1ADQH

Crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
225
structure length
225
Chain Sequence
EVQLVESGGGLVQPGRSLRLSCVTSGFTFDDYAMHWVRQSPGKGLEWVSGISWNTGTIIYADSVKGRFIISRDNAKNSLYLQMNSLRVEDTALYYCAKTRSYVVAAEYYFHYWGQGILVTVSSGSASAPTLFPLVSCENSNPSSTVAVGCLAQDFLPDSITFSWKYKNNSDISSTRGFPSVLRGGKYAATSQVLLPSKDVMQGTNEHVVCKVQHPNGNKEKDVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG4 REA FC
publication title Structure of human IgM rheumatoid factor Fab bound to its autoantigen IgG Fc reveals a novel topology of antibody-antigen interaction.
pubmed doi rcsb
molecule tags Complex (immunoglobulin/autoantigen)
total genus 35
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 1997-02-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1adqH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1adqH02
4PRPE 1L6ZA 5BQ7B 5L8LB 2YHGA 4M7KL 1AI1L 4XP6H 3P40A 1BD2E 4KK5C 2BFVH 2PXYC 5K9QG 4X9BA 5C0AE 2ZNWA 4P2QE 5ITBL 3MNWA 1A1NB 1ZLVK 1AP2A 5FV1L 3K7UA 1VFBA 4HFWB 1HWHB 4KPHL 4TSAH 4C56A 4F33A 3Q6FB 3O3DB 4JY6B 4NJ9H 1NGWB 3MGOA 1RHHA 3DXAE 5DD6B 2H45A 1FORH 3MLVL 1N7MH 4G9FE 1S78D 5I1GL 4NOBA 5GPRA 5DD0L 2FX7L 5JOPD 1YN6A 4NZUL 4MJIE 1UC6A 4G9DA 4KMQA 2Z8WC 4WU5A 1A1MA 2F19H 1TVHB 1N2RA 2DJ4A 4GSDH 5K59E 1JMZA 1NAMB 3TO2A 2VC2L 2RHEA 5L88L 1FC1A 3KPRA 2BVOB 4Z7VF 2I5YH 2O5YH 3PJSA 3KPOB 5IBTH 1SEBA 4U6HB 2P8MA 3O41A 3OGOE 1LE9A 4HV8A 1MSPA 2ZPKH 4IMKA 4F7MA 3PL6B 1JWUA 2UZXB 3KYOA 4E42B 2AEPL 4BFIA 2F54E 4OCYH 4UZGA 3SJVE 1IGIL 2QJDA 3H3PL 1J7VR 3QQ3B 4BELD 3HI6L 1F45A 1KXVC 3V4PL 1OGAB 3I6LE 3QUYA 4NQCB 1WBXB 5F7MC 1KPRA 4Y89A 1FL3A 4NSKA 4UU9A 2F53E 5EU7C 1UA6H 5TDOB 3ZMRA 2GT9A 4I0PB 4NNPL 4R3SB 2CKBL 1RIVL 2FECI 1A9EB 3Q0HA 1TJHH 4X5WB 4CGTA 3ZDYF 2QSCL 4G7YL 3WE6B 1YEJH 1RUQH 4NHCH 4ZQKB 1F4AA 1HOCB 2VLLB 4M7ZC 5GSVB 4OFVA 4NQDB 4KZDL 3W81A 4IOIA 5GGTH 1INDL 1CFQA 2HT2C 3OB8A 3UAJD 4F58L 2VERN 3MRHA 3DYPA 1Z0MA 4NZDA 4X99B 1K8IA 1NEUA 5E8EB 4M00A 4JPVH 1UH4A 2OJZH 1F6FB 4YHNA 1MFNA 2CLZB 4OF5A 4Z77A 4R4BA 3QEHB 1NFDF 1FO0A 1I7RB 1X5YA 4XWOD 3MCKA 1TLKA 4PGEB 2A77H 3L7FB 3T1FB 5HVGB 1LILA 1L7IL 1LO3H 3AGVA 4I3SH 1CTNA 1BVLA 3MMEB 1GPOL 3Q5YA 5C0NC 1WVZA 5JHDA 3BIKA 3ARUA 1CXIA 4EUPG 2WUBH 3DBXB 2GJZB 3PWPB 2EZ0C 2J5LB 3MRDB 3I2CH 2BHYA 3LKOA 4JAMB 3X11A 3BKCH 5FGBC 1FJ1B 5TQ0H 4AEIL 1W0VB 4JDTH 4RMTA 2PW1A 3QHTC 2Z92A 4OJFH 1MCWW 3GHEL 3PL6D 4U0QB 1Q0YL 4NQEE 2YD1A 1QBBA 4NIKB 4JB9L 1YNKL 4XCYA 4JFHE 1JGVH 5DJ0B 4PG9B 2QKIA 5GZOD 3TO4C 3S88H 2EH7H 3I6GA 1H5BC 3X3GH 3HAEH 1L9MA 3QIUC 1OGAD 3QDGB 4UMGA 1DANU 3OXRA 4NQCD 4MNQE 1O5DT 1QSED 2Z31A 1T6WA 1KEGL 3DIFB 5HI5C 2I27N 5D7KD 3O3EA 1ZHKB 4ZOCA 5DJ8A 1EEYB 2DLEA 5JW5A 1A1OA 4I0PD 4LCIL 4L9LA 3UTTE 4W68A 1BM3H 1I7UA 2WINA 4ISVB 1MQ8A 3GMPB 3MXWH 3WFDL 5EUOF 4GQ9H 3W5MA 4DKFL 4ZOBA 5EORH 1B0GA 3P9LA 3RWCB 1D6EB 3MLTA 3QIWC 4MNHB 4LCYA 3GSOA 4NQDD 4GRMA 2IAMA 5CIPB 4PBXA 4LHQB 4YHYC 4Y1AE 2D2OA 5CD5C 4XNQA 3A6CL 4P46C 4URTB 2FNBA 4WO4D 3T04D 4MVBC 3BUYB 4P9MH 4TVPL 1HI6A 2BJMH 1ZHNA 1GGBH 3K8MA 3VXMB 1FNEA 3IB4A 1J0ZA 1EXUB 4TNWF 4HG4K 4OGZA 3F58H 5FUZH 5TJWK 1JI2A 3HUJE 1EUTA 5DJYB 4PJAA 2VABA 1G1CA 1R5WA 2CKBB 2YC1A 3BZFA 2DB8A 4ZD3L 2E6JA 4IS6B 5BRZD 2DQUL 1WF5A 2ZJSL 4NHUA 3SKMB 1N6VA 4P2CG 4XAKE 5BXFB 1KJMB 3K74B 3F62A 2GAZA 1DQDL 5FF6A 4WJ5A 4AIXA 1R6VA 1UM6H 4I48B 4MDIB 5IROC 5T1KA 3I02A 1EERB 4DCQA 4LEOB 2PW2B 5D5MB 4WV1A 4ODSL 3WFEH 2JJSA 5KSUA 2JF1A 4JLRA 4LSTH 4FFVC 4ZPTA 4K7PX 5GGUB 1JZ7A 1N0XH 2DOCA 4S0TD 1EHAA 5FYLL 3TO4B 4LSQH 3QIUB 4L4TA 3U83A 1I8LA 2ADIA 3KPNA 1GZPA 3GK8L 4PJGF 5F6HJ 1CIUA 5JA8B 5EZLA 2X89A 3JTSB 5BJTA 4JPKL 9CGTA 1RZIB 1B0RB 5FXCH 3LIZL 5GRVK 4W81A 5JOPE 1HHKB 3QDGD 3OX8B 4XMKH 1YUHA 2NY6C 5ESVA 4W70A 5CJOH 5TF1L 2OTUA 5BZDB 3ZSTA 5HDQH 4PB9L 3S35L 3EYFB 3VRLE 1QRNA 2WW8A 4GW1B 2VSDA 3QIWB 4RX4D 2MNUA 4E9LA 5KVFH 2VZUA 3H9SB 5FYJD 5BS0A 2YUXA 2APVA 2HFGH 4JZJC 3L3OA 1TITA 2EIZA 5LGJB 4ONFL 4YHYB 1OSZB 1ZE3C 4JO1H 1U95B 3KNBA 1U8OA 3HA0A 1FO0H 3QRGL 4P46B 3F65A 1IILE 2K7PA 1DLHA 1S7WB 5E2WH 2R2BB 4OIIH 4G6ML 1LO0H 3AMKA 3AROA 4XPAH 4EVNB 5FK9B 2MQ0A 2D7MA 3VXMD 1OAUH 3S36H 4PY8I 5FHBH 3U36A 5I1DA 1X6NA 4D9LL 3DO7A 3P4NA 3JTTA 3MRBA 1RUAH 5C0ND 1MHPL 5I16B 1FVCB 1P7QB 1VFAA 2Q8BL 2EZ0D 2LAAA 1XF3A 5JUEH 1ZA3B 1KBGL 5D7SH 3MSPA 2YD5A 2EKSA 4QHMB 5DWUL 3ULVH 3SDDA 1P7KB 4JM2F 4KJPC 4HWNA 5F1IB 3H9HB 1NANI 2NW2B 5D1QC 4MWFA 5T3ZH 1AKJA 2QQLH 4AG4H 5BO1H 1E4XI 4KHXL 3SCMA 1NJ9B 2A1WL 5B3JE 3MOBH 3TO4D 4PTUA 3BKML 4H0GA 2X1OA 1J12A 3QIUD 3ELAT 5D7LB 3FQWA 3BHBB 4XNUL 4ZXBA 3LKQA 4XNXH 4D3CH 1UCTA 4ODXA 4L5FL 5HI5D 3DX6B 2M2DA 1IGMH 2HVKB 1QVOA 2X4TA 5EZIL 2ZKHH 5IV2A 4XP1H 4LPYA 1Q94A 1U3HC 1CD9B 5CP7B 5LGHL 4P2RB 3MJ8B 3U6RB 1F2QA 4PJ8A 3UJIH 3QIWD 3WN5A 2GSIA 3TFKC 3IKCB 3H9SD 2X4PB 3DX7B 3NIDE 4PJEB 4RAVA 4LLWB 1CU4L 3EFDH 1U8JA 5CD5D 2ZCHL 3ARBB 1NEZG 4P46D 1M6OB 2R23B 4PIRF 2XFXB 1OGAE 2P47B 1NQBA 4NQCE 3T0WA 5TPWH 5ECJE 2AABH 3UBXI 3HG1A 1WISA 2C3XA 3FKUS 4OSUL 5C6TH 1N5YH 5D7KE 5DMGC 2EH8L 1G1YA 1ORQB 1T04A 5F7DB 4LLUB 4Y16C 3T2OA 1T03L 3WJJA 4XAWH 4YR6A 5JZ7D 1LHZA 2IPKB 2EICA 1CF8L 