1ADWA

Pseudoazurin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
123
structure length
123
Chain Sequence
ATHEVHMLNKGESGAMVFEPAFVRAEPGDVINFVPTDKSHNVEAIKEILPEGVESFKSKINESYTLTVTEPGLYGVKCTPHFGMGMVGLVQVGDAPENLDAAKTAKMPKKARERMDAELAQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOAZURIN
publication title Pseudospecific docking surfaces on electron transfer proteins as illustrated by pseudoazurin, cytochrome c550 and cytochrome cd1 nitrite reductase.
pubmed doi rcsb
molecule tags Electron transport
total genus 34
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1adwA00
3ZBMA 2Y1AA 1IC0A 3NSDA 2QPEB 1EZLA 5I6NA 4E9YA 3NSYA 1NICA 2GSMB 2YAEA 2W8CA 3IEAA 5D4HA 2HZHA 4F7KA 4G7SB 2DYSB 3H4FA 1AS6A 1IBYA 2IDUA 8PAZA 4G72B 1MZYA 3H56A 5PAZA 2RACA 2AANA 2XVBA 2YXVA 1SFHA 1XMEB 1EHKB 1AS7A 2Q5BA 1RCYA 1ZDQA 3HB3B 4KOCA 1AANA 3EH5B 2XX1A 2DV6A 2HXAA 2FQGA 3JT2A 1NZRA 3IE9A 3KW8A 1TEGA 1J9QA 3DTUB 3AW5A 4DP8X 4BXSV 1PF3A 1OCCB 2IDQA 4KO9A 3WI9A 4A68A 4EF3A 4A2DA 1BQRA 2IH9A 3IBOA 1KV7A 1TEFA 2IDSA 5B7FA 2FT8A 1E5YA 4HCFA 3TBBA 3PAVA 1E5ZA 4ENZA 1X9UA 3OMAB 2YAOA 4DPBX 2TSAA 1URIA 3T6WA 3CZUB 1CUOA 4JKNA 1ILUA 1DZ0A 1L9SA 1PMYA 1PZAA 4X4KA 2BP8B 3NT0A 3AG4B 1PLBA 1W6WA 3CDZB 3SBRA 1SDDA 3CVBA 1L9QA 2OJ1A 1V10A 4GP8B 1HAUA 3S3BB 1GY1A 1JOIA 1AG0A 2I85A 1N70A 2A3TA 2FQEA 1KDJA 1QLEB 2CAKA 2CJ3A 3ERXA 2BP0B 4A2HA 1RKRA 4DP7X 4DP6X 3JTBA 2PPFA 3FYEB 4GXFA 3UADA 1NDTA 2DYRB 1JERA 1XB3A 1GS7A 2XUWA 2XV0A 4G70B 5TK4A 2IH8A 4A66A 2HX7A 2X88A 5A7EA 3FPYA 4GYBA 3QJUB 2AFNA 4HHGA 2UX6A 3FYIB 3V9EA 3MX0B 2WO2B 3NSCA 1L9PA 5D4IA 2BZCA 1GY2A 4AKOA 3ZIYA 5B7MA 1J5DA 2GI0A 2AZUA 2VN3A 4G7RB 3FQYA 1L9OA 4G71B 2J5WA 1WS8A 1SHWA 1QHQA 2XLLA 1M9WA 1MDAA 2VW7A 4HHWA 3CVDA 2P80A 3NSFA 2XU9A 4WTQA 4DP2X 3AY2A 1PLAA 2GC7C 3PAZA 2GHZA 2PP7A 3WG7B 2PPAA 2VM4A 3ZDWA 1AZCA 1WA0X 2LLNA 2B3IA 3NJKA 3T71A 3ASNB 3FU7A 1JXFA 4JHUA 2XYBA 1NIBA 2FQDA 4F2EA 3GYRA 4HIPA 3OM3B 3UAEA 4UF7C 4N4YB 1WAEA 4CSPA 4A2FA 4UANA 1OV8A 1JXDA 4YSEA 1MZZA 3FS9A 1E67A 1ZIAA 2VW4A 4DP4X 3FSVA 1SDDB 1J9RA 1NPJA 3S8GB 3CVCA 3WIAA 4GY4A 1A8ZA 1GYCA 3AG1B 1L9TA 1M57B 1JZIA 3QJSB 4HALA 5IY5B 5I6PA 2PPCA 1ZV2A 3NJGA 5F7BA 5ANHA 1XB6A 4YVUA 1AS8A 4PAZA 1RZQA 2NRDA 1WA1X 3HEIB 2FNWA 1A3ZA 1FWXA 2YAHA 2Y69B 3X1NA 4DPCX 1IKOP 3FQ1A 4JHVA 1BXUA 1BEXA 2EILB 1R1CA 3QJQB 4HZ1A 4KOBA 4DP9X 1L9RA 4FA7B 3FT0A 4NAJA 3PCYA 1SJMA 1XB8A 5F7AA 2EINB 3ZX1A 2OCCB 3N2JA 1NIAA 1BYOA 1KCWA 3MBWB 3WKPA 3EHBB 1JXGA 4BDVA 4YSQA 3ABLB 4YSTA 3UAAA 1GS6X 2CALA 1AACA 1ZIBA 1ASOA 2VSMB 3X1GA 2FT7A 3C75A 4Q89A 1W8EA 1BXVA 3FSWA 3L45A 3QPKA 2J55A 1ILSA 1NIDA 1GW0A 1BQKA 2UXVA 3RYMA 3FSAA 3QJTB 1HAWA 3NP4A 6PCYA 1GSKA 4A2GA 3WNJA 3FU7B 2FQFA 9PCYA 5B1KA 2YARA 4YVNA 1AZBA 1ET8A 1KCBA 2HX9A 3T6ZA 4AKPA 2VMJA 4Q8BA 2QDVA 3TASA 1WS7A 4NB7A 2YAFA 1V54B 4BWTA 5I6KA 3PLYA 4BXVA 1ID2A 1RZPA 3S3DB 2BW5A 1E30A 4DP1X 2BW4A 1SF3A 1W6LA 2XXGA 3IN2A 4A2EA 1X9RA 4AKQA 2E86A 3QQXA 4BK5C 1CC3A 3NJIA 4F2FA 1F56A 3SBPA 2PCYA 1AZRA 1ASQA 2Q9OA 1PAZA 2IAAC 7PCYA 4HAKA 2XV2A 3QJVB 2YAMA 2XWZA 2FJSA 1B3IA 1ET7A 1M56B 3IN0A 2TSBA 4YSAA 2PP8A 3OMIB 3H4HA 2HLEB 2QPDB 1BXAA 4RH4A 2H47C 3AZUA 1AZNA 1JZEA 3X2QB 1A4CA 2H3XC 4DP5X 1PNCA 1KDIA 1JZJA 4WKXA 5AZUA 1AQ8A 3KW7A 4KO5A 2MRYA 5E9NA 3AG3B 3UABA 3PPSA 3U25A 3PAUA 5TK2A 2PP9A 4QKTA 3D12B 2JFCA 4BDVB 1AG6A 1ZPUA 4FAAB 1SHXA 5PCYA 2P80D 1J5CA 4NERA 2BWIA 1JVOA 1ADWA 3NYKA 1UATA 5D4JA 3FSZA 1I53A 4YSUA 5B7EA 2HRGA 2BHFA 4E9RA 3GDCA 2GC4C 2I7SA 3T9WA 5B3SB 4YSDA 3X1BA 1PNDA 2UX7A 5B1JA 3T6VA 2IWFA 5B1BB 5AKRA 2PCFA 1T5KA 1SFDA 2H5UA 2GB2A 2IDTA 5I28A 3NJMA 3WNIA 2OV0A 5EHFA 1J9TA 3G5WA 1BAWA 1IBZA 1NIEA 5FC9A 2EIKB 2ZONA 3FU8A 3ABGA 4YSOA 5I6MA 1OCRB 5B1AB 1A4AA 1OOWA 4UAHA 1KGYE 1NPNA 1OCOB 5I6LA 1IUZA 1ASPA 3SBQA 1KBVA 1JZFA 4CSZA 1OE2A 4E9TA 2XX0A 4AX3A 1FA4A 2IDFA 