B A;  3PO2 J;  4LD5 A;  3DLA A;  2OZU A;  1Y8R B;  2CUE A;  4O5V A;  5DCF A;  1IN4 A;  1Y0N A;  3AL0 B;  2HEO A;  4E7I A;  1XDU A;  2IVM A;  4HDU A;  2XAH A;  1YIT I;  5K5O A;  5FKK A;  4KT6 A;  4H0E A;  4XON A;  1G3T A;  2CSO A;  1Z1D A;  2DBB A;  1B4A A;  2HDC A;  1Q1H A;  2LF8 A;  1GLN A;  1GV2 A;  5HDG A;  2ZSI B;  6PAX A;  3JW4 A;  3NQO A;  4GGG A;  3OIQ A;  5LBQ A;  4JX5 A;  2M4G A;  1CF7 B;  1JT0 A;  3KLO A;  1D3Y A;  4CYC A;  2E36 A;  3CD6 I;  3L2Q A;  3CCR I;  1GV5 A;  1GVD A;  4ZYH A;  2V1U A;  3E6M A;  4ZDL A;  3K70 D;  2NOJ B;  2E2J J;  4F55 A;  2L9N A;  4AIK A;  5ERI A;  4BXF A;  1KA8 A;  3FKI J;  3J7A Y;  3K70 C;  2JT1 A;  5DV5 A;  1AWC A;  3RQ4 A;  3K9T A;  1VQ4 I;  4LK1 F;  2YU9 J;  2HVS A;  2VBW A;  3A0H C;  2QM3 A;  2DMU A;  5B1B H;  1YS7 A;  2VXZ A;  4IRG A;  4E7J A;  5ILU A;  4EMS A;  1YIO A;  2PX9 A;  2BY3 A;  3F23 A;  4X6A J;  2HOT A;  1IO2 A;  2DA5 A;  4GDF A;  3K6G A;  3GYH X;  1E3H A;  2JUG A;  3V4G A;  3E5U A;  3L2U A;  3BQZ A;  1J5Y A;  2ZXJ A;  4AM3 A;  2X1D A;  4QTR A;  4NBQ A;  4KIS A;  2BY0 A;  3OYI A;  5C3E J;  2QBY B;  4LG0 A;  4I99 C;  1IAW A;  1U5T C;  5K7H A;  2FQ3 A;  2Q2E A;  2VB6 A;  1WZ2 A;  2DPU A;  3K2Z A;  2GXA A;  2Z5U A;  1DP7 P;  4YFN F;  1YRN B;  3GUD A;  1HQC A;  4W97 A;  2CRG A;  1Z6T A;  3PNV A;  2PLY A;  1JTX A;  4BU2 A;  1A04 A;  2M7B A;  5JHU A;  1BR4 A;  1YYV A;  4G9Y A;  3CCY A;  2JSC A;  5M5Y J;  4HF1 A;  3K2A A;  4PJM A;  3GTL J;  2ZNZ A;  3K0L A;  5ED4 A;  1KZH A;  3S1R J;  2R7Q A;  1LVK A;  2G7H A;  2DQR A;  5JLX A;  2FE3 A;  2LMD A;  3DU6 A;  3EUA A;  5J3L A;  1K83 J;  4XOP A;  5EZH A;  4I6Z A;  2HOS A;  3PQK A;  3RQI A;  2HGC A;  3S3M A;  2CW7 A;  3NWT A;  5A2Q K;  2J5O A;  4ZH4 F;  4I02 A;  2DA6 A;  4KMF A;  3ZN0 A;  1YG2 A;  4UNO A;  1K7A A;  1SAU A;  1ETW A;  4CZC A;  3BR1 A;  2XGC A;  3KFW X;  1P4W A;  1IN8 A;  3K4M A;  2DA3 A;  3LSI A;  3HBL A;  2K7L A;  3JAM K;  4RAG A;  3KP3 A;  1SMT A;  4IHT A;  2CG4 A;  3DPU A;  3C18 A;  3A01 B;  2G7U A;  3L2V A;  2IPQ X;  2XPU A;  1AHD P;  4E70 A;  2ZNY A;  1VI0 A;  3CUQ B;  1PYV A;  3OYD A;  3RI4 A;  4L9V A;  4C3J J;  2O8K A;  2E35 A;  2QEX I;  3PQJ A;  1D8K A;  1P92 A;  1SFO J;  4N4O B;  4NDL A;  2HDW A;  3FHN A;  1POG A;  4YEJ A;  3HOU J;  2DFH A;  2YSR A;  4UVA A;  1B72 A;  1K6Y A;  5F0H A;  5GP9 A;  4BUP A;  5L3E A;  1PP8 F;  3S15 J;  3CO7 C;  3FF5 A;  3MMY B;  5IP6 A;  4ESB A;  2QVO A;  5JVT A;  2ECB A;  1W5C C;  3DBH B;  4S04 A;  2IGN A;  2WC2 A;  1OCO H;  2R7O A;  4BY7 J;  1VTN C;  3FBN B;  1GT0 C;  3DXJ F;  3A03 A;  5GPC A;  3GTG J;  2RQQ A;  3HKZ A;  1ZGJ A;  4XLA A;  5E3M A;  5CYV A;  5KK1 A;  5D4R A;  4PJN A;  3UNG C;  1KYW A;  4GO1 A;  3I71 A;  2FMY A;  2DMN A;  3HGG A;  4TV7 A;  1YO5 C;  1TW2 A;  5IYB J;  3L2C A;  2P7C B;  4G8X A;  2EPF A;  4CCK A;  4V2F A;  4PGG A;  2DOD A;  4B43 A;  2LK2 A;  4HX4 A;  2M30 A;  2BW3 A;  1VQ6 I;  2EH3 A;  3BG7 A;  3ZPL A;  3WU0 A;  4BQA A;  