1CE6B 3QFDB 1ORSB 2R4SH 3T1WA 4EI5A 2BDNL 3HRZB 4AMKH 4LDOB 1RUMH 2F74B 3MRRB 2N1KA 5D1QB 4NQDE 2FSEB 4XCNA 4NT6B 4AM0B 4X83A 1R0AL 5C8JA 3HR5B 3O6MH 4FFVD 1A3QA 4Z76B 3OKYA 4GRLC 2AQ2A 2O5XH 4LLMA 4UQ3B 1FZMB 4ZTPH 5C0CA 2XXMB 1YZZA 1HINH 1IGCH 2BCKA 4MSWB 2HFFA 2AI0L 2QR0A 3DVIA 3L3GA 1HZHH 2IGFL 3NFNA 4UBDD 3LPGA 4ONHA 3N1FC 5HHPA 1A6PA 4M02A 2GHWB 2AJSL 3LKPA 4U6YA 3NCFB 4X6BA 3RJQB 1PGRB 4XPHH 3V0AC 5B38G 3KXFA 4QHLA 1OAQH 4JRWA 3SGJC 1U3HB 5AYUL 2PTTA 3CK0L 1FRGL 3DHMA 5BZWB 3UTPD 5IT2L 4OZIF 1AFVH 4QHNA 2UUDH 1QR4A 2W9DL 3OAZH 1MHHB 3R1GH 3R0MA 1A6ZB 3AU1B 4NNXA 2DI7A 3IRPX 5BRZE 3CX5J 1CDJA 3O3BB 3BIAX 3PWPE 3RDTC 3OB0H 5CJBA 4ONOA 4P2RD 4OF3A 1IL1A 5C0BB 4EDWH 5CMAA 4NNYB 1HKLH 2K3TA 1MCPL 3I75B 4HK3J 2J7LA 4Z0BL 2WNGA 4MXQD 1QEWB 1MAMH 2EXYD 3MUHL 1G9ML 1T7WA 2QSTA 1MCRA 2BZDA 5DXWA 3CH1B 3WHXA 4JO4L 3VD3A 5CWSA 1T5WA 3D9AL 5B39G 1MRDH 4CN6A 2BRQA 4HKZB 4RGNC 2APTA 3MLUH 2YA1A 5KG9B 3K80A 1KB5L 3ARBD 3LEYH 5FM8A 3P73B 4CVZB 5EC2A 1NC2A 1T1XB 3QDGE 2VTFA 3RL2A 2Y5EA 3ROOA 1YPZF 4Y16B 4MB5A 1OD9A 4J3SA 1IKFL 2PR4L 3B9EA 3GIZL 5F1KC 4KDWA 5I1CL 2AK1L 4NZTL 3P0YH 2B1AH 4JPWL 5FYKL 4HBQA 3QHFH 1YNTA 3KLAB 2R2EB 4NO5A 4IHOA 3IGAA 4OUUA 4LVEA 3FOLA 1LVEA 5FYJE 3WCYA 4BFBD 3RZCA 3NZ8A 1J10A 1J87A 1MHEA 1I8MA 7CGTA 1Q0XH 1NEZA 1FFOB 2QSVA 2XWBA 3RL1B 2BSTB 5HHXL 4KJPD 3GSWB 1L0XA 5IHBA 4GRLB 1IAKB 3E8UH 5D1QD 5T33H 4U1KA 2XWTB 4PB0L 1RJZB 4XP4L 3GJEB 1WQVT 4WDIB 1GGYA 1OT2A 1G9MC 5INCB 3VGBA 3FONB 3OAYH 4EBQH 2AJXH 4ZYKB 4G5ZH 3RIFF 5ISZB 3LN5A 1ZSDB 3E6HA 5GIRB 2D7OA 5LBSL 4I3RH 3VXME 4NUJA 1OTSC 3MV9A 1F3JA 4N0UB 5CBAA 1IC7L 1A6TB 2DI8A 4MCYA 1VHPA 5KTEH 3O3AB 3NH7H 1VKXA 3EDKA 1U3HD 1P7HL 4XBGB 5H35A 1MFEL 4Z78B 4QXUL 5I66A 3EJZD 4NCC2 3L9RB 3X14A 5IB4A 4W4OA 4MA1B 2F8OA 1AJ7H 4OFPA 3TFKD 5HHOB 2F5BL 5C0BD 3LN4B 4HUXB 1Q9LA 4BK5A 4KXZH 2ZCKL 3STZB 1RUPH 3CUPA 5D5ME 1H3XA 4RGNB 2FATH 2FLRT 1IEBA 3TNNA 5DEFB 5B38A 3IDGA 2BMKA 1MJUH 3UTSB 2Q87A 4OLZL 4FXKA 8FABB 1RVFH 3MQIA 1HHHA 1YMMB 1CD1A 4HIIA 2GK0A 1D5MB 4NKOB 5EOQL 5JPNA 5DS8A 4EDXB 5JOFA 5DMGD 3SQBA 2C3HA 5EU6B 3K4ZA 5DHXB 2XYCA 3J7HA 1ZWIB 4O2EB 4JG0H 2AXJA 4RZCB 4Y16D 1NMBH 2D7QA 4ODVL 4Y4HB 4IMLB 5SWSB 5IVZA 2VITA 2A6DA 5JHLH 2WBWB 1U6AH 3KJ6L 4MX7A 5HD8D 4LFHD 1OSPL 3VGEA 3AM8A 3BD5A 5B39A 4HAGA 2YD6A 3OZ9H 3KPMB 3H9SE 1AQKL 4KTEH 3D6GA 3RA7H 3B2VL 3QBTB 4L3EB 1GGUA 1X5KA 4R7DA 5ALCH 3OKEA 3DMMB 35C8H 4DW2H 1AQDB 3QYCA 4OQ1A 3LRSB 5JLZA 4RA0C 3T3ME 3KLHC 3MRKB 4NBXB 3L3DB 2B2XH 3AAZA 5IMOB 2WWMC 4KRNA 3UPAA 2NNAB 1Z2KA 1KB5B 3TESA 4O4YL 5DURB 3P3YA 5F7YC 4L8CA 5GGSY 5ISZD 5L6YL 4OTXH 1S5IH 1T20A 1A4KB 4ODUB 2ZUSA 4FQCL 2RFXB 3K2UL 4KROC 4LGSB 4JO3L 1KOAA 4HDIB 1YEDA 1DUZB 1U8KB 3GJFH 1ZVYA 4F7TA 1KEML 1MWAL 4ETQB 2MCPL 5JPMA 4Y19A 4RFEA 1IFHH 3MACH 5HHOD 2GIYA 3DV6B 1F4XH 5E9DA 2R8SL 1SBBA 3BP5B 1BP3B 3RTQA 2FH6A 4RGND 3GM8A 1C12B 3HPLA 3V6BR 2ZSWA 3MUGA 5DK3A 2DF3A 2EO9A 4GAJL 4J3OC 3RPIB 4FMKA 3UTSD 3VFTB 5K9QI 1A7NH 3DVFA 4DVBB 3DUSB 2FD6H 3PWUA 2F9BT 5LAXA 3DX8B 4IRJD 4X6EB 1YMMD 1PKQA 4YHPA 5D7LE 5H2BB 3QUXB 3LQZA 3GNMH 1VESA 1J1XL 3NACL 1DBKH 3KDMB 4XP6L 5JORA 4X0KA 1FH5H 3UTPE 5EU6D 2BFVL 4AEHH 4AIOA 5KSBF 1JFQH 3VFSA 3GMMA 4PJDF 3FO1B 1CQKA 3MRJB 4Y4HD 3OR6A 4LLDA 1JE6A 2DL2A 5SWSD 1U3JA 3L5XL 2I24N 4P2RE 3HLAB 3CC5B 5IHUH 5IQ7H 4LAQH 1ERNA 3DJ9A 2G2RB 3QWOB 4NJ9L 4JEGB 2NY2B 5BOZG 1BMGA 1FORL 4NDMB 3GMQB 5MP6H 1PY9A 4L3ED 3QIBA 5E7BA 2BSRA 1MJ8H 5IESH 2CK2A 2ZWLT 4C54A 5J12B 3DMMD 4PJEE 1X4ZA 2D9CA 2CRZA 1DQLH 5F3HA 2F19L 5E6IC 1L0YA 2IFFH 4HK0B 3JWNC 2ADJB 1NCWH 4BKLA 2I5YL 1SJHB 3DSNA 2Y36H 4PY8J 5IBTL 4DZ8A 2I25N 4RAUB 1S7RA 5DURD 1F42A 4FNLH 1R24A 4L4VB 2ZPKL 2VDNH 3GEWB 4KROB 1PFCA 5DI8B 3CX5K 1J1OH 4QYOB 5CJ8A 2VLRA 2HG5A 3PDGA 1MPAH 2DQHH 3MR9B 4X8JB 5SX4H 5GS1A 4PJHA 4QNPF 3BZEA 3BD4A 3QPXL 1ETZB 3SDXF 4LCWA 4GW5B 5H94B 1EHLL 2YRZA 4MHHI 3O4LB 1CGUA 3M8OH 1CDIA 3GMRB 3AVEA 5DJZB 3UJJL 1UENA 1FE8H 1UA6L 2FHBA 2V9TA 4KKCC 3CJJA 5MENB 3EDDA 3LEXB 4UINL 2EEDA 1TJHL 1A6AA 2X4QB 4OLVL 1MH5B 1LEKB 4JREC 5JIHA 1YEJL 3E0GA 4TN9A 4K55A 1HE7A 2A6JA 3H7BB 2GW5A 1RUQL 3QNXB 4NHCL 1ITBB 2BVPB 2DLHA 5H37G 3TLRA 4ACPA 3CVHL 2XPGB 4KFZC 5C08A 4AJ0A 4XXCA 2GFBA 2LVCA 5T5FH 3QUXD 4POZC 4NFDA 5GGTL 2CMRL 1DBAH 4WTXA 1BJ1H 3P4OA 5DK0B 5BV7H 5DRNA 2FEEL 4N0CC 4P9HH 3L3IA 2YWZA 2MKWA 5FKPA 1G9EA 4Y2DC 4JPVL 3EYUH 5KAQG 1MWAB 1W0WB 2YPLD 3D0VA 1FFNB 5C0BE 3BQUA 4J3UA 1KN4H 4HPOH 2NY2D 3ARDA 2A77L 1IAOB 5DEGA 1C16B 2VO5A 1LO3L 5E6IB 4I3SL 1B4RA 4M6NH 3FQTA 1SYVB 2ENSA 3D18B 1D5IH 3KLHD 1QQDA 3CFBB 4GKZA 2WUBL 1LO5B 3PUCA 3HZYB 3P30H 5IP4A 5CP3A 4S1SL 4J8RA 5FECA 2HJLB 3WIHA 3MA7A 3DARA 2WSKA 1KLUB 2FZ3B 4J4PC 1ZGLB 3CSYA 5E95B 2HFEB 3NVQA 1LD9B 4JDTL 4OD1H 4L4VD 3Q5OA 3LD8C 4F3FB 1NGYB 1P4LB 2VRAA 5BVJB 4MAYB 4OJFL 4KROD 1DANT 5DMIH 4PRNB 3TWCL 1U8IA 4UOW0 1RJYA 2VB5A 1XGQB 1ZA6A 3T4YB 3CDYA 1JGVL 3S5LB 2QQKH 4Q0XH 5I8CB 5IF0A 3V5KB 2EH7L 3S88L 2E7MA 3LKNA 3S3PA 2CLVA 1XCTA 4AQOA 2VSCA 2O26U 3O4LD 1M71A 3IJYA 1H3GA 2VZ1A 2X1WL 5DJCA 3C5SB 3ZDXF 3BPCB 2N7AA 5ESAB 3BIBX 3P0GB 1BWWA 4JREB 5MEND 3MRNA 4GKSB 