1AD6A

Domain a of human retinoblastoma tumor suppressor
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
185
structure length
185
Chain Sequence
VMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RETINOBLASTOMA TUMOR SUPPRESSOR
publication title Structural similarity between the pocket region of retinoblastoma tumour suppressor and the cyclin-box.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
total genus 70
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 1997-02-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1ad6A00
1C9BA 4II5B 4G6LB 3BLHB 5LQFB 4CFNB 4F7NB 1KXUA 4OR5B 2PHGA 4EOSB 4CFUD 1H26B 3O0GD 1H1SB 1OI9B 2CCIB 1G3NC 5ICPB 5HBHB 4IMYB 1D3UB 2PK9B 4EOJB 4CFUB 4BCIB 2W9ZA 3G33B 1AISB 2CJMB 3MIAB 1BU2A 4UN0A 1AD6A 4BCFB 4EC8B 5BNJB 1OIYB 1VOLA 4ELJA 1O9KB 1OKVB 2I40B 2W9FA 1XO2A 2BPMB 5CYIB 1URCB 3RGFB 4BCOB 4EORB 3M03A 3TN8B 1VINA 2IVXA 2CCHB 3TNIB 4RODA 3TNHB 2W99A 3EOCB 3EIDB 2WPAB 4YOSA 2W2HA 2UZLB 1OL1B 2C5VB 5FGKB 5LMKB 4BCJB 1QMZB 1GUXA 4BCNB 2WXVB 1FINB 2C5XB 3DDPB 2PMIB 2W96A 1P5EB 2I53A 2WMAB 4Y72B 4YOZA 2C6TB 4YC3B 2F2CA 1GH6B 1OIUB 2C4GB 4CFVB 4EOOB 5HBEB 4BCKB 4F7JB 2UZBB 3POMA 2UZEB 4EOMB 1H24B 3EJ1B 4F7LB 2IW8B 1OGUB 4F6SB 1GY3B 3BLQB 3MI9B 3MY5B 5HVYB 2WHBB 4BCHB 4CFWB 1H1PB 3F5XB 4FX3B 3TNWB 4CXAB 1VYWB 4CFXB 5IDPB 3BHVB 1H4LD 1N4MA 4ROCA 2UZDB 5HBJB 4EC9B 5IDNB 5EFQB 4ELLA 2UUEB 1UNGD 4EOPB 1JSUB 4BCQD 3MY1B 1UNLD 5CEIB 4EONB 4BCMD 5L2WB 2C5OB 2B9RA 1FVVB 1OL2B 1H27B 4I3ZB 4BCQB 4F6UB 4F7SB 4BCMB 1O9KA 3DDQB 1JSTB 4CRLB 2IW9B 4F6WB 4BCPB 2IW6B 4NSTB 3H4CA 4EOLB 2G9XB 1W98B 3DOGB 2JGZB 2WEVB 1OKWB 2R7GA 1UNHD 4F70B 2V22B 2WMBB 3QHRB 5I5ZB 1ZP2A 5HNBB 1H28B 4KRDB 1GUXB 4BCGB 3LQ5B 3QHWB 5HQ0B 4CFMB 2EUFA 4EOQB 1JOWA 4KRCB 4TTHA 5ACBA 2PK2A 1H25B 3BHTB 1PKDB 4YOOA 2C5NB 2X1NB 1H1RB 2WFYB 2BKZB 4EOIB 4OGRB 3K7AM 5IF1B 4ROEA 4EOKB 3BHUB 1TFBA 3BLRB 2QDJA 1H1QB 2WIHB 1E9HB 1JKWA 1F5QB 2WIPB 4BCND
chains in the Genus database with same CATH superfamily