4E9WA 4YL4A 4G7QB 1JZHA 4ZK8A 4DP0X 5AFAA 3OQRA 2HX8A 4W1TA 4YSCA 2QT6A 1FFTB 1WA2X 1A65A 1MG2C 3UGEA 1BQ5A 3NJFA 4KO7A 4BWWA 3WKQA 1GS8A 1N68A 2X87A 1A4BA 2J57A 2JKWA 3OD3A 1KYAA 4TXVB 2BWDA 3ASOB 2HRHA 3UACA 1BYPA 2JXMA 5I5IA 2VW6A 2XV3A 2N0MA 3TBCA 5I5JA 2BO0A 1VLXA 2GBAA 1OF0A 2EIJB 1NWOA 4GP4B 4GP5B 1DYZA 4P5RA 1QNIA 4W9ZA 1OCZB 1AAJA 1MG3C 3EH4B 3TU6A 1CYWA 2ZOOA 2ZWNA 3NJLA 4P5SA 5I26A 3S8FB 2ZXWB 2VM3A 2R7EA 1J9SA 1ETJA 2EIMB 2FT6A 3T6XA 2UXGA 2BZ7A 5I5MA 1AZUA 1YLBB 4L0PB 4KNUA 3TA4D 3DKHA 4YSRA 3ABMB 4HCGA 1GR7A 1NINA 2W88A 1AIZA 1NIFA 1PY0A 3AG2B 3BQVA 3N55A 4KNSA 4E9QA 3BVDB 2AZAA 3V9CA 1NTDA 2UXFA 1HFUA 5B1JC 1AR1B 1OE1A 2B08A 4E9SA 1PCSA 4M3HA 1OE3A 1AOZA 4M4RB 4A67A 2J56A 1V55B 2PPDA 3CG8A 7PAZA 4YSPA 3DIVA 4DPAX 3FPXA 3EH3B 3PXLA 6PAZA 2CCWA 2PPEA 2I7OA 2YAQA 1E65A 2DY2A 1PLCA 1ET5A 2CUAA 2YQBA 3NJJA 2MTAA 2DWSA 4HCIA 4N8UA 2YXWA 5I6OA 2VSKB 3NJHA 3X1FA 2BP8A 3FQ2A 2UXTA 4YSSA 1PZBA 1TKWA 1KBWA 4AI7A 2XXFA 3CDZA 4AZUA 5LDUA 2GIMA 4KO6A 3X1EA 3NJNA 2FTAA 2CBPA 1JZGA 1ZDSA 3FU9A 4E9VA 2WSDA 1JVLA 1PZCA 2IWKA 1CURA 2YAPA 3GXUB 2WO3B 3NP3A 1TU2A 3S3CB 3EF4A 2FWLB 4KNTA 4BWUA 2IWEA 3OMNB 1CYXA 2QDWA 4MFHA 2DWTA 1NWPA 4PCYA 4K9JA 4E9XA 2BP0A 2R7EB 3ABKB 3QJRB 2PLTA 4QLWA 1SNRA 1SF5A 2AVFA 3SQRA
chains in the Genus database with same CATH superfamily
2K6YA 3BXNB 3VU2A 4N0CD 5IB1B 1LEKA 2K6ZA 1F2XK 5J6HA 4U0RC 3GSVB 4MHHG 3FULA 5HYSA 1KYFA 2EABA 4NCDA 4ZFFB 3RJDA 2HZHA 1V7NL 5ABAA 2IQAA 2AK4B 1AI1H 1FNGA 1TF4A 2CHNA 3HHSA 4L4VB 1T1ZB 2DI8A 1LEIA 2NY0B 1VEOA 3W5MA 3ISYA 2F53B 1PX8A 2DQFB 2FYYA 4HIXH 2AI0H 5C6TL 3TGXA 1G7PB 5DYOA 5DRWA 5AOJA 5FHAL 3BKYH 3OVUB 1KCVH 3N85L 1RIHH 2DQHL 5CFAA 2R9HC 1XL6A 3MRIB 1MAJA 2KMWA 4Z1PA 3MNDA 2I32A 3F6JA 3GJEB 1I8KA 1KV7A 2IDSA 5B7FA 5JOFB 1VJSA 3ILEA 5I71C 3PJSA 4OLWL 4QAWA 5TTRA 5DHDA 2Z64C 1SHMA 2ADYA 3UP6A 4PHZA 5I23A 3WUZA 3JWDC 3W11D 1JXKA 2X4NB 3RU8L 1H5BB 1T1WB 1TZAA 4KK8D 3Q06A 2PKDA 4PW3A 1S7QA 2FIKA 3NN8A 2PMZA 3CFJA 3CNKA 3PYCA 2EKJA 1JWMA 2G9KA 4Y4FA 1T21A 4MCMA 4XP1L 2ID5A 4X2UA 3ZHLA 4UNTA 3U4EA 1V7NH 3FRUA 1DBKL 5IMMB 5L2KB 1T03L 1LO2L 1ZS8B 4HK3J 3A22A 1RULL 1TU2B 4Q2ZB 4FG0A 2W38A 2Y36H 4X4ZA 1NEPA 3WE6B 4AGLA 2CJ3A 4KMTL 2AQ3A 3KDMB 4CN1A 1AGBB 2WTRA 1EO5A 5C97A 4XMLL 4IOIB 3OZLA 4WHYH 5EBMA 1OB1B 4AQOA 5I5RA 4TYUA 4KWUA 3ZKSD 4WI8A 4A66A 4Y9EA 1CICB 1IM3D 3BAYA 1VFOA 1ZWIA 1JV5A 2EIBA 1BOGB 4LVHB 5I66A 5H4YA 4WO4D 3LAFA 3RWJA 3RGBA 5EZOL 1E4KA 5A2CA 5EN3A 2HP4A 4OLWH 3F65A 3H0TB 2IANA 1DVFD 2ZWYA 1C9SA 3RVVD 3VXSB 3RU8H 1FDLL 3VXOA 5ESQA 4A2MA 2FJGA 4X4MA 2XWBA 1NDGB 3F00A 2DQGL 3P4NB 5BZXA 5H4ZA 5A2JH 2Q7YA 4Q6IB 4XP1H 4R5XA 4WTQA 3E6HA 3HMXL 3PWJB 3VFPA 3PE9A 4PJIB 1DBKH 2PPAA 5GQBA 1TCRB 1LO2H 3ZSTA 1T03H 4KTDL 1KPRA 3A67H 4Y1AA 1RULH 4HZLB 4HEPG 4N2MA 1XF2A 5D4QA 5FFOA 4JDZA 1E2WA 1COBA 3GT6A 3MNZA 4U4BA 4ELMB 5T3XE 4NPKA 3NIGB 5ICYB 2D0FA 3HW7A 3NIDB 2ADIB 3LZOA 4XMLH 4QGYA 1WAEA 2ITCA 2H8PA 3T8MA 1P4UA 1AXSB 5BOJA 4DK5A 5IZ7A 1FNLA 4JHZA 3H2QA 3UCRA 3V7AG 2C9AA 3QHFH 2QZQA 1DLHB 2WLIA 5AZEL 3ATFA 4KV5F 5KZCD 4JRXB 4Q9QH 4UCFA 5EZOH 1FZJA 3EDEA 1HCZA 4Y7OC 2K78A 2NXZD 1A6TB 1N2RB 1NFDE 3VWKA 1MHCB 3SDAB 5IY5B 3EH1A 4JM2F 3GUTB 4HGWB 1ZV2A 3EYUL 4LEEA 5B39A 5J6SA 4OLUH 4PJ7E 1FDLH 3WKML 5C09A 3STLB 2VKWA 2VC2H 2G2RA 4J3BA 4AL8L 4EI5B 4XWGL 3WJLA 1PX3A 4NRZB 3NEOA 4ZPTB 2DQGH 1HCYA 5AVRB 3WY4A 3S8WA 3IBEA 4Y4FC 4APXA 2VLLA 4WHTA 3MA7A 4P5KB 4R3SA 5I1AB 4HMCA 2CDFA 2HJFB 3L1OL 4PJIF 1L9RA 4KTDH 3G9AB 2Q8BL 1NBQA 1G7IA 3FT0A 3N42B 5DZOA 3ZT7A 4GIPD 4X7FC 4G7YL 2CCLA 3DHPA 3ZK0A 3QNYB 4JMNA 1ZT4A 1CK0L 5J5EA 2WZ0A 1BZQK 2HB0A 4ELMF 3D2UD 2YPKA 4HBQA 3NIGF 1A1NB 4LCIH 2L7UA 3P73B 4JFDD 4PRAB 1FYTB 2DQDH 3T0WA 5C0FB 3FB5A 4ZAKD 3FQWA 3ZT6A 4Y8AA 5F6HJ 4Z7IA 4NNXA 4L3AA 4DZ8A 2A83B 2FT7A 5EFIA 1HILB 1Z9OA 4KJYA 5D1ZD 3LY6A 2CLVA 2YC1B 