1AD6A

Domain a of human retinoblastoma tumor suppressor
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
185
structure length
185
Chain Sequence
b'VMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RETINOBLASTOMA TUMOR SUPPRESSOR
publication title Structural similarity between the pocket region of retinoblastoma tumour suppressor and the cyclin-box.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
total genus 70
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 1997-02-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1ad6A00
1O9KA 1XO2A 2IW6B 3RGFB 1VOLA 4YOSA 4IMYB 1GH6B 4EOLB 4EOPB 3BLRB 2F2CA 1H1PB 4BCHB 2WEVB 4EORB 3M03A 3MY5B 4BCKB 4F70B 1G3NC 5LQFB 1JOWA 4CXAB 1JSTB 3F5XB 1H27B 4ROCA 1VINA 2C5XB 4BCJB 1OIUB 2WIHB 2CJMB 1UNLD 5IDPB 3DDQB 2BPMB 2CCHB 1C9BA 2C5NB 2PK9B 4CFVB 4BCQD 4UN0A 1TFBA 5ICPB 1UNHD 4CFUD 3BLQB 4BCOB 1OIYB 2UZDB 4EC9B 1F5QB 2WPAB 3POMA 4EOKB 4BCND 3O0GD 2G9XB 1E9HB 4EC8B 4ROEA 2QDJA 4F7LB 1H26B 1O9KB 4YC3B 2PK2A 5HNBB 5HVYB 1D3UB 2WIPB 5HBHB 3TNWB 3MY1B 2I40B 4F7SB 5L2WB 4BCIB 3QHWB 2B9RA 1H28B 2C5OB 2WMAB 1FVVB 2PMIB 3K7AM 4EOJB 1OGUB 2W99A 3LQ5B 5BNJB 1OKVB 4EOSB 5CYIB 4FX3B 4F7NB 2EUFA 3BHUB 4CFXB 4BCNB 1UNGD 4NSTB 2IW9B 1JSUB 2R7GA 4KRDB 4BCGB 4CFWB 1ZP2A 4EOOB 4II5B 4ELJA 3TNIB 2JGZB 1H4LD 2W9FA 4TTHA 4BCMD 4YOOA 3BLHB 1JKWA 3EOCB 1H24B 1H25B 3DDPB 2UZEB 3TN8B 2WXVB 3BHVB 1BU2A 1OI9B 2BKZB 5HBJB 4Y72B 2IW8B 2C5VB 4CFMB 1KXUA 2W9ZA 4ELLA 4F7JB 4BCQB 3EJ1B 4F6UB 1FINB 4CFUB 1H1RB 3G33B 2UZBB 2WMBB 5IF1B 5FGKB 4RODA 1QMZB 2W2HA 4KRCB 1H1QB 3TNHB 5HBEB 2PHGA 3EIDB 1URCB 4OGRB 4OR5B 3QHRB 2C4GB 5I5ZB 4BCFB 1N4MA 4EOQB 2I53A 4F6SB 1P5EB 4EOMB 5CEIB 1OKWB 2WHBB 4EONB 1VYWB 2WFYB 5EFQB 5LMKB 2C6TB 3MI9B 4CFNB 2UZLB 1OL1B 3MIAB 4CRLB 2W96A 1AD6A 4BCPB 2V22B 2IVXA 1GUXA 4G6LB 1GY3B 1GUXB 2UUEB 5ACBA 3DOGB 3BHTB 4EOIB 1W98B 1PKDB 1AISB 1OL2B 3H4CA 4BCMB 5HQ0B 1H1SB 5IDNB 4YOZA 2X1NB 2CCIB 4I3ZB 4F6WB
chains in the Genus database with same CATH superfamily