1C9BA 3DL1A 4F7NB 1H26B 3HBLA 3X20B 1OI9B 1G3NC 2KR6A 2W9ZA 3X25B 3G33B 1AISB 2CJMB 3MIAB 4UN0A 4BCFB 4EC8B 5BNJB 4ELJA 2QF7A 2W9FA 2BPMB 3B57A 3RGFB 4EORB 3M03A 1VINA 3HZJA 3TNIB 2CCHB 4RODA 2KMGA 3TNHB 3QYGB 1P5EB 4MFEA 2WMAB 4Y72B 1UGPB 2C6TB 4YC3B 2C4GB 3EJ1B 4F6SB 3MI9B 3A8LB 2QFZA 4OB1B 2WHBB 4CFXB 4ROCA 2CYZB 3TW7A 5IDNB 5EFQB 4LOCA 3KHIA 3MY1B 3A8GB 2B9RA 5DQWA 2ZPFB 3WVDB 3QWLA 3QYBA 2IW9B 4F6WB 2IW6B 4NSTB 4QSHA 1UNHD 2PJQA 2V22B 1ZP2A 1H28B 1GUXB 4BCGB 5HQ0B 4BXXX 4EOQB 4KRCB 4M6VA 1H25B 2X1NB 1E7PA 2DXBB 3K7AM 4OB0B 2WIHB 1E9HB 2WIPB 2DD4B 2ZPIB 4BCND 2IN3A 4G6LB 3X26B 3BLHB 2PHGA 3HO8A 2PK9B 1AD6A 1O9KB 1XO2A 4AKHA 2W99A 3EOCB 3EIDB 2WPAB 4Z6YA 2UZLB 2G77A 3VYGB 3VYHB 1GUXA 1AHJB 1UGSB 5IHYA 2C5XB 2DD5B 1ENWA 2PMIB 2CZ0B 2I53A 3QXEB 1GH6B 3DTOA 4EOOB 2ZPBB 4BCKB 4OB3B 3BG5A 1OGUB 3BLQB 3MY5B 1UGQB 3F5XB 4FX3B 3TNWB 4CXAB 1H4LD 2UZDB 4EC9B 3VKGA 2UUEB 3QZ9B 4BCQD 4BCMD 4I3ZB 1H27B 4BCQB 4F6UB 3X28B 4BCMB 1O9KA 4CRLB 4BCPB 4ZGDB 2D0QB 3H4CA 2AHJB 2WEVB 2QGSA 4CFMB 3DJBA 2ZPGB 4HNUA 1H1RB 2WFYB 2DMEA 3BLRB 1H1QB 4NC6A 4OR5B 4BY7X 4JX5A 1H1SB 1D3UB 5HBHB 4IMYB 4EOJB 2DPPB 1QLBA 2CZ7B 1BU2A 1VOLA 3A8HB 4HNVA 2I40B 5CYIB 1URCB 4AKIA 3VKHA 2BS2A 4HNTA 2IVXA 2W2HA 3GTMS 1OL1B 5LMKB 4BCJB 1QMZB 4BCNB 1IREB 3DDPB 4JX6A 2DXCB 4BBRM 2F2CA 2QDYB 3HHTB 1OIUB 5HBEB 4F7JB 2UZBB 2ZPEB 2UZEB 4EOMB 2IW8B 1GY3B 4BCHB 4CFWB 1H1PB 4HLQA 1N4MA 3HB9A 3QYEA 1UNGD 4ZGJB 4HL4A 2CZ6B 3X24B 3BG9A 4MIMA 4EONB 2C5OB 3A8MB 1OL2B 3DDQB 3DOGB 3QYHB 2R7GA 4F70B 3QHRB 4KRDB 3LQ5B 3QHWB 2EUFA 1JOWA 4TTHA 4FM4B 4MFDA 3BHTB 1PKDB 4YOOA 2C5NB 4EOIB 4OGRB 4EOKB 3BG3A 1F5QB 5DQVA 1V29B 4II5B 5LQFB 4CFNB 1TD6A 4OB2B 1KXUA 4EOSB 4CFUD 3O0GD 2CCIB 5ICPB 4CFUB 4BCIB 4BBSM 3QZ5B 1OIYB 1OKVB 3WVEB 4BCOB 3TN8B 2ZCFB 4YOSA 2BS4A 4AKGA 2C5VB 5FGKB 4ZGEB 2WXVB 1FINB 2W96A 5EJCA 4YOZA 4CFVB 3POMA 1H24B 2QQ8A 3PO3S 4F7LB 2LW4A 5HVYB 5IDPB 1VYWB 2WJ9A 3BHVB 5HBJB 3A8OB 4ELLA 4EOPB 1JSUB 1UNLD 5CEIB 2BS3A 5L2WB 1FVVB 4F7SB 3NDQA 1JSTB 4EOLB 2G9XB 1W98B 2JGZB 1OKWB 2WMBB 5I5ZB 5HNBB 2CZ1B 5ACBA 2PK2A 4AI6A 2BKZB 3TW6A 1FKMA 5IF1B 4JX4A 2ZPHB 4ROEA 2ZZDB 3BHUB 1TFBA 4BY1X 2QDJA 1JKWA 1UGRB
chains in the Genus database with same CATH topology