2CDEB 3QFJA 1HH6B 5DJ2B 5E99H 1SJXA 1HXMA 1ACYL 1B90A 5ISZE 2FBJH 1EGJA 4HS3B 4BUHA 1A4JB 1M7IA 1RSFA 1HH9A 2JK5A 1MUJB 4UTBH 4N0UE 4RRPG 2V2XA 3AS0A 3RWJA 4D9QE 3NCYP 5KS9A 4JN1H 3GI9L 1MCSA 5HI3C 1J18A 5M94B 3T2NH 4PBWD 5EN2A 4Y2DB 5I0DA 3ARPA 1JGDA 3FT2A 4JDVB 1BOGB 4R26H 3OWEA 2NY3B 3PNWB 2L4OA 1I7TA 2MQ3A 4P9ML 32C2A 3V6OA 1GGBL 5HHOE 3RY6A 2HTKC 3LEVH 4S2SB 2E8ZA 3ZKSD 2Z8SA 3A67H 1A6UH 3G9VA 3F58L 4JHAH 4FN0A 3TA3B 4RGNE 1F8TH 4BH8A 2D0FA 2DRUA 5E6ID 2QV2A 4XCCH 3UTSE 4G80A 4JDZA 1HQRB 4LGRB 4CVXA 1YMME 3WFHB 4YHML 3LSOB 4YGAB 1IJ9A 2IH1B 2D4FA 1VACB 3VRIA 1UM6L 1TJIH 3LD8B 3PGDA 1EEZB 5EU6E 4W6XB 1KPUA 3WFEL 4DGIH 1G6VK 2E27H 3BW9B 1M05B 1KT2A 2Y4SA 4LSTL 3ZL4H 5SWSE 4HH8A 2VH5L 4MAYD 2VQ1A 4AENA 2YD8A 1N0XL 2OS7A 1X5HA 2IBZX 3F8UB 4N0YL 3KYNA 5IR1B 5GRZA 1WWAX 4I8DA 43CAB 1MEXH 3WFBL 1W8OA 3CMGA 5KOVC 3RAJH 1GH7A 3G5XA 3O0RH 4L3EE 4WUKH 1RY7B 2BNRA 2ZZUT 2AK4A 4KKCD 3V7MA 4B0MM 2A0LD 5CJOL 3GSQA 3INUL 3VXQB 1ZKAA 5FKAB 5GS3A 1OF2A 5HDQL 3HRPA 5IW1A 2HFTA 5DFVC 3F6LA 5JQ6L 1AGBA 5EOTB 1FL5B 4U1IA 3VCLB 1FSKB 2X1PA 4HWEL 4IMKC 4JFPB 2APWA 4POZD 2HFGL 1UZ6F 3ABZA 1S9XB 4CU6A 3WKMH 2QHRH 5AUMB 1S7SB 4JO1L 4MQ7B 3T0XA 4CW1A 5I1LB 3S34H 3ZYIA 4ZFZB 5HBBA 1FO0L 4YAQB 3K1KC 4E5XA 3MRMB 2ARJA 3BEVB 5E2WL 4LPVA 4XGZA 5I30H 4OIIL 3ES6B 1LO0L 1KCUH 4M5YL 2IH3A 4K8RH 2NY3D 4XPAL 3RI5F 2YD4A 5F96H 4UIMB 5C92A 1OAUL 3S36L 5HGDA 5FHBL 3HB3C 5CP3H 4UDUB 4PJ7B 3JV0A 2EDKA 4M7JH 4LNRB 4ZOAA 3WIHH 3TA3D 5EDXA 5D72H 4RRPA 5I8OH 2YMXH 3FRPA 3DGGA 1JN6A 4LMQI 4NM4L 2FB4L 3TNMA 3MNVA 3VU2A 4ALAL 5D8JH 5I17A 1UB5A 3BOVA 5D7SL 3JBG7 3MNWB 1AP2B 1YQVH 1VFBB 1ES0A 3ARGA 4C56B 4F33B 1NAKH 3MREA 1NMCB 2OI9C 4HPYL 1ACZA 3MGOB 1WITA 4JHZA 1RHHB 4AG4L 1N4XL 2Z0BA 5BO1L 2ZP0T 2FJGA 1NBYA 1WEJH 2NX5B 3MOBL 4OLXH 4TRPL 4P5KA 1YN6B 2QADC 4G9DB 4XNXL 4RBPH 4D3CL 4WU5B 1A1MB 3HC0A 1N2RB 2BHUA 3V4VH 4GG6F 1MLCA 5D7JD 3TO2B 1IGML 3KPRB 3FN3A 2ZKHL 1EGJH 3PJSB 3NBNA 2R69H 1FYTA 1SEBB 2ICEA 3V7AE 5KAQF 4K2UL 2P8MB 3O9WA 4U1MA 3O41B 1UB6A 1LE9B 4HV8B 4F7MB 3FFDA 1KCLA 3UYOD 4M1GH 1JWUB 1YQ2A 3KYOB 5EUOB 4WI7A 3FOMA 3PQYA 1OTTC 4L4VE 4ZUVA 2AJZA 2BNQA 3LS5H 2VLJA 4GAYA 4ZUWA 1YEGL 2NW3A 4I4WB 4XVJH 3BVNB 3EFDL 3QUYB 4LP5A 3ULVC 4Y5VA 5KZCB 5ILTH 2BVEA 1KPRB 1FVEA 1FL3B 3BMVA 2IFGA 4NSKB 4UU9B 1MQKH 2P8PA 5TPWL 4YE4H 5IK3A 2AABL 2HTKD 4WFHD 3QPQC 2GT9B 3VFPA 3O4LE 3NFSH 5DD3H 5C3LD 3BH9A 4MQXC 4RGMC 3CD4A 1B0WA 4HJGA 4HJJH 4U6XA 4N5EC 4PS4L 4NFBA 1A8JH 5MENE 3I3BA 4XAWL 4L9LC 4HXAH 3EHBC 1ZEAL 4IDLA 1OQXA 2Z35A 2R4SL 4IOIB 4UT6L 5FYKU 2P24A 2MWCA 2BRRH 3LS4H 3PHQA 3GUTA 4O2FA 1CFQB 1QSFB 1HYSC 4P5TA 3DSFH 4NQVA 2AJUH 4X7TA 1RUML 3RGVA 4OM1L 2OI9B 2G9HA 3MRHB 4JY4A 4J7RA 1K8IB 3BD3A 3O6ML 3FB7A 5E8PA 2O5XL 4C56D 5C1MB 4ZTPL 4YHNB 3MODL 4Z77B 4R4BB 5A16A 1HINL 1FO0B 3MCKB 5MI0C 2QADB 1YYML 1KTRL 5EA0L 5E56A 4UOJA 5GS0H 2NX5D 1UM4L 3BYYA 5T1LA 1QBLH 1V8HA 2OTPA 1BVLB 2DD8L 3I6KB 4CKVX 2V7HA 5E5UB 5JHDB 3BIKB 4Y4FD 4KMTL 1OAQL 3CSPA 3OF6A 3IDYC 5E0QA 2BVTA 3D85A 4YDKL 1KJ3H 1AFVL 4NO3A 5DVNA 4YH6A 4U7KA 5EPMA 1WLHA 2J2ZA 3KPRD 4DKDC 3LKOB 5GRYA 5KVDH 3X11B 5K9JH 1P53A 2I07B 4XTRC 2PW1B 5IVXF 2Z92B 5JMRA 3LCYA 2Q8AH 4WW2C 4G8EA 1HKLL 1WZMA 4WV1C 2JJSC 1MAML 4H20H 3A6OA 4ENEC 3EZJB 4S1RL 4HQQH 4X9GA 5JIPA 5C0RH 5GGVH 1UEYA 2QKIB 3W2DL 4PGJA 3I6GB 4TQEH 3OXRB 3QUYD 3QZWA 1I8LC 2HKHH 1ZANL 3LEYL 2Z31B 5KZCD 3HMWH 4XB8A 2DLGA 4RGMB 3DYMA 1F58H 3O3EB 4G8IA 5DJ8B 3DUHA 3WXVH 4BQ9A 4DGYH 1A1OB 4CUCA 5JW5B 2YOCA 4L9LB 4WTWA 1I7UB 2WINB 5I71C 1MCDA 1BZQK 3W0WD 3OKMA 2B1AL 4LRNH 4HUVA 1B0GB 3P9LB 4G8FA 5EO1A 4HS8H 5EO9A 2XZAH 4Z95H 3MLTB 4I2XA 5J6GA 1TTFA 3GBLA 4RWYL 3V79C 2IWGA 1MCOL 2MOVA 2YRLA 4LCYB 3Q5TA 4LRIC 3GSOB 1SM3H 4GRMB 2C1OA 1FAIL 2IAMB 1B6UA 1QSFD 1ZLSL 2YN5A 1ZLUH 5DUMH 4XNQB 3E8UL 4MA7H 5T33L 1KC5H 5MI0B 4UNUA 1E0OB 4R97B 1HI6B 5K59F 1U8NA 1FNEB 5T5NF 1IAIL 1JNHA 2FHFA 4MD0A 4G5ZL 3B83A 2QADD 2NQCA 3OG6B 4I3RL 3MBXH 3IDYB 4PJAB 1K85A 2VABB 5EO0A 2YC1B 3BZFB 5KTEL 3NH7L 2EDFA 1PDKA 4NHUB 2GAZB 1A3LH 5FF6B 2EDJA 1Z5LB 4WJ5B 1U8MA 5J4MA 5T1KB 3I02B 4LVOC 3WIFA 5M7QA 4WV1B 2P5EA 5KSUB 1AJ7L 5TE4H 3VE0A 5JXEA 4JLRB 3SDDC 1OTTD 5ADPH 3JV4A 1M7DA 4ZPTB 2QQNH 2E6QA 3V52H 4HWZA 5F9OH 4PRAA 2DL9A 4L4TB 2J8HA 1HSBA 3ULVD 2ADIB 3KPNB 1MJUL 1GZPB 3SCMC 1CLCA 5EZLB 5BJTB 3L7EA 1T1YA 5T3ZD 4KDVA 4FQLH 1CGSH 1MRFL 4ZXBC 4YDVA 3RNQA 1UH2A 1YUHB 2Z31D 1Q1JH 3EFFA 1TCMA 2XRAH 2VDKH 2ATKA 3QUML 5ESVB 5I71B 4MQXD 5F71A 2Y1VA 2OTUB 1ZT4A 3HTLX 2BOCA 1QRNB 2X40A 5J0BA 5A2FA 1SMAA 1JBJA 4HZLA 5BS0B 3VFOA 2I26N 1WZ1L 3HNSH 5BMFH 2BY3A 3L3OB 2HTLD 1MVFA 1T5XA 3TCLA 3HCVA 5J1SC 2EIZB 4PJ8C 3JUZA 1E28B 4JZNA 4KTEL 3RA7L 1WIUA 1K6QH 3KNBB 1U8OB 2PYED 5EBMA 5JIIA 1CLOH 5ALCL 1JK8A 2IAMD 3QR2A 2BY2A 3TBYA 5DA0B 1DLHB 5F7WC 1DQJA 1A02N 4HGKC 5I9QB 4HUNB 2B2XL 3CFJA 4GLRH 4NZJA 1A7RH 3QWRA 1VERA 1RZJH 2UZIH 4WFHE 3U36B 1MFDH 2IMMA 4WI9A 4ZFGH 3DO7B 3P4NB 3JTTB 3MRBB 2DMBA 4MLSA 5C0EA 2VDRL 1EZVX 4G42A 4TNWK 4XHJC 1S5IL 5GGRA 1VFAB 1TTGA 2XA3A 3WJJC 4PJ7E 4UV7H 3MBED 1XF3B 5I76A 1R5IA 3O3UN 3QI9A 2EKSB 4XTRD 3SDDB 3J8F7 5T1KD 4PJIA 