2CZ6B 2IW6B 4IMYB 2BS3A 4EORB 3MY5B 3VYGB 4BCKB 4AI6A 4BCJB 1UNLD 3DDQB 4OB2B 2CCHB 4FM4B 2WJ9A 1F5QB 2WPAB 5HNBB 3KHIA 5HBHB 3TW6A 4M6VA 5L2WB 3QHWB 2C5OB 4EOJB 4BY7X 3LQ5B 4Z6YA 1OKVB 2BS2A 3QZ9B 3B57A 3QYGB 1JSUB 4KRDB 4EOOB 3TNIB 3HHTB 4HLQA 2IN3A 1H4LD 2W9FA 4TTHA 4BCMD 3HB9A 3A8OB 3QZ5B 2KR6A 4BXXX 4MFDA 2ZPFB 3DDPB 2PJQA 3NDQA 1BU2A 3DL1A 4HNTA 4CFMB 4F7JB 3EJ1B 4F6UB 4HNUA 4NC6A 5DQVA 1FKMA 4ZGJB 1H1QB 3TNHB 2KMGA 2ZZDB 2AHJB 1URCB 2QGSA 4OGRB 4OR5B 5I5ZB 1N4MA 1OKWB 4EONB 5EFQB 1UGQB 4CRLB 1OL1B 3MIAB 1AD6A 5ACBA 1ENWA 1W98B 2CZ0B 5IDNB 1V29B 1UGSB 1XO2A 1VOLA 4EOLB 1H1PB 1H27B 4ROCA 2DPPB 3A8HB 1C9BA 4CFVB 4BCQD 1UNHD 4CFUD 1OIYB 3O0GD 3GTMS 4F7LB 4YC3B 2PK2A 3MY1B 2ZPGB 4BCIB 1H28B 3QWLA 3K7AM 2W99A 5BNJB 4EOSB 4F7NB 2ZPIB 1UNGD 4ELJA 4II5B 2ZCFB 4AKGA 3BLHB 1JKWA 2BKZB 4Y72B 2C5VB 4ELLA 2DXBB 1FINB 2WMBB 2DXCB 2CZ7B 2W2HA 3HZJA 4F6SB 1AHJB 3VYHB 2QQ8A 4MFEA 3MI9B 4OB0B 2UZLB 2W96A 4BCPB 4QSHA 3TW7A 1UGRB 3DOGB 2ZPHB 4ZGEB 1AISB 2BS4A 1H1SB 4YOZA 2D0QB 1O9KA 3RGFB 1GH6B 4HNVA 1G3NC 4LOCA 5LQFB 1JSTB 3F5XB 2C5XB 1OIUB 2CJMB 3X28B 4UN0A 5ICPB 3BLQB 2UZDB 3POMA 4BCND 2QF7A 4ROEA 1O9KB 1D3UB 4BY1X 2WIPB 3TNWB 2I40B 4OB3B 2B9RA 4AKIA 4BBRM 1E7PA 2CZ1B 5CYIB 3BHUB 2DMEA 4NSTB 2R7GA 4BCGB 4MIMA 3PO3S 4YOOA 3EOCB 1H24B 2UZEB 1OI9B 5HBJB 3HO8A 3VKGA 2IW8B 2ZPBB 3BG9A 3BG3A 1H1RB 3G33B 2UZBB 5IF1B 5FGKB 4RODA 1QMZB 3DTOA 5HBEB 3EIDB 3A8GB 2C4GB 2ZPEB 4EOQB 2I53A 1P5EB 4BBSM 5CEIB 2WHBB 4OB1B 2QDYB 1VYWB 2WFYB 4JX4A 2C6TB 4CFNB 2IVXA 1GUXB 2UUEB 3A8MB 4ZGDB 4EOIB 1OL2B 3H4CA 4HL4A 4BCMB 5HQ0B 2X1NB 5IHYA 4I3ZB 4F6WB 4YOSA 4EOPB 3BLRB 2F2CA 4BCHB 2WEVB 1TD6A 3M03A 4F70B 1JOWA 4CXAB 3HBLA 1VINA 2WIHB 5IDPB 2LW4A 2BPMB 2CYZB 2C5NB 2PK9B 1TFBA 4BCOB 4EC9B 1IREB 4EOKB 3X20B 2G9XB 1E9HB 4EC8B 2QDJA 5HVYB 1H26B 4F7SB 2WMAB 1FVVB 2DD5B 1UGPB 2PMIB 1OGUB 4FX3B 2EUFA 4CFXB 4BCNB 3QYHB 2IW9B 4CFWB 1ZP2A 3A8LB 3X24B 2JGZB 3DJBA 2G77A 1H25B 3TN8B 2WXVB 3BHVB 3QYEA 3X25B 3WVDB 1KXUA 2QFZA 2W9ZA 1QLBA 4BCQB 3QYBA 4CFUB 3X26B 4KRCB 2PHGA 3QHRB 3VKHA 4BCFB 3QXEB 4EOMB 5LMKB 2DD4B 3BG5A 3WVEB 2V22B 1GUXA 4G6LB 4JX5A 1GY3B 4JX6A 5DQWA 3BHTB 1PKDB 5EJCA 2CCIB 4AKHA
chains in the Genus database with same CATH topology