1C9BA 4II5B 4G6LB 3BLHB 5LQFB 4CFNB 4F7NB 1KXUA 4OR5B 2PHGA 4EOSB 4CFUD 1H26B 3O0GD 1H1SB 1OI9B 2CCIB 1G3NC 5ICPB 5HBHB 4IMYB 1D3UB 2PK9B 4EOJB 4CFUB 4BCIB 2W9ZA 3G33B 1AISB 2CJMB 3MIAB 1BU2A 4UN0A 1AD6A 4BCFB 4EC8B 5BNJB 1OIYB 1VOLA 4ELJA 1O9KB 1OKVB 2I40B 2W9FA 1XO2A 2BPMB 5CYIB 1URCB 3RGFB 4BCOB 4EORB 3M03A 3TN8B 1VINA 2IVXA 2CCHB 3TNIB 4RODA 3TNHB 2W99A 3EOCB 3EIDB 2WPAB 4YOSA 2W2HA 2UZLB 1OL1B 2C5VB 5FGKB 5LMKB 4BCJB 1QMZB 1GUXA 4BCNB 2WXVB 1FINB 2C5XB 3DDPB 2PMIB 2W96A 1P5EB 2I53A 2WMAB 4Y72B 4YOZA 2C6TB 4YC3B 2F2CA 1GH6B 1OIUB 2C4GB 4CFVB 4EOOB 5HBEB 4BCKB 4F7JB 2UZBB 3POMA 2UZEB 4EOMB 1H24B 3EJ1B 4F7LB 2IW8B 1OGUB 4F6SB 1GY3B 3BLQB 3MI9B 3MY5B 5HVYB 2WHBB 4BCHB 4CFWB 1H1PB 3F5XB 4FX3B 3TNWB 4CXAB 1VYWB 4CFXB 5IDPB 3BHVB 1H4LD 1N4MA 4ROCA 2UZDB 5HBJB 4EC9B 5IDNB 5EFQB 4ELLA 2UUEB 1UNGD 4EOPB 1JSUB 4BCQD 3MY1B 1UNLD 5CEIB 4EONB 4BCMD 5L2WB 2C5OB 2B9RA 1FVVB 1OL2B 1H27B 4I3ZB 4BCQB 4F6UB 4F7SB 4BCMB 1O9KA 3DDQB 1JSTB 4CRLB 2IW9B 4F6WB 4BCPB 2IW6B 4NSTB 3H4CA 4EOLB 2G9XB 1W98B 3DOGB 2JGZB 2WEVB 1OKWB 2R7GA 1UNHD 4F70B 2V22B 2WMBB 3QHRB 5I5ZB 1ZP2A 5HNBB 1H28B 4KRDB 1GUXB 4BCGB 3LQ5B 3QHWB 5HQ0B 4CFMB 2EUFA 4EOQB 1JOWA 4KRCB 4TTHA 5ACBA 2PK2A 1H25B 3BHTB 1PKDB 4YOOA 2C5NB 2X1NB 1H1RB 2WFYB 2BKZB 4EOIB 4OGRB 3K7AM 5IF1B 4ROEA 4EOKB 3BHUB 1TFBA 3BLRB 2QDJA 1H1QB 2WIHB 1E9HB 1JKWA 1F5QB 2WIPB 4BCND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C9B A;  4II5 B;  4G6L B;  3BLH B;  5LQF B;  4CFN B;  4F7N B;  1KXU A;  4OR5 B;  2PHG A;  4EOS B;  4CFU D;  1H26 B;  3O0G D;  1H1S B;  1OI9 B;  2CCI B;  1G3N C;  5ICP B;  5HBH B;  4IMY B;  1D3U B;  2PK9 B;  4EOJ B;  4CFU B;  4BCI B;  2W9Z A;  3G33 B;  1AIS B;  2CJM B;  3MIA B;  1BU2 A;  4UN0 A;  1AD6 A;  4BCF B;  4EC8 B;  5BNJ B;  1OIY B;  1VOL A;  4ELJ A;  1O9K B;  1OKV B;  2I40 B;  2W9F A;  1XO2 A;  2BPM B;  5CYI B;  1URC B;  3RGF B;  4BCO B;  4EOR B;  3M03 A;  3TN8 B;  1VIN A;  2IVX A;  2CCH B;  3TNI B;  4ROD A;  3TNH B;  2W99 A;  3EOC B;  3EID B;  2WPA B;  4YOS A;  2W2H A;  2UZL B;  1OL1 B;  2C5V B;  5FGK B;  5LMK B;  4BCJ B;  1QMZ B;  1GUX A;  4BCN B;  2WXV B;  1FIN B;  2C5X B;  3DDP B;  2PMI B;  2W96 A;  1P5E B;  2I53 A;  2WMA B;  4Y72 B;  4YOZ A;  2C6T B;  4YC3 B;  2F2C A;  1GH6 B;  1OIU B;  2C4G B;  4CFV B;  4EOO B;  5HBE B;  4BCK B;  4F7J B;  2UZB B;  3POM A;  2UZE B;  4EOM B;  1H24 