1ADQH

Crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
225
structure length
225
Chain Sequence
EVQLVESGGGLVQPGRSLRLSCVTSGFTFDDYAMHWVRQSPGKGLEWVSGISWNTGTIIYADSVKGRFIISRDNAKNSLYLQMNSLRVEDTALYYCAKTRSYVVAAEYYFHYWGQGILVTVSSGSASAPTLFPLVSCENSNPSSTVAVGCLAQDFLPDSITFSWKYKNNSDISSTRGFPSVLRGGKYAATSQVLLPSKDVMQGTNEHVVCKVQHPNGNKEKDVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human IgM rheumatoid factor Fab bound to its autoantigen IgG Fc reveals a novel topology of antibody-antigen interaction.
pubmed doi rcsb
molecule tags Complex (immunoglobulin/autoantigen)
molecule keywords IGG4 REA FC
total genus 35
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 1997-02-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1adqH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1adqH02
4BUHA 4PJBA 1P4LA 5CIPA 2DMKA 3L5XH 5E00A 3M8OH 2I5YL 1HIML 5C0AA 4LCWD 4U1SB 3BHBA 4TSCL 3TA3A 3NFPA 2B1HH 1AGCA 1XIWD 5H2BB 3ZL4L 2GEEA 3HR6A 2ZUQC 1HKLH 5GS1C 3W0WD 3K3QA 3V4UH 4JEGB 5D7JD 3U7YL 1DBML 1X7QB 3W2DL 1TVHA 3BI9X 4HUUA 1OF2B 3LS4H 2YXMA 3H3KA 2HT3C 1FJ1B 3BH8B 2O26U 1LO4L 4MVBC 5IVZA 4PLOB 1C5BL 2EC9T 3TNNA 3IYLW 5EORH 3L7FB 4O9HH 4PG2C 4JZJB 2FR4B 1IAMA 2EDDA 5CGYC 5MEQB 1KXTB 5J6GA 4NN7B 2VXTL 3DYPA 4WFGD 1YEHH 3AVEA 3VW3L 5I30H 4LNVA 3MOBH 4U6HB 1NCBH 1ZGLM 1FCCA 5F7KC 1KTDA 3HC4L 2K7PA 3DV6B 5D72H 5MEND 4M6MH 4PJDB 5IF0B 1SBSL 3QNZA 3FZUC 3KLHC 4BQBA 4ZNEA 2J2ZA 3AS3A 1FJ1A 5F7DB 3TZVC 5J56B 3ARPA 4JY5L 3MACH 3ZE0E 1IC7H 4M1DH 2R4RL 4J3WA 4WY7H 1KJ3H 3U4AA 4XPGL 2Q7YA 1U8JA 4QF1A 2EYSB 5T1KB 3V79C 5C0EB 2WP3O 1AXTL 4FXGB 2F9BT 3QB7C 4J12A 5IMOA 3UPAA 4NQVA 3C2AH 3BP5B 3QZWB 2ENYA 2AXGA 4LKCB 5JIIA 4F7PA 3VXSB 2VDLH 1CGUA 4ZXBD 4WUUD 1WIOA 1S7RB 3KYAA 5F9JB 1W0WA 4C55A 5DJ8A 2A83A 1UKTA 1VEMA 5HD8C 3EDDA 4RX4A 4FQJL 4TNWF 4HJ0D 1BBJB 4LQ1A 1WZ1H 1KJ3L 1UJ3C 4AEEA 2HVJA 5B4MC 5DD0L 4YFLF 1NAKH 4P9HC 5FHAH 1M7IA 1IFHL 2VUYA 2XQYG 5D96B 3VXRD 3VXUA 1NGZB 3HNTH 1KN4L 4Z6AT 1KFAL 2DF3A 4FQXD 5JZ7C 5FM8A 1HK6A 1BOGA 2C4FU 5D5ME 4NKDA 2VR9A 1I1AA 5GZNC 3QNZB 5JIHA 2AP2A 3VG0L 5JQ6L 2V17L 3EDFA 3U46A 3ULVF 2ZKHL 3THMH 4IOFD 2YRZA 1AQKL 5F70A 1KEMH 3CSYB 1IEBB 3UYRL 2EDQA 2FX9H 4RMVA 5EZJB 5GJTL 2R1XB 1F6FB 3PHQB 4MA3B 2EYSA 3MGTA 1M7DA 2BVOB 1JZ3A 5FA3A 3KXFA 4GRMA 1KTKE 2FECL 3TN0B 3QWRD 4YEFA 1QRNA 4ZTOH 3VH8A 4KTYA 4XNZC 1KEGH 4YZFF 3RAJH 2IBGA 5D1QC 4P99A 1VESA 3MYZA 3U0TB 3JSSA 4N0UE 5D70H 1OTSC 2P46B 3RI5F 4AH2B 1QZ1A 4KVNL 4LHUB 1PLGL 2P5WB 3TO4D 4ZAKC 2IBZX 3MYJA 3T0EB 4O00A 3GIZL 3BPCB 3ZKQD 4ZO8A 1A6AA 3K2MC 2BNUB 4OCLC 2B4CL 2VQUA 2YEZB 4U1LB 2A2QT 3QNXB 3MRCB 4H1LH 1MEXL 3BUYB 5D2LB 2Z8WC 2Q86B 4QKXB 4M48H 3BO8B 2QQNL 2NNAA 4MVBD 3ZE1F 4PJ7B 2HT2C 5KVMC 3KPMA 1XF5B 1FFNB 3V4PH 5HGHA 1AKJD 1RZKH 3ULVH 1DUZB 4JPKL 4OGAC 5EFIA 5DS8B 5GZOC 3UO1H 5EULV 4LLYB 3BD4A 1E6OL 1NGXA 2CIIB 1BM3L 2G9HB 3UTPD 2GJJA 2VISB 4X6BA 3TNMA 4XB7A 4OLYH 3FO1A 1C12B 4IS6A 1QD0A 4HV8B 1LP9F 4R6UA 3BT2L 5FYJU 5JXEA 1S9WA 4JN2A 3LZFL 1QO3A 2UWEE 3DIFB 4HGWA 3T08A 4XCCL 4D9LL 1A2YB 4XNMB 3IB4A 3NFPB 3BAEL 4I4WA 5H35A 1G7IA 3X12B 1N7MH 2QHRH 4ERSH 2I9TB 2V5RA 4G42B 5HHNA 4ONOA 4P23D 1OAXH 1LDPH 2F8OA 4JO3H 3B2VH 4FHBD 4HW6A 4JPKH 3MRHB 5DEGA 1UM4H 2RQ8A 4KXZH 4HS8L 2XTJD 3QXVA 3WHXB 5ABDE 5AYUH 4JFDD 1H8NA 1CGSH 1EVUA 4HIHA 1PKOA 2V5TA 3EYOA 4GUPB 2X4SA 2ZUVA 4G8FB 1KB5A 3H7LA 2XOTA 3MRNB 5DUBB 4ZD3H 1JVKA 4ZNCD 1SYVA 4K71B 1REIA 1U8PA 1WC7A 5C09B 3LMJH 1PQZA 2VDPL 2ICEB 4LSSL 5B3JF 4UNUA 2GTWB 5ENWA 3WIIH 3O3BB 1AR2A 2VL5B 1EJ6A 4GW4B 4EN3D 3AGVA 3D3VE 3Q5TA 2NY3B 4XP9H 3BZFB 1CICA 3VH8G 3C6LD 1KCSL 1U8MB 3GDBA 2HYMA 3S88H 3BIKA 3I50L 4KGLA 4LQFL 4P0DA 1RHFA 2E6JA 3VMOA 1IT9L 3JZ7A 1QLEL 3IDGA 4HHAA 5I66B 4J1UB 4FXKB 1TPXC 1IGCL 4I3SH 4FFWD 4LOUC 4MA7L 3CFBB 4PRAB 2HG5B 3BT2H 4XNXL 1BLNA 1N3NA 4XT1C 1XGYL 3VFVB 3GHEH 1MWAB 1CN4A 2R0ZH 3TA3D 2VRAA 2RR3A 2VSDA 3HR5A 3SOBH 3MA9H 3MLYH 5AYQA 2C4XA 5GS2D 4PJCF 3UTZA 4OZHE 2H6PB 3PE9A 3VFPA 5T1LD 3PGFL 4HKBB 3W81A 3FO2B 4L3CB 4P23A 3GO1L 2BX5A 4HUNB 4IOSD 5BS0D 3KPQA 3P9LA 4JQXA 4I3RH 5C0AB 1DVFA 4L4VD 2BRRH 3RU8L 1T03L 2NY5C 2W92A 1N64H 3O6KH 1GOFA 3QQ4B 5FK9B 2ILLA 1OL0A 3QHFH 3C5JB 4E0RB 5C92A 3DARA 4PJFE 1V7MH 1RZFL 2EC9U 1MFDL 2PR4L 2YXFA 1PLGH 2WWKO 1QFUH 1IJ9A 3U0TA 2FIRT 3R1GH 1OCWL 5I17A 2FATH 4C58B 3MRBA 5EZLA 5E8DH 2CXGA 2OTUB 3SBWC 1Q9KB 4MDIB 1WZLA 2PF6A 3VRJA 3QPXL 5CGTA 4M4RA 4PGDA 4K3EL 2R0LL 2AJZA 3SDCC 1XGRB 1YMMB 3B5GA 2DQTL 1LHZA 1T0PB 3L3GB 5ELIA 1I4FA 1IEAB 3QHZL 3EYUL 1INEH 3RY4A 5I75B 2M8XA 5SWSA 1N8ZA 2Z8VC 2FWOB 2E9IA 2HN7B 1C1EH 3HPJB 1KT2A 2D0GA 4GQ9L 4PV9A 1A7BA 1TZHA 1IAIL 2YPLB 4HEPG 2P5EE 1RUKH 3GMQB 1ADQL 2AQ1A 3O6FD 4Y4HB 5DF0A 5GRUL 1A9EB 4DFIA 4EOWH 2UZIH 1MI5B 5IGXH 1GGUA 4GW1A 1PX4A 4W6WB 1DBMH 4Z7NE 1XGPB 4EQ2A 1ZA6B 2P4AB 1WBZA 4G8GD 5DEFB 1QSFE 4LCWE 1KJ2B 3GMLA 1I8IA 4LLVA 4LSVH 1JRHH 2EYTA 5CILH 4XX1E 4ALAH 2F53A 4NQSB 2Z31D 4LFHG 4TQEH 1N6VA 5DD5L 2XT1B 5EUKB 2XTJC 1MI5D 2JCCF 1OAXL 1JTOA 3BWAA 4O2EA 1BECA 4IRSA 4X9HA 5KSUA 2XWJA 1A6ZA 3MROA 2VTFA 1Y18A 2BSED 4PJAA 1LE5A 3MUY1 2YHGA 1JGLH 1DLHA 1K8DA 