1O9KA 1XO2A 2IW6B 3RGFB 1VOLA 4YOSA 4IMYB 1GH6B 4EOLB 4EOPB 3BLRB 2F2CA 1H1PB 4BCHB 2WEVB 4EORB 3M03A 3MY5B 4BCKB 4F70B 1G3NC 5LQFB 1JOWA 4CXAB 1JSTB 3F5XB 1H27B 4ROCA 1VINA 2C5XB 4BCJB 1OIUB 2WIHB 2CJMB 1UNLD 5IDPB 3DDQB 2BPMB 2CCHB 1C9BA 2C5NB 2PK9B 4CFVB 4BCQD 4UN0A 1TFBA 5ICPB 1UNHD 4CFUD 3BLQB 4BCOB 1OIYB 2UZDB 4EC9B 1F5QB 2WPAB 3POMA 4EOKB 4BCND 3O0GD 2G9XB 1E9HB 4EC8B 4ROEA 2QDJA 4F7LB 1H26B 1O9KB 4YC3B 2PK2A 5HNBB 5HVYB 1D3UB 2WIPB 5HBHB 3TNWB 3MY1B 2I40B 4F7SB 5L2WB 4BCIB 3QHWB 2B9RA 1H28B 2C5OB 2WMAB 1FVVB 2PMIB 3K7AM 4EOJB 1OGUB 2W99A 3LQ5B 5BNJB 1OKVB 4EOSB 5CYIB 4FX3B 4F7NB 2EUFA 3BHUB 4CFXB 4BCNB 1UNGD 4NSTB 2IW9B 1JSUB 2R7GA 4KRDB 4BCGB 4CFWB 1ZP2A 4EOOB 4II5B 4ELJA 3TNIB 2JGZB 1H4LD 2W9FA 4TTHA 4BCMD 4YOOA 3BLHB 1JKWA 3EOCB 1H24B 1H25B 3DDPB 2UZEB 3TN8B 2WXVB 3BHVB 1BU2A 1OI9B 2BKZB 5HBJB 4Y72B 2IW8B 2C5VB 4CFMB 1KXUA 2W9ZA 4ELLA 4F7JB 4BCQB 3EJ1B 4F6UB 1FINB 4CFUB 1H1RB 3G33B 2UZBB 2WMBB 5IF1B 5FGKB 4RODA 1QMZB 2W2HA 4KRCB 1H1QB 3TNHB 5HBEB 2PHGA 3EIDB 1URCB 4OGRB 4OR5B 3QHRB 2C4GB 5I5ZB 4BCFB 1N4MA 4EOQB 2I53A 4F6SB 1P5EB 4EOMB 5CEIB 1OKWB 2WHBB 4EONB 1VYWB 2WFYB 5EFQB 5LMKB 2C6TB 3MI9B 4CFNB 2UZLB 1OL1B 3MIAB 4CRLB 2W96A 1AD6A 4BCPB 2V22B 2IVXA 1GUXA 4G6LB 1GY3B 1GUXB 2UUEB 5ACBA 3DOGB 3BHTB 4EOIB 1W98B 1PKDB 1AISB 1OL2B 3H4CA 4BCMB 5HQ0B 1H1SB 5IDNB 4YOZA 2X1NB 2CCIB 4I3ZB 4F6WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O9K A;  1XO2 A;  2IW6 B;  3RGF B;  1VOL A;  4YOS A;  4IMY B;  1GH6 B;  4EOL B;  4EOP B;  3BLR B;  2F2C A;  1H1P B;  4BCH B;  2WEV B;  4EOR B;  3M03 A;  3MY5 B;  4BCK B;  4F70 B;  1G3N C;  5LQF B;  1JOW A;  4CXA B;  1JST B;  3F5X B;  1H27 B;  4ROC A;  1VIN A;  2C5X B;  4BCJ B;  1OIU B;  2WIH B;  2CJM B;  1UNL D;  5IDP B;  3DDQ B;  2BPM B;  2CCH B;  1C9B A;  2C5N B;  2PK9 B;  4CFV B;  4BCQ D;  4UN0 A;  1TFB A;  5ICP B;  1UNH D;  4CFU D;  3BLQ B;  4BCO B;  1OIY B;  2UZD B;  4EC9 B;  1F5Q B;  2WPA B;  3POM A;  4EOK B;  4BCN D;  3O0G D;  2G9X B;  1E9H B;  4EC8 B;  4ROE A;  2QDJ A;  4F7L B;  1H26 B;  1O9K B;  4YC3 B;  2PK2 A;  5HNB B;  5HVY B;  1D3U B;  2WIP B;  5HBH B;  3TNW B;  3MY1 B;  2I40 B;  4F7S B;  5L2W B;  4BCI B;  3QHW B;  2B9R A;  1H28 B;  2C5O B;  2WMA B;  1FVV B;  2PMI B;  3K7A M;  4EOJ B;  1OGU B;  2W99 A;  3LQ5 B;  5BNJ B;  1OKV B;  4EOS B;  5CYI B;  4FX3 B;  4F7N B;  2EUF A;  3BHU