3QJTB 3P4OB 2BVPB 3ULUF 1E4KC 5DTFA 1EAPA 5F7FA 4HFUL 4LHUA 4JKPH 2FX8L 1U92B 3HVNA 3TZVA 3EYUH 4AIOA 4QRTA 3IKKA 3EJSA 4F8LA 2JCCA 3WKMH 4A7VA 4AL8H 3E2HB 1X4YA 4XWGH 4TTGA 3EJUA 1FNHA 2NY2B 4L8CA 1UJ3A 1JPEA 3RL2A 4XO8A 2AEWA 2FB4L 1GRWA 2WCGA 2EDLA 1KIUB 3L1OH 2EQDA 3LKNB 4G11A 2BW4A 4WEBL 1TZGL 3QZLA 4XOBA 2Q8BH 3MNVB 3N42F 4NOFA 4OJDH 2NY5C 4PYHA 1NC2A 4P5MB 3QIUB 4C4KO 4ZZFA 4ZW5A 3L9BA 2B2XL 5KUMA 1CK0H 4LGSB 4YAQA 1E7VA 2NNRA 4TNFA 1QFWM 5IV2B 4KKPA 2P7TA 1SY6L 2C3VA 5FA3A 2E8ZA 4WUUA 2XWZA 1II4E 1E4WL 4ODVH 4J1UB 1ET7A 3SPJA 1A6WL 1NH6A 2WQSA 4Z7UF 5D96B 3DBSA 4HUKB 2P8LB 1CXLA 2QPDB 5K9QG 1PZ5B 1PJ9A 5E08L 2P8MA 1IE4A 3EBGA 2DLFH 3VDAA 2CJUL 4MS8C 1MELA 3C8KA 5BRZA 4HFUH 3BKML 1P69B 1PSKL 3VWKC 2HT3C 1K5NB 2GIXA 1IKNA 3N1MC 2XFXB 1KB9J 1G7HB 5BZWB 3WJLC 2E7HA 2H2SC 2R2CA 2W65A 4NGHL 2ZCZA 5SX4H 4UZUA 3WTYA 2JQMA 4R4BB 5KSBE 4KROC 2O6PA 1Z5HA 3MHZA 2X1XR 1GZHA 3MYJA 1ZLVH 4WEBH 4PS4L 1TZGH 3P3UA 4LP5A 5IBUG 2XN9A 3ESMA 4EI0A 4EZLA 3D6GA 3EXJA 4IDLA 3EYVA 5FWRA 2B2XH 4UDUA 1NCUA 4KDVA 2BXYA 2EDXA 2WM0A 5F8RC 1G4RA 1SY6H 4AVIA 3Q01A 4IBVA 3FO0L 4GAJL 4ZOBA 5DQ9B 3JWDH 1E4WH 5AVZB 3ZRFC 2IALA 1A6WH 5I9QC 3NQKA 1XCWA 2CDGA 5E08H 1RZJH 2DQCL 2R4RL 1XR8A 3U4BL 4TULL 1A4AA 3DUSB 4P05A 2CJUH 3BKMH 1E6JL 1PSKH 4WO0A 3G08A 3TZVC 1JZFA 3KPQA 5AENA 1TT6A 32C2B 4LLUA 4DPRA 1N8OE 4E9WA 1MY7A 3ARZA 2XIIA 3Q2NA 4RZKA 3UIZA 1YN7A 3AXHA 1UJ3C 1KYDA 3R1GL 4JLRA 3S2AA 1E9QA 4FQPA 1ZLVK 1SPDA 2XZAL 2GVYA 4FQQB 4OGAD 2QSCL 5A2LH 2EVIA 4E0RA 2GI7A 1BXXA 3G6JB 4PS4H 5F7DA 5FFGA 1UB5A 2K4WA 3QW9A 4MMYA 4C56E 4JFSA 3BVUA 3SYCA 1XIWA 5DHEA 2AJ3A 3K2IA 3T2QA 1A4BA 1SUJA 5DU7A 4QYAA 3PDOB 3CZSA 3S5YA 3P3RA 5EOTB 2IDCA 2UWEA 3FO0H 4GAJH 5BMFL 3IK2A 4IOSA 3BYYA 3IJYB 4X0KA 1HNFA 5B8CA 1H3GA 3KLLA 4WWKB 4Y9CA 4N8CH 1QSEE 2DQCH 4MWFB 4PP1C 3TU6A 2R4RH 2ZWNA 1HHIB 3U4BH 1BJ1H 1RZGB 2W60B 5F0LB 1R5VB 5EDSA 4W70A 3T1FA 1E6JH 1E7UA 3A5VA 4GIAA 3KZ8A 5IB2B 1NGYB 4LL1A 1EH9A 1EXUA 3Q3GA 1YYLH 1N4XL 1UOVA 4ZXBC 1IKNC 1NCBL 2B77A 2J6EA 3I75A 4PLJD 3II3A 4K4KA 4YR6B 1HE8A 3KG5A 3R1GH 3E3QC 4AENB 2XZAH 3F62A 2GSIA 1TYRA 3CXDL 3E9UA 4LPCA 2RFXB 1PY0A 1GZHC 4X6FA 1I7RA 4PREB 3G6JF 5D7JA 2VQTA 2BVOA 3BN9D 2J1KA 4QRPD 3BVDB 3DIDA 3PABB 4JO2L 4H8HA 4XMVA 3K8LA 1G9NC 2CO3A 4JFHE 2CLZB 3OGCA 4ZUUA 3GRWL 4EIBA 5ICZA 4JL1A 5HGAA 3QWRA 2XTJC 2AJXH 1MFCL 5LNEA 5EO1A 3X14A 2FEDC 5GXBB 2WZAA 4UT9L 4X9GA 1E5CA 2EIEA 5KS9E 3B9KB 5T1JA 3GQFA 4TSCL 5T3XH 1W2KT 3S36X 1FIGL 4GG8A 4DH2A 5CEZL 2YLHA 2KDYA 5JIIA 2VN4A 1O6SA 5JDSB 1JMZA 3A4DA 1B4JL 2ADFL 3VH8A 4ZMLA 4XNYL 4PJHA 4H8QA 3FQ2A 1NCBH 3VD5A 4MD5A 1E8WA 2H2PC 3LKRB 3QUHA 1KBWA 3MACH 1F6FB 5HPMA 5FKAA 4OSUL 1IBGL 2P43B 2B1AH 2VZOA 4XI5D 1RJLA 3U1SL 5C3LD 5SWZA 1NUGA 3QIBD 1CG9B 3GSOA 1KXQA 3L4VA 1CZ8H 2QDWA 4JO2H 1ANUA 2ZUUA 5B21A 3GJFH 5CLZA 2YIHA 1XIWC 4HJGA 4LEOA 5F0MB 2VDNH 3FH8A 3P1VA 3HC3L 1NCAL 3GRWH 4LP4A 4Y8DC 3UJIH 4DEUA 1JI2A 4JCMA 3QQ3B 1MFCH 2I9TB 4AQ1A 1UKTA 5T1KD 5LCVL 3LXUX 1UXSA 5IBLD 2ZNXA 5B8CC 4UILH 5DJXB 1JZ5A 2CR3A 3TBTA 1BF8A 2QHLA 3WNMA 3DPDA 3D85D 5E24E 5JZ7C 2EC9U 3ASWA 4GSXA 2YWYA 3GXPA 3L4ZA 1FIGH 5BV7L 3L5HA 2H9GB 4R97C 2YXVA 5GJTH 4P3CL 2VWEE 3MLTB 2F5BL 2MQ3A 2NY5H 1B4JH 5IJVB 4RZCA 2JIXB 3AU1B 4XNYH 4D8PB 4HUUA 1NFDB 1Z9SA 4HIJA 1KG0A 5IM7A 4ZDHA 1RJYB 5SWQB 3TJEL 3IT8D 3WHXB 4PJ7B 1I1CA 1B0RA 4HJEA 1IBGH 3GJFB 4I3GA 5BNXD 3LEVL 5CEYB 4FI8A 1FL6B 2OR7A 2VDNB 3WY2A 1OAKL 3DX2A 3GJFK 3ZSSA 2BSTB 1W72L 5D7JC 3O11B 4LKCA 3H85A 3OMAB 5G55A 5F3HA 1VHPA 1BA9A 4FNUA 4Y5YB 1WYJA 3HC3H 3FO9A 1NCAH 1PMYA 1YNTA 2OTPA 2H32H 1KXQE 4XP4L 1AZVA 3NT0A 2GT9A 4HJTA 1I3RA 4NC1C 5TDOA 5F7HA 1EAJA 5LCVH 1PD0A 5EWIL 1OPGL 1PU0A 3GRGA 1JGIA 3N91A 4H8UA 2CM5A 4L05A 3FT2B 2I26N 2GHWB 4LLQA 3SOBL 3DTXA 3MNZB 4HKZA 1BZ7B 1IGMH 2LW3A 3QR0A 2EDOA 2VZTA 3F84A 4NIKB 3ZKND 4JFEA 4DETA 5GGVL 4Y0GA 