4JR9H 2RQ8A 4QGYA 5IVNA 3HNVH 3WD5H 1L6XA 4MWFB 1AKJB 1IFHL 4ORGA 3PG2A 4NZRL 4ENED 3SCMB 1F4XL 2ERJB 4PTUB 4C56E 4L4TD 3FFCA 3FQWB 4ZXBB 2E9WA 3LKQB 1AD0A 1A7NL 2NX5E 2IPTH 5E1HB 4ODXB 3TZVA 3TIEA 4KQ4H 4S0SD 1G6RA 4MAUH 3B2UC 3GNML 5IV2B 2PF6A 3EKCA 1DBKL 4PLKC 1I8IA 4YZFE 4B50A 1FH5L 4P99A 1FNLA 2UVEA 5LWYL 2VL5A 3CXHJ 3PHSA 1JFQL 3KPRE 2ADGA 1QFOA 4QXTA 1BJMA 1CT8A 4PJ8B 1QRND 3C60A 3WN5B 2GSIB 4LHJB 4O02H 3VFWA 5IHUL 5IQ7L 5BS0D 2CIIA 2XXCB 5L9DH 5HGBA 5EUOE 3WHE1 4CU7A 4RAVB 5J9PA 1U8JB 4FQ2H 5MP6L 5CGYC 5TFSH 1DEDA 1MJ8L 5IESL 4OI7A 3HUJF 2GCYA 1DVFA 5EFIA 1R3JA 1G84A 4MZ3A 3HG1B 1R3IH 1T0PB 5DO2C 1NCWL 2C1PA 4KRPC 1T04B 5I2IA 2HJKA 1DN0A 4YFDB 5F89B 4FNLL 4TULL 3VRJA 5BVPH 2VDNL 3IFOB 4R96A 5E5MA 1J1OL 1DBBL 4Y5XA 4HW6A 3HI5L 4EI5B 1K9TA 1MPAL 4CL7A 1T22A 3RZCC 4XCNB 3VI3E 3PV6A 4YLQT 4I18A 5C8JB 1QSFE 3SDDD 12E8H 1LEIA 1XF1A 3UP1A 1CFSA 5C9JA 3M8OL 4LLMB 1E4WH 4PLOB 5D2NA 5C0CB 2BCKB 1AKJD 2HFFB 1FE8L 2QR0B 3L3GB 2VE6A 4ELMA 5KSAA 4FXLA 2IALA 3NFNB 3SCMD 1NGQL 4ONHB 4GRWB 5HHPB 4TTGA 3LKPB 4U6YB 1VPOL 1YEEL 3QXDA 3KXFB 4ZXBD 3LDBC 3VRLF 4QHLB 2R0LH 1YMHA 3IDUA 2PTTB 3BRFA 5F1NB 3SO3B 3B9KA 4QHNB 3QQ4A 5JHDE 2JELH 5ID1A 4NNXB 5JXAH 4M93C 3RU8L 4QXWA 3FQXA 4LP4A 5GJTL 1X5JA 5DTFA 3K2MC 1NKRA 3BDYL 3L5WA 3H9ZA 3T08A 4GXUM 4UIKL 1IL1B 2AVGA 3C09C 3OSKA 4P9HL 5CMAB 2PXYA 4X98A 4PJ8D 1CS6A 4MCZA 2M1KA 3GJFB 4NKIH 1ONQA 3WHXB 4HMDA 1BZ9A 1KN4L 4HPOL 5CWSB 3TN0A 4ZUTA 4M48L 2P44B 4YBHA 4Y2OA 2B20A 3ULVE 3LN9A 4M6NL 1S9YA 3L3JA 4LPUA 2BSSA 5ACLA 5T3ZE 2L7UA 5EC2B 3AUVA 1KPVA 2FYYA 1NL0H 3RL2B 3P30L 2A6IA 4XCEA 3ROOB 5LKNA 4J2XA 4OZ4A 4JY5H 1J9CT 2C3GA 1IT9H 4XPTH 4XHJD 4F8TA 3UO1L 1YNTB 4L3AA 3FL7A 2LE9A 1FL6A 4IHOB 2UUDK 3OAZK 2PYFA 4OUUB 1E6JL 5DVOA 2I60H 2D3VA 3FOLB 3RZCB 3NZ8B 1HEZA 1MHEB 1I8MB 1NEZB 1MOEA 4IOSD 4EI5D 5B3JF 3OB0K 1FHGA 1UKTA 1LP9A 1M4KA 2QQKL 4Q0XL 2H3NA 1OARH 2YKLH 4P9HC 4U1KB 1E4KA 1OLZA 1FNAA 5DHVA 3WXWH 3TH4T 4IDJH 4CVWA 4AL8L 5C0CD 5FA4B 3LN5B 3E6HB 1ZGLM 2V9QA 1S8DA 3LDBB 3S7GA 4JFEA 1FNHA 4NUJB 3LKSA 4LLYA 3MV9B 1F3JB 5CBAB 5SWQA 3JWOL 1F90H 4MCYB 4NGHH 1RMFL 4U1JA 2FBJL 3B2UD 1VKXB 3UYRH 2RGSA 4M93B 4M1DH 2KQNA 3ILQC 4PJAE 5HPMB 4PLKD 5H35B 1GRWA 3HE6A 5C0JA 4ELKA 5I66B 3A6BH 3MJ6A 3B8SA 3X14B 1UXWA 2Z91A 4PJFA 3NIDF 4JN1L 5IB4B 1HDMA 5I8EA 3T2NL 2AGJH 1BJ1J 1XMWA 4R26L 1Q9LB 2P45B 3CUPB 5F3BA 2HKFH 2NY4C 1IEBB 4W6WB 2BSED 3BT2H 3TNNB 1KENL 5B38B 4RQQA 2OX5A 2RR3A 4P4KA 2P7TA 4FXKB 4K7PH 3VW3H 5I8KH 1FZJA 5F7HA 4WRLA 1FFQA 1F8TL 1HHHB 3SGKA 4OZHA 4L4TE 1CD1B 3ULUL 4ZO9A 2P43B 4JFXA 1A2YA 3VFRA 4HIIB 2GK0B 4XCCL 5BCAA 5JPNB 3OAYK 4M3KB 4OB5L 5DS8B 1QBMH 5JOFB 4G8GA 5DO2D 1F4WH 4OCLC 4XXDA 1CIDA 3QEQA 3NABL 1F4YH 5IVZB 2VITB 2A6DB 1K8DA 4Z0XA 4MX7B 1IC1A 4DGIL 2YA0A 3JSSA 5FGBA 2OR8A 5B39B 1QRNE 2P8LA 3ZL4L 4P5MA 5BV7B 3RZCD 5BS0E 5GHWL 5TDPA 3SQOH 2NXYC 1CE1H 4U4BA 4R7DB 1C5DA 3VFGH 5JQHC 3C08L 3OKEB 3ZZ1A 1MEXL 5EOCH 1FZOA 3RAJL 4UILH 5DZNA 3O0RL 4WUKL 2GJ6A 3V8OA 3QIBC 2RIKA 4FRWA 4LQFH 2JKXA 4OF8A 3OJ2C 3HE7A 1O7VA 4OZGA 5IQ9B 3OKKA 2APXA 1CL7I 1WBYA 1RZGA 4L8CB 1NGZA 3ULUC 1FV1A 1T20B 3MV9D 4ZS6C 5I18H 3CXHK 5GGVY 1CVRA 1P84K 4PRHA 4RCAA 1SBSH 3DVNA 5C70A 1AO7A 4J12A 1YEDB 3WKML 4F7TB 5FB8A 2MKLC 5JPMB 4Y19B 4M6MH 3VWKA 5A2IH 3QCTL 1ZV5A 1AE6H 2CRIA 3MLXL 4RFEB 5IMLA 2CUMA 5I30L 2NY4B 5HTSA 3O2DA 5E9DB 2PN5A 5J7CC 3MLYH 3QUKA 4O00A 3ARYA 3RTQB 3HPLB 4ZG1A 3MUGB 2H1PH 1YC8A 2GSGA 3BX7C 3WIHL 4P0DA 2WMPA 3PWUB 5I73C 5LAXB 4GKOA 1PKQB 4YHPB 5D72L 5I8OL 4C55A 2HP4A 3LQZB 4HIXL 1NMAL 5JORB 5D8JL 4X0KB 1YDPA 4XXCC 1T89C 3X12A 3VFSB 5ICXA 3GMMB 4WY7H 4YDLC 1Q9OA 3OR6B 3D1MC 4LLDB 4M7KH 1NAKL 4F57L 2G75A 2NXYB 1PSKH 1Q38A 3GJFK 1DEEA 1T21A 1DR9A 1MFBL 3ZE2E 5ITBH 3WDJA 3KVQA 4OLXL 2C4XA 1JPTH 3BQUC 3QIBB 2BSRB 3QDJA 3F7VA 3ARDC 4GS7C 4KJQC 1NCTA 3SN6N 5KVGL 5F3HB 4UDTA 5DEZA 2PUQT 1IKNC 3V4VL 4PV8A 4BQ6A 3AC0A 3F7RA 3VGHA 5I1GH 2VWEC 5DD0H 4BKLB 5F9AC 4NZUH 2R69L 3EO1A 2B7DT 4I77L 3HG1E 4DZ8B 3TEUA 1S7RB 2DQDH 3U7YH 1R24B 5HVHB 1UJ3A 4M1GL 1TNMA 3FQNA 3G5ZA 2VLRB 3ILQD 2HG5B 3MRPA 1CFVH 5IFAH 1ZHBB 3LS5L 5D5MF 5GS1B 4D2NA 4P49A 4PJHB 4XVJL 3TH3T 2A9ML 3BZEB 5CIPH 5FCSH 3SPVA 4LSRH 4CN4A 1BBJA 4LCWB 4CAGA 5E08H 3AS3A 1JGLH 1BIIA 4UV4L 1PD6A 3RBSA 3IRZA 1IGIH 4X80L 1MQKL 5DMKA 3HI6H 2NY4D 1UADC 1UVQA 1HSAA 1Y6KR 3NFSL 5DD3L 2E5EA 1S7QA 3RTQD 3RX5A 5C0CE 1A6AB 1TJGH 3FQUA 3NFPA 4HJJL 5ICYA 5I73B 1INQA 4GRWE 1FNFA 2A6JB 4HXAL 3T8XA 4XMPH 3CPLA 2EE3A 5C08B 4NNPH 2JB6A 1RIVH 2GFBB 2EYRA 4NO0A 2QSCH 4G7YH 2DYPA 1PQZA 2BRRL 3LS4L 1XGPA 3ZT6A 3P4OB 5DRNB 3U4AA 3V2AR 1IEAA 3L3IB 3N1MC 1NH6A 3T0EA 4LMQE 2X41A 5L2KA 4K23L 3D0VB 3BJLA 2NXYD 1R3HA 3BQUB 5EU5A 1YN7A 2JCCA 4FG6C 3ARDB 1QHPA 4GS7B 5GS0L 5DEGB 1Q9WA 3RY6C 3FQTB 3QIBD 1UACL 1QQDB 5L8KB 4GKZB 1TPXC 2R1YA 1NCBL 4Z7WF 2X70A 4CMMA 1YY9C 3LQMA 3SE3A 1KJ3L 4J8RB 2LU7A 5FECB 4PJXA 5ANMA 3MA7B 2VR5A 5KVDL 1GPOH 2A6KA 3C8HA 3CSYB 5SWZA 1GXEA 1WIOA 1J0KA 1H0DA 3GHBL 1WICA 1DUYA 4S1DC 1DTUA 2Q8AL 1F3DH 2BXYA 4M4PA 3CXDH 1U8IB 4XVUC 2VLRD 5DFTA 1RJYB 1ZA6B 2Q3ZA 4H20L 4AEIH 4LSSH 3O2DH 5C0RL 3LKNB 