4P46B 1TETH 5E5MB 1ULVA 2X1PA 1SY6L 2F5BL 4UBDC 3IDJB 3Q3GB 3RTQD 5BXFA 3L3JA 4NQEB 5J11B 3RQ3A 1QR1A 4J3XA 4H8WH 4ODVL 5E24E 4XP1L 5AZ2L 2HT4D 3AUVA 1KV3A 1I8KB 1EK3A 3OKDA 2YBRB 4HAFA 3TCLB 1YPZB 1RIUH 5JW3H 1JK8B 1YEFH 3DV6A 1QKZH 3U7AA 4PJCE 3QAZC 3SKMB 4DCQA 4R4ND 3BWUC 5D9SB 2F5AH 2HLFD 2J6EH 5FUOH 1EVTC 5HDOA 2X44D 3S5LG 1U9KA 4HKXA 1NJ9B 3BN3B 4OTXL 1Y6MR 1DQQB 1PZ5B 4X6FA 1JTPA 1KPVB 4L8SB 1E4KA 3DMMC 3RNQB 1YEFL 4L4VE 4GLRH 4RMTA 4XAKE 2F8VA 5E56A 3FQTB 3WLBB 3IF1B 1ITCA 3MXWL 4MNHB 1YN6A 3O11A 3QIBD 1MHEB 2B5IB 4IIQA 4PRID 4PJ8D 1NGWB 1INEL 3GSXA 4XCFL 4U6YA 4MHHG 5IHZB 1TZGH 4GJTB 4WY7L 1R0AL 3A0OA 5LJYH 4ONFL 4ZSOB 3DX9A 1JFQL 2ZOLA 2LE9A 3V0AC 5J89A 4ELMF 3PWJB 3HPLB 4LP4A 2UUDH 3ZT5A 3O2DA 5TQ0H 1N59B 2OYPA 3GIVB 5ITFA 1QVOB 1P4IH 3LN4A 1QFPA 4JDVA 2ED7A 3TPKA 2OXGA 1FLRL 4NN5C 3VXMB 4JKPH 3DO3A 1P7HL 5F9WB 3U30C 5DQ9B 1Q9WA 1FL5B 1HDMB 3HZMA 3IF1A 2QEJA 1P4BH 5MENE 1A3QA 1CGTA 3TJEH 4WCYH 4WFEE 2VMFA 3DXAB 4E5XB 3L3KA 2CJUH 1X4YA 2CGRL 4KMTH 1TZGL 5EO9B 1DLFL 3MCLH 2V2XB 3TYFA 4U6XB 5ANMA 1H15B 5IT2H 4HUXB 1I1CA 1DQQA 1ZLWH 1MELA 4G6KH 4QOKA 5TDNA 3GSNL 4YHML 2NY5H 4PJFA 1B9ZA 5E6IA 4GW5A 4X6DE 5JW5B 4LIQE 5I0DA 3SDXE 1E4XI 5IV2A 1WEJL 4JRYB 3DROB 4J3SA 1BREA 4OCWL 4A6YA 1U36A 4DGIH 5DJYB 3QUMA 3KPSB 3QDGE 1PFCA 4KMTL 1A0QH 1MVUA 3FQXB 5HPMA 4XPFL 3NCCB 4K2UH 4YDJA 5B8CA 5DMIL 5T1MB 5IIEB 2P24A 4GMTH 3AB0C 4HUKB 3PQYD 1HQ4A 3N1GC 4JFYB 5E2VH 1MAML 5DD6B 5C9KA 1J11A 4F7MA 2RHEA 3DVFA 4RISH 1TCMA 4F2MA 4JAMA 2R2HA 2H32H 1U8QB 3KJ6H 2WAHA 5I1JL 3JV0A 3WDIA 2MFNA 2HFTA 4QHKI 1YEJH 1CZ8H 3BD3A 1MFEL 3NH7L 2J5LC 3CXDL 5CD5C 3VFOB 3LPGA 1FCGA 4R0LB 3UJTH 1CLYH 1OW0C 1CF8H 3KPPB 2AVGA 3MRLA 4CJ0A 1S9YA 2A6JB 4TUOB 2VQTA 2D9QB 2PO6C 2F53D 1H5BC 3TH2T 1OSPH 3MJ7A 3HUJB 3QRGH 3VXOA 4ETQA 5CZXD 3B3IB 2V2TB 4LASL 4ZOEA 1JZ7A 1H3PL 1LO5A 1C08A 1HZHL 1GGYA 5TDPB 4PD4J 3S9DB 4KRMB 3DYMA 1A3LH 4H25A 3PWPB 4F58H 2L7UA 5A2IH 5HGAA 4YAQB 1D9KA 5CEYB 5HGDB 4OFYA 1KLFA 3EO0A 3MBXH 3JWOH 1KJVA 4RGNE 4Q6IA 4PJXE 4UOW1 3T4YA 1CK0L 3OSKA 4U7MA 4U7SA 1KJ2L 2Z91A 5C3LD 4JQVC 4G6AD 3HZKB 1NCCL 2X2YA 3OKEB 1RZIA 5E03A 1VEOA 2ITDB 4M3JA 4MWFA 5CZVH 3MBED 1QBML 1CTOA 2H32B 4F7EA 1KG0B 3GJEA 3BPNB 2BFVH 4GAYB 2A9MH 5TE7L 3LEVL 2X70B 3IDIB 3RUGB 4XCEA 5FA4B 4LSPH 3QO0A 2X89A 1UZ6E 4MA7H 4M8QB 4NC1E 5CHNB 4KJQD 3DO7A 1U8NA 2M26A 1DTUA 4IRZH 2Y1VA 4LMQI 1T1XB 1D9KC 2EDTA 4NNXA 2VLKD 5GGQH 2EDFA 2Q8AH 1PYWB 5E8PA 3NGBC 3SKOA 3KPOB 1NC2D 5FIEA 3VWJD 5EU3A 5J0BA 1U8PB 3UBXI 5DJ2B 2FCBA 4MD5A 1NEZG 2GFBB 4N90E 2JB6B 1MCRA 1ZVHA 2B7DT 3QEUB 4RGOL 3BGMA 4OCSL 4Y0GA 3HC0B 2H45A 2W60A 4PIRF 5EU6A 4OI7A 3T4AB 3V52H 4I0PB 2F8XC 3H6JA 3OHXB 4YHOH 2Q20A 3RWGA 1X5LA 3DHJA 1RIHH 2AV1B 5CP3A 4U1JB 1QFHA 3VWJB 3N50A 4TRPL 1IGJA 3O6LH 5A3ID 1NGPH 4TPRH 4Y2DD 1RUQH 2BSSB 4M1CC 4ZUTB 4OV5B 1J8HA 3MC0A 3V9FA 5MENA 2YD4A 2IEPA 3HI1B 3BZDA 2DWEA 3I9GH 3BP6B 1GPOH 2IPUK 3G5XB 1A1NB 3MRPB 4LPWA 1RPQA 1RZGB 2EYRA 5E2TL 1J87A 3HHRB 1J05A 4NNPL 1QFWL 3ARDA 2PNDA 3BE1H 4XP5H 4HIEB 1NFKA 1D6VH 3BKMH 1EUUA 4P9HH 5F7WC 1WWAX 4WDIB 4QYOA 1JGUL 2CLVA 4LBEA 4EVNA 2FD6L 1CE6B 4MD0B 4J2XA 5AWNH 4YZFE 1F3DJ 3C5JA 4E0RA 1GC1C 5EBWB 5H8DA 4NWUH 3K81A 5KG9A 1MQKH 1DDHB 1T4KB 1A7OH 4M5YH 4P2RB 4QRPA 1B0RB 1OT2A 3CH1B 4Y88A 2C1OB 3CVIH 1WFOA 3A6BH 4NZRH 4XPHL 2WUCH 3C60D 4RWHA 5SX5K 3VRJB 1I1YA 3Q6GL 1JI2A 4NNYA 3SDXB 3K7UA 3UJJL 5HGGS 4CGTA 4LF3A 1KPUB 2NY4D 5F8QC 3NFSH 3QRGL 3LEYH 1MJ7H 4DZBA 4XMLH 2VXUH 4F7CA 3KDMB 1DQML 2DBLH 1C08B 2B39A 3ZKXC 4Z95H 4FG6D 3ULUC 5D71L 4X4YB 3QXAA 3BEWA 1F42A 5IB2A 3PQYB 1OAZH 1K8DB 1MFDH 3MRRA 3Q6FA 4AEIL 3O2WH 2CIKB 4HFWA 1T1ZB 4OB5H 1DBAH 1KCUH 5I8KL 2DQJH 1KJVB 3PWVA 4JHWH 3CLEL 4R4FL 3U0WL 3ZKMC 1P2CB 4JRYE 1DVFC 3MCKA 4OCSH 3IKCA 4FQQB 4NQDD 2F53B 1I8KA 4Z7QE 4R7DA 4RAHA 1E28A 1KCVL 3WLWC 3GMLB 1K4DA 3BMVA 4DZ8A 1EEYB 1N3NB 4PJ5B 5C8JA 4JANA 1SVCP 5E94A 1CDJA 5I8EB 4L1DA 2R1WB 3SGJA 1M6OA 1NFIB 4NHCH 2W65A 2N4IA 3MRIA 4D0CB 2DWDB 4ENED 3AMLA 1G1YA 3X14A 4JFED 3MRKA 3G04A 3BPLB 1QSFD 3QH3A 3D85B 1TQBB 1LVEA 2FNBA 3ALPA 4OZHF 4HJJL 1FE8L 1FFQA 2MNUA 4QXTB 3FFCD 3BJLA 1G7HA 4KPHH 3LDBB 2CO6B 5GGUA 2I9TA 3KLSA 2AXGB 5DTFB 1C8PA 1I3GL 4NQVB 3BZ4A 4P2YA 1V3JA 5MI0B 2V7NB 4ELMA 4N68A 1L0XA 4YHOL 1QSFB 3P0VH 5F9AC 5LWYL 4JDZA 5JA8B 1CGYA 3QO1A 3C5ZB 4YDJB 4X6BB 4XVUC 3N1QC 1HWHB 4FQ1L 5IROC 1ZGLA 4GG6A 4TUJB 1CG9A 3HNSL 3QEQD 5IESL 3RL1B 3VG0H 5JQ6H 3IETA 2DIBA 3NBNA 1JI1A 1SEBA 4V1DB 1EBAA 1VFMA 4L9LA 1CK0H 2XWTB 3LH2H 3OWEA 4PTTB 2FGWL 5EO0A 1FN4A 1T5XA 4DGYH 4ELKA 4G42A 3VFUB 1UVQB 3LQZA 3SGEH 2DQHL 3P4OA 4ZFOB 1JHLH 1DN0B 4XC3L 2VDOH 3BD5A 3OKLA 2XFXA 3K0WA 1MCKA 1RD6A 3RX7A 1W0VB 5JORA 4JO4H 3MRBB 3EO1A 2O5XL 3MV9B 4U6XA 3JWDC 3EJYC 4PUBH 1JPTH 2GSIA 3FJTA 3HNSH 3D3VA 3VXTB 4KY1H 1EFXB 3P4MA 3MJGX 2FL5B 3RWFA 1P53A 3MLSL 5FKPA 3PGCB 3S35X 1FIEA 4S2SA 4JHAL 1U3YA 4K3HA 4X7TB 1FL3A 1EBPA 5EPMA 1LK2B 1M7DB 3TN0A 3PF2A 4WJ5A 2ED8A 2P1YA 1XF2A 3MJ9L 1NQBA 4MYWB 3GJFH 2PCPB 4PP2B 2CUIA 5KG9B 5DRNA 1FVCB 1BX2A 3RVXD 5F1KC 1ZK9A 3P4NB 1ODAA 3CC5B 2J4WH 1MRCL 4PJBF 1LWRA 2FH8A 2WQ8A 4R2GB 