3S3JA 5FYKL 4AGNA 5DJAA 1T3FA 2F5BH 3U0TA 2CR0A 1L3WA 5FYLD 4C8XA 1EEYB 3FYEB 1R3HB 2VITB 2XI9A 1NFDF 2CHZA 3MRJB 2X2JA 2X09A 4B7LA 2ZKXA 4PJ7F 3VFTB 4HUNB 5K9KB 2HX7A 3L17A 3OLIA 3LEVH 1P7KA 3QFJD 4QHUB 3POHA 3HFML 1R46A 3BIKB 4ZMWA 1OAKH 2BLFA 2IBGA 1GY2A 2H32B 2GCYB 4S1RH 1U93A 2AXJA 1QABA 4QRRD 5HGGS 2KZ1B 3KPNB 4FQXD 3SQBB 3RDTD 4N9OB 1MDTA 3VI4F 1M9WA 2VW7A 3MJ6A 4XP4H 3M86A 2KERA 3VJ6B 1GJUA 4Y88A 1N5AA 3ZTNL 1DCEA 1KZYA 5F96L 1PX4A 3ULAB 5K69A 1UZ8A 3WFCL 4AQ1C 5KAQG 4F57L 1OPGH 2GC7C 1OAXL 2WLNA 3SOBH 4NRXA 2YBRB 4FMKA 5DJ6A 3MOAL 4ALAH 4WI4A 2OMZA 2W9EL 2WXOA 2EEDA 4N0UE 1FN4B 5GGVH 1A7NL 5E00B 2YZ8A 4FD0A 4WIQA 1A2YA 3LEXB 4UIKL 2FGZA 3BPOC 2FBRA 3RZCB 1RZ7H 2CJTA 4KJQC 3H9SA 4MA7L 1DBAL 3P11L 3UBXA 1W72B 3X12A 3PL6A 3NACH 2A6DB 3EFDL 1ZIAA 4PP2A 3CHSA 3BFWA 4FNTA 4GMSL 1JTOA 4S10A 1NUNB 3HFMH 4BFNA 4BSJA 2WLYA 5KSBB 1RHHB 3BP7A 3PHQA 3NAAH 4JZOB 3T0EA 3MGOA 4EE2A 1EHXA 3ELQA 3HRZB 1M57B 1FFOB 2R1WB 4XCYA 2AQRA 5ANHA 3MRFA 1I8AA 5E2WL 4JY4B 5DQJA 1FAKT 3I6KB 2IEPA 1GGCL 2EDYA 1OTUD 2GSGB 4Y4KB 5ILTH 2YAHA 5I24A 3GSQA 4JHVA 3ZTNH 3U46B 3BSZL 2QJDA 2CLRA 3V10A 5ID0B 4F57H 5AB9A 5DF0A 3L8QA 3SPVA 4HZ1A 2EDRA 2EC8A 1OGAA 3CN1A 2MNJB 3HCVA 4ZUVA 4FA7B 1OCWL 3MOAH 5KVFL 2W9EH 4PJGE 5FO9B 3N3EA 4OV6F 5DD0L 5DDHB 2XKNA 1A7NH 5IB5B 3IAGC 2AXFB 4OFDA 2X5PA 3FFCA 3QZMA 5EU4B 1W0WB 2XIDA 3TOPA 1FHNA 1SOSA 3EZ8A 3HBPA 5DCCA 1E8ZA 3P11H 5DFVD 4OF6A 1JZ2A 1H3WM 4M6ML 5LO7A 5DI8B 5JPNB 5IW6A 2P46B 4NQSA 3EFDH 4KJPC 4PG2A 5MERB 2AJZB 2OR9H 1R17A 1DBBL 4Y5VA 4GMSH 3AB0B 3H9SE 2ZT9C 2ITDB 5IHHA 2UXVA 3KL0A 5I75C 1NJ9B 2APWA 25C8L 4Y5XB 1KGUA 3RIFK 1OKEA 3T3PE 2N56A 3KEDA 4MD0B 1MXDA 4P2OA 5D93B 1CFMA 2ZUYA 4DEWA 1QUNB 3D4GA 3L16A 4GKSB 4X8JA 2NR6D 3S5LA 3UMNA 4C56B 1HT6A 5IB4B 4ZMTA 4FQ1H 5CGYC 5DMIH 1Q1JL 3T0EE 1WD8A 3BSZH 4QD2E 1NGWA 1JF5A 4XNMB 3OLGA 4RAUA 3VW3H 2GJ6E 3WL9B 4CC1A 2YJQA 3S3DB 1NFKA 4HJJH 3MLUL 2BW5A 3GMNB 5AVVB 1OCWH 2CXKA 3QG6B 1HXMB 5DD0H 5IW1B 5F71A 4EMZA 1QSEB 7TAAA 1XH1A 1HI6B 5DEJA 1PD1A 1AZRA 4W9KC 3IGKA 4M6OH 3TFKC 3KPSA 1JVKA 1UWGL 1VENA 4CADB 4DK3A 4Z7OE 3DRQB 5AB2A 4M6MH 1VERA 7PCYA 3PL6C 3QJVB 4LF3A 2VOTA 4BFFA 4KMQA 2A38A 3G7TA 3OC5A 1DBBH 1KTBA 4LLVA 4H0LC 5ADPL 2K4AA 4O2EB 3RL1B 1AKPA 1U0QA 4V2CB 1JF1B 3RIFF 2X4RA 1JPSH 3V5DB 5KYYB 3CN0A 3T0EC 2IMMA 3GMOA 3L13A 3MLZL 4X5PA 5D7LA 5DJCA 4AYBA 4DP5X 2HFFB 4U1JA 3T6QC 4B9JA 4LPVA 1P1VA 4ORZC 4PRIE 3B5TA 4MXWH 4UM8A 1XSKA 3PAUA 3THMH 4FJZA 3TV8A 1Z9NA 4Y16D 4Q4IA 3U1QA 3T1WA 1SHXA 5HGHB 5E0QA 4YE4L 5AW0B 5CD5C 2DM2A 5FM4A 5F1IB 4M7JL 5A43C 1RPUA 1ZHBB 3I9GH 1Z3GH 3AREB 4KQ3L 4LVNB 1IAIM 3N50A 2A9CA 5KS9B 1GGIL 1BDYA 4KX8A 3ZYZA 1Z9LA 4BFGA 3MREA 1JBJA 4HU8A 2X28A 3QUXB 4BH7A 2WNXA 4PBXA 3BAIA 2X4QB 3PDDA 2FGWH 5JNYB 5KSAB 3K71B 4PCSA 1EUTA 2PW1B 4PG2C 3G5WA 4Y5VC 1IBZA 3FCTB 5CCGE 1DBML 3RPBA 3JTSB 5ADPH 2R2EB 3OSKA 2DLGA 3TFBA 2X1OA 2HG5A 4HA1A 3L7EB 3POCA 3X11B 4GBXB 1KXHA 1Y18A 3MLZH 5E1AA 3MSPA 1UD5A 1IUZA 4IK6A 4NNYB 5HHPA 2HG0A 4P46D 3WN5A 4R7VA 2WUCL 1UQSA 4QCIB 4P2OC 4UM9A 1V27A 4PJCE 4RESB 2H1XA 3LVEA 1FA4A 4YHOL 3KS0J 1M2VB 3BMWA 4YL4A 2IPKA 3IFOA 4G7QB 4P5TB 1OWRM 2ZXQA 5B3NA 3KWXA 2XQBL 3U7WH 1JZHA 4BV1A 3GM0A 4YE4H 5KBMA 5CGBA 4UQEA 3OR6B 2APTA 1V3KA 5AFAA 2NYYD 4M7JH 2LR4A 3I02A 4ZZKA 1S7UB 2HN7A 3DVGB 1FI8C 4BHUI 5DSCB 1ML0A 1WA2X 2NSMA 4BH8B 4F8QA 4MJ6B 3L4WA 4YGVA 2F1BA 5AG9A 2V5TA 4FXGA 2EC9T 3M1CA 3W9EA 1BLNA 1N68A 5KS9F 5CLTA 3VAEA 2NNFA 3CH8A 4WK2B 3OD3A 3UC2A 3O4OC 4K0OA 2CHXA 2EDKA 3GSXA 3UACA 4NENB 3ISRA 2I25N 1U8OA 3UP1A 1BVNP 1TTAA 2B8OT 1LK2B 3PY9A 1EHLL 1DVUA 3CMOL 3L3HA 3Q2WA 5IROA 1DBMH 2AHIA 1MSPA 3L3DA 1MG3C 2EVHA 4PS8A 1CDIA 2Y07H 3BX7C 4X6CF 4OJEH 1TVHB 4GKNB 3WAJA 2NYKA 4JZNA 4TUJB 3RWDA 3D39E 3VXUA 2WUCH 1OSZA 2H7WA 1AZUA 5I1IH 1CL7H 4YHOH 3WAKA 4YLCA 3MJ8A 2XQBH 1I9RL 4NQVA 1CFNA 4U1NA 