3GHEH 5CZVL 4RIRA 2CLVB 1XCTB 2YEZA 1Q0YH 4TQEL 4WW1A 5CILH 3N1GC 2H2SD 1JRHL 3SDAA 4JB9H 1N8ZA 1YNKH 3HMWL 1U8QA 3CIQA 3IJYB 1KIRA 1FVDB 1YNLH 5I1AA 5DJCB 4BSVA 1F58L 4J1UA 5GJSH 5J1TC 3BAEL 5IMKA 2ICWA 5GS0C 3WXVL 4DGYL 3MRNB 3QFJB 3UXFA 4FHBD 1KEGH 1DLFH 1HXMB 2YK1H 4LRNL 4WFGD 3QCUH 1RPQA 2XZAL 1M7IB 1KLGA 4LSVH 1HH9B 4DN4L 2JK5B 3R8BB 3MV9E 3O6KL 5C08D 1T4KA 3EOAB 5C0GA 2V2XB 1P2CA 2EDDA 4X5LA 3F7YA 3RWJB 1SM3L 4DKFH 1OWWA 5KS9B 3PXHA 5J1AA 5J56B 1CDBA 5EN2B 2Q20A 3OBAA 1TENA 5DUML 1JGDB 3FT2B 4MA7L 4HZAA 4QO1A 4TPRH 1LNUA 4PJEF 5KANI 1ZAGA 1KC5L 1LDPH 2DKUA 1I7TB 1L9NA 4X6CA 3RUGA 4HS6A 32C2B 4YHIA 5HYQA 5E2JA 1BECA 5A43C 3ALPA 3BQUD 4OBRA 5C7XH 3H2WA 3ARDD 1HKFA 1TPXB 2W38A 4BH8B 5HDLA 3MBXL 4TVPH 1DQMH 1NCNA 3MJGX 4OCXL 4G80B 4K8RD 4KKAC 4JDZB 4X8XA 4CVXB 3ORJA 5AD0A 5FGRA 4QOKA 3SGJA 2VAJA 5GS2H 3VRIB 1VFMA 4TUKH 3PGDB 2DMCA 5F1SA 1KPUB 4HWBA 5IHZB 5TE4L 1KT2B 1RZKH 3QB7C 3QQNA 1A14H 3SDCA 2QQNL 2VQ1B 3ARGC 4GAGH 1OY3B 3MV7A 4AENB 2HMID 1NUGA 4AYFA 3K3QA 4O5LL 5F9OL 3KYNB 3SKNA 4GO6B 2DTMH 4QRPA 4WFFD 4WFED 3G5XB 1WUNT 2B5IC 4UB0H 5FYLH 1CGSL 2P5WA 2ZOLA 3C8KA 2PCPA 4N9OB 4OKDA 4QNPE 2AK4B 1Q1JL 2VDKL 3GK8H 3UDWA 5IFHL 3GSQB 2ED7A 4OLYH 1OF2B 3LIZH 3IKKA 4PRDA 5IW1B 3EYOA 3QFJD 4P3WA 4BFGA 2MTPA 1AGEA 3ARTA 1AGBB 1P4IL 3O9WC 3BPOB 4U1IB 2EC8A 4E0RA 2AQ3A 2OXHA 4PB9H 1I3VA 4BZ1L 1K6QL 1X7QA 4CW1B 1XF2A 3CFDA 1I4FA 2UWEA 5JW4M 4E5XB 2ARJB 4XGZB 1P6AB 2A38A 3VWJD 3KWWA 4Y19E 1GCFA 1H9VA 4NPYB 2IH3B 1NSNL 2IBGA 1BD2A 1UCBH 1CICA 4YBQC 1A7RL 1JPST 3C5JA 5HGDB 5FHAH 1MFDL 4ZFGL 5E9DE 4G6MH 3PXJA 4OF0A 4PBVC 3IFPA 4RGOH 2C9AA 3IDMA 4JHBA 4JFZH 3DGGB 1FLTX 1JN6B 1F4HA 4FQ1H 1YY9D 3TNMB 3MNVB 4KI5C 4G9FA 2BVUA 1UB5B 4ZUUA 1PKQE 1KGCD 4JANA 1OM3L 3WL9A 4CJ0A 1ES0B 3ARGB 3RGVC 4JR9L 1WWWX 1JZ5A 3MREB 4XVUD 3HNVL 3WD5L 1KBGH 2NMSA 3ZSSA 2FJGB 3FB5A 1NBYB 3EDFA 1FBIL 4P5KB 1J1PH 4JKPL 4FZEH 4DGVL 4JFYA 3PWVA 3NPSC 1B2WH 2WP3T 2IPTL 3HC0B 1XZ0A 4TNVF 4P59H 2X4UA 2C7UA 1IGTA 4KHXH 5C6WH 5IMMA 4KQ4L 1XR9A 2XKNA 4GMSL 1MLCB 3QG6A 2D0GA 3BISA 3K1DA 3QDMA 4MAUL 4XNZB 5GS0D 3QCVH 1VEOA 1FYTB 3M07A 4QXGH 2ICEB 4LLAA 1CXFA 4OFKA 3O9WB 4U1MB 3NCCB 1MI5A 1UB6B 4L5FH 3FFDB 5J06A 2WBJA 1QR1A 3P77A 4O02L 1RUKH 3FOMB 3PQYB 5LGHH 1T6VN 4ZUVB 2AJZB 2BNQB 5L9DL 3IJSA 5GISH 1EAJA 4PP1D 4GAYB 2NW3B 4NOFA 4ZUWB 3VXUA 1CGXA 1V7NL 2VLRE 2XQBL 2FX8L 4FQ2L 5TFSL 4Y5VB 1IAIM 1RIUH 3GSNA 3U2SB 1FVEB 4PJHE 4NBZB 3V5DA 1MCCA 3DX9A 4WI2A 2IEPA 2P8PB 5TDNA 3I9GH 5IB5A 4LCWE 5IK3B 1OTUD 2GITA 1EBPA 3VFPB 1R3IL 2EIEA 2ZCHH 4LK4A 5D9SA 43C9A 2MSPA 3BH9B 1MCQA 1JNNH 4HJGB 3DRQA 4YDJA 3Q3GA 4RBPK 4U6XB 2R0ZH 3EYQD 3L6FA 1C8PA 1ZXQA 4F9PA 1JTPA 1PY4A 1CVSC 3C9NA 4KKAD 2A74A 4JM4L 1FCCA 3GFUA 5AAMA 2EH8H 2Z35B 4HWBH 4WFGE 1T7YA 1AIFA 4WCYH 3MX0A 2NY0C 3GUTB 2P24B 3PHQB 1FGNH 4O2FB 2I9TA 4P5TB 4NQVB 5C08E 4KAQH 4X7TB 1CF8H 4HIEA 3RGVB 5L2JA 1FAKT 1I85A 1L0QA 1VB9A 4JY4B 4C59B 1A22B 3QA3A 5JDJA 5GRJH 4PJCA 4FQPA 4FTVA 3FB7B 4FFYH 3ARGD 4DTGH 1KELH 1QFPA 4ZAKA 1Z9OA 3KLDA 5A16B 1ZOXA 4OV5A 4KTDH 3VXTB 4R8WL 2CJUL 2V7HB 3D39B 4X7CC 3OHXA 1JYXA 2V9RA 2R0LL 3OAUL 3DECA 2IGFH 3GRWA 3D85B 3S96A 3NA4A 5EPMB 4NO3B 1S9VA 2VWEE 2DM7A 2AJSH 5JXAL 4AK1A 3MCLL 3G08A 4Q9CA 3AS1A 1FYTD 4GAFB 4MNQA 5ENWA 3O9WD 5DC4B 1FRGH 4U3HA 4PJBA 5D1XA 5EZOH 4G8EB 5C0AD 1WFNA 5D7IB 4NKIL 3PQYD 1WAAA 2BNQD 1G7LA 3CU7A 1JI1A 3QZWB 4TTDC 4YDIH 4WFFE 4WFEE 5FCUH 1JVKA 5HGAA 3OKOA 4G8IB 4LLQA 5EUKA 2A2QT 4JY5L 4BSWA 1IT9L 1KYOJ 4XPTL 2NLJA 5GQBA 3OKMB 1N3NA 5SX5H 4HUVB 1U9KA 3R8QA 5EO1B 5EO9B 4NM8L 3BI9X 4I2XB 5J6GB 3QFJE 4FQXA 1IE5A 3DWTA 5E8NA 4KI5D 3GIZH 2PR4H 2BVQA 4JPWH 5JIKA 5FYKH 3KPPA 5I0ZA 3AMLA 4P5TD 2LVEA 3TJEH 3IDNA 5GRUL 3RGVD 1OARL 1OCWH 4ZDHA 3U0PA 4XPBL 5KS9E 3HZVB 2OR7A 5E94B 1X5ZA 4MNGA 1QTYT 2R0WH 1U8NB 5HHXH 3X13A 4BZYA 4IDJL 1BFOA 1G6RL 1JNHB 4MD0B 1NLDH 4K9EL 4PB0H 3ZE0E 3V6OE 4XP4H 3IAQA 5EO0B 1FG2A 3BUTA 4FFZH 4YPGA 1F90L 2VZVA 5FO9A 1IM3A 3OJDA 3D39D 4NGHL 3UYRL 3OF6D 4PPTA 1SYSA 2XTJB 1HILA 3D85D 5LBSH 1F97A 2Y72A 2IADA 1LE5A 1U8MB 2G60H 1U8LA 3MNZA 1IC7H 3WJLA 2ICES 3WIFB 3QI9C 4DKEH 1KGCE 2VXTH 2P5EB 2WQ8A 3VE0B 2OL3A 3IU4H 1AR1C 3JV4B 5KW9L 1MFEH 1M7DB 4KK6C 3GSNH 4KY1H 3E1F1 2ILLA 4QXUH 4OKVA 4HWZB 3T3PE 5LJYH 4PRAB 5E03A 2C4FT 5FO8A 3BT2L 1HSBB 4M5ZL 5E8OA 1ZLUK 1HXYA 4K7PL 3VW3L 2F5BH 3L7EB 5KJRL 1T1YB 3OR7A 2ZCKH 4RWHA 4YDVB 3RNQB 2VXQL 1D5ZA 3EFFB 4JRXA 1QBML 2OLDA 4XX1G 2ATKB 4DN3L 5CJ5A 4OLZH 1F4WL 1ZLVH 1ADQA 5CKAA 3CSGA 1ZT4B 2BNUA 1U58A 2VXUL 1KB9J 3CNKA 4K9EC 2FEDD 2BOCB 2AK4E 1QD0A 3PDOA 5EOQH 4U1GC 4B5EA 4A6YA 4HZLB 2VDQH 5FOJA 3VFOB 3U1SH 3TCLB 1T5XB 1E27A 3HCVB 3C60C 2NY1D 3MCG1 2XG4A 2PO6C 4JZNB 3V0VA 4BA8A 3CVHA 2KPNA 3SQOL 5EBMB 3VFGL 3ZKQD 2VOTA 2VLMD 3TBYB 4ZO6A 5EOCL 5DVMA 4UILL 2X4NA 1D5XA 1DQJB 5DQDL 1AQKH 2JJTA 5GSRA 5I6XC 3B2VH 1NCDL 4LQFL 4OCWL 2ZUYA 3CFJB 1OLLA 3KAAA 1DVFC 3GRWH 5KVEH 3B8YA 5C0EB 5HHQA 3WMSA 1FDLH 4G42B 2LABA 3G6DH 4HG4J 3SKOA 5GGRB 3QUZA 3WDHA 3LRGA 2WM0A 3CDGA 1RD6A 1S9KC 3CZJA 3QG7L 1WZKA 5I76B 1SBSL 3QI9B 4Y5XC 2JLLA 2XTJD 5L6YH 5JOEA 2WIIA 4OZFA 1I9IH 3HC4H 