5DQJA 1IQDA 4J6RL 3S6CA 1MRFH 3LS5H 5E8EA 1OT1A 3CUPB 4XTRC 4FG6C 4J4PD 1YZZA 4ZDHA 5IVXA 2H1PH 1ACYL 4XC1L 3VRLF 2E6PA 4EDWH 2FJFA 2YBRA 1ETZB 4ODTH 4XMPH 3ARFB 3MREA 1ZVSB 2AEPL 3H9HB 5I0ZA 1OARH 4QRPD 4NDMB 2HTKD 3GKZA 1S7VB 1W0VA 5JORB 3NCYS 1W0WB 2BVTA 1IQWH 1UXSA 1OQOA 3CMOH 4A2MA 2Z31A 4ZAKA 4X6CB 5ICZA 1J0KA 2F54A 4WTZG 2K9UA 3L9RA 1PQZB 3RGHA 4NUJA 3ZYZA 4EDWL 5CLTA 1NGYB 4G6KL 3BQUD 1AQKH 1IM9A 4OZ4B 4K3DH 3M17B 2J8UF 2Y25A 4U4BA 3REWA 4BA8A 4BH7B 1G9EA 5F3BA 1LK3H 4H0HB 3ULSB 3VFNB 4UQ2A 4XCNB 1E4WH 2CKBA 1PKQA 5DHXB 1ES0A 2WBKA 2R1WA 3D5OF 5E94B 5GRJL 4KU1A 5HYJB 2AI0L 3QQ3B 1PBYA 5TE6L 3BRDA 3IT8D 3QUZD 4TN9A 1D5MB 1H3VA 3VGBA 5INDA 1A7NH 3PWVB 4OV6F 5C7XL 5DRWA 2OP4L 2JELH 1CFNA 1P2CA 1TXKA 4O4YH 2C4FT 5DA0B 2Z8SA 3M07A 4YFLI 2HFGH 5DUPH 5JOFA 3OJDA 4XCFH 1NEZA 3GHBL 2B4CH 2IH3B 4CMHB 1JZ2A 4MGXA 1NANI 1FRGH 4NO2B 2NY6B 3RWCB 3P30H 2R2CA 3LV3B 1CFBA 2NXZC 4F57H 5I8EA 3RWEB 1L9NA 3PL6C 3OTTA 1H0DA 4XPAH 1M7XA 2NTFA 4JFHE 1A6WL 2ARJA 4I18C 4DOHB 1HOCB 3UXFA 5E4EC 3RDTC 4NBYB 5I71C 1JPGA 5DZLA 5CGMA 3D48R 3QNXA 1Z0NA 3ZTNL 5JW4R 4RFNC 3MNZA 5JPNA 1IC5L 3GSWB 3ARGC 3H9ZA 1UJ3A 4EUPH 4S1SH 5BV7L 3QUYA 1K5NA 4P23B 4JY6A 1V3LA 4L8BB 1MY7A 1P9MC 3SDDD 3ARBC 4DKDC 1M71B 3NZHH 1DL7L 5I16B 5ILTL 1PY9A 5FYJD 5DDHB 1ZGLB 1NCWH 2YRPA 1AO7B 4YX2H 1I7RA 1IGFL 2VDPH 4LSSH 5TDOA 4WHYH 1EIBA 1A7RH 3RPIB 2V9RA 4OJFH 3CFBA 5IB1B 5EU3B 5B38A 1T1WA 4OLUL 5GRVK 5J13C 2EE3A 2VLRA 2CKBH 4FFYH 2YD3A 5SX4H 4YFDB 3TT1L 3KLHD 5HY9B 1RV6X 4J4PC 5KANI 4BFEA 1FO0A 4PJCB 3WIFB 1PG7X 1OW0A 1XEDA 2Y06L 1MRFL 4HH9B 3FO9B 2ICWB 4HKBA 1EX0A 1IGJB 3MLZL 4M93C 5B22A 4X7CC 2E7LA 2EYTB 1RUKL 3I6KA 4TTDD 2WIIA 4HMDA 3QDMA 4GXVL 4WV1B 4YHIA 2Y6SD 4HS3A 1J8HB 3IRZA 1TDQA 3QG6B 5D2NC 4OLUH 5FO8B 3SDAA 1JV5A 4EBQH 4G43B 4JFFA 5EU4B 5HHVH 1V05A 5F89B 3BUTA 3OKKA 4NN6C 1I7UB 2N7AA 3VI3E 3SO3B 5HYSG 4NQCA 1FO0B 2IH1A 2KKQA 2NXYB 5LKNA 4ODUB 1UQSA 3LRHA 3CVHH 3W9EB 2Z31B 2APVA 4RA3A 4R97C 1INQA 3X17A 4YXHH 3GRWA 3PABA 4GSDH 2H9GB 3O8XB 1QSEA 1R3LB 4GXVH 5B4MD 5D6DA 1B0GB 2DICA 1JGLL 3VFGL 3K1DA 1WJ3A 3S97C 2F19H 5EUKA 4OKVA 1QYGH 2JCCB 3VG9B 4U0RC 1W8OA 2X5PA 3MBXL 4WW2B 5SX4I 3WDJA 4C56B 5HYSB 1WTLA 1EAJA 3EHBC 1IAIM 3VGHA 1I7UA 4NZRL 4K9EH 1GL4B 3QQ9C 5IHUL 3TLRA 4EI5A 4G8GE 1RHHA 1RZJH 5DUMH 2VSCA 3UZVB 3IFOA 5EOCH 2P5WD 3QIUA 5ESVA 1IC1A 1UEYA 1HI6B 2ORBL 5MHSD 4KI5F 1J7VR 3KXFD 2VH5H 4NKQB 1JGDB 4N0CC 3WFDH 2QQKL 1I1YB 5K9QI 3MCKB 3B4NA 5D1ZB 3QCVH 3N1PC 2DTML 3V5DA 3OB8A 3ZTJG 2ZUWA 4GQ9H 4C4KO 1BD2A 1T5XB 3JV6B 4LGRB 2QSCH 4JHZA 1R24B 1Z2KA 5BZWB 4XNYH 1J0HA 3EYUH 4UMGA 4RDQF 4L3EA 1OTUC 5D7JA 4CL7A 2C3VB 3RWEA 3B83A 2XTJE 1Z3GL 1FO0H 1FVDA 3LQMA 1R5WB 2VL4A 3ZHKA 4QRSA 4G7VL 1N2RB 2ARJB 4TUOA 5JZ7D 2LVCA 4NOFA 4EOWL 3F6IA 4XVSL 3HUJA 3VXOB 3NTCL 1FG2B 3FQUB 8FABA 1LGVA 1A6VH 3GSQB 5KZCD 1T1YA 4LRIA 4DQOL 4E9LA 1BZ9A 2AQ3A 4RMRA 4PTUA 3MLXL 3BP6A 3ARBD 5DJ0A 3IVKA 2DBJA 1ADQA 2APBA 5FDYA 3CXHK 4FQCH 4PRNA 3EO0B 3PGFH 4LPXA 3GMRA 1DBKH 1E27B 3EFDH 3QWOA 4MAYC 3WBDA 1MCWW 3DX6B 3VU2A 2E3VA 3EOAA 1CDGA 1XCQA 5JXAH 3I6GB 1AQDA 1EXUB 5FKAB 1AO7A 4MNQE 4X6DF 3DUSA 5D1XA 4ETQB 1WC7B 2IBBA 4PJDE 4JJ5B 4XBPA 3FKUS 4V2BA 1NH6A 3CH8A 4X7SH 5FA3B 1T6VN 3AXLB 4K07A 1DEDA 3RRQA 4RFEB 5GGUB 4OLWL 1FYHB 4PRPE 1JTTA 4QEGA 4X6EB 3SGDH 5AG8A 1MF2H 3KPLA 4HPYL 1PSKL 1L4IA 4P2RD 1BFSA 1UWGH 2FJGB 2QSVA 4Z7VB 1F00I 2JJVA 5EH1A 2YUWA 3WO4B 1T1XA 1ZLVH 4KDTC 1P5VA 1F97A 3B9AA 3HG1E 3VWKB 5K59F 4UDTA 4XPGH 5D7KE 2O93L 1FZJA 4RNRB 3V4VL 4OGXH 4PJXB 1Z9LA 2R4RH 1S7SA 1EHAA 1C5BH 4QHUA 1VEPA 2EDRA 4M43L 1S5HA 3S3SA 4LRIC 2VH5L 5E6IC 4Y5YC 1KPRA 5BRZE 4O5LL 1T21A 3QDJE 1PKQB 3V6OC 3TYGL 3RWCA 3V7AG 3O3EB 4XP4L 1J5OL 1X5JA 2HP4A 4LLYA 3W11C 3OX8B 3WKMH 2XFXB 5GPRA 3NABH 3GMMA 2J7LA 1E4JA 2A83B 1ORQA 1ZEAH 3QXWA 4IRJC 2X4OB 4CVZB 4JN1H 3IDYC 12E8L 1WICA 2AABL 1I7ZB 4JGUA 3CGTA 3L95B 5D5MB 4LDEB 4NNXB 2XKNB 2NZIA 5H35B 5CJOH 1RUAL 2IANB 1NDMA 5E6IB 2YEZA 2MQ3A 1DBJH 4FXGA 2W9LA 1HHIA 2AW2A 3AREC 5F6IB 1U93A 2PCPA 4PP2A 4NDMA 3V8OA 2I9LB 2FB4L 3EYVA 4P4KD 3IFOB 5ESVB 4PJIE 3KPRB 3EZJB 5IVZB 3WXWH 4MCZB 3UTPE 4WRLA 2UY6A 4K8RL 3VD5A 2PYEE 1N0LA 5DJ6A 5AZ2H 4ESKA 1T04A 4PR5A 2NZ9D 3MLSH 1Q94B 3CUPA 4YXLH 3B2VL 4Z0BL 2MPAL 4F37K 1KPVA 3TA3B 4GG6F 1N59A 3QUZA 3JVGC 5E8OA 1N6QL 5KTEL 4P2OC 4X5LA 3SDYL 1A4KB 5FO7B 3TF7C 2IMMA 3ARBB 1T7YA 3GSWA 3ARDD 2XQYK 1YEKH 4YNYB 1K6QH 4LCIH 1ZOXA 3RWDA 2YUZA 4YAQA 2AK1L 4L4VB 4LU5H 4WGVB 4Y5YA 3RY6C 4XHQA 3SCMD 5SWZA 3MUZ1 2EZ0C 5DJ6B 3EYSH 4RFNB 5J1AB 4XWOC 2JCCE 1IGYB 3STLB 4BQCA 2L0DA 4YPGA 1MCHA 4Y2OA 5GGSY 3U1SL 3NABL 2X4SB 1G7JA 2CMRL 2IMNA 2PXYB 4JG0H 3JV5A 4MQ7B 3FFCE 4TNVK 4XPBL 1QPXA 3T2QA 4UTAH 1LP9B 4MD5B 5BS0A 4M4PA 1U3HB 3ULSA 2IH3A 3TPUB 3QI9B 3EFDL 5F9OH 3ARSA 3TBTA 3VGDA 4L8SC 5TH2B 5DJ0B 3IVKB 3CK0L 3QIWD 4NFCA 1KLUB 3WD5H 1JYNA 1JYVA 3U0PB 3B2UC 1I3RB 2OZ4H 3U79A 1MJ8H 4CRPA 1MJJB 4IRSD 5IM7A 4MD4A 4KRPB 5C0FB 3K2UL 4K9EL 1XGQA 2NR6C 4PJHF 4P2RE 1H15A 5FKAA 1AQDB 4OCRH 3B9DA 2W9DH 1LP9A 4O02L 4OD3H 1YN7B 2VQ1A 1FGVH 2AJUL 5DLMH 5DJ2A 3F62A 4JANB 4X6DB 4K23L 4MNGE 5KTEH 