2Z4TA 3A4EA 2YUZA 2C9SA 1DVQA 3AXLB 4MJ4A 1ZT1B 3EAKA 3CX5K 3IJHA 1MJJA 2A9DA 3V6OA 1I8MA 5D2NE 4LLDA 3QC6X 2ZP8A 6CGTA 2VQ4A 4NO0B 3T8XB 4MXVE 1PCSA 4KKZA 3O2VL 4EUPH 5EEYA 4JY6A 1KEGL 5GIRA 2P5WD 4A7SA 5C0GB 1KBBA 4GO6B 1PBYA 4TNGA 3T4YB 2FR4B 3CUPB 5B3JF 1EHLH 2FO1A 3CMOH 1M7IA 1V55B 1D2OA 4CBZA 4U05A 1F3JA 2YXFA 3DSNA 1B0GB 3BEWA 1NFIB 4Y19A 1MCFA 3PXLA 1IMHC 1WSST 2B3RA 1OP5H 2QPSA 3K6DA 3WN5C 2DL2A 4AWJC 1AO7A 4X5RA 1GAFL 4YSSA 1VEMA 4AJYV 1BZEA 4B53A 2ZJSL 4XPAL 2XXFA 4HF5L 4AZUA 2GIMA 3COOA 4AG4H 5F9WC 4WU7A 1MKFA 3QORB 3VXUE 3PNRB 3FMGH 3LN5A 4X80L 4PG9A 5DHXB 1FZOA 4KU1A 5CZXC 3RX5A 1S3KH 4AYEC 1HX0A 2IWKA 5JORA 4EUPB 1ZHNB 1A9EB 3B9DA 1FP5A 1JTPA 2W0KA 4LLWA 2EDEA 3LPGA 3O0RL 3VRIB 4FXGC 2OMVA 3FB8A 4N0UB 1PW3A 1N12A 3BZEA 3O2VH 3GI9L 4OF5A 1C08A 1KEGH 4HHAA 4BQ6A 5DLML 2PXYB 4NN7B 1XCXA 1TZHA 4O58H 1SJEB 4K5MA 5IROC 1DJSA 5L7XL 3OKEA 1H0DA 1OP5K 2AJSL 4U2YA 2VABA 5DR5H 1RZIA 4OCYL 3GMQA 5GS2H 3KD4A 3V4LA 5GS0L 1ZTMA 2OSLA 1TTUA 2NZ9D 1DUZA 3CPUA 4A55A 2WLJA 4UQ2A 4WI2A 2KI6A 3LZRA 3G04A 5CIPH 3EH5B 2QQQA 5IEKA 1GAFH 2IJ0C 4H4NA 3TEYA 2UVFA 3DMMA 4XPAH 1JNHA 1SHSA 2BNRE 4U6YB 2PYFA 4OLXL 1ZLSL 5I0XA 4G1EB 3RJOA 1J1XL 3TH2T 4LASL 1XZ0B 2TAAA 1AO7E 1LILA 1TEFA 4XCFL 2MPVA 2RR3A 2ZPKL 3O0RH 2NTSP 4K9EL 1A9BA 1XD0A 3V6OC 3HI5L 2NXYD 1ZLUH 3US0A 2E27L 2GAZA 3A24A 3EJJX 3MV7E 4PJGB 1KLUB 4V33A 4LIQE 4W9LC 4UYPA 2JI1A 1KFAL 3NCBB 1VF5C 3GI9H 1PZAA 4R5TA 2BDNL 2ESVA 5F1NB 4ZG1A 3K46A 1PLBA 3F12B 3X3FL 3GHPA 4MDIA 5JTWA 4HDIB 5DLMH 4HIIA 2XKSA 4XC1L 3O41A 1BVKA 5BRQA 3U6RB 1DANT 4XN5A 4LP8A 2YGNA 5CIPB 3MJWA 3O6MH 8FABA 2AJSH 3KCWA 2F74A 4LSQL 4LVEA 2SEBB 1GY1A 1HDMB 3RJQB 1OGTA 1QVOB 2XWJA 3DPBA 4OCYH 2R0WH 2W91A 4HK0A 4E5XG 1J5HA 5JO5A 5JHDB 2ZAHA 2CAKA 1A21A 3IWVA 1FNSL 1RIUH 1RK0A 4DP7X 5BO1H 1KIPB 3F01A 3T3PB 4BZ1L 1RI8A 4DN4L 5LLIC 3APDA 3F85A 4MDJB 3CZGA 1T1XA 3KPPB 3E6FB 3N06B 4U3XA 3HLAB 4OLXH 1ZLSH 2PWEA 1OT1A 2QQNL 3GZQA 1RZ8A 3NA9L 4JX0A 2AK4D 1J1XH 3BIAX 4LASH 4L4VD 1S7VB 2V9TA 2WO2B 3FH5A 2NY0D 3FTGB 3QT2A 4NNPL 5ETUA 4XCFH 1ZLUK 3RHWK 3MV8E 2GJ6B 2F53D 1UM5L 2Q2EB 2WYTA 2ZPKH 4JAMA 2W0FB 5TE6L 3UJJL 1R0AH 2VXTL 3PWUB 5IUCA 5B38B 4G7RB 5JOPE 1ZJAA 1KPUB 4PJGF 1HEZB 4ZW3A 4DTGL 2FD6L 1YC7A 2EEXA 3F83A 4DOHE 1KFAH 1CWVA 1WGVA 4DERA 2EVGA 1B3JA 1D5BA 2BDNH 4CA4A 2J2ZA 3X3FH 4RWYH 1F6LL 4AV4A 1KJVA 1U42A 4Z7OB 5HGDA 1LP9A 1NA8A 2X38A 1D6EA 3BDYL 5EIIA 1QZNA 4JO4L 3FOMA 3HZMA 5TH2A 3KPOB 4LSQH 3PWLA 4LNRA 5A7BA 5KJRL 3BRGC 1BQSA 1KEML 2WP3O 4AQEA 1R3JA 4FTVA 3FU7A 4HV8B 2Q76A 1JXFA 4GS7B 1LGVA 3M7FB 1NM4A 3MLYL 1FNSH 1IBFA 2X44D 4BZ1H 1YQ2A 3Q48A 3DMMC 4PRIB 4YBHA 5AL0A 5AVYB 3T3PF 3V5KB 4CSPA 4NFCA 1OV8A 1VEPA 4KK6D 2L4OA 2QELA 2YQ3A 3KWWB 2QQNH 3NA9H 3WTTA 4A7GF 5L2KD 4ZW8A 4PJAF 2OMTA 3H42L 2QQKL 4U7SA 2BS8A 2OYMA 4MMZB 1KTLA 4CDHA 3UJJH 3T8VA 2VXTH 3L2MA 3FC8A 3NGBC 4YOKA 3B5GA 2PPCA 4FERA 4RRPA 4YFLI 1RUPL 2FD6H 4DTGH 2XPYA 4OB5L 4FFVC 1R5IA 4X6DE 1U3JA 4QOKA 5INCB 5TJWK 4N6RB 4MCZB 4TUUA 4KHTH 1FVCA 2HCZX 2LVCA 4IRZL 4UQAA 3WTSA 3GNMH 4GJTB 4Z7OF 3WTXA 5HXMA 1N6QH 4F33A 5KJRH 3I3EA 4N3UA 5CP7B 4JJHA 1KEMH 1RUML 4UTAL 2YEZB 3SKOA 4PEEA 1BIIB 3S97C 1BAGA 4J3OC 3ZTDC 2GJZB 2AC0A 3D4CA 4QO1A 1S78C 2DKSA 3VXSD 1T4WA 1IBDA 2VM9A 2YSTA 4Z8FL 4XT1C 4PJCB 1G7JB 1Z6JT 4CU6A 35C8H 1IGYA 4Z5RA 1JPFB 2WXRA 4A04A 3B2DC 3X1GA 4OF8A 1FO0L 4N2DA 3QXDB 4J8QA 1HL4A 3H42H 2QQKH 4N1HB 4UB0L 1RPKA 2N4IA 4FQJL 5GS3A 3BIBX 4U1MB 1OB0A 1DQJB 4WUKL 2KUTA 9PCYA 3WENA 4KZCA 3PGCA 3QK0A 1RUPH 1U36A 1AZBA 1WC7A 4HJ0D 3AMKA 1XL4A 4OD3L 4OB5H 1FF5A 2NW2B 2A4ZA 4M4PA 1M3JA 3TO4A 4FABL 1UGNA 3K6FA 2VZVA 4JN1L 3NK3A 4ZRGA 4X6EB 3FOLA 4CMHB 5ALCH 1ED3A 5EN2A 2DM3A 3QDMA 4ZNCD 3MA9L 5DO2C 4JRXD 4K8RL 1N0LA 5IMKA 1QO3B 3IN2A 2E9WA 3SBWA 2ZQKA 4UTAH 3QQXA 3SDAD 3NJIA 2P8PA 1G43A 1MREL 1U8LA 1T5WB 1FVDA 2AEIT 4EI5D 1JZDC 