B;  3EJ1 B;  4F7L B;  2IW8 B;  1OGU B;  4F6S B;  1GY3 B;  3BLQ B;  3MI9 B;  3MY5 B;  5HVY B;  2WHB B;  4BCH B;  4CFW B;  1H1P B;  3F5X B;  4FX3 B;  3TNW B;  4CXA B;  1VYW B;  4CFX B;  5IDP B;  3BHV B;  1H4L D;  1N4M A;  4ROC A;  2UZD B;  5HBJ B;  4EC9 B;  5IDN B;  5EFQ B;  4ELL A;  2UUE B;  1UNG D;  4EOP B;  1JSU B;  4BCQ D;  3MY1 B;  1UNL D;  5CEI B;  4EON B;  4BCM D;  5L2W B;  2C5O B;  2B9R A;  1FVV B;  1OL2 B;  1H27 B;  4I3Z B;  4BCQ B;  4F6U B;  4F7S B;  4BCM B;  1O9K A;  3DDQ B;  1JST B;  4CRL B;  2IW9 B;  4F6W B;  4BCP B;  2IW6 B;  4NST B;  3H4C A;  4EOL B;  2G9X B;  1W98 B;  3DOG B;  2JGZ B;  2WEV B;  1OKW B;  2R7G A;  1UNH D;  4F70 B;  2V22 B;  2WMB B;  3QHR B;  5I5Z B;  1ZP2 A;  5HNB B;  1H28 B;  4KRD B;  1GUX B;  4BCG B;  3LQ5 B;  3QHW B;  5HQ0 B;  4CFM B;  2EUF A;  4EOQ B;  1JOW A;  4KRC B;  4TTH A;  5ACB A;  2PK2 A;  1H25 B;  3BHT B;  1PKD B;  4YOO A;  2C5N B;  2X1N B;  1H1R B;  2WFY B;  2BKZ B;  4EOI B;  4OGR B;  3K7A M;  5IF1 B;  4ROE A;  4EOK B;  3BHU B;  1TFB A;  3BLR B;  2QDJ A;  1H1Q B;  2WIH B;  1E9H B;  1JKW A;  1F5Q B;  2WIP B;  4BCN D; 
#chains in the Genus database with same CATH topology
 1C9B A;  3DL1 A;  4F7N B;  1H26 B;  3HBL A;  3X20 B;  1OI9 B;  1G3N C;  2KR6 A;  2W9Z A;  3X25 B;  3G33 B;  1AIS B;  2CJM B;  3MIA B;  4UN0 A;  4BCF B;  4EC8 B;  5BNJ B;  4ELJ A;  2QF7 A;  2W9F A;  2BPM B;  3B57 A;  3RGF B;  4EOR B;  3M03 A;  1VIN A;  3HZJ A;  3TNI B;  2CCH B;  4ROD A;  2KMG A;  3TNH B;  3QYG B;  1P5E B;  4MFE A;  2WMA B;  4Y72 B;  1UGP B;  2C6T B;  4YC3 B;  2C4G B;  3EJ1 B;  4F6S B;  3MI9 B;  3A8L B;  2QFZ A;  4OB1 B;  2WHB B;  4CFX B;  4ROC A;  2CYZ B;  3TW7 A;  5IDN B;  5EFQ B;  4LOC A;  3KHI A;  3MY1 B;  3A8G B;  2B9R A;  5DQW A;  2ZPF B;  3WVD B;  3QWL A;  3QYB A;  2IW9 B;  4F6W B;  2IW6 B;  4NST B;  4QSH A;  1UNH D;  2PJQ A;  2V22 B;  1ZP2 A;  1H28 B;  1GUX B;  4BCG B;  5HQ0 B;  4BXX X;  4EOQ B;  4KRC B;  4M6V A;  1H25 B;  2X1N B;  1E7P A;  2DXB B;  3K7A M;  4OB0 B;  2WIH B;  1E9H B;  2WIP B;  2DD4 B;  2ZPI B;  4BCN D;  2IN3 A;  4G6L B;  3X26 B;  3BLH B;  2PHG A;  3HO8 A;  2PK9 B;  1AD6 A;  1O9K B;  1XO2 A;  4AKH A;  2W99 A;  3EOC B;  3EID B;  