4JQVA 4U1LA 5F9JA 1HWGB 1QA9A 4PJIB 5K9KA 4JO3H 1BGXL 1JNLH 4ORGB 3MZTA 4I18C 5HYIA 3I3EA 5JXED 3FMGL 1KEMH 5CFHA 2VDPL 3MXVH 4LLVA 2V7NA 5D2NC 3IAPA 3FFCB 5KSAC 4TTDD 3DV4A 3KPOA 1AD0B 3LPWA 3WLBA 3TZVB 2DMKA 3TIEB 1G6RB 1CDYA 3HFMH 4M6OH 3MRCA 4NYLA 4P3CH 4RNRA 1I8IB 4LHUG 4U1GB 1V5JA 3FHAA 3B9KC 2VL5B 3NIFE 2ADGB 1UGNA 4LDLB 4QXTB 3PGCA 1CT8B 4XAKD 3C60B 1NDGA 4ORZC 1J1XH 1FYTE 3NACH 3NCEB 5IBLC 1G9NL 3SDYL 2CQVA 3VFWB 2QLVB 5T3XL 1JZ2A 1QSEA 3QDAA 2CIIB 5DUPH 1BF8A 1PSKL 2OZ4L 3PWJA 3NAAH 5HGBB 2E7HA 5C09A 2Y6SC 1XR8A 1VADB 5J9PB 3PQYE 3L5XH 2BNQE 1JPTL 3B6SA 3TN0C 5I6XB 2Q1EA 2GCYB 3ARFD 3UROR 1G7IA 1DVFB 5EFIB 1R3JB 3OG4B 4TUJA 2X9WA 4HMCA 4DEPC 3ARWA 5FUOH 2C1PB 5KVMC 3QWRD 4BJLA 5I2IB 4F37K 1NBQA 2HJKB 4C83A 1I1AD 1Y0LA 3WHE0 1DN0B 2DQDL 5CJQL 2DQCL 2K7QA 4OM0L 3U7YL 3M17A 3VRJB 3WNOA 4R96B 4HSQA 5E5MB 3ILPA 4Y5XB 3SGDH 1HHGA 1OAXH 4WO4A 1CFVL 5IFAL 2OL3H 1AC0A 4KI5E 3B43A 5E7FA 1T22B 2WWKO 3QI9D 4N90D 1NKOA 4LIQH 3PV6B 4I18B 4LSRL 3VXOA 5E08L 1AR1D 2IC2A 1LEIB 1ITCA 4KK6D 3T1FA 1JGLL 2J6EA 1CFSB 5C9JB 5L0QC 1E4KC 5D2NB 2HJFA 3QPXH 1YEFH 2VE6B 3DBXA 5BRZA 4ELMB 5KSAB 2IALB 5CCKL 3WYRA 4PUBL 1EHLH 1IBGH 1TJGL 1EHNA 1Y6NR 5FDYA 1ADQH 3FFCD 3QXDB 2ED9A 3AY4A 3UJJH 5C71A 3BKJH 1YMHB 2B39A 4XMPL 3TZVD 5IJVA 5J6HB 5EB9A 1KYOK 4GBXA 4NBYB 4A6YH 3B9KB 2AV7A 4RFNC 4U1NA 4UINH 3QQ4B 3CCHB 4LBEA 3D39E 5DRXB 1KCSH 5ID1B 4OLVH 4ZO7A 2GKIA 3FQXB 1BQLH 5DTFB 3QDHA 3HE6C 3L5WB 4X9FA 3KLSA 2Q6WA 2ZCLL 2CD0A 3CVHH 3WKNA 1NC4A 4DAGH 2PXYB 4X98B 4ETYA 4MCZB 4F7EB 3EO0A 3MUZ1 2CMRH 5DUBA 4QWWC 5J57B 1ONQB 2R1XA 2V5RA 3V4UH 4LU5L 2V5YA 3TN0B 4ZUTB 2WV3A 4N8CH 5D7IE 1ZHKA 4ODTL 3WFCH 4P23A 4P4KC 4B53A 1S9YB 3L3JB 2HH0H 4DEPB 2BSSB 4OGXH 1FGVH 1MHCA 3MV11 4LHUA 4NQSA 3SGKC 1FN4A 2OBGA 1KPVB 1BOYA 1TQBC 2FYYB 4PJ7F 1DVFD 4XCEB 2XZQL 4OZ4B 2AJYL 1CCZA 1JGUH 3EJYC 3KPTA 2PTUA 5HDBF 4OUOA 4TSBL 4OZFH 5TE6H 1FL6B 2J4WH 4M62H 4S1SH 2PYFB 1HEZB 3CXDL 4NCC1 5E2UH 4I2XE 1LP9B 4LSSL 2J1KA 3O2DL 5DGRA 3MLPA 4WENB 2H3NB 5L0QB 3H8NA 3TWCH 2XI9A 5DHVB 5IBUB 5CILL 2VLME 4PGDA 4XVTL 2SEBB 4M7LT 2V6HA 3LH2L 1YNLL 5D2LA 3S98A 5GJSL 1S8DB 2APFA 5TQ2L 3HE7C 4YZFF 5CEZL 1BREA 3B4NA 4Q97A 5EG6C 4R4FH 1KJ2A 4JFEB 3LKSB 2YPKA 1DLFL 2HWZH 2YK1L 1T0MA 5SWQB 4RFNB 1KB9K 4U1JB 4YXHH 3QCUL 4LSVL 3VA2C 4HX1A 2KBGA 3HE6B 3B9KD 5C0JB 2O5ZH 2VISA 2E9BA 2YUWA 4ELKB 1PVHA 2W0KA 3QRFM 4M7ZB 1ACYH 1H15A 1BQHG 1UXWB 2Z91B 3OKLA 4PJFB 5HI4C 5IW6A 2XTJE 4DFHA 1HDMB 5I8EB 2EDHA 5IBLD 4KJYA 1WCQA 3VWKC 3JTSA 4KK5D 5C2UB 4TPRL 2PXYD 1GL4B 1MCJA 1LDPL 1OT1A 5F3BB 2VXSL 4JZOA 4E41A 1UXSA 3GI9H 1D7FA 2Y6SD 1QFUH 2FJHA 3G6JA 4RQQB 3HNTH 1DBJL 4P4KB 4XI5C 1JF6A 3TN0D 4YHKH 5C7XL 4FQJH 1FZJB 1WJ3A 4XH2A 4OZHB 3C8DA 4Q74A 1TQBB 4JFXB 5DVKA 1A2YB 3VFRB 1DQML 1A0QL 4FABL 3KHQA 2Q76B 4G8GB 4XCFH 4XXDB 4D9RD 3QEQB 4NC2B 3FN9A 2EO1A 4QY8A 3WV0A 4CNIA 1IQWH 2CLRA 1HQ4A 1F2XK 4TUKL 3HS0A 1RK0A 3PWLA 4JVPA 1K8DB 4Z5RA 1KTLA 3ISWA 3VI3F 3D5OF 4YHMH 3BMWA 1RZKL 3PWPD 2P8LB 1A14L 3TJHC 4P5MB 4NRYA 5AZEL 4GAGL 3TP4A 1S7VA 2J6EH 5HXMA 2D7TH 5TDPB 4WW2A 4Z7UA 3TBSB 5JR1H 1C5DB 2GY5A 1U91A 1W2KT 2EEBA 3NCBB 2DTML 1FZOB 1CTOA 2VH5H 4FP8H 2EYTA 3EO9L 2GJ6B 5DVLA 1U8HA 4UB0L 3LAFA 1TETH 2W0PA 4N0YH 1H5BB 4QTHA 1A7PH 2GY7B 4J3VA 4X4XB 4JJ5A 5C86A 1I8KA 3HE7B 5KSVA 4QLRA 3IU3A 3SE8L 3WFBH 3OKKB 1JPFA 2QEJA 4P4RA 1WBYB 3RWHA 1RZGB 1NGZB 4FXGA 4OLYL 5MERB 3QHZH 2V17L 1FV1B 2B4CH 2EXWC 2Y7QA 4ZSOA 4IIQA 2FGZA 4JFED 4POUB 1GAFH 1DBMH 1EFXA 3DTXA 2VUYA 1UJ3C 2LV4A 3INUH 3DVNB 1HCFX 1AO7B 2XA8H 5E1AA 5FB8B 1INEH 3HE6D 5FO7A 5JQ6H 1NJ9A 4KDTA 3VWKB 4HWEH 5C6PB 4N90E 4LRIA 5IMLB 1WFTA 3ULVF 3KHOA 4QWWD 1RZKC 2HT2D 4P57A 1S7UA 2L0DA 4PJIE 4YHOL 1UCBL 3QUKB 4O58H 1VEPA 3P0VL 2RJMA 5FHAL 4H1LG 5DJDB 1ULVA 4P4KD 2GSGB 3E3QC 4M5YH 1V3KA 2XKUA 1FZKA 1OB1A 1TFHA 2VJXA 3L1OH 4EIZC 4RGOL 4M03A 3FFCE 1C1EL 4HIHA 3VH8G 2C26A 4KVNL 4G43A 4JFZL 3VXSA 4FQ1L 1BQHA 2HN7A 5CGTA 4JFDA 3LKRA 2AJVL 4Z7WB 5D6DA 3WUZA 3X3FL 1T3FA 2YN3A 4XZUA 3EJYD 1QPPA 3X12B 5ICXB 3QEQD 5H8DA 1Q9OB 2CO6B 1U8PA 5D70H 4NM4H 5TE7H 5TH2A 2FB4H 4ALAH 3H7LA 2G75B 25C8H 2NTSP 3T0EC 3ZKNC 1DEEB 1RFDH 1T21B 3BZ4A 1I9JH 4PYGA 1J8KA 1MRCH 1J1PL 3QDJB 3F7VB 4FZEL 2P42B 5B21A 3HR6A 4HPYH 5IOPA 1B2WL 4OCMC 2DWEA 4K7FA 4UDTB 5J8OA 1N4XH 1XEDA 4P59L 4LKXA 1KJ2H 5IWLA 2GJ6D 4PV8B 4RMUA 4TRPH 1WFOA 3OXSA 1CGVA 4CMHC 2DDQL 2R39A 4PJAF 3QCVL 3HE7D 1T7ZA 3EO1B 4ZOEA 4QXGL 3ZKXC 2VL4A 3SE3C 2NY6B 1AXIB 3BZDA 2XICA 1UJ3B 3GI8H 1YEIH 3FQNB 1MIMH 3G5ZB 4QEGA 3MRPB 1RUKL 4NQUA 3GSXA 4K2UH 4YO0A 4DUWA 2XQYG 5GISL 4EXPX 1MREL 1AO7D 5HI4D 3UYPA 2Y5TA 1UT9A 4JZJB 4Q6IA 4QCIA 3MROA 3SPVB 1BBJB 3U9UA 2VLKA 3VWKD 5A3IC 1QKZL 1RIUL 1ROWA 1BIIB 1KIUA 4ZMAT 1YEGH 4C4KO 5DMKB 3I9GL 3BP7A 1BIHA 3SDAC 4G6FB 1UVQB 2OP4H 1ZHLA 3B9DA 1K4DA 4ZFOA 1S7QB 5ICYB 1JNNL 5D2NE 3FQUB 2ZUVA 4MVBD 2R0ZL 4ELME 1INQB 3P4MA 3T8XB 1C7SA 3CPLB 4OLUH 4HBCH 2JB6B 1A9BA 3DI2B 2WIMA 3QXTA 4N9GA 1FC2D 5JA9A 4HKXA 4HWBL 4NO0B 4QRQA 1J0HA 4WCYL 3IXAA 4GUPA 1QP1A 2DYPB 1PQZB 4PS4H 1FGNL 1XGPB 1SVZA 4KAQL 4L8DA 3QUMA 3C6LC 4EEEA 1ZEAH 1IEAB 3PGFL 4G6KL 