3U9UA 4WJG3 4X9YA 3D39B 1I4FA 1M05B 4ANWA 1OZUA 4PW9A 4HAKA 3LOWA 4UZGA 5AYUL 3GBNL 3SDCB 4PJ8B 4PJCF 4YC2B 1M56B 3KYOB 1FV1A 3QEQE 3RTLA 3K72B 5DZAA 3L4YA 4YSAA 4FQIL 1TPXC 3H4HA 4TSBL 3DV6B 1X9LA 3GHBL 1AC0A 1JL8A 3AZUA 4UB0H 2H0JA 4FQJH 5C0BA 3BW9A 3ZT5A 1D7FA 2K1MA 4WUKH 3LNHA 3FTUA 3T0VA 1QFOA 2AS5M 4L8BB 1KBKA 4L3CA 4HLZG 4QT5A 1FYTD 3T2NL 4AV0A 3AG3B 4AVHA 3PPSA 3U25A 4LLMB 5CSGA 5D2NB 3QR1A 1Y0LB 3WGVB 1HQRA 2JFCA 3CFBB 3F7VA 2EYTA 5DJ8B 4YK4C 4IDJL 2HN7B 3EGXB 1CFTB 4JN1H 3SE3A 3I9PA 1NDMA 5C6WH 1JXJA 3EG9B 3LN4A 4GB9A 1CI3M 3PFQA 3MA9H 1GOGA 3MKKA 3O3AB 1JCVA 3KHQA 2CO7A 2XPZA 4N24A 1EJOL 1T7VA 4LIQL 4ZS7L 1ZKAA 1SEQL 1PNDA 2O4EA 2AEQL 5TF1L 4PGDA 2A6IA 2O6EA 1FO0B 1HESA 3L9RA 2NY2D 1ZJBA 5DMKA 4KMLB 5AYUH 1TQUA 4GQRA 4L48A 2P1YA 4NQTA 2CHWA 1BAFH 1KJ3L 1SOQA 2BRQA 1T0MA 2FSDA 4FQIH 5H94B 3VYPA 2K9FB 1K2DA 1V05A 1AGEB 3FU8A 3GHBH 4BSVA 4PUBL 1YYCA 1NCJA 3QIUD 3SCMA 1HKFA 4WNQB 3HS9A 3DETC 4UT6L 3K6SB 1KC5L 5BQDA 4HIEA 3KR3L 4JRYB 1JZ3A 4L8DB 4U1NB 3N0AA 2VL4A 3ZZSA 2GW5A 1XGRB 3QPQC 4QKXB 3I74A 3TO4C 5C0BE 2C1OA 4IDJH 4MXVF 4OGXL 2HWZH 1KB5A 3LPOA 4D94A 1S9WA 1NGQH 2BXZA 5E4IA 2WTOA 2A6JB 1SM3L 1T2QH 5LAXA 4DP0X 4MZ2A 5HDQL 4N8VG 2EVFA 2M26A 4LIQH 4ZS7H 3SBWC 4NYLA 5SV3A 1U3NA 2BIIA 4MB4A 3WDHA 1M6OA 3ZE1E 4BWWA 1GS8A 1KGCD 2E74C 3L1EA 5TF1H 3S88H 2WKLA 5IHUL 4I0CC 5ISZA 4NN5C 1DVZA 2E6JA 1AGCA 3OKOB 3AQXA 3CK0H 2XV3A 3FQRB 5D7IA 4O2CB 3BZFB 3FRPG 4DKEL 4Z7NF 3BZ4A 4H8WL 3IDIA 3DX3A 1MW0A 1NLDL 2R1XA 2CO4A 3D4ZA 2D9CA 2NY3C 3VFVA 3DJ9A 4WFHD 2BNRB 2X9YA 5E8OA 3RGVB 2WD0A 2E6PA 1UM4L 4PUBH 1YJDC 3G5YA 2GK0B 3QDJE 4R7NB 2J44A 1AO7B 3OWRA 4UT6H 4FKKA 3G5ZB 2JB5H 1KC5H 2FT6A 3JV6B 1BEYL 2DYPA 2HPOA 3KR3H 2BZ7A 2G3XA 3MV7B 4K7PX 3S4SB 4XVJH 1GGBL 3OMZA 4OGXH 5CU5A 3ABMB 1ZTXE 1HYSD 5ITFB 1JCKA 3SE3C 1I7ZA 5KBDA 5HSFA 5LDSA 1T7WA 3P2TA 4F93B 3ME0A 1KT2A 3MO1A 4XC3H 5DHVA 1RK1A 4W4OA 1OK8A 2YPLA 3TNMA 1NTDA 3B3BA 4Z7WA 1C08B 3HFFA 3N40P 2HFGL 2GYSA 4Z95L 5IHUH 4M1DL 5K9JL 3FUKA 5BOZG 4A6YA 2OKMA 4HS8H 3T65B 3X3GL 2ICEB 1JFHA 3C6LA 3LH2L 4H8WH 4KKCC 1EVUA 1NLDH 2Y3NA 3GDBA 4M43H 1BG9A 4LHJB 5I2IB 2YOAA 1RIVL 5ISZE 2EEAA 4WSJA 5IIEB 1YZZA 1UM4H 2Z35B 2NSQA 3OJDB 1HEHC 1K3IA 3SCMC 5CJXA 2DY2A 1T1YA 4W4NA 1AR1C 2LU5A 4Z7VE 3PIQA 4HUVB 2WB7A 3MV8B 3IRPX 2HMID 2KPNA 1XD1A 1RSYA 4ODWB 3L7FB 4HETA 3WYRA 5AW5B 2MHAA 5E4OA 4HFWA 4CW1A 4WJKB 1K8DA 5BS0B 1GGBH 2OX5A 3CDZA 4FX5A 4DOHB 5LDUA 4KO6A 5ACLA 1EA9C 1U8IA 1I85A 4WWKD 1FVEA 4PBDA 1CDCA 4XX5A 1H15A 2UYLA 1TTFA 2FWLB 1MHHA 5D72L 2NY6C 4H0IA 3WJMA 3SQOL 4MFHA 3BUQA 5F7YC 1DEEA 1HHJB 2HVJA 4FQHB 1ZHKA 5FB8B 3QQ4A 5K9JH 3QI9A 1QWNA 5T1LA 1DTUA 4XWOC 3RNQA 2RJMA 1MW2A 3C5SA 4OV5A 1XFPA 1LK3H 2A4EA 2Y1AA 2DWYA 3LH2H 2VLKE 2PWFA 4JPWL 3LSOB 3DO4A 3ZDZE 5K59E 1F3DJ 3N40F 4PWJA 4HQQL 5D4HA 3VXPA 2MKWA 1ZA6B 2OXGA 3W0WE 4KXZH 4O51B 1TTRA 3WFEH 1YMMA 5TQ0H 5F1OB 4I4WB 3SOTA 4Y1TA 4MMXA 1TQBB 4RAVB 1SFHA 2ED6A 2ENYA 3Q8BA 4G8EA 4GRLB 4U1GB 4HMEA 5AEAA 5BCAA 3TIDA 2HXAA 4GQ9L 4ABQA 4AUJA 3VFMA 3GTTA 1BMGA 4NWTH 5IESL 1HHGB 4QRQA 4UIMA 2WINA 4FULA 2O5ZL 3IB4A 4X6DB 2CU9A 3CU7A 1PF3A 1DCLA 1OCCB 4KKAC 3IF1B 4MGXA 3B9KD 3MUZ1 5FA4A 2CUMA 1YEDB 1U58B 3MNWA 5BUGA 3QZBA 5CJOL 4W4OC 4M1CD 2G4GA 3D3VA 2YUWA 3VWJA 5F0PB 4M7LT 5EBLB 4G1MA 4Z18A 1WUNT 5IREA 2YEQA 2JJVA 4S1QL 2NNCA 3VD3A 4F7TB 1DZ0A 4WI6A 2ERJC 2IPUK 5BVPL 2YRPA 1E5UI 3OR7A 4Z3FA 3C6LC 2R51A 5DWPA 1M1XA 1OK0A 1F4WH 1GSMA 3VGFA 2VR6A 4HQQH 4M61B 3QGVA 1OT2A 2ZCHL 3CLFL 1RAMA 1MCDA 2FATL 1KLGB 5DJ0A 1QKZL 1JOIA 2FNBA 2FAUA 5CJXC 1OSEA 1SQMA 3B7SA 2FX9L 3GGWA 4HWZB 4PJXE 4KDTA 4ZUTB 1U8QA 1P5VB 2FL5A 2Z92A 5HHQB 4R2GB 5DHYA 4MD4B 3AT9A 1R5WA 4GQ9H 4QRAA 5T3XD 3SKNB 3GS0A 3CSTA 3RVWC 1FPTL 4XMZA 5LG6A 4NDMA 4G70B 2O5ZH 4FXKB 4FADA 2VRKA 1I85C 4J23A 4FFYL 4M5ZH 2XBDA 3FB6B 4HHGA 1LQSR 1K5WA 2UX6A 1W0VA 5FM5O 