2WPA B;  4Z6Y A;  2UZL B;  2G77 A;  3VYG B;  3VYH B;  1GUX A;  1AHJ B;  1UGS B;  5IHY A;  2C5X B;  2DD5 B;  1ENW A;  2PMI B;  2CZ0 B;  2I53 A;  3QXE B;  1GH6 B;  3DTO A;  4EOO B;  2ZPB B;  4BCK B;  4OB3 B;  3BG5 A;  1OGU B;  3BLQ B;  3MY5 B;  1UGQ B;  3F5X B;  4FX3 B;  3TNW B;  4CXA B;  1H4L D;  2UZD B;  4EC9 B;  3VKG A;  2UUE B;  3QZ9 B;  4BCQ D;  4BCM D;  4I3Z B;  1H27 B;  4BCQ B;  4F6U B;  3X28 B;  4BCM B;  1O9K A;  4CRL B;  4BCP B;  4ZGD B;  2D0Q B;  3H4C A;  2AHJ B;  2WEV B;  2QGS A;  4CFM B;  3DJB A;  2ZPG B;  4HNU A;  1H1R B;  2WFY B;  2DME A;  3BLR B;  1H1Q B;  4NC6 A;  4OR5 B;  4BY7 X;  4JX5 A;  1H1S B;  1D3U B;  5HBH B;  4IMY B;  4EOJ B;  2DPP B;  1QLB A;  2CZ7 B;  1BU2 A;  1VOL A;  3A8H B;  4HNV A;  2I40 B;  5CYI B;  1URC B;  4AKI A;  3VKH A;  2BS2 A;  4HNT A;  2IVX A;  2W2H A;  3GTM S;  1OL1 B;  5LMK B;  4BCJ B;  1QMZ B;  4BCN B;  1IRE B;  3DDP B;  4JX6 A;  2DXC B;  4BBR M;  2F2C A;  2QDY B;  3HHT B;  1OIU B;  5HBE B;  4F7J B;  2UZB B;  2ZPE B;  2UZE B;  4EOM B;  2IW8 B;  1GY3 B;  4BCH B;  4CFW B;  1H1P B;  4HLQ A;  1N4M A;  3HB9 A;  3QYE A;  1UNG D;  4ZGJ B;  4HL4 A;  2CZ6 B;  3X24 B;  3BG9 A;  4MIM A;  4EON B;  2C5O B;  3A8M B;  1OL2 B;  3DDQ B;  3DOG B;  3QYH B;  2R7G A;  4F70 B;  3QHR B;  4KRD B;  3LQ5 B;  3QHW B;  2EUF A;  1JOW A;  4TTH A;  4FM4 B;  4MFD A;  3BHT B;  1PKD B;  4YOO A;  2C5N B;  4EOI B;  4OGR B;  4EOK B;  3BG3 A;  1F5Q B;  5DQV A;  1V29 B;  4II5 B;  5LQF B;  4CFN B;  1TD6 A;  4OB2 B;  1KXU A;  4EOS B;  4CFU D;  3O0G D;  2CCI B;  5ICP B;  4CFU B;  4BCI B;  4BBS M;  3QZ5 B;  1OIY B;  1OKV B;  3WVE B;  4BCO B;  3TN8 B;  2ZCF B;  4YOS A;  2BS4 A;  4AKG A;  2C5V B;  5FGK B;  4ZGE B;  2WXV B;  1FIN B;  2W96 A;  5EJC A;  4YOZ A;  4CFV B;  3POM A;  1H24 B;  2QQ8 A;  3PO3 S;  4F7L B;  2LW4 A;  5HVY B;  5IDP B;  1VYW B;  2WJ9 A;  3BHV B;  5HBJ B;  3A8O B;  4ELL A;  4EOP B;  1JSU B;  1UNL D;  5CEI B;  2BS3 A;  5L2W B;  1FVV B;  4F7S B;  3NDQ A;  1JST B;  4EOL B;  2G9X B;  1W98 B;  2JGZ B;  1OKW B;  2WMB B;  5I5Z B;  5HNB B;  2CZ1 B;  5ACB A;  2PK2 A;  4AI6 A;  2BKZ B;  3TW6 A;  1FKM A;  5IF1 B;  4JX4 A;  2ZPH B;  4ROE A;  2ZZD B;  3BHU B;  1TFB A;  4BY1 X;  2QDJ A;  1JKW A;  1UGR B; 