5GRJL 3PP4H 1P7QD 3T0EB 1P1ZA 3MRQA 4PJ5A 2CXGA 4UT6H 4Q2ZA 5L2KB 4FFYL 3VFMA 3BGFC 4DTGL 1KELL 1Y6MR 2VDOH 4H1LA 1NLBH 1R3HB 5EU5B 1YN7B 2JCCB 4JFFA 3NCMA 4OM1H 4IRSA 1NDMA 1N0LA 1I9RH 4ZTOL 4KTDL 1Q9WB 3D25A 4ZS7H 3VH8A 4U1HB 4TSCH 4RA3A 3QDJD 5ELIA 3MODH 1LO2L 4H88L 1ZVHA 2R1YB 4JN2A 4NKQB 4MB3A 4CMHB 4N5UA 3H6JA 1OW0A 3QT2A 1YYMH 4IM8A 4KMLB 2X70B 5EA0H 15C8H 3NA9L 4R4NC 3RP1A 4CMMB 1UM4H 3ZKXB 2MPAL 4PJXB 5ANMB 1BJ8A 2DD8H 2A6KB 5D7LD 2DAVA 5SWZB 1BZ7B 3AREA 4D9RE 4TVPD 1XF4A 4KMTH 1H0DB 1DUYB 4FFWC 1WC7A 2NY6D 1MFCL 4YDKH 1LGVA 4F15C 5EZOL 5IEKA 3O45A 3QJFA 4G6JL 5CSZA 4X6DA 5GS2D 3WUWG 3SDCC 4CVUA 4ONGH 3ROLA 3BE1H 2W9EL 5LXGH 3IDJA 5HVFB 2FEEI 4LASH 4RIRB 3RVVC 2YEZB 4WW1B 4MMXC 3WBDA 4YDIL 1LP9E 3SDAB 1N8ZB 2YXMA 5F21B 1U8QB 1KIRB 1Z9MA 4S1RH 2FL5A 1YC7A 5E2VL 5FCUL 5I1AB 3W2DH 5D71H 3N50A 5IMKB 2ICWB 4G6FD 1ZANH 1N26A 2X4SA 3UDWC 1PLGH 4HGMA 5FYLD 1QFWH 1AH1A 1Q72H 2AXFA 2A83A 1IZJA 5EU7E 1KLGB 1EK3A 3B5TA 3BPLC 4JFEE 1NCCH 5C0GB 1FPTH 1P2CB 3F7YB 4NO0D 6FABL 1RU9L 3ZE2F 2DYPD 2W0LA 3N1PC 4NCDA 5J1AB 1UYWL 3TJEL 4YJZL 4KKLC 4RWYH 3BGFB 2E7BA 2CKNA 1MCOH 1OCWL 2HVJA 3H3BC 3SGEH 5FUCC 3U4BH 3W11C 8FABA 4HT1H 1LNUB 4PJFE 1W72A 3DUUA 2IG2H 4IRJA 4X6CB 2R0WL 4HS6B 1FAIH 4MXVE 3RUGB 4YHIB 5HHVH 3D0LA 1ZLSH 5HYQB 1JHTA 4R90H 3FB8A 4OQTA 4EDXA 4UT9L 5J13C 1FLRL 1NLDL 3IFLH 1CICC 5LVEA 4L9DA 3QH3A 3CFEA 4O2EA 2WP3O 5EIQA 1LK2A 1K2DA 4EIGB 4Y4HA 1IAIH 1YEHH 1MCBA 4FFZL 4OZHE 5AD0B 5DT1H 3VGAC 4DZBA 5JNYA 4YHZH 4G8GE 2G60L 1BX2A 4F15B 1GC1H 4L3EA 1N64H 5SWZD 4DKEL 2VXTL 4JVUA 3QEQE 3IU4L 3RDTB 3SDCB 3RIAK 3UZQA 3GSNL 4KY1L 3MV7B 3Q6GL 3LRSA 4RSVA 1CLYH 1II4E 3SKNB 4QRPB 3F6IA 4F9LA 5A3ID 5DZOA 5CAYB 1EO7A 2Q7NA 3CAFA 2P5WB 2ZOLB 3C8KB 2PCPB 4GRWF 4W4NA 1F11A 3SDAD 3MLWL 3V95A 1SQ2N 1PAMA 5CINH 1EPFA 2GJ6E 5MEPA 2IF7A 3QO1A 3IS1X 5T1MA 5EC1A 3VFVA 4PRDB 1MRFH 3EYOB 1AGEB 3HN3A 1RZ8A 2NXZC 3BPLB 4M7LH 1DN2A 1U0QA 1XCQA 3QUMH 2VDQL 3WUWA 4OFDA 3QQ9C 4E0RB 3U1SL 3FT3A 4LDEB 3ZHLA 2WBJC 1D9KA 1Y18A 1N59A 1VFOA 1X7QB 3ESVF 4KKNA 1XF2B 3CFDB 3MRIA 4H1LH 1Z9SA 1I4FB 1WZ1H 3AB0C 3EIFA 2UWEB 1AO7E 4PRBA 1KIPB 3FTGA 3WEXA 3QWQB 3REVA 3KWWB 5C0FA 2ZG3A 5J13B 4HGWA 1BD2B 3DX8A 1CICB 1ZGLP 5EIVA 1EFQA 4MYWB 5F1OB 4D0BA 3C5JB 3GRWL 5KVEL 3O11A 5IKCA 4GRWH 3V6ZA 4HLJA 4GRLD 3FT4A 2WANA 4LAJH 5D96C 1FDLL 4H0IA 3G6DL 3IFPB 1SMOA 3CDFA 3IDMB 3OPZL 4F9PC 5HY9A 4R4ND 4MA3B 3VGAB 1CI5A 5E6YA 1BEYH 5ACZA 4EKXA 2YPLA 4ZUUB 2G2RA 2VDRH 5E2TH 4J3XA 2DIBA 3BSZH 1I9IL 3HC4L 4FFWD 3WL9B 4N0FA 4Z7WE 1YY8A 3WFZA 2ENYA 3STBA 5DFWH 3SY0A 3ZDZE 3GSVA 4D9QD 1I85C 1XGRA 1JNLL 4WTZA 2HT3C 2XNAA 3RWFA 3RDTD 3TT1L 2JTDA 3BKYH 3FB5B 1B88A 2FH8A 4R9HA 4ZAKC 3MXVL 3HZMB 3MYJA 4WI6A 3RVVD 5B8CC 4FMFA 4PG2C 4JFYB 3PWVB 3ZTNL 2DLTA 4QRPD 5TGBA 4NZRH 1XZ0B 2HA1A 2X4UB 4BZ2H 2C7UB 1IGTB 5IMMB 2FRGP 1XR9B 2XKNB 3MJ9L 1CGTA 1U2CA 2P5WD 3HFML 3QDJE 3QDMB 4M6OL 5HYJA 1MY7A 2J8UA 4JGMA 5EIIB 3F7PC 1BVZA 4P3CL 1FNGA 3FJTA 2NXZB 4Y5YA 3LQAH 1HIMH 1MI5B 3EDEA 2WBJB 1QR1B 1ETZA 4TVPE 2X9YA 4JFOA 3ET9F 5DUPL 5LWYH 5I1JL 3IJSB 3GMRA 1JHKL 5D1XC 5ABDE 3NAAL 3VXUB 1W72H 3AB0B 1CR9L 4FQIH 3BGMA 3TC9A 3ZT5A 4KKLD 4OQTH 3GSNB 3W11D 3V5DB 3DX9B 1G7JA 5I1HL 1QYGH 5J3HC 1J5OL 2W9LA 5IB5B 3U0WH 2GITB 1G7QA 1CG9A 2CO7B 3OTTA 5D9SB 5FUOL 4MS8C 5D96B 5GRWA 1CICD 4OLWH 5DGQA 3VXNA 3DRQB 4YDJB 3Q3GB 5MEQA 1IC5L 2DJUA 3L6FB 1W8NA 2GTWA 5IM7A 3PDDA 3C9NB 1BFTA 2A74B 4MXWL 4YIQA 5FYLE 1GVIA 2GI7A 1AIFB 1OAXL 5SV3A 3K81A 2OL3L 4FQXC 2I9TB 3CMOH 1OTSD 1PZUB 1A7OH 4TULH 2DI9A 1A6VH 4HIEB 3NOIA 3VFUA 5L2JB 3OMZA 3PF2A 1H3TA 1IRAY 1DBBH 3QA3B 4LIQL 3E2HC 3KS0H 4PJCB 3IJHA 4FTVB 3HI5H 5LG1A 1RK1A 2KKQA 4LCCA 4XPGH 4YBLC 4ZAKB 1QLRA 5FYKD 3ALWA 2DBJA 4K3DH 3T0EE 1YEFL 4Z7NE 1PG7X 5L2KE 4OV5B 5CKGA 4PTTA 4U49A 3OKNA 1IBGL 3LOWA 2JCCE 1ADQL 2NTFA 4YXLL 2AKRA 1KULA 4PGCA 3HI1A 3OHXB 4S1QH 3BKJL 2AS5M 1NGQH 1V7MH 1X5AA 4TNVK 3S96B 4A6YL 3BXNA 1NGYA 1S9VB 1AGCA 3MLZH 1KCSL 1MCIA 1VPOH 1YEEH 1JYVA 3G08B 2R2HA 1ZT7A 1BQLL 1CFNA 5DMYA 2NXZD 1NBZA 5ENWB 1MI5D 4PJXE 2ORBH 5ANME 4PJBB 3U9PL 1NUFA 4G7VL 1T89A 3WJLC 2ZOKB 1QSZA 1T1ZB 5D1XB 4DAGL 1RZFL 5SWZE 2WBJD 4HUMB 2H6PA 4WWKA 3RU8H 2VN4A 2QBWA 5GJTH 3V4UL 2DN7A 2YD3A 3BDYH 4UIKH 1G7LB 4N8CL 3MA9H 2Y07L 5ESAA 1KCRH 3WFCL 2L7JA 1SHMA 3GMNA 3UBXA 2EDQA 1XGTA 2HH0L 3IDXH 4OGXL 1FGVL 5HGAB 3OKOB 1MFAH 4LLQB 4M48H 4HS3A 5EUKB 1MJ7H 3T77A 1A4JA 3U46A 3D48R 5HHMB 1IKNA 1U42A 3QSKB 4BSWB 4PLNC 1JGUL 3ZE1E 1QRKA 1N3NB 2WWMD 5TE6L 3VJ6A 2J4WL 1WGOA 4FQXB 3BDXA 4M62L 5E8NB 2XIDA 1JF1A 2BVQB 5E2UL 3UO1H 1YEKH 3E2HB 3KPPB 4Q7DA 4YBLB 1NAML 3IDNB 1E6JH 4QRUA 4ZDHB 3U0PB 1UQSA 4D0DA 1FG9C 4XBPA 2HT3D 4FTVD 4MNGB 4XBEH 2V2WA 3KR3H 3TM6A 4MMZC 1J05A 3TBWA 2X5PA 4I1NB 4OGAC 3X13B 2IPUK 4XP9H 5CBEA 2JJTC 3KPLA 2X42A 1VSCA 4X6CE 2FX9H 3RUGE 1WBZA 3VD4A 4TUOA 5DD5H 4Z7VA 4R4FL 2OTWA 1XF5A 2HWZL 1DFBH 1FG2B 3C5ZA 4YPGB 3ULUF 2JJVA 4AL8H 1EEZA 4D8PA 1IM3B 3OJDB 5FO9B 2GYSA 4YXHL 4QTIL 1NUNB 3LMJL 1SYSB 3QUZC 1HILB 7FABL 2PNDA 1M05A 4MQTB 4ESKA 2O5ZL 2IADB 1LE5B 1OGTA 2W91A 3D3VA 3ECBB 5SX5K 1U8LB 3MNZB 5K93A 3JWOH 3U82B 1RMFH 