2X53A 1HYRC 3ARGB 4AUYA 1PJWA 3L54A 5AD0A 1WHPA 5DFTA 1FJ1A 4EIZC 4MAYA 2JIXD 2X70A 4X5WB 3QWOB 1MFBH 1WIOA 3C5ZB 4YX2L 3V6ZA 2DI7A 2XNAB 3QI9C 2VO8A 3VXQA 2AGJL 3A4AA 4KRPC 5CN3A 4GKZA 3KWTA 1G4MA 5DC4B 2P80A 4WNJA 4D0CA 4GW4B 3R8BB 2XU9A 4PTTB 3HZVB 1LXMA 3ZYJA 5JIMA 2FATH 1ZGLA 3EO1A 3BLBA 1QKZH 3QEQB 1ORQB 5JXED 3FFOA 3T4AB 4K3HA 5E70A 4EVNA 1QEWA 4MMXC 3CHPA 5ICXA 1FCGA 1PKQE 1BQUA 2YRZA 5I73C 3MBXL 4XE5B 4L29B 1U8JA 3WLWC 3MTRA 4MYWB 5CEZD 2CIIA 3MFFB 4J4PD 5D71L 3JTTB 2Y5TA 3FSVA 3T04D 2PWDA 4FFYH 2VLRE 3MR9B 1VZHA 5FUCE 1BOYA 3LKOA 4OM0H 2JLPA 1CDYA 3CVCA 4G8GE 4TPRH 1RD6A 3WIAA 1F6AB 5FCUL 4TS6A 4X4XA 4LARL 4P2RE 4HKBA 3LZFL 2BSRA 3FQXA 3QIWA 5C0AA 3NPZB 4N0FB 3VWJC 4XOEA 5EA0L 2P5EE 3W9DB 2WWOA 2AKRA 4U6VH 1A66A 4OBRA 4D8OA 1ZTXL 4M8UA 3V8CA 2AGJH 1A22B 4M6AA 5DRNA 3DV4A 3B6SB 3D48R 1SYVA 4JS7A 4NKDB 5IQ9A 3KYNB 1F1DA 1ZV5A 2EIZB 2XG4B 3FQTA 1G7LA 1R1CA 4B96A 4G6FB 3PQYB 3WIIL 1ADQH 3LV3B 5FYJU 1XF5A 1HK6A 1BZDA 2O30A 3N1FC 1F11A 1B0IA 1MH5A 4KUCF 3DXAA 1CT8A 1S7TB 4LXFA 1Q9KB 1BYNA 1UWYA 3MBWB 4KDTC 4F37F 1DFBL 2D8KA 5E5MB 4TUKL 4F2MA 3MBXH 4EQ2A 2OI9B 3UTTA 5E51A 4LSSH 1EZVX 3Q1EA 4RNRB 2VN5A 2QZ5A 5IJKA 4ERSL 1GS6X 5D71H 3TBYA 3OX8B 5E8NA 5J0BA 4IOFD 2LT9A 5C0BB 1G7MA 1P6FA 3MRDA 2C9QA 3L45A 3OB0H 4JJ5B 3ABZA 3U82B 3BPNC 5EF0A 4LARH 3LZFH 1QLFB 1FSKB 2E3VA 2OFQA 3RZCD 2NY4B 3MRRB 5EA0H 1N8ZB 2XWTA 5C0IA 4I18A 4MAYC 3KH4A 3ZE1B 1ZTXH 3IJ9A 1OM3L 3WNOA 3RFZB 4ZO7A 1S9YB 3I3BA 1ECZA 4IGBA 4H2AA 3EYQD 4V1DA 5J13B 2Q3XA 2O26U 3CTTA 4JRLA 1KIQB 4ZFQA 1W8OA 2IH1B 3WIIH 4K2UH 3VXRE 1XCTA 1OVZA 2VO5A 4G59C 2XXGA 3STZB 1U8CB 4ZUSB 4JFTA 5DK0B 5E0FA 3TJPA 5I8OL 1XBRA 5HHOA 4PJEE 2DKMA 5AAWA 1BVLB 3QDJB 1F56A 1DFBH 4KHXH 4O02L 5KYXA 3EFFA 5C6PB 4Y4KD 3ALWA 1D9KA 2V2WA 1S5HB 5FYKD 2E76C 2D0GA 2L8AA 4ERSH 3UTZA 2Q86A 2W94A 3OB0K 1G9MH 3QUKA 2BHUA 4KRNA 4F2ME 3CDGA 2OMWB 3LMJH 3OKNA 4XCEB 5AUMA 3WNLA 4HOXA 5HVHC 1CDJA 3ZL2A 2Y6SC 1SBSH 1IEBA 2O61B 3FN0L 3QIWC 4XHJC 5I1DB 1J48A 4XH2A 5I19L 1GTNA 2EDBA 2CPUA 4RGNC 2JKTM 1J1OL 3KW7A 1KN4L 2WZPD 1MIML 3UABA 3ZE1F 3EYFA 1OM3H 3WUWA 5I1KL 3NCEB 2EZ0D 4AQAB 1M71A 5ADOH 1MJ7L 4PWHA 3R06A 1IQDB 1JG9A 5DMGC 4NQDE 3L5IA 3P4MB 1UXWA 5JPMC 5DUML 4B3VA 5H35B 4HPYH 1JGDA 1MCEA 5B1JA 4C56D 4O02H 2WLLB 3VQMA 4Z7VB 1BJMA 2VTFA 4W6XB 3C12A 1WFMA 2VR7A 5IJKC 1SJHB 1PLGH 4LSVL 2JK5B 4OIAA 2F7QA 1F4XL 1IILE 4EOWH 3FO2B 3CZNA 4JO8A 2VN6A 3MRHB 1WFIA 2N59A 1QSED 3B3IB 4IRSB 4EKJA 4F7PA 3FN0H 3ENEA 1T6WA 5DJDA 5I6LA 2DQEL 4PJFA 1ASPA 2HVBA 2QL1A 4IS6A 4YDVA 5F88B 5I19H 4I18C 1JP5A 2I5YL 1E4HA 3CWGA 1J1OH 4ZMVA 2OCJA 1KN4H 2OJEA 4FNLH 4WEUD 1DJXA 5I1KH 3MRKA 2WNKA 4IGBC 4GSUA 1RUKL 4BKLA 3H55A 5C9JA 5HGBA 3RY6A 3GSRA 3BWSA 1OTTC 4EO5A 3D2TA 2VLKB 1PFOA 4N8PA 4O02B 3ZDZB 1O6VA 2N3JA 1P4LA 3LQZB 5DUMH 1WD9A 2W0LA 3WV0A 1SXSA 3CE1A 3UGEA 4DGYL 3PNWB 3W0WB 3DX9A 2F19L 4NJAL 2F9BT 3CLEH 2XBZA 1GH7A 3GSNL 5AAWC 2WN2A 3DO7A 1HHKA 3D0LA 5JPMA 2CR6A 1D9KC 2XC8A 3P2DA 4JFHD 43CAA 3KGSA 4G6KL 1IJNA 3GMPB 4FTDA 1IU1A 3T77B 3CFKB 2QPUA 1MCCA 4LSVH 1T04A 1QBAA 1F4XH 2HTKC 4W9ZA 3M88A 1I8IA 3ARED 3JWOL 1U2YA 1NEZA 1XF1A 3FAWA 5I26A 2CO6A 1F8TL 3NCYS 4BYHA 3I6GA 1W80A 1SMAA 4FC3E 2DQEH 3EOAA 2BOCA 3ZO9A 1GZQB 4PJ9B 2OMYB 3MZGB 5DO8A 3QUXD 3RWCA 1JV2B 2XT1B 4GI9A 5F6IB 5I5MA 3LKSB 1QOKA 1YLBB 5KSAD 4AM0B 5JW4R 4L0PB 4YHPA 3REWA 4NBXB 4WSGA 1DQQA 1IIIA 4PJFE 1U8NA 1SN0A 3O3BB 2X1QA 3EJRA 4GT0A 4R9HA 2ZUWA 1IM3A 4KY1L 1CVRA 4H88L 3KVQA 1UADC 1R47A 5TDNA 5TE7L 4GBXD 3V4VL 2Y7MA 4PFEA 1ZHKB 4WO4A 3T08A 2X4PB 2F19H 2Z7ZA 4NJAH 3GSNH 5B1JC 3GBEA 1DVFA 3ZR5A 3RKDD 1OE1A 1VAHA 3FT4B 4UQIM 2OW7A 2Q8AL 4PJXB 3NFSL 1JGVL 4P5TD 4B41A 1FC2D 3T2OA 2UZXB 1IQWH 1I7TB 4N0CC 5AKTA 2AXGB 1GTFA 4G9DB 1HC1A 2QBWA 3V0VB 2DQJL 2EDFA 2VE6B 4DPAX 3JWOH 2GFBA 2YFNA 4BD4A 2CCWA 2F7RA 2YMXL 2YAQA 1F8TH 1UOWA 1EHNA 5D5ME 