#chains in the Genus database with same CATH homology
 1C9B A;  4II5 B;  4G6L B;  3BLH B;  5LQF B;  4CFN B;  4F7N B;  1KXU A;  4OR5 B;  2PHG A;  4EOS B;  4CFU D;  1H26 B;  3O0G D;  1H1S B;  1OI9 B;  2CCI B;  1G3N C;  5ICP B;  5HBH B;  4IMY B;  1D3U B;  2PK9 B;  4EOJ B;  4CFU B;  4BCI B;  2W9Z A;  3G33 B;  1AIS B;  2CJM B;  3MIA B;  1BU2 A;  4UN0 A;  1AD6 A;  4BCF B;  4EC8 B;  5BNJ B;  1OIY B;  1VOL A;  4ELJ A;  1O9K B;  1OKV B;  2I40 B;  2W9F A;  1XO2 A;  2BPM B;  5CYI B;  1URC B;  3RGF B;  4BCO B;  4EOR B;  3M03 A;  3TN8 B;  1VIN A;  2IVX A;  2CCH B;  3TNI B;  4ROD A;  3TNH B;  2W99 A;  3EOC B;  3EID B;  2WPA B;  4YOS A;  2W2H A;  2UZL B;  1OL1 B;  2C5V B;  5FGK B;  5LMK B;  4BCJ B;  1QMZ B;  1GUX A;  4BCN B;  2WXV B;  1FIN B;  2C5X B;  3DDP B;  2PMI B;  2W96 A;  1P5E B;  2I53 A;  2WMA B;  4Y72 B;  4YOZ A;  2C6T B;  4YC3 B;  2F2C A;  1GH6 B;  1OIU B;  2C4G B;  4CFV B;  4EOO B;  5HBE B;  4BCK B;  4F7J B;  2UZB B;  3POM A;  2UZE B;  4EOM B;  1H24 B;  3EJ1 B;  4F7L B;  2IW8 B;  1OGU B;  4F6S B;  1GY3 B;  3BLQ B;  3MI9 B;  3MY5 B;  5HVY B;  2WHB B;  4BCH B;  4CFW B;  1H1P B;  3F5X B;  4FX3 B;  3TNW B;  4CXA B;  1VYW B;  4CFX B;  5IDP B;  3BHV B;  1H4L D;  1N4M A;  4ROC A;  2UZD B;  5HBJ B;  4EC9 B;  5IDN B;  5EFQ B;  4ELL A;  2UUE B;  1UNG D;  4EOP B;  1JSU B;  4BCQ D;  3MY1 B;  1UNL D;  5CEI B;  4EON B;  4BCM D;  5L2W B;  2C5O B;  2B9R A;  1FVV B;  1OL2 B;  1H27 B;  4I3Z B;  4BCQ B;  4F6U B;  4F7S B;  4BCM B;  1O9K A;  3DDQ B;  1JST B;  4CRL B;  2IW9 B;  4F6W B;  4BCP B;  2IW6 B;  4NST B;  3H4C A;  4EOL B;  2G9X B;  1W98 B;  3DOG B;  2JGZ B;  2WEV B;  1OKW B;  2R7G A;  1UNH D;  4F70 B;  2V22 B;  2WMB B;  3QHR B;  5I5Z B;  1ZP2 A;  5HNB B;  1H28 B;  4KRD B;  1GUX B;  4BCG B;  3LQ5 B;  3QHW B;  5HQ0 B;  4CFM B;  2EUF A;  4EOQ B;  1JOW A;  4KRC B;  4TTH A;  5ACB A;  2PK2 A;  1H25 B;  3BHT B;  1PKD B;  4YOO A;  2C5N B;  2X1N B;  1H1R B;  2WFY B;  2BKZ B;  4EOI B;  4OGR B;  3K7A M;  5IF1 B;  4ROE A;  4EOK B;  3BHU B;  1TFB A;  3BLR B;  2QDJ A;  1H1Q B;  2WIH B;  1E9H B;  1JKW A;  1F5Q B;  2WIP B;  4BCN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...