1PEWA 1SEQL 3O6FA 4JQVC 5DJ6A 3P9WB 1R3LA 2OL3B 4KH2A 5L7XH 5AWNL 4PJHF 5EU3A 4XWGL 3SGEI 5D1XD 3BWAA 4PR5A 4OKVB 3FRPG 5D7JA 1I3GH 3DRTA 5FO8B 5E8OB 1RJLA 1HXYB 1QFUL 1L4IA 3HNTL 3MV7E 3CVIH 4YHKL 4FQJL 1H8OA 4QRRA 3OR7B 4HH9A 1LK3L 1D5ZB 4QRPE 1GGCH 1KENH 2FCBA 4JRXB 3GKZA 4KHTH 2LTQC 1IAII 3RNKA 1BAFL 3EBAA 2P5WE 4XCFL 2BNUB 1U58B 5LQBL 3ULUH 4HULB 1HNFA 5ICZA 1IQWL 5HHMD 3PDOB 4OB5H 4A6YB 5EBWB 3DROA 2W60A 5GGSA 1NANH 1RIHL 1I1RA 4ZPVA 1E27B 4FQXD 1JPGA 2GK2A 3NABH 5E70A 1TXKA 2J6EL 3W9DA 3V0VB 1DE4A 3D2UB 2D7TL 4WUUA 2OSLA 3VI4E 3CVHB 3V5HB 3RVWC 3H9YA 4B7LA 5JR1L 3HAEA 5E4EC 4UIMA 1NFDA 3B3IA 3JVGA 5DRWA 3WLWC 4FP8L 2X4NB 4UDUA 1D5XB 4TOYH 5GHWH 1TETL 5GSRB 5BW7A 4MJ4A 4KXZI 2UWEE 4OD2A 4F8QA 3GKWH 1A7PL 1F5WA 5SV4A 4HIJA 3C08H 1SVCP 4NKMA 3TT3H 3GB7A 1WWBX 5HHQB 1BQSA 4XVSL 2AXGA 1GOGA 3KJ4C 3QHZL 4GKNA 1FNSL 2B4CL 4RMRA 4DFIA 3SKOB 3QUZB 2EC9T 3QP3A 5IW3A 1GAFL 3CDGB 1DBML 1AXTH 5ERWB 3MRFA 4I13B 3O2VH 4WO4C 2WIIB 2XA8L 4OZFB 3IAGC 1INEL 4U1LB 1NGXA 5F9JB 1QA9B 2NX5A 3V6FA 1DL7H 5F7FA 2DBLH 5K9KB 1YYLL 1RI8A 3CFCH 4ERSH 4Y4FA 3GDBA 2R56H 4Y0GA 3QCTH 4N0CD 4O58L 4LLVB 3MLXH 2V7NB 5FYJL 1J86A 5FYKE 2CDFA 4L29A 3DV4B 4Y2DD 4LNVA 6CGTA 3WLBB 2FIKA 2HLAA 2LTQB 4MA8L 2K1MA 2J5LC 3L1OL 4J6RL 4A2LA 1FIGH 3KYAA 4JQIL 3AY4C 5EUOA 5MEOA 2VZOA 2D7PA 1JUFA 1RV6X 4JRXD 3MRCB 3NZHL 4NYLB 4RNRB 1NBVH 1L7TL 4G6AC 2R15A 4GBXC 2RBLA 3SE9H 1RZ7H 1GZQA 3QDME 4I4WA 3MGTA 2B4CC 3PGCB 4HIXH 1X5LA 3BVNA 5D70L 1NDGB 5I75C 5TE7L 4AT6A 4FQQA 3FHQA 1MI5E 1NMAH 1QSEB 1C7TA 5KS9F 3K46A 2AV1A 25C8L 4J4PD 3PWJB 4XC3L 1RFDL 5E4EB 5C09B 1XR8B 1I9JL 3D2UD 1MRCL 3VXRA 3B6SB 1HHJA 2LAGB 3CLEH 3VXUE 4F57H 3W0WA 4L8BA 3ZE0F 2YD2A 1MFBH 4MHHG 4P23C 4MD4A 1JWMA 1G7IB 1KJ2L 4OGAD 4TUJB 3NCJL 4OLEA 5DC0A 3IYLW 4NN5C 2AP2A 1AHWA 3KJ4B 2BP3A 1BWMA 4JHWL 5KVGH 1CXHA 4C83B 1Y0LB 2IBBA 4C58B 1UWGH 1QSFA 4K07A 3TYGH 3M17B 3GI8L 1YEIL 3QZWG 3ILPB 4FA8A 3QUZD 1MIML 3GMLA 4QRTA 3ZTJG 1F6LL 1HHGB 4WO4B 4KUZH 2NYYC 4I77H 4OIAA 3N9GL 1GGIH 1EEQA 1U92A 3T3PF 4KGLA 3H0TA 3F5WA 4BFIB 3VXOB 2P48B 4ZUSA 3I6KA 4PJGA 1OAYH 2A9MH 2HJFB 4PJCE 5HI3D 1QLFA 5DQ9A 4FTVE 1X5GA 5BRZB 2P4AB 2C5DC 4KQ3H 3MV01 2OP4L 4ODBD 4UV4H 4OFYA 4PRIA 4X80H 1E6OH 5E8DL 5IB1A 1CWVA 2I07A 5HJ3A 2APBA 4OLUL 5IJVB 4EOWH 1K3IA 4JE4B 5EZJA 3GSUA 3GBNL 4GBXB 4HBCL 1BFVL 2AV7B 4U1NB 4LBEB 1DZBA 4QHUA 3GMOA 3VXPA 2Y9RT 4UQ2A 5I75B 4MLIA 2CH8A 3VGFA 2Q6WB 2EE9A 3ALXA 1RURH 3FO2A 5F88A 1NC4B 3PP4L 4AIZA 1WT5A 4N1CA 3ARZA 3EO0B 5DUBB 2R1XB 2VDOL 3MZGB 2V5SA 4PJBE 1NLBL 3RVWD 5SX4I 2EDEA 4WHTA 1TZGH 3IXTA 4X7EC 1XH3A 1I9RL 1REIA 5C09D 4HD9A 1DSFH 3WLWD 4HLZG 3IVKA 4P23B 3JXAA 4ZS7L 2NZIA 1NGPH 2ARWA 1DQTA 1WAAE 4K23H 4TSCL 4NN5B 3SE4A 1MHCB 1W0YT 4LHUB 4NQSB 1FN4B 3G5VA 4HXBH 4KUCF 15C8L 2VQTA 3L95A 4NRZA 5FDWA 1UACH 4HKJA 4YC2C 3OGCA 2PYEA 5DZLA 1X9QA 1NCBH 5HHME 2YSSA 4LL9A 4JM2A 1ZS8A 1UZ8A 5DFVD 2DKSA 3GHBH 3ARSA 4ONGL 3BE1L 5LXGL 1CDHA 3C87A 3T0AA 4LASL 1JYWA 4PGDB 1KCVH 2YWYA 4LSUL 4DWHA 2EKJA 2NCMA 4XCYB 1JHLH 5D2LB 5JZ7C 3B5HA 4U3CA 3VG9C 2CSPA 3MBEA 4ODWA 5D71L 5CZVH 1KTDA 4MNGE 1WIPA 2YPVL 4K94H 5I74C 1EJ6A 1JRHH 3EOYG 1KJ2B 3NIFF 1PLGL 4EN3A 3W9EA 2YPKB 3MLSH 1Z5LA 4J3WA 1QFWL 1T0MB 1Q72L 4L8SA 4M8VA 1T7XA 2KL6A 4HX1B 3P11H 3HB3D 3BAEH 3U7WH 3WS6A 4IIQC 1S3KH 1NCCL 4G6AD 4GBXD 4EI6A 1B6DA 2QQQA 4U6VL 2VISB 4DKAA 1FPTL 3QNYA 1H15B 3OKLB 4NRXA 5IW6B 4L4JA 3MV8A 4DN4H 4KJYB 4KDTC 4UBDC 4EUPA 1T83A 3O6KH 5ID0A 3U4BL 1NC4D 4HT1L 4UTAH 3UTQA 2IG2L 5D1ZA 4G3YH 2KZ1B 3UMTA 4JZOB 3T09A 4E41B 1UXSB 4PD4K 5HHVL 2FJHB 4R90L 2QTEA 3G6JB 3VGGA 1Q9KA 3AXLA 1CFBA 2C3WA 2DLFL 3IDIA 3IFLL 4FQHA 4XH2B 2ZUXA 4LIQE 4P23D 5F7NC 1ZHNB 3BPNC 5IIEA 1YEHL 3WNKA 2BX5A 5C0IA 4LHUD 2XN9A 4F2MA 4B7IA 4YC2B 1AGFA 5DT1L 5IG7A 3A0OA 4KI5F 4QY8B 1E28A 5F97E 5HHNA 4JRXE 4CNIB 2CLRB 1HQ4B 4MXQC 4OCXH 5D6DC 4YHZL 2EXYC 1CFTA 3HS0B 1RK0B 1R5WB 3PWLB 1GC1L 4Z5RB 1N64L 1KTLB 5JHDD 2EIDA 1ZT1A 4PJ9A 4K71C 1YJDL 3QXUA 2NYYD 2YZ1A 5DRZA 4NRYB 1Q8MA 1S7VB 3ARBC 3BO8A 1D5BA 4DCQB 1N5AA 4WW2B 4Z7UB 1CLYL 1U91B 2AW2A 3TBVA 3RKDC 4XP5H 2EYTB 3WNPA 4ZFOL 3E6FA 1U8HB 4ZNEA 3P2TA 1H3UA 3VG9B 4O5LH 3RWEA 4QTHB 2AQ1A 4JJ5B 3RBGA 4NKDA 3IFNH 1I8KB 5CINL 5I74B 2H32A 5KSVB 3IU3B 5IWLC 5K33A 3ARQA 5F9DC 1JPFB 4P4RB 3RWHB 2VKWA 2NPLX 4FXGB 4OZIA 5DC9B 1KSRA 2Y7QB 4ZSOB 3Q1SH 4IIQB 3QPQD 4M7LL 2MHAA 4V2CB 1EFXB 3DTXB 5IFHH 2CUHA 2RCSH 3EUUA 5C07A 2XKSA 1IM9A 4N5ED 5FM5O 4Z8FL 5E1AB 3RWDA 1QLEH 1JZ3A 3EHBD 5FO7B 1P4IH 1GC1C 5D7IF 1KIQA 1QZ1A 4Q6IC 1YJDC 4CDHA 4BZ1H 1HYSD 4P57B 1S7UB 4D94A 3K4DA 3T0VA 2VR9A 4E41D 4P2OA 1T2XA 5FOBA 1KJVA 1UH3A 3BPNB 2VAAA 4Y4KA 1CBVH 5JW3L 1FZKB 1OB1B 1YPZA 2H2PC 2R4RL 1NSNH 2UY6A 3EJZC 4HIHB 4F37F 2DLIA 4G43B 5HVWA 1UWXH 3VXSB 1BQHB 2HN7B 4PFEA 4JFDB 4Q9RH 5I1DB 3LKRB 1BEYL 1T3FB 4XZUB 3F7QA 3FO9A 5E2TL 3S9DB 2OQJA 3BSZL 4M8QA 4K71B 1U8PB 4YHLH 1MCNA 5TH2B 5GRXG 4JFQA 1WWCA 4LVOB 1A5FH 3BKYL 5HDBE 1OM3H 3BZ4B 3QEUA 2FO1A 1QSEE 3TH2T 2FECL 4KI1A 3T65A 4IRSC 1WZLA 4Q9QH 2ESVA 5IOPB 5C09E 2DWEB 4K7FB 4AQ1B 4WEBH 4BZ2L 4LKXB 5F89A 1J8HA 3ZTJH 1FBIH 4ZODA 3OXSB 2WLZA