B;  4CFX B;  4BCN B;  1UNG D;  4NST B;  2IW9 B;  1JSU B;  2R7G A;  4KRD B;  4BCG B;  4CFW B;  1ZP2 A;  4EOO B;  4II5 B;  4ELJ A;  3TNI B;  2JGZ B;  1H4L D;  2W9F A;  4TTH A;  4BCM D;  4YOO A;  3BLH B;  1JKW A;  3EOC B;  1H24 B;  1H25 B;  3DDP B;  2UZE B;  3TN8 B;  2WXV B;  3BHV B;  1BU2 A;  1OI9 B;  2BKZ B;  5HBJ B;  4Y72 B;  2IW8 B;  2C5V B;  4CFM B;  1KXU A;  2W9Z A;  4ELL A;  4F7J B;  4BCQ B;  3EJ1 B;  4F6U B;  1FIN B;  4CFU B;  1H1R B;  3G33 B;  2UZB B;  2WMB B;  5IF1 B;  5FGK B;  4ROD A;  1QMZ B;  2W2H A;  4KRC B;  1H1Q B;  3TNH B;  5HBE B;  2PHG A;  3EID B;  1URC B;  4OGR B;  4OR5 B;  3QHR B;  2C4G B;  5I5Z B;  4BCF B;  1N4M A;  4EOQ B;  2I53 A;  4F6S B;  1P5E B;  4EOM B;  5CEI B;  1OKW B;  2WHB B;  4EON B;  1VYW B;  2WFY B;  5EFQ B;  5LMK B;  2C6T B;  3MI9 B;  4CFN B;  2UZL B;  1OL1 B;  3MIA B;  4CRL B;  2W96 A;  1AD6 A;  4BCP B;  2V22 B;  2IVX A;  1GUX A;  4G6L B;  1GY3 B;  1GUX B;  2UUE B;  5ACB A;  3DOG B;  3BHT B;  4EOI B;  1W98 B;  1PKD B;  1AIS B;  1OL2 B;  3H4C A;  4BCM B;  5HQ0 B;  1H1S B;  5IDN B;  4YOZ A;  2X1N B;  2CCI B;  4I3Z B;  4F6W B; 
#chains in the Genus database with same CATH topology
 2CZ6 B;  2IW6 B;  4IMY B;  2BS3 A;  4EOR B;  3MY5 B;  3VYG B;  4BCK B;  4AI6 A;  4BCJ B;  1UNL D;  3DDQ B;  4OB2 B;  2CCH B;  4FM4 B;  2WJ9 A;  1F5Q B;  2WPA B;  5HNB B;  3KHI A;  5HBH B;  3TW6 A;  4M6V A;  5L2W B;  3QHW B;  2C5O B;  4EOJ B;  4BY7 X;  3LQ5 B;  4Z6Y A;  1OKV B;  2BS2 A;  3QZ9 B;  3B57 A;  3QYG B;  1JSU B;  4KRD B;  4EOO B;  3TNI B;  3HHT B;  4HLQ A;  2IN3 A;  1H4L D;  2W9F A;  4TTH A;  4BCM D;  3HB9 A;  3A8O B;  3QZ5 B;  2KR6 A;  4BXX X;  4MFD A;  2ZPF B;  3DDP B;  2PJQ A;  3NDQ A;  1BU2 A;  3DL1 A;  4HNT A;  4CFM B;  4F7J B;  3EJ1 B;  4F6U B;  4HNU A;  4NC6 A;  5DQV A;  1FKM A;  4ZGJ B;  1H1Q B;  3TNH B;  2KMG A;  2ZZD B;  2AHJ B;  1URC B;  2QGS A;  4OGR B;  4OR5 B;  5I5Z B;  1N4M A;  1OKW B;  4EON B;  5EFQ B;  1UGQ B;  4CRL B;  1OL1 B;  3MIA B;  1AD6 A;  5ACB A;  1ENW A;  1W98 B;  2CZ0 B;  5IDN B;  1V29 B;  1UGS B;  1XO2 A;  1VOL A;  4EOL B;  1H1P B;  1H27 B;  4ROC A;  2DPP B;  3A8H B;  1C9B A;  4CFV B;  4BCQ D;  1UNH D;  4CFU D;  1OIY B;  3O0G D;  