1G7QA 1FYTA 1RJLB 5DK2B 1QNZL 1K5NB 1U8KB 2PTTA 1X6LA 2G2RB 3X13B 3OKMA 4ZTPH 2AJZB 5EIVA 5DK0B 1VFBA 4LPVA 2HKFH 4EDXA 5I30L 1CU4L 3LD8C 2D2OA 1S9WB 5E6ID 3VFRB 2HVKB 4JFPB 4LCCA 1MCSA 1HWGB 3ZDYF 3BKJH 1PVHA 2O5YH 3JWDH 4ZFZB 2XTJB 1YC7A 4U0RB 5TF1H 2QBWA 3FQTA 5SV3A 3CDYA 3WJLA 2HRPL 5BV7H 5DMKB 1HCVA 1R3KB 5DT1H 4LGSB 2C3VA 3B9KD 2HLFC 4JY6B 5CJXC 2IPTH 4APQD 2Z31C 2FECI 4PV8B 2IQ9L 3E1F1 4M7LL 3CZFA 2NXYC 3IRPX 3HI6L 5D1ZA 1GCFA 4NN6B 1A6WH 1JGEA 2FBJH 3OAYH 4AQ1B 3T3MF 3V5HA 1CE6A 4Z7VF 3U7WH 3OG6B 2HRPH 2CRYA 5IB2B 4UBDD 1S5HB 5EBWA 3VH8B 5GGRY 4FQLL 3S7GA 2CQVA 3L5WB 3INUL 1C16A 1J05B 4WFHD 4LP5A 4MNQB 4KDVA 5CP3H 3SDXF 3N1MC 1KIPB 5BMFL 1NAMH 1X5ZA 4JG1L 3AU1A 1XCQB 1T2QL 1GZQB 2NCMA 1KPUA 3Q3GA 3HAEH 1D5BB 3VI4E 1IAOA 1PYWA 1UM4L 2MTPA 4WU5A 4R4NC 2NLJB 1SJXA 3NZ8A 1JNLL 3QI9D 1AY1H 4F58L 4LU5L 5DI8B 4GKNB 4NO5B 3L5XL 4WI5A 5C6WH 4HXAL 4R96B 3G6JB 3FO0L 1CL7I 4DCQB 3OKKB 4NQCB 4NZTH 3RWJA 1I7TB 3O45B 1D3CA 2H6PA 2CKNA 1A7QL 4FFYL 4Y16D 2X1WL 4FTVE 4P4KB 5IB3B 2FJGA 5JDSA 2FYYB 1N5YH 3TNMB 3TIDB 3DMMD 3WUWA 1T2QH 5IIEA 3F7YA 4YHZH 3ZT6A 5FB8A 1JRHI 3WE6A 3LKPA 4OZFG 1A1MA 1G7JB 4OLZL 4PJGE 4QXWA 3RIFF 4PJEE 4CMMA 4HUWA 3SKNA 1UACL 1WWWX 3H8NA 1TCRA 5E8PB 2ICES 4JFEA 5I1IH 4C56A 2BZDA 4PJ5A 3B2UD 4M6OH 4J8RA 1CXEA 1IAKB 1ZT4B 1KELH 1JWSA 5FECB 1T3FB 1KLUA 5E9DB 5I71B 3H9SE 4RISL 5E4EB 4F7TA 5MI0C 4QNPE 3QJHA 3M8OL 4LLMB 3OJVC 2BOBB 4X7FC 1AI1H 5ERWA 5C08A 1MREH 3OAZH 1ROWA 1E4XH 4X4MA 2D03H 5D6CB 2A6KA 3T0DA 3FFDA 4WDIA 2NY6C 3IJHB 4G9FB 5TDOB 2VLJE 1MCOH 2OMNA 2XIDA 1JRHL 1OGAD 3QUKB 5IESH 2HWZH 2Y07H 3RL2A 2ADGB 5HHOE 1U8LB 2H26A 3ECBB 3SDYH 5B39B 4TUKH 4WEBH 4V1DD 4HIIB 5JIKA 4U1MB 5ERWB 4KHTH 2UWEB 2AGJH 2QTEA 3OKYA 5MHSE 3FO9A 1LP9E 3QUXD 4E42B 4LCUB 2PO6D 3FN3A 4JFXB 4QLRA 1CDIA 1OAQL 4L29A 3CLFH 4M7JL 3KS0J 4L9LB 4I3SL 4TNWK 5EC1A 5GGSB 5IBUB 2CDFB 3C09B 4BJLA 2NY7H 5C0JA 4QCIB 2YS4A 5T1DL 1JK8A 3ZKSD 3V6BR 1NUFA 1QTYT 3MSPA 3N1FC 4Y5VB 4P46D 2IG2L 5EOCJ 5GRJH 5CILL 1FNAA 2ZCKL 3HC0A 3HRZB 5IW6A 2NXYD 2FX8H 1MVUB 4LSUH 2OM5A 4RWYL 3P40A 2Y7QA 4KAQH 4M5ZL 2R29H 5GRXG 3NACH 3X3GL 3JXAA 5MERA 1BJ8A 3QHTC 2Y23A 3N06B 4IJ3B 1SMAA 1Q72H 1XR8A 3PABB 5L8JB 1R5IA 4UDTB 2BP3A 2ZCHL 2FX7L 2HLAA 4P3WA 5IFAL 1CS6A 1JPSL 3TH4T 5CD3B 2XN9A 1HHHA 3H7BA 3TO2A 2YZ8A 1MQKL 4H5SA 4KDTA 4ISVA 4NHUA 5SV4A 2EKJA 5JPNB 4X6CE 1UT9A 5FYJL 4FQHB 4LHQB 3RGVD 5AWNL 1MCJA 1W72B 4LSRL 4KVCH 1I8MB 3QFJB 5I1AB 3SGDI 1QA9B 5L9DL 4FTVD 4YH6A 3SE3A 4G6MH 3VD9A 1HXMB 3W0WA 3C08H 4Z5RB 1E6JH 3VWJA 2I27N 2CSPA 5GS1A 4JM4L 4TVPD 1BBJA 2OL3H 2F54B 1HN1A 1FBIL 2A0LD 3F8UB 3UTQA 4JO2L 5D1QD 3MGTB 1IM3A 4GKOA 1FFOB 3I6LD 4D9RD 5ISZD 4R7DB 5GIRB 4G8EA 3ZMRA 3P11L 2W07A 5FF6B 5I1EH 2EECA 2E5EA 1IKNC 1BVKA 3QCUL 5CFHA 2B1AH 4JB9L 4ORGB 4YDVA 4OZIA 4X7SL 1WQVT 2XRAH 3FQWA 4PJ9A 2BSRA 7FABL 4GXUM 3TCXA 2A6IB 2CO7B 3IJYA 3IXAB 4PB0L 1EEZB 5C0AE 1MHEA 4ODSH 5K33A 4NRXA 1E6JL 4OI9A 2Q1EA 5AEAA 4G5ZH 2ZCLL 1F5WA 4ZOBA 3CJJA 1AD0A 1AHWA 3C6LB 3RBGA 2DMBA 1UEMA 3EFFA 3SCMA 2D3VA 5IMLA 2MHAA 4OGAD 4KI5C 5IVXB 1LQSR 4S1QH 3ZDZE 2WBJA 1I9JH 4P9HL 3TZVA 3U9PL 2E7CA 3R1GL 2ZUUA 3LKNA 3GSUB 4MQXD 3JVGA 4Y7MA 5ALBH 4DN3H 1XF5A 2FSEB 3PP3H 1W72H 5HGBB 4QRTA 1ZLUK 3RVWD 3TVMD 5IFJB 2FBOJ 2C7UB 4NKIH 3S4SG 4JPVH 1J0ZA 3BDYL 5CMAB 2G2RA 4QRQA 1YJDH 3BFOA 1T7VA 5J3HC 4YJZL 1KCSH 4DKAA 4HPOH 2A9ML 2IQAA 1F4HA 3RNQA 4OCNC 1HKFA 4L4JA 5MEQA 4F7CB 2OL3L 3UJJH 4H1LB 2O5ZH 2RGSA 4KRPC 4PGJA 4M6NH 4XRCA 4WEUD 2PTVA 4ZUVB 5LWYH 3QUKA 2GY7B 4ZYKB 1NEZB 4G7YH 4WO4D 1W0YT 5DJYA 4URTB 5KS9E 4I0CC 4JO1H 2ZUTA 5CMAA 1QSED 5BV7C 2VZTA 1U3HC 5MP6L 5CAYB 1KGCD 5KVGL 4KK6D 3ESUF 4N0UB 5MEPA 4MDJA 2WWMD 2BK8A 4Z95L 3VXQA 1AHWC 1DFBH 4G8IA 2IFFH 4P2QB 1ZHLA 5C07E 3GMOB 2BNQE 2DQHH 3KR3H 1S9KC 1TJGL 3WV0A 4LHUG 3BKJL 1P6AB 6CGTA 2CKBL 2AJXH 4DUXA 1QACA 3B43A 1KB9K 1MCQA 3UAJC 5AD0B 3ARDB 3QPQD 3EYFB 3IDGB 3U4BL 3MRLB 3O6FA 5E8EB 3HG1D 4XP1H 3RJQB 2YD5A 2DTMH 3TA3C 3HPLA 2HVKA 3DSNA 4JFPA 4NKOA 3SJVA 1H5BB 2J88H 3L9RB 3FB7A 1IBGH 5HHPB 3IDNA 3ZYOA 4WW1A 4OZ4A 4XZUA 4WHDA 5DR5H 5C7XH 3DROA 1CLOH 1A9BB 9CGTA 4OGYH 1E4KC 5ADPL 1CFVL 4S11A 2QL1A 4K7PH 5LG1A 3MV7E 1CL7L 1G7QB 4PJHE 4RAVA 5EG6C 2NY1D 1TTFA 2X4PA 4UUJB 5JXEC 4WI2A 4GW1B 1MCIA 4DVBA 4XVJL 4LSPL 5FB8B 4PJXF 4U49A 5HDQL 4UT6L 5I8OH 4WV1A 4YHIB 4ZPVB 3E8UL 3PGDA 3QEQB 4KUZH 5DDHA 3IFPA 5DZOA 3OJ2C 4P5TD 4WHTB 1XCTB 2VWEC 3PHOB 4WU7A 3V0WH 5FO9A 2FHFA 3M17A 3REWB 5IMKA 4AY0A 4Z78A 2DI9A 1SVZA 2I60H 2Q86A 3P4OB 4PTUB 2IFFL 3GZKA 4DUWA 2P7TA 2GQHA 4NQDA 4PJDA 2CIKA 3O8XD 3T3ME 3ARRA 1C5CL 2OTUA 1DVFD 5FA4A 4PY7A 1OGAA 1T22A 2Z92A 2E9JA 4EXPX 1C12A 4IS6B 4PRPA 4M6NL 4XVUD 2P5WA 2VISA 1EFXA 3P4MB 5D7LD 1BOYA 1T80A 4MXVE 1TJIL 1H3UA 3EO9L 4PR5B 4EI5D 3VFSB 4G7YL 1WT5C 1LO5B 3O6FC 4BELD 3L3DB 1JPST 3QQ4A 3ULUF 1A7PH 4QHUB 4NJAL 4MJ4A 3TBYA 1CD1B 3QDHA 4KFZC 1V3MA 1IGIH 4LVNB 3NCMA 2JJTC 1NBVL 2Z93B 4XNUL 4RIRB 2C7UA 2XZZA 2COQA 2AS5M 4LCYB 3U2SB 4I77H 4MMXC 3T2PA 4BK4A 1FDLH 1QLRA 3HE6A 3CC5A 2IC2A 4FQJH 4U1MA 3H3PH 2UWEA 5ACLA 3G04B 1HXYB 3G5ZB 5I2IA 2B2XH 1YPZF 4U1SA 4KRPD 3TBWB 