1F9N A;  3GTO J;  2KT0 A;  5F08 A;  1R22 A;  4KN4 X;  2JUC A;  1J0R A;  3E6B A;  3GEZ A;  1HDP A;  3IH4 A;  1BIB A;  5HS7 A;  2FA5 A;  2GIZ A;  3K4K A;  3GVA A;  2HR3 A;  3AG1 H;  3BQY A;  2HKO A;  4CSW A;  4HLX A;  1X2N A;  4F3Q A;  1J09 A;  2GWR A;  3QOE A;  2CJJ A;  3WE2 A;  3Q0U A;  2JA5 J;  3B6A A;  3WU1 B;  4HRI A;  3VPR A;  1R5G A;  3ZN1 A;  5TIS C;  4CCO A;  4ABZ A;  1W7P B;  1KU9 A;  1Z91 A;  2E1N A;  2XAQ A;  3H92 A;  1OR7 A;  3CDH A;  1PVE A;  3BG5 A;  4XKB A;  2QQ8 A;  2ZKZ A;  2LP0 A;  5EEH A;  1JT6 A;  3CTA A;  5LHH A;  1OYI A;  1HDD C;  2VKH A;  3DTI A;  3MKL A;  3HOW J;  3OYM A;  3LWF A;  1STZ A;  3AG3 H;  2RN7 A;  1MH4 A;  1FX7 A;  1OYW A;  2HTJ A;  2MW8 A;  4JQF A;  3K69 A;  3MN2 A;  1EV7 A;  2VI6 A;  3J7A O;  2VKV A;  3HTS B;  1ZG1 A;  1T0F C;  2NVY J;  4GYG A;  2DA1 A;  1QQI A;  2BE5 F;  1XG1 A;  5DM7 F;  4UUS B;  4BYY A;  1VQ7 I;  1IN5 A;  4G7Z F;  3BJO A;  3FXL A;  5HDK A;  3GZN B;  4KA4 A;  1ORK A;  1MJB A;  4KFC A;  2G9W A;  5JI6 A;  3BJ6 A;  1OCR H;  3S1M J;  1IF1 A;  1JE8 A;  4FX0 A;  1G2H A;  3JRI A;  2M5W A;  3M9A A;  2H27 A;  5E8I A;  3KP2 A;  3HRS A;  1SD7 A;  4P96 A;  1DDN A;  1LEA A;  1XDS A;  4Y13 A;  3FXM A;  5M3M J;  4WX9 A;  2EZL A;  4KIT B;  1LFB A;  1SAN A;  3S1N J;  2XB0 X;  1O4X A;  3JTH A;  2EA2 A;  1GXP A;  3HOV J;  3CP8 A;  2A6T A;  4UHT A;  4M71 A;  3W6K B;  1RI7 A;  3C7J A;  3NEU A;  2GQQ A;  1MJ9 A;  4CCL A;  2CUJ A;  4MNU A;  1MDM A;  1P6R A;  2F5D A;  3PUB A;  4CZZ A;  2K3F A;  2HS5 A;  4WXH A;  3ZR8 X;  1QPM A;  3F0C A;  4I0B A;  4DZP A;  2VOO A;  5IT9 K;  3SZP A;  2YUS A;  1TC3 C;  3M8J A;  2XF5 A;  3GWZ A;  2DXI A;  2V1N A;  2EZH A;  3CJQ B;  2IAI A;  1ZR4 A;  4U0Y A;  5DD8 A;  2D1H A;  2P4W A;  4E7L A;  2VLA A;  2A07 F;  2XRN A;  5LD2 C;  3H1C A;  1H9G A;  1V4R A;  2LKS A;  2A6H F;  2OZ6 A;  2WA0 A;  4E7K A;  2FOW A;  3DKX A;  2XAU A;  1OCC H;  1KQ9 A;  3FXJ A;  5KCM A;  1EH7 A;  3KE2 A;  2BGC A;  4EJO A;  2I10 A;  4A93 J;  2UXN A;  1LEB A;  3OL3 A;  1F43 A;  3U1K A;  4S05 A;  1O57 A;  5GTH C;  4BJ5 C;  2M8G X; 
#chains in the Genus database with same CATH homology
 1YHQ I;  3CCM I;  3CF5 F;  5DM6 F;  1HC8 A;  1VQN I;  3CC4 I;  4IOC F;  2ZJR F;  5GAD J;  1MMS A;  3G71 I;  1VQL I;  1YIT I;  2QA4 I;  1VQP I;  2ZJQ F;  1VQO I;  5JVG F;  4V19 K;  2E35 A;  2QEX I;  3CCS I;  4IOA F;  2E36 A;  5DM7 F;  3CD6 I;  3PIO F;  1VQ7 I;  3CCR I;  2H8W A;  5GAH J;  1VQ8 I;  3CME I;  3CC7 I;  3CCJ I;  1VQM I;  3CMA I;  3PIP F;  1VQ4 I;  3G4S I;  3J7Z I;  3CCU I;  5GAG J;  2NXN B;  1FOW A;  3J7Y J;  4IO9 F;  2OTL I;  1VQ5 I;  2ZJP F;  3CJT B;  3CCV I;  3CCQ I;  3CCE I;  1YI2 I;  1VQK I;  4UY8 I;  1VQ6 I;  2K3F A;  2JQ7 A;  3CC2 I;  1YJW I;  1S72 I;  2OTJ I;  1YIJ I;  3I56 I;  2E34 A;  2FOW A;  1QA6 A;  3I55 I;  3G6E I;  1ACI A;  1YJ9 I;  1Y39 A;  3DLL F;  5GAE J;  1YJN I;  1FOX A;  1VQ9 I;  1FOY A;  3CCL I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...