3GTM S;  4F7L B;  4YC3 B;  2PK2 A;  3MY1 B;  2ZPG B;  4BCI B;  1H28 B;  3QWL A;  3K7A M;  2W99 A;  5BNJ B;  4EOS B;  4F7N B;  2ZPI B;  1UNG D;  4ELJ A;  4II5 B;  2ZCF B;  4AKG A;  3BLH B;  1JKW A;  2BKZ B;  4Y72 B;  2C5V B;  4ELL A;  2DXB B;  1FIN B;  2WMB B;  2DXC B;  2CZ7 B;  2W2H A;  3HZJ A;  4F6S B;  1AHJ B;  3VYH B;  2QQ8 A;  4MFE A;  3MI9 B;  4OB0 B;  2UZL B;  2W96 A;  4BCP B;  4QSH A;  3TW7 A;  1UGR B;  3DOG B;  2ZPH B;  4ZGE B;  1AIS B;  2BS4 A;  1H1S B;  4YOZ A;  2D0Q B;  1O9K A;  3RGF B;  1GH6 B;  4HNV A;  1G3N C;  4LOC A;  5LQF B;  1JST B;  3F5X B;  2C5X B;  1OIU B;  2CJM B;  3X28 B;  4UN0 A;  5ICP B;  3BLQ B;  2UZD B;  3POM A;  4BCN D;  2QF7 A;  4ROE A;  1O9K B;  1D3U B;  4BY1 X;  2WIP B;  3TNW B;  2I40 B;  4OB3 B;  2B9R A;  4AKI A;  4BBR M;  1E7P A;  2CZ1 B;  5CYI B;  3BHU B;  2DME A;  4NST B;  2R7G A;  4BCG B;  4MIM A;  3PO3 S;  4YOO A;  3EOC B;  1H24 B;  2UZE B;  1OI9 B;  5HBJ B;  3HO8 A;  3VKG A;  2IW8 B;  2ZPB B;  3BG9 A;  3BG3 A;  1H1R B;  3G33 B;  2UZB B;  5IF1 B;  5FGK B;  4ROD A;  1QMZ B;  3DTO A;  5HBE B;  3EID B;  3A8G B;  2C4G B;  2ZPE B;  4EOQ B;  2I53 A;  1P5E B;  4BBS M;  5CEI B;  2WHB B;  4OB1 B;  2QDY B;  1VYW B;  2WFY B;  4JX4 A;  2C6T B;  4CFN B;  2IVX A;  1GUX B;  2UUE B;  3A8M B;  4ZGD B;  4EOI B;  1OL2 B;  3H4C A;  4HL4 A;  4BCM B;  5HQ0 B;  2X1N B;  5IHY A;  4I3Z B;  4F6W B;  4YOS A;  4EOP B;  3BLR B;  2F2C A;  4BCH B;  2WEV B;  1TD6 A;  3M03 A;  4F70 B;  1JOW A;  4CXA B;  3HBL A;  1VIN A;  2WIH B;  5IDP B;  2LW4 A;  2BPM B;  2CYZ B;  2C5N B;  2PK9 B;  1TFB A;  4BCO B;  4EC9 B;  1IRE B;  4EOK B;  3X20 B;  2G9X B;  1E9H B;  4EC8 B;  2QDJ A;  5HVY B;  1H26 B;  4F7S B;  2WMA B;  1FVV B;  2DD5 B;  1UGP B;  2PMI B;  1OGU B;  4FX3 B;  2EUF A;  4CFX B;  4BCN B;  3QYH B;  2IW9 B;  4CFW B;  1ZP2 A;  3A8L B;  3X24 B;  2JGZ B;  3DJB A;  2G77 A;  1H25 B;  3TN8 B;  2WXV B;  3BHV B;  3QYE A;  3X25 B;  3WVD B;  1KXU A;  2QFZ A;  2W9Z A;  1QLB A;  4BCQ B;  3QYB A;  4CFU B;  3X26 B;  4KRC B;  2PHG A;  3QHR B;  3VKH A;  4BCF B;  3QXE B;  4EOM B;  5LMK B;  2DD4 B;  3BG5 A;  3WVE B;  2V22 B;  1GUX A;  4G6L B;  4JX5 A;  1GY3 B;  4JX6 A;  5DQW A;  3BHT B;  1PKD B;  5EJC A;  2CCI B;  4AKH A; 