5E8NB 2KUTA 4OZHB 5DC9B 4DAGH 4Z7VE 3S34H 3MRFB 4KTDH 2L7JA 3DETD 3MRNA 1LD9B 4KKAC 2APWA 3P30L 2IAMA 4I5BA 4M7ZC 1ZGLP 4I48A 4X9IA 5CEXB 1CD9B 3GHBH 5DTFA 3NGBB 2GJZB 1BFOA 2OI9B 4MA8L 4E41B 4N0FA 4ZXBA 2G5BA 2NX5A 1NL0L 2BOBA 2HT4C 4PY7B 2Q3AA 3OKNB 2Z35B 4XP6L 5TPWL 2E8YA 3D39E 5ICZB 4ZFGL 2ED9A 1WCBB 2A6DB 5BVJB 2ZUSA 5DD1L 1EUTA 4PJAE 2N56A 3UYPA 4OD2A 5ITBL 3LOWA 3NIFF 5FF6A 5C09A 5DFTA 4OAWB 4OM0H 1UFUA 2IANE 1KG0A 5D1QA 4I0PA 2MPAH 4U05A 5C2BL 5KVDH 2BCKB 1CLYL 1AJ7H 5EFIB 4OCWH 5GXBB 2I26N 5F93C 2HT3D 1URLA 5IKCB 2X4QA 4LDLB 1IKFH 1SJEB 1B88A 4FQXB 3V6ZA 4YE4H 4HWEL 4U0QB 4OZFH 5HSFA 1Q38A 2BNQA 3IDMB 4NO3B 1B6DA 1CE1H 2R0WL 5CGYD 5EC1B 4PLNC 4MJ5B 1MFAL 1RVFL 1KCKA 2O5XH 3NA9L 1JBJA 2WIMA 4N5UA 1EO7A 3WNPA 3HE7D 4UIKH 2APTA 1CIDA 1YYML 5DD5H 4KKBC 1F4YL 5DRNB 3KJ4B 5F7NC 3KPLB 4MXQC 2WINA 5B39A 1FP5A 3F65A 1R3HB 4Q7DA 3LB6C 4HJGB 4OCXL 3QWQB 1CFQA 2PO6B 4PJGB 1CBVL 1MIEL 2YPVL 3VA2C 1Q9KA 1Q0YH 4WW2C 1ZEAL 1IGYA 2AK4D 2HJFB 5L2JA 1OAUH 3D69B 5EA0H 1QEWB 2YUVA 3ZHDA 4WI8A 4RGND 3TVMA 4OUOA 5GGSA 2Z4QA 1YEDB 2OJZL 3O8XC 1JGEB 4H8WL 4ODVH 4R97B 4EJ1C 1JWUB 3CLEH 3V5HB 1KT2B 5GRVL 4N9GB 5D7SH 2ZZUT 1MAJA 4FQCL 2HN7A 1KUMA 4BSJA 4JRXD 1ZA3A 3QP3A 1B0RA 3CSBA 3MR9B 4KRNA 4PGBA 3VFTB 1T5WB 3AB0B 3FTGB 3V0VB 4V1DE 3T0EA 3KJ6L 3P11H 1TJHL 3MGOB 2VLJB 3DSFH 1D5XA 3MPCA 5D2NB 5I18L 2BNQB 1G9MC 1MFCL 1QEWA 4OM1H 4WNQA 4K23H 5JO5B 1J18A 1JGDA 3IETB 5SWSE 3GI9L 2JIXB 4CVUA 3R0NA 3GBML 1OM3L 1FZOB 5ESQA 3B9VA 2YA2A 2E8ZA 4LSVL 3KWWB 5I76A 3MLTA 1T66C 4OLWH 4Z8FL 3E0GA 3QUYD 3FB6A 1YQVH 4NPYB 3BGFC 4K2UL 1YNTB 2ADFH 1P7QA 5GRWA 3CMOL 4ZPTA 1LEKA 4EXKA 3LQAL 3KYOA 5SWQB 1UXWA 3B8SA 5D7JB 4LCIL 4K7FB 3BKYH 3G6JA 4EUPA 1MRDL 4PRPD 1T03H 3W9EA 3HE7B 3CH1A 4IOFC 3UPRA 1IC4H 1A6AB 1RK1A 4J3VA 1VGKA 5E1HB 1J9CT 3CSPA 4N8VB 4JHAH 5CBEB 2I25N 1DQTA 3ZTJH 2Q7YB 5J1TC 2R23B 4ZSOE 4XPBH 4UTAL 5LQBL 5F9WC 2Y9RT 3U30B 1BJ1J 1UB5A 4JFEB 3VFVA 1ZHBA 3U1SH 4NNPH 2NY0B 3QDMD 4I48B 3VFNA 3RVUD 3EGSB 3HE6D 3GMNA 5I1LB 5CZXC 5B39G 3RGVB 4HG4K 3ARGB 4HJJH 3RA7H 3PWNA 5DFWH 4J23A 4JR9L 5CJOL 2K7QA 3RY6A 3WD5L 4UILL 4KDWA 5CKAA 1I1AD 3FT4B 4RMQA 3FB7B 2E6QA 4XI5D 1OP5H 5EBLA 4ODXA 4RGMC 4N5EC 4S1DC 1K3IA 1U8QA 1C7SA 2C3HA 5JPMA 2KZ1B 3F12A 2R2BB 3HA0A 2HT2D 2NXZB 4KQ4H 2E27H 1YNLL 5HYQB 4H88L 1FYTD 5F7FA 1M71A 2Y7QB 3QPXH 4AM0B 3TGXA 1N2RA 3EYOB 4L8DA 1SM3H 1S9YB 1IL1B 2A6JA 4OIIH 5GGTH 1TJGH 4WFED 3TBVA 3H3PL 3ROLA 4OFPA 3ULUE 2Y36H 3MRGB 1AGCB 2IANA 2HFEA 2AK4E 2CDFA 4H5SB 3LQZB 3GSRA 2PTUA 4W70A 5IW1A 4PJEA 5I73C 5KSBE 3PWLA 5DJZA 5FYLL 5CJBA 2Q6WB 2G60H 1OP3H 1YN6B 1CFVH 3OX8A 5CHNA 4HXBL 3SE9L 3BSZH 1IL1A 3UCRA 1OSZA 3MUHL 3MA9L 3MLYL 4M43H 3TWCH 5BVPH 2E9BA 3U36A 4P9ML 4YK4B 3NN8B 2FBJL 4UU9B 1V8HA 1GAFH 1OPGH 1SYSA 4PJEB 1KOAA 1P6FA 3RIAK 5CZKA 5FYLH 4Y2DC 4M1CD 1T89C 1T5WA 4K94C 4DW2L 3R06A 3IGAA 5HBBA 5DK2A 1P4LB 2R8SH 2EDHA 3WS6A 3FCTB 3IU4L 4JO3L 3KYMA 5BJTB 2G5RA 1D5MA 1FSKC 4X5XA 1N7ML 4S1RH 3S37X 2EDXA 3QFJD 3PHOA 4WU7B 1F90L 2CDGA 1TJIH 5EU6E 3MCG1 3C9NB 4PRIB 4ODHH 2X05A 1EEYA 2I24N 2B20A 3U9UB 2X4NA 2E9WA 1MCFA 3KYNA 3SDAB 1NBZB 3QEUA 2QQLL 2A73A 5D1QB 1UZ8A 1CZ8L 1ZE3C 5IQ9A 3FQWB 3RAJL 3RWDB 4XNZB 1FAIL 2A6IA 3IXAA 3H42H 3WHXA 3S4SB 5EC2B 4M9OA 3TN0C 1ZLSL 4GAJH 4JFZH 3MUGA 2H2PC 5GJSH 3NIFE 1NPUA 1QNZH 2IGFL 5GGTA 5JW4Q 1RZ8B 4XXCC 3MRKB 4Y16A 4DN4L 1Z0MA 1X5IA 4W68A 1AKJB 4XHJD 3NZ8B 1I9RL 1F2QA 1ZLWK 3DPBA 1DBBL 1AR1C 2UWEF 1WWBX 2GJ6A 3ZE1E 1FE8H 1A14L 2HJKA 4QRRD 1YJDL 3MV9E 3ARFD 2QQLH 1T20A 5KANG 3HRZA 1DJSA 4X4XA 3FAWA 5TE4H 4AENA 1HHGA 3EYSL 4NSKA 4XI5C 5ADOH 5CBAA 1ZT7B 2PUQT 3RZCD 4NJ9H 4NO0D 3HFMH 4ZSOA 2XZQH 2WBJD 5L8LB 4P2QD 5IB5A 1ZTXH 1NMBL 3UPRB 5CD3A 4DEPC 3U4EB 3BZEA 3O6LL 2ENSA 1QVOA 3LN4B 4NP4H 3GSQA 3JUYA 3LHPH 4WGWB 4WU5B 4U6HA 1KTDB 1NGQL 5L2KB 3MTRA 3BEWB 3RVVC 3RUGA 4JHWL 3MZGB 5D2NE 5HGAB 1RMFL 4AM0A 1YQVL 2BVQA 1XMWA 5E2TH 4HG4J 2UZYB 5EIQA 4DKEH 5FGCE 2YMXH 2BY2A 4Y8AA 3BH8A 4FNLH 1A6TA 4OCRL 4JCLA 4YXKH 1P69B 3MRFA 4CU8A 3FFDB 2F5AL 2Z91B 1MCPH 4OKVB 5IW1B 4UQ3A 4LDOB 4HXAH 3QISA 4RAUA 3MXVL 3UMTA 4G80B 5FV2A 2H26B 4HIIA 5IR1B 4P5MA 3CFJA 1KEGL 5KOMC 1WWCA 4D0CA 3GSNB 2FEEI 5C0RH 2ZG2A 1TLKA 1A6TB 3KPSD 1KYOJ 2XA8L 2EIBA 1Z9OA 4P5TB 3WL9B 4S1QL 3HMWH 4ZPVA 1JPSH 5KSBA 1NGZA 1FZJB 4LCWA 2VR4A 1PD6A 3MLRL 3CIQA 4NO0A 5FGBC 1YEJL 2MQCA 4MLSA 5T5NF 3IAGC 5I1JH 3R4DA 4NKIL 2OR9H 3BZFA 5ECJE 2R0KH 5TE6H 3ZSSA 1I3RA 4N8PA 2GKIA 4OF0A 1QP1A 1S7QA 4QXGL 4XMKH 2EDLA 2XG4A 1SJEA 4GS7B 4YX2L 1INDH 4CMMB 1EMTH 5GIRA 5DUBA 1AO7D 1I8IB 3DNKA 1JWMA 1YN7A 2VQ1B 4XBEH 2VE6B 5E99L 2YR3A 3WFCL 1NBZA 2AV7B 2ATKB 3ROOB 1RUQL 1HHKB 4X80H 1YYLL 4WEBL 1SY6H 3NIGE 4FQ2H 4N1CA 5C07A 2WUBL 3QEGH 4R96A 7FABH 4UZGA 4ZUSB 4KRLB 3RWJB 1WZMA 1A9EA 3LKOB 5HY9A 2VZSA 3D25B 2C1OA 3V7MA 3EOTH 5I1KL 4FA8A 1HXYA 4P3CH 4K8RD 1QO3B 4CU6A 4M1GL 2OS7A 5DGQA 5GGRB 1A2YA 4XNMA 1SBSH 3OAUH 2BMKB 3O2DH 5DMGD 1PJ9A 1A7NL 4M1DL 3O0RL 2YD7A 3SDCA 3QUZB 3QT2A 4JZNA 4NPYA 5LGJA 5FUOL 3BDXA 4AEHL 1UCBH 4CW1A 1YYMH 1EZVX 4CDHA 4C54A 4PS4L 2IF7A 1FFNA 3U9UA 4B50A 1R3KA 2GJZA 4J3OC 4EI5B 1HSBB 3CFDA 5BQ7A 4PJ7A 4QOKD 5DS8A 1V7NH 4AG4H 5F6HJ 3TZVD 3EOTL 2C5DC 2VDKL 5JOEA 4D3CL 4KC3B 1KIQB 3UYOD 2A6KB 1A7RL 2IADB 4U2ZA 5GGRA 3RVVD 4L4TB 5DA4A 4LARL 1G6RH 5FK9A 1GGCL 2DRUA 1Q72L 4I2XE 5HVHB 3JV6A 1YECH 1KC5L 2OX5A 5CJQH 4C56D 4JFDB 4OZGA 1JCKA 3HI6H 3PWPA 4WHYG 1QPPA 3TIEB 1G7IB 3FB8A 3QQNA 3HNTL 1FV1B 4KMLB 4BZYA 3G9AB 2ADGA 3AAZB 1NUNB 5C07B 1XH3A 5KS9F 3F58L 2NPLX 1V7NL 1RHHB 2ATPA 2FSEA 5DD0H 3QBTB 4KROB 5GS2H 1BJ1H 3B9KC 4XVSH 2R2EA 1BQLH 1YEEL 4KUCF 35C8H 3RWGB 4Z0XA 5IKCA 2YMXL 3BQUB 5I1GL 3WFZA 3MX0A 3D39D 1NGXB 1FLRH 2P5EA 2D03L 1EO5A 1X5FA 3KPRD 3GKWL 2J8UB 4U7KA 3S5LB 1BQSA 1S7WA 3T3PE 1EHLL 4X6FB 5DJCB 3EFFB 1GGBL 5C71A 2AJ3A 4P3CL 1A7OL 3ILQD 1MCCA 2WNGA 1TIUA 3DECA 3P2TA 2P8LA 2DD8H 1T3FA 5E9DA 2EKSB 1AFVL 4UDUA 1NCTA 1PGRB 5L7XL 3TBTB 3BYYA 1WBXA 3QWRA 4L3CA 5HYJA 2GAZA 1HNFA 3HS0A 3P77A 3QUXA 5A2LH 4GG6B 1T0NA 3OF6A 1MFBH 3C8DA 5ETUA 2VDKH 4PG2A 3U83A 5JW4N 1FDLL 4Y19A 4R2GD 5FCUL 3V8CA 5A2FA 4KKCD 4LQFH 3ZKNC 2PYFB 3BX7C 4F33A 2R2BA 3WS6C 1FV1A 3NVQA 1QLEH 4N1HB 5FGCB 4F7PB 3DRTA 5ADPH 2PW1B 3QWOB 3TO4C 3P73A 3ARWA 3E6FA 1YDPB 1G9ML 3PWPD 3S4SA 1YY9D 2O5YL 3JWDL 2DMCA 1UCBL 2V2XA 3UTSB 4FXLA 2GK2A 2XPGA 5TFSL 1QRKA 5I74C 2NW2A 3VGFA 1H8SA 4FQ1H 2ZUQB 1XGUB 1VACA 1G7MA 1CXFA 1OLZA 2VDQL 5T5FL 4Z77A 3VDAA 4F9PC 3W2DH 1RAMA 2DQUL 4N1EA 4XGZA 3NAAH 2X6MA 3I3EA 2W60B 1YNLH 2LTQC 4Y5XC 2LAAA 2J12B 4L4VA 4QHLB 2N1KA 2FJHB 5IBLD 3FCTA 3BIBX 3SO5A 3P77B 2VIRB 3FT3A 4PG9A 2XZAL 2BVPB 2G75B 3MGOA 1D9KD 4DQOH 4YHPB 2CUMA 3O2DL 3GUTA 1VB9A 4W6XB 1UH3A 4EN3B 1MQ8A 1JGVH 2FATL 3D39B 2MMXA 4ZAKD 32C2B 4GRWB 1CQYA 4A2LA 1G0XA 3MNWB 4U1GB 1P7QB 1OP9A 1GOHA 2ZUXA 1D7FA 1T21B 1KSRA 3CU7A 2JIXD 2DQCH 1MHCA 3B9EA 4XNYL 5J6HB 3RVTD 4PJ5D 4YHNA 3LMJL 4APQA 3MLWL 1ND0B 3SKJL 5EU7E 1DANU 3SE9H 2MKLC 1ZAGA 2GITB 2VLRE 5HDLA 2WANA 2XPGB 1MY5A 2HTLD 3BHBB 1MLBA 5BOZG 5D5MA 4HCRH 2EEDA 4JM2A 2BVOA 3TIEA 4Z18A 3QDGB 4LEOA 5IVOA 3HC3L 5DJXB 5EO0B 4QTIL 5C70A 3GSVA 4RDQG 3KLAA 5FUCE 4RQQA 4NP4L 4YK4C 4F7TB 4LLDA 4DN3L 1ZSDB 3HR5B 3H3BC 1CTNA 2W59A 2EXWD 2FEDD 1HHGB 4YQXL 1LO0L 1U8KA 2PTTB 3PXHA 5C0AD 3IU4H 3RGVA 5B8CB 1H9VA 4AT6B 5FYKL 3KNBA 3BKCH 4YPGB 3E8UH 4KUZL 3ILQC 1M4KA 3SY0B 5AAMA 1EXUA 1J86A 4HZLB 4Z0BH 4LOUD 3QUML 1J1PL 4I3RL 3PG2A 5L88H 1ZHLB 1BM3H 4U1HA 1G7PA 1U2CA 4JLRB 3PL6A 3VDBA 5I8CA 3DSFL 3HI5H 4LSTL 4OT1L 3B8YA 1PG7L 5DUPL 4OLVL 1RURH 3AS1A 3MRJB 3T0ED 4I18A 1TTGA 1FC1A 3U0PA 4TRPH 4Y2DA 1HINH 5IQ7H 1T1ZA 4U6YB 1BJMA 4QY8A 4ODUA 4PB9L 3D25A 5FM5M 1ZTXL 4QGYA 5CIPB 3PDDA 4G6JH 3L7EB 3SE8H 1RUAH 4PRIE 3CCHA 3STLA 4JFYA 3CNKA 1QR4A 3S5LA 2LABA 1HILB 5HVWA 1D5ZB 3DUSB 1MPAL 4I1NB 4PD4K 4DGIL 1U8JB 4DTGL 1N0XL 1ETZA 3PJSB 4G9DB 1S78C 1MNUL 5E2UH 5F97E 2D7TH 1UB6B 2J1KA 5C6TH 4ZOAA 5C1MB 4L3EB 3MRHA 3HC3H 3VRIB 3UZQA 4QRUB 5TE4L 25C8L 5GS0D 2Q8BL 2AXFA 3A6CL 3QAZB 3HE7A 1IC4L 2HFGL 4WWKA 4RZCB 3UBXB 3WFDL 1AD9A 5FGBA 3K1KC 5HJ3A 1A5FL 2BNRE 3WIHA 3L7FA 1QQDA 4L9DA 1XF4A 1BZQK 3RGVC 2A74A 4PGDB 5T1LA 1R5IB 1A22B 2W38A 4IOIB 3ZKMD 1RZ7L 3E6HA 4YHKL 4GRLA 4XMPL 4HULB 4LAQL 3QIWA 4NO0B 1I85C 4N0YL 1WFUA 3E2HC 2WLYA 3NCEB 3ZSTA 1VACB 4XGZB 3FQRB 4UILH 4WO4B 3UBXG 5C6PB 5HI5D 4DK6A 3KLDA 2ATPB 2V7NA 3WCYA 1A1OA 4KHXH 4JFFD 5F7DA 2XY1A 1SJVA 4ZO6A 3CU1A 4ENEC 5GISH 4GO6B 4JVWA 4XXDB 2VN4A 1PG7W 3M1BB 3T4YB 2VXUL 4ODHL 4FMKA 4BUGA 3J7HA 4P49A 2VDOL 4DKFH 5L2KE 1P84K 1YQ2A 2CLRA 4BSVB 3UEZA 1WLHA 2HAZA 2YKLH 3HZYA 3NCJL 1J0IA 2AKRA 1JF1B 2XKNA 3RTQA 5L9DH 4LBEB 4LLUA 4N9GA 4POZC 4G8EB 3BDBA 4OIIL 4GAJL 2XWTA 4JFZL 3LS4L 4LEXH 1U8LA 1LO4H 3SDCD 3QULA 5I15L 2HA1A 1CGSL 4BZ1H 3L3OA 3BVNA 2NY5L 1J88A 4OFIA 3CSGA 5E7BA 4F3FB 2QQQA 3E3QE 4HCRL 1QSVA 3N85H 1D6VL 3X11A 5I75C 2RCSL 1RI8A 3L3HA 2R69L 2P47B 3O4LE 4LLQA 5HXMA 5DHYB 5BO1L 5IBUG 2OP4H 3SDCB 4H8WC 1QRND 2CR6A 3TVMC 3X3FH 2FEDC 3CZJA 1K3ZA 1S3KL 4XVTL 3X12A 3QR2A 1DE4B 4LVOC 2IG2H 4BQ9A 1FNSH 1FVEB 5HYEA 5SWQA 1FHGA 1F4AA 3DRQA 4FZ8H 3DUHA 4I77L 3ARGA 5DO2D 3PQYA 1G9NL 5GZND 2OTPA 4Q9QL 1G7LA 3QPQC 4OZGF 4WWKC 4QRRB 1GAFL 1JNNL 2AV1A 3T77A 1A1MB 1KIPA 1NFDA 1AGEB 1FNLA 4YHLH 4GUPA 3ARYA 4Q2ZB 2YWZA 3O9WC 5DQDH 3QIBA 2GK0B 1XIWB 1U3JA 4HZLA 3BEVA 4WO4C 3IS1X 1BVLA 5E5RB 3OZ9H 1UWXK 5DQ9A 3RTQC 4ZUUA 4PV9B 3TBSB 1R24A 4Z7WF 1ONQA 1TQCC 3V4UL 1OAZL 4IMKA 1LE9A 4AEFA 1ZSDA 4GT7A 1HKLL 1IEHA 1IGMH 1UXWB 1BWWA 2ICWI 3CVHA 5I8KH 4WTZA 4OCMC 1LMKA 1M05A 4OB5L 5D7KD 3S36X 4XP6H 3SE8L 3ULVE 3FHAA 1KN4H 2DM4A 3L3HB 3O2WL 4G7VH 4YPJA 1N0XH 5FCSH 1BD2E 1GSMA 2KH2B 4XNQB 4A6YL 2EXYC 2Z4QB 3EOBA 2IAMB 1U8OB 2F74B 4KHXL 4IEFB 4OCYH 32C2A 2Q7NA 4N8VG 3BO8A 1KELL 3DURA 3EDJA 4ZUVA 4MJ6B 5JPMB 2GSGA 4DN4H 2DL9A 2VO5A 2VZOA 3D85D 1LEIA 2NY3C 4HWEH 3QEHB 1Y6KR 2F54D 3P9WB 2IGFH 5CSBA 4EUPG 1IKFL 3V6OE 5GZOD 3G5ZA 1XF4B 4ZOCA 3CZFB 5T3XD 5DRWB 4MAUH 4D3CH 4PJ8A 2R0LH 4X5WA 2MSPA 5I15H 1LILA 3BH9A 4XNUH 4F7MB 1BVLB 1Y0LB 5ACZB 4MB3A 4JFQA 3QXUA 1QBLH 5EPMB 4MXWL 4NQUA 2FD6H 1X5YA 4XAKD 5KSAD 2GIYA 1MIEH 1HHKA 5K59E 1MWAA 4FQIL 3RL2B 5EU6B 1AH1A 2ZCHH 3Q6GH 3GB7A 1V7ML 2CK0L 4U1IA 1OAUL 2VDLL 2X4PB 1NAMB 4R0LA 3HS0B 2GHWB 3MV8B 3J8F7 