#chains in the Genus database with same CATH homology
 1O9K A;  1XO2 A;  2IW6 B;  3RGF B;  1VOL A;  4YOS A;  4IMY B;  1GH6 B;  4EOL B;  4EOP B;  3BLR B;  2F2C A;  1H1P B;  4BCH B;  2WEV B;  4EOR B;  3M03 A;  3MY5 B;  4BCK B;  4F70 B;  1G3N C;  5LQF B;  1JOW A;  4CXA B;  1JST B;  3F5X B;  1H27 B;  4ROC A;  1VIN A;  2C5X B;  4BCJ B;  1OIU B;  2WIH B;  2CJM B;  1UNL D;  5IDP B;  3DDQ B;  2BPM B;  2CCH B;  1C9B A;  2C5N B;  2PK9 B;  4CFV B;  4BCQ D;  4UN0 A;  1TFB A;  5ICP B;  1UNH D;  4CFU D;  3BLQ B;  4BCO B;  1OIY B;  2UZD B;  4EC9 B;  1F5Q B;  2WPA B;  3POM A;  4EOK B;  4BCN D;  3O0G D;  2G9X B;  1E9H B;  4EC8 B;  4ROE A;  2QDJ A;  4F7L B;  1H26 B;  1O9K B;  4YC3 B;  2PK2 A;  5HNB B;  5HVY B;  1D3U B;  2WIP B;  5HBH B;  3TNW B;  3MY1 B;  2I40 B;  4F7S B;  5L2W B;  4BCI B;  3QHW B;  2B9R A;  1H28 B;  2C5O B;  2WMA B;  1FVV B;  2PMI B;  3K7A M;  4EOJ B;  1OGU B;  2W99 A;  3LQ5 B;  5BNJ B;  1OKV B;  4EOS B;  5CYI B;  4FX3 B;  4F7N B;  2EUF A;  3BHU B;  4CFX B;  4BCN B;  1UNG D;  4NST B;  2IW9 B;  1JSU B;  2R7G A;  4KRD B;  4BCG B;  4CFW B;  1ZP2 A;  4EOO B;  4II5 B;  4ELJ A;  3TNI B;  2JGZ B;  1H4L D;  2W9F A;  4TTH A;  4BCM D;  4YOO A;  3BLH B;  1JKW A;  3EOC B;  1H24 B;  1H25 B;  3DDP B;  2UZE B;  3TN8 B;  2WXV B;  3BHV B;  1BU2 A;  1OI9 B;  2BKZ B;  5HBJ B;  4Y72 B;  2IW8 B;  2C5V B;  4CFM B;  1KXU A;  2W9Z A;  4ELL A;  4F7J B;  4BCQ B;  3EJ1 B;  4F6U B;  1FIN B;  4CFU B;  1H1R B;  3G33 B;  2UZB B;  2WMB B;  5IF1 B;  5FGK B;  4ROD A;  1QMZ B;  2W2H A;  4KRC B;  1H1Q B;  3TNH B;  5HBE B;  2PHG A;  3EID B;  1URC B;  4OGR B;  4OR5 B;  3QHR B;  2C4G B;  5I5Z B;  4BCF B;  1N4M A;  4EOQ B;  2I53 A;  4F6S B;  1P5E B;  4EOM B;  5CEI B;  1OKW B;  2WHB B;  4EON B;  1VYW B;  2WFY B;  5EFQ B;  5LMK B;  2C6T B;  3MI9 B;  4CFN B;  2UZL B;  1OL1 B;  3MIA B;  4CRL B;  2W96 A;  1AD6 A;  4BCP B;  2V22 B;  2IVX A;  1GUX A;  4G6L B;  1GY3 B;  1GUX B;  2UUE B;  5ACB A;  3DOG B;  3BHT B;  4EOI B;  1W98 B;  1PKD B;  1AIS B;  1OL2 B;  3H4C A;  4BCM B;  5HQ0 B;  1H1S B;  5IDN B;  4YOZ A;  2X1N B;  2CCI B;  4I3Z B;  4F6W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...