1RJYB 3ZE2E 5HVHC 5HI3D 4YXHL 4PJEF 3O8XA 4RNRA 1NAML 3KPRE 4PP1C 3V5KA 4JGJA 2MOVA 2A74B 4HWNA 3VWKA 4KZDH 3VFGH 4Z78B 1G7HB 5KVFL 4ZODA 4PJBE 2AQ2A 1DL7H 1N5AA 1VKXA 3EAKA 3IKKA 2BY0A 3HAEG 1IGTA 3LKNB 5D7SL 1CT8B 5KOVC 1RZJL 3SPVA 1WAAE 5JA9A 1L7TH 4TPRL 4Q97A 4U1IB 4EI5C 1IZJA 3DRTB 3RX5A 4F3FA 5LBSH 5I1DB 2W65B 3GK8L 3L5WA 1N6UA 2ZSVB 4D0BB 3PL6D 1TETL 2RIKA 1EERB 1WBZB 3RKDD 5IEHB 1XGQB 4Y5XA 5ITBH 3MA7B 1DUYA 4MNGA 2ESVD 4UTBH 2HWZL 1DQLL 4U1GC 4W6YB 2D7QA 1QBAA 4H1LG 4KTEH 4APQC 1DE4A 3MZTA 4FFWC 5KSUB 3MLZH 4YDVB 4OZIB 1OGTB 3LKSB 2GJ6D 4FQHA 1FNGA 3LN9A 4OQTA 3EO9H 3FHQA 5E1AA 2Z93A 4HUVA 1CICB 4K7PX 5IJKA 4POUB 2DQDL 1FIGH 2A73B 4JPIB 1R3IL 1ZHKA 5E08H 3JWNC 1UA6H 3WFBH 5DWUH 5CCKL 2LVEA 1F4YH 3CDCA 1PEWA 1T04B 4Z0XB 3U4BH 2BDNL 1BIIA 5L2JB 2NY1B 3NA9H 3TYGH 2PXYD 4O2CA 1FFPA 1LD9A 1S9VA 2VR5A 3MBEC 1FQ9C 2A1WH 3OPZL 3OKOA 4UNVA 4PLJD 1G0YR 4I8DA 4M9PA 4MWFB 5F71A 3NIDE 4CN1A 2ARWA 4MB5A 1F3DH 1INDL 3W9DB 1A4JB 4MXQD 5IFHH 4PB0H 1X5GA 2F19L 2GTZB 2AEQL 5ANME 4QRQB 2RFXA 2IQ9H 4M7LH 3QEQE 4U1KB 3G08A 5F7UA 3KHQA 2I5YH 3DV4B 1NSNL 4E41D 5F7HA 3IAPA 1ND0A 3DXAE 5IJKC 1KJMB 1CFSB 4YUEL 4PJAF 4X7TA 5CEZL 1DEEA 3CFKB 4NCDA 3L1OH 2VE6A 5LGJB 5DD3H 5TGBB 1UKSA 3I75B 2ZG3A 2YOCA 4MA1B 1SEQH 5DJDA 1OSPL 1XZ0A 4PUBL 3H42L 5A2JH 4HUVB 2ADJA 5TF1L 1C5CH 2AK4B 4FMFA 3UTOA 1MJJA 4YLQT 3DUUB 3ZDZF 2OK0L 4HC1L 4KGJA 4PRPB 4PFEA 4OD1H 3A6CH 5E00B 3GRWH 3VFMB 2ZNXA 4E42A 2VZ3A 3CSYA 2EO1A 5CEZD 1FZMB 3HAEB 2AI0H 4JGMA 5E9DD 4NQSA 2JELL 3WJLC 3LB6D 3H0TA 1T66D 4C83B 4KJQC 5CS7A 2VXSH 1C7TA 5D70L 1BHGA 2ITCB 5ENWB 3H9HA 2PYFA 2W91A 2QSQA 4NC2B 4CDGC 4LVEA 4OLXH 1D6EA 1HXMA 1QG3A 2OSLA 1QBMH 1DANT 1HSAB 1DQJB 4IRJA 5ISZB 2MCG1 1PKQE 3LKPB 5HVGB 5E8NA 2B0SH 4Y8DC 1NMAH 2WUCL 3B9KB 4DEPB 1FFRA 4JPWL 5CWSA 1C1EL 3I6KB 4N0UA 1PAMA 4GW5B 5HHME 1NGQH 3VXQB 5E8OB 1MJ8L 4HWUA 3C60A 5JNYA 3LKQB 2AGJL 1BFTA 2JE8A 4YBLC 1S5IH 3TBSA 5A3IC 4MJIE 4MX7B 4W4OC 5C08D 1K85A 3RVUC 3HE6C 4KZEL 1MJ7L 3PIQB 4M8QA 3KPRA 3DO7B 1OVZA 1FNHA 4YDKL 5F8RC 1BZ7A 5J6HA 4XAWH 4S1RL 1EGJL 3W0WB 3GI8H 4JG0L 4D0BA 5H94A 2CD0A 3EYFA 2YPLE 1MJUH 3WFBL 2HRLA 3QUYC 1MAKA 3MBEB 3EOAB 1AGEA 2EDEA 4HKZB 5ESQB 2ZCKH 3RNKB 2GYSA 5B3JE 3WMSA 1YA5A 4QHMA 2EC8A 2FWOA 1AP2A 2B4CC 4AQOA 3V6FA 1CR9L 4HKJA 5FO7A 3IDXH 2DLGA 5F21B 3QIUD 5HHNB 1P84J 5JTWA 2JB5H 3VFUA 4YNYA 5J57B 5IVXF 2DQIL 1CICC 1F3JA 3KYOB 1A1OB 1CDBA 1YPZE 3LKRA 3MRRB 4NUGH 3QIBC 3SDAC 1F6AB 3OKNA 4I9WE 3ORJA 4APQB 3LRGA 5K93A 1A6PA 4Y19D 4LLQB 1O7VA 4KJWC 4HKZA 3AU1B 2HMID 4QYOB 4ODWB 2IPKB 1HOCA 3SCMB 5DLML 1NBYA 4HXBH 3EUUA 1TITA 2MHAB 2Y5EA 1F13A 1U8OA 1HHIB 5DMIH 1JPFA 1XGUA 1HH6B 1QFOA 4YO0A 5F1OB 3UDWA 1U91A 3AAZA 2HKHL 4BSWB 3SKUD 4KK5D 1ACZA 1BIHA 2Q87A 3SEPA 4RMUA 1RK0B 5IR1A 4Y2DB 5EN2A 3G5VA 1U58B 4X98B 1FAKT 1OGAB 5JQHC 4LSQL 3U9PH 3FT3B 35C8L 1ZVYA 3GMMB 4NWUL 5BO1H 4XBGB 3CFCH 2AXHA 1XIWA 4UB0L 4XB8A 3D0LB 2IJ0C 2CLVB 3P0VL 3TP4A 4Y5VC 1ZS8B 2HJKB 4WTXA 5EOTB 3MV7B 2FEEL 1F58L 4FTVA 4BYHA 2X41A 3BN9C 5GJTH 2ARJQ 3MV9D 4G3YH 3RUGF 3V52L 4CW1B 2JLLA 1ZHBB 1RZKL 3ULVL 4LEXL 4Y4FA 4KI5D 1JHLL 4PJGA 3DLQR 1G7LB 1M05B 3BIKB 3QUXB 4YHYB 3MUGB 4JY5H 1E4XL 1P4IL 2EE6A 3MRDA 5CJXA 3VD4A 1S7TB 3RDTA 3IS0X 3ZYJA 1QQDB 2OL3B 4C56E 1JGVL 4YGAB 2DTSA 2AXJA 1EAPA 3U4EA 5EIIA 4LIQL 1FFOA 1UWXH 1KBGL 3ILPB 1VFUA 4LLAA 4LPYA 5ICYA 2JK5A 4BQ6A 8FABB 1YEGH 3HG1A 3QCUH 5JW5A 1S3KH 5INCA 1TCRB 4HPYH 2EH7H 2DLFH 5JHDE 1YNTA 4G3YL 2GT9A 5EU4A 4NM4L 5HHXH 1LEKB 4ZPTB 5C08E 1MFBL 4N0FB 4ZXBB 1HQRB 3OHXA 3RY5A 1ZV5A 4OUUA 4J7RA 2V6HA 3FQXA 3QDJA 5C0CD 4LAQH 3TN0D 4X7DC 2LV4A 4MLIA 3IFLL 3UPCA 2VLJA 3V4PL 1RUPH 2NZ9C 3C08L 4L5FH 1VGKB 3WKNA 3VFMA 2EIDA 4Y4FC 2ICCA 2DQIH 3ILPA 4QXUH 4JM2B 3VXMA 3V5DB 5I8OL 1JF5A 1FH5H 1SYSB 3EKCA 1AR1D 5D4QA 4EIZC 4UU9A 2VLRB 3F7PC 1FNEA 3VFWB 1BEYH 3NTCH 2X1OA 1NC4A 5I1EL 3QG7H 2FJHA 2GSGB 2KBGA 5EO9A 4P48A 1P1ZA 2DYPD 2XRAL 1VGEH 1C16B 4R26H 4HWBL 4MDIA 4Z7OE 5J4MA 5BMFH 1UWEH 5LBSL 5C0BA 2NYYD 3D0VA 3KPSE 3MLVL 4MHHI 5GS0L 4UAOC 5C0IA 4NOBA 1XIWC 3HZKA 1CD0A 3VFSA 4W4NA 4NQXB 5A40E 3I6LE 4DKEL 1Y0LA 2ICWJ 5D7IB 3UAJD 2P43B 4CADA 3KGRA 3PHQA 4H1LA 1JFQH 1YMHB 4ODXB 1ZXQA 4HK0B 1WZKA 4QCIA 1T4KA 2AERT 3N85L 2GCYB 2DOCA 3MNZB 4D9RE 3HUJE 5ISZE 4G80A 3OKLB 4H26A 3RWHB 1JZ8A 2ZWLT 2LU4A 4KK9D 3X13A 1F90H 3UJIL 4RZCA 5B38G 4HH8A 5J12B 1B2WH 1S9XB 4F15C 1IKNA 4M62L 2X7LB 3TNNB 2X4OA 1MCOL 3TVMB 4BZ2H 2HJFA 3ROLB 2C9AA 1GIGL 5I9QC 4PJIF 4XP5L 3BEVB 3QHFL 3TT1H 4PRHB 3MFFA 3BKML 5DYOA 2VDMH 1FO0L 2D4DA 3SPVB 5E1AB 1WCQA 2O61A 5IHLB 4JM2D 3OR7B 5T3XE 3S98A 43C9A 1F3JB 1AGFB 4FP8L 4JFDE 2ZSWB 1AD9B 4PJCA 3WIFA 1MREL 2XXMB 1Z3GH 3SOBL 5BZDB 2WMPA 1B0GA 1IAOB 5FDWA 5INDB 2H9GA 3F6LA 1KB5H 4NKOB 4S10A 3KVQA 3S37H 3WIHL 5F9OL 5DJCA 5FO9B 3LEXA 1MAMH 4PY8I 3T0VA 2NMSA 1FLTX 1U8HA 2AV7A 3QG6A 2D7OA 1UADC 3JV4B 1KPRB 4X8JB 4NRYB 2EIZA 2YC1B 3FN0L 2VKXA 3WNKA 3QUMH 3UTTE 4P4KA 4XMLL 2VXVH 5D1ZD 3KJ4C 5D7IF 3ZO0A 2CPCA 4AT6A 2FDBP 5GGQL 4L8BA 1NCBL 1S9XA 3L7EA 1JJUA 4BFGA 1UGNA 5JMOC 1T0MA 2BY3A 1IARB 2YKLL 4HGKC 4P57B 4PGCA 4HC1H 4QXTA 4NZTL 4ALAL 5TQ2H 3M45A 4N8VA 1DQLH 2AKRB 3HZYB 2KQMA 4DGYL 2YK1H 1JZ4A 1IEAA 1IQWL 5I73B 5I8CB 1K8IA 5LXGH 2FH6A 4G6JL 1MFAH 4I4WB 4GAYA 2P5WE 1SY6A 1XAUA 4U3HA 5IW3A 2DDQL 2X4UA 3C5SB 1OF2A 4JO1L 3DETC 3LAFA 4D9QD 2WZPD 3R0MA 1AXTH 1GYAA 1IGCH 4OLEA 2DQCL 3C60C 2X4RB 4OF7A 4G8IB 4P2QA 2EDJA 3QIWB 1RZIB 3GMOA 1X6NA 1KJMA 1CXHA 4C83A 3UX9B 2PYEA 3QI9C 1B6UA 3IU3B 4NHUB 3T09A 4ZFOA 1O0VA 2D31A 2D7PA 4TVPL 4UQ3B 1X44A 4QWWC 3K80A 4YBQD 4PYHA 4HWZA 4QRUA 1XGTA 4X6DA 3MR9A 1AXSB 1BQHB 1UM6L 2ADJB 5I1CL 5IFHL 1B3JA 3U82B 5K9KB 2X1QA 3Q2CA 5C0BB 4YHNB 1VHPA 4YDIL 1GGIH 2J8UA 3O41A 5F72S 3IFNL 4ONGH 1M7IB 3EYQC 5T33L 5SWZE 3CCHB 5LGKA 1FZOA 1F11A 5HI4D 4NZJA 4KZEH 1G6RA 2NY0C 3VFRA 3VXRE 3QJFA 5GS3A 5ID0B 3MV8D 4TOYL 2GJ6B 2V2WB 2CR3A 3WLWD 5B8CC 4JDTH 4FABH 5HYSA 1JL8A 1WVZA 4HWZB 4GRLC 3CFEA 4JY4B 5LAXA 3HZVA 3VXSA 2BSRB 4K8RC 1KB5L 2XKUA 4HF5L 4GRWE 3I3BA 2FGWH 4LVNC 4R8WH 1NMAL 2BXZA 2F58H 3PWUA 3VFPB 4L8CA 3X14B 4K3EH 4KMQA 1KXQE 3HE7C 5C09E 5C9JB 1H3PH 4XVJH 2X4RA 3BP7A 5F1IB 3WN5A 3O6FB 4Y4HD 2B2XL 2VLKE 4Z7WE 3GBLA 5E2VL 3V6OA 4YXKL 2X40A 3MREB 5C0DA 5F6IC 1CLZL 2FJFB 2QLVB 3MV7A 1MFCH 1TVBB 4GXUN 3QULB 3DMMA 1VDGA 2VDRH 1JUFB 5C0GA 1ZMYA 3TJHC 3RHWK 1CFQB 2PO6A 4WI7A 3DGGA 2Y6SC 4Y1AB 1Q9LA 4IHOA 3THML 4OF6A 2AEWA 1SM3L 4R8WL 4WUUE 4B7IA 1KEML 3IDYB 3KYMB 3R06B 2ZSWA 1BD2D 4HFUL 1HHJB 1GJIA 3GMPB 1NLBL 4Y4KB 1FYTE 4QOKB 2Q8BH 2B8OT 5DHYA 4LLVB 1IM3B 4X4ME 1O5DT 1Q0XL 1Z5LA 1PEZA 2MKWA 1T1YB 3SQOL 1U3ZA 1HYRC 3CFIC 5T33H 1KFAH 2FO4A 2CRZA 4ZS7L 3EYVB 1XF3B 2LTQB 4LFHD 3OB0K 4JKPL 3GB7B 2JKXA 1NMBH 1TZHB 3CFJB 4YUEH 2ZSVA 2J6EA 4IDLA 5I2IB 4M3KB 1YY9C 5F7LB 2Q3ZA 5JDSB 1NC2A 2BJMH 4NNYB 3SDXA 4WNQB 3SN6N 4PRDB 1YY8A 5DK0A 1ED3A 4XCYB 4NRZB 2DM3A 5GHWH 5MEPB 5BZDA 1J10A 3BZEB 4M6ML 1I7ZA 5IG7B 4OQ1A 4D2NA 4PJGF 1OPGL 3T8XA 3BUYA 2XZAH 2KQNA 4PPTA 3RJDA 2R0WH 4PJFF 4PTTA 1A14H 4WJ5B 1CL7H 1U91B 1GH7A 5KBNC 2GCYA 4TSBL 2EDWA 5EWIL 1NFDF 2OQJA 3T65A 4WO4A 3WIIL 1IC7L 1GXEA 4X4YA 4AENB 15C8H 2P49B 4E41A 4X4XB 3QIUB 3WSQL 4FRWA 4PY8J 5GGVY 1N5YL 2NTFB 4MCZA 3CD4A 3BQUA 3I3DA 2L4OA 3D0VB 1AHWB 1VENA 5IBTH 2CDEB 3OAUL 2KPNA 4HMCA 4L29B 5D6DC 4JPVL 1MWAL 4M1GH 5DD1H 5EZIL 3G6JE 4YR6B 5AZEL 3A6BL 2D9CA 2YN5A 4AEHH 2NX5E 1HNGA 4KH2A 2BSTA 5SWZD 5I1CH 3OJDB 3G6DL 1J8HE 1A4JA 3P73B 1F8TH 2KL6A 4X6EA 1XT5A 3OG4B 4Q58C 4O5LH 1QBLL 3EYQD 1QOKA 1QSEE 2Z8RA 3MNVA 4H20L 5FHBL 1HSAA 3IDMA 4LLWB 1XGYH 3IFNH 4ONGL 3V6ZB 4NFDA 1S8DA 4YDLB 4UV7L 3CX5K 4HUWB 3NPZB 3PGDB 3ME0A 3QEQA 3ARQA 4XNQA 1R3JA 3ZDYE 3PUCA 3VXUB 4Y4KD 4YHLL 1VFOA 1U42A 3OAZK 3BQUC 4BM7A 3PDOA 4LPCA 1A02N 1GOGA 4ODBD 2XWJB 2XICA 2QV2A 1A1NA 3TWCL 3AC0A 2J8UE 3QJHB 2X42A 1HH9B 5I1HL 2VITB 2PW1A 4OZIE 1EGJA 4GSDL 2EIEA 3BW9A 3LEYL 4JRXE 3VGAC 4PS4H 3FFCB 1IC5H 5GISL 4LHJB 4PGEB 3VXUD 3QDGD 2P8MA 2YSSA 3VXRA 1W2KT 3X11B 5J06A 1I8LC 2VXTH 3VW3H 5DRZA 5DEFA 1AY1L 1XR8B 3ZTNH 2R9HC 4YBHA 5BOPA 2NY2B 1A7PL 1U92B 3ULVD 3FQUA 4P5TA 1U95B 2EDKA 3O2VL 3LPWA 2DJUA 2DQEL 4GBXB 4JFFB 2DLEA 1P9MA 2H32A 5FO8A 1RMFH 5A16B 1ITBB 5I1KH 1U93B 4RGOH 1T20B 1ZANL 2H8PB 2D0FA 3EOYG 5F3HA 4LKXB 1I9JL 3NIDF 2R2EB 1WF5A 4BZ1L 2GAZB 4RCAA 4GOSA 3KHOA 5SWZB 4ZTPL 1RIVH 2D7TL 2RJMA 3IFLH 2LQRA 1T7XA 4HH9A 4OZFA 3ISWA 3S34L 4XBGA 3LN5B 3OAYK 5HD8D 2R15A 3GBNH 4BSVA 2R29L 4HJ0C 4NJ9L 3SO3C 2VABB 3MRMB 3WJJC 3MRGA 4OM0L 1UWGL 4CVXA 1UCTA 3DIFA 4HGWB 2AJ3B 4CU7A 4HK0A 5T1KA 4ONHB 2ZOKA 1FPTL 2WBJB 4IRJD 4OBRA 4WW2F 1AIFA 4HIJA 5CEXA 1WFNA 4P4RB 3TT3H 1NBQA 2XNAA 5GSRB 2E7LC 4MNHA 3ARGD 2VLLB 3KPMB 1KNOA 5DMKA 4KWUA 2EZ0D 1AGBB 1QHOA 5HPOA 5DC4B 2X7LA 4MJIA 3P9MA 1B0WA 3GM8A 4IDJL 3SE3C 2IFGA 5JLZB 4LCUA 2CRMA 5CINL 4PJ8B 1R3LA 3PWJA 1BF2A 1HCFX 4QHNB 5H2BA 5MENB 4GS7C 2BMKA 3FOMB 3O4OB 3PV6B 4IJ3C 2DLTA 4FQPA 1ZT4A 1OB1B 3DJ9A 3WXVL 1IM9D 4DOHE 3UZEA 3ARVA 3F5WB 1I3UA 1DDHA 1CD8A 1I1AB 1SEQL 1FYTB 1RJLA 3O11B 4HIXH 4QRTB 1XF3A 2HFFA 3DX8A 2ZJSL 4IRSC 1BZ7B 3ARXA 4OUUB 1YJDC 3IXTB 3BXNA 3QNYA 1NFDB 2V5SA 3ARDC 4P23C 4BZ2L 3C09C 5E6ZA 4L9LC 5HHXL 1HILA 1A3RH 4H0IA 3W0WE 4HS3B 4ZO7A 43CAA 4P5TC 3VXPB 4MA3A 5CBEA 1HINL 4QRPE 2R56L 1NGYA 2DM7A 3LEVH 5J8OA 2GY5A 1N5AB 3LS5L 3MRQB 4XWOD 4YGVB 4X7EC 4IIQC 5EBGA 4J3TA 1A6UH 1IT9H 4B41A 4HLJA 4OQTH 1AXIB 3DRQB 4R4BB 4YXLL 1Y18B 1JWSB 5JIPA 1A6ZB 1RY7B 4I18B 3QO0B 5AAWA 5J1SC 3FB5B 5I1LA 4NSKB 5BRZB 5M7QA 1FH5L 4XNXH 3QQ3A 3HNVH 5ETUB 2W0KA 4O51A 4BFIA 2RAMA 1BBDL 1HQ4B 1EJOL 4HGMA 2B0SL 5IOPB 3O3DA 1LO3L 1QR1B 4NYLB 3VCLA 2W9EL 1D5ZA 2MCPH 4I5BB 3SQBA 2SEBB 1JV5B 1TFHA 1J1XL 5IWLC 5LGHL 4JREB 4RQQB 2Y06H 5IV2B 4PJIA 2NNAB 4UDUB 5ICXB 3D9AH 4AL8L 2JB6A 3WFEL 2HH0L 2XQBL 2AJVH 5DO2C 1LO0H 3IJYB 5I1HH 4HWBA 3HKFA 4HBCH 4LSDA 1NSNH 5EORL 3VXMD 2CXKA 3PNWA 3MJ8B 1YEHL 3O9WD 1OGAE 1F11B 1MOEA 3NAAL 5MP6H 1K4CA 4OF3A 1ZANH 3B3IA 4NQXA 2V2TA 4U1HB 1MHHB 4NCC1 1T1WB 5JUEH 4Z76B 5C0JB 4FTVB 3OMZA 1JNHA 1NCCH 1IAII 4JFOA 1L7TL 4P3DA 4NIKB 2OJEB 4K55A 1XFPA 1L6ZA 5CD5D 3WXWL 5D2LE 2BHUA 3HLAA 4Z7UB 1T7ZA 1A6UL 1OTUD 3OXSB 3C6LC 4U1KA 5IWLA 4I13B 4KQ3H 4Q6IB 2VWEE 5HYIA 2C26A 2ZPKL 3SGJC 2QJDA 1GRWA 3AROA 2DLHA 2IADA 3LN5A 1BAFH