2FJHB 4IIZA 2RH0A 4JKMA 3CCHB 4F7CB 1P9MA 1FFPB 3LZQA 4K94L 5DQDH 1TKWA 4XZUB 5HHNA 3OKMB 1EDYA 5AOIA 3RY6C 4L1SA 4P23B 1TXKA 1JZGA 3GSNB 4GUCA 4L0ZA 1TVBB 15C8L 2YD3A 4Z0BH 5H37H 3S98A 1CURA 3QEUA 4C4KT 4JHAL 5TE7H 1KENL 3SDXA 1FL5B 3V4VH 4DUXA 5C2UB 4WGKA 3CDFA 4XXDA 1RY7B 2Y24A 1JZ6A 1BD2E 4NUQA 2WZ6A 4GMTH 1UG9A 5F9JB 3VDBA 3W11C 2XSKA 3DHMA 1JGVH 3FL7A 3NFSH 4FMFA 4IU3B 2C7UB 2XDHA 4PJXF 4KK8C 4XPFH 1PKQB 1VB9A 3OKDB 3UGUA 3L3JA 5B4MD 4S0SD 5I6NA 4BE6A 5H8DA 1G6RL 4OVVA 3DVNB 3H6JA 3NABH 4ATTA 5IP4A 5EF3A 1OSPL 3HN8A 2VLRB 3PGDB 1MZYA 4JNXA 3ARXA 4KTEH 1JWSB 1BCIA 2D7QA 4G8GB 7FABH 5IB3B 4NO0D 3IDMB 4HKXB 3DOHA 1XMEB 4P2RB 1IGTB 3ATAA 1ZDQA 3D2UA 4JR9H 1OM9A 3OJ2C 2CA3A 4JFDA 4MZRA 2MJWA 2P5EB 3V4VB 5M7QA 5DA0B 4K94H 1WBXB 4ZAKA 3HA0A 4BSWA 3EJQA 3ATDA 3SE8L 2Q1EA 3IDNB 2E7MA 1JYWA 3V7AE 15C8H 2MFNA 1Y1DA 4ZXBB 2BMKB 1E43A 5CLYA 2JCCF 5D1ZA 4GFXA 4YDIH 2ICWB 4WO4C 1IC5L 4GIOA 5FKPA 4ZPVB 3IS0X 4WU5A 5IHZA 4JFZL 1SOKA 3IJSB 3AM8A 1DVFC 2Z91A 3RVVC 1JGLL 1YEEL 2CRYA 5DJZA 3T6WA 4D7PA 3UPRA 4U3CA 4PRHE 3VFNA 1DJHA 1OXYA 1HSAB 2JE8A 2CNZA 3QG7L 2E4FA 3QORD 4B95C 1BBDL 1SDDA 1G6RH 3OC8A 4QUOA 2ENSA 2MPAL 2ZUTA 1RMFH 3ULVE 4YBLC 4KX7A 4OUUA 3I2CH 1EIBA 2BRRL 4CMMA 1I1YA 1SJVA 1Q0XL 1AG0A 3AQDA 1N59B 4S2SA 4WSKA 5CD3A 1JHLH 3IWUA 4HCRA 4Z0XA 5HDWA 1XF4B 1P9MC 3NFPB 1UHVA 3KS0H 1XGUB 4WDIB 5JYLA 2PXYD 2XUWA 5ENWB 4FMVA 4ZTPL 1I1AB 3SE8H 1J8KA 1MPAL 3B1UA 4NQXB 2J8UA 5CHNA 3RBGA 3FYIB 1FG9C 4JFDE 3CC5B 3HE6B 2E0PA 3CVIH 1IC5H 5E4EC 3VXRB 1D7DA 3KXFB 4PR5B 5BQ7A 4X4YB 2NXZC 3BCFA 2A1WL 1G6RB 1A8JH 4G71B 4NQQA 4PJEB 1UENA 1WS8A 4OCRL 3IFPB 2C9XA 5EBWA 2VIRB 3QG7H 4PJBA 3ZRCC 5GGRA 4LQ1A 1AGFA 1QLRA 3TIEB 1BBDH 1VKXA 3UBXI 3MRGB 3NSFA 1KV3A 4PGCB 3FFDB 3LXCA 1AZCA 3ZDXB 1Q0XH 5KBKA 4BA8A 4ZW6A 1XGTB 3HNSL 4ABWA 4DJMA 1GPOL 1IC7L 5IHBA 5I8CB 4C83B 1P1ZA 5TQ2L 4JFVA 1CD8A 1C7SA 4LMQI 4L3EB 3VUAA 5JDJA 5GS2D 2DIJA 3D0VA 1H19A 3BGMA 1EMTL 1Y7VA 4ZAKC 5IR1B 1KGJA 4XCNB 1JXDA 3FS9A 2VW4A 3D8MA 4NLHA 5EU5A 3V4UL 4I9WE 1HL5A 1S8DB 4G6JL 4TV3A 1UZ6E 4B5ZA 4ELKA 2VL5A 1AQDA 1BGXL 5D1ZC 1IM9B 2HJLA 3ZL4L 4NQDB 3UO1L 3QDHA 5JHDD 3MRBB 4B9KC 2R2HB 4OTXL 2A1WH 1ACXA 2J8UE 3M1BA 3AM8C 4BE5A 3NJGA 2C1PA 5E5LA 3OKLB 4BUHA 2HKHH 5F21B 4MNGA 1XB6A 4OCRH 4HPOL 1SXZA 4HD9A 5KW9H 2DEYX 2FNWA 4NP9A 4OZFH 1A02N 3B8SA 1AXIB 2H45A 4Z3JA 1D5IH 5E6SB 5F7WC 4DAGL 3ZPDA 4AC4A 3VGEA 1JUFB 2QTVA 3JWNG 4FKEA 5DRXB 3MTXA 4QTHB 4R7DA 2W07A 2GJ6D 2LABA 3DGGB 2AERT 1IGFL 2VISA 3LRSA 3O6FB 4ABUA 3ZDXF 5C7XL 5ANMA 1A0QL 1KJ2L 3HNSH 5I74B 2FJFA 1QWHA 1BYOA 3VQLA 5D2LE 4KFZC 4AC2A 1GIGL 1T5XB 3SB3A 2OL3A 1ROWA 4RAHA 5IT2H 5F7LB 4Z3GA 5AW7B 1A6AB 3IFNL 5GS0D 1BFOB 1EMTH 3QUKB 4UNUA 2IPTH 3P77A 3SDYL 1XGQB 3QZWB 4I48B 3DX7A 3DX8B 3V4UH 1MVUB 2NLJA 2R83A 4HEMA 1GXEA 4ZFZB 3RURA 4G6JH 3QULA 4LKXA 1OW0A 3HIZA 4WWNA 3H3PH 2J55A 3ZL4H 3GLAA 1PIFA 2CDEB 1B4LA 3QXAA 4OZFB 3UO1H 1Q90A 4A2GA 1CF8L 3LJ3A 1AH1A 4OTXH 3L5WB 3LIZA 5ESAB 3L95A 3IMWA 1KJMA 4PRID 3LTVA 3M6DA 1P4BL 1M42A 2BVQB 1LO0L 3CZFB 2EE9A 1Y6KR 3JBG7 5JR1L 3D25A 1WS7A 4ZODA 4F9LA 3GSWA 4DAGH 4PB0L 3E0GA 5I6XC 3P3SA 1MHEA 3ZY7A 3HS0B 2BIHA 3LS4H 4O00A 4TTDD 5J6GB 3UX9B 2G60H 5C7XH 1CGWA 1IGFH 2CBMA 4A2EA 1R3KA 2WIIA 4QRPA 1KJ2H 4BQ9A 4OF0A 3SGJA 4GAFB 1TFPA 4ENED 5I1EL 1GIGH 5E1HB 3D7PA 1MCHA 3CIQA 1FL3B 4MQTB 3RRQA 3IFNH 3M7OA 4HXAL 2YAMA 3P3YA 5ANME 4Q9CA 3SDYH 3SE9L 1L0XA 5E9DE 3IN0A 1KPVA 2X4UA 2JLLA 2X6UA 4HUXA 1GGUA 1T7XA 1HQ4A 4AXWB 3NVQA 4ZYKA 4PJHF 3AC0A 1I8LA 3QJOA 5HHME 3HG5A 5CFHA 1XCQA 4ZFGL 1P2CA 1N67A 3ES6A 1JHTA 5DT1L 1YPZE 2OJZH 2Y5QA 5E9NA 4ONFH 3RDJA 5C70A 2E7DA 3FUJA 1PVHA 1TSHA 1MCQA 1LO0H 4BUGA 2JI2A 4WW2A 4BDVB 1KJ2B 5JR1H 2ZXBA 2Z7WA 5SV4A 2BC4A 3UZQB 1XH3A 5SWSB 4ZQKB 4F15B 5AW4B 5EEVA 4OGAC 5D4JA 3QA3A 3QIBA 3GXDA 5KYNA 4ZNEA 3AAZA 4MXQD 1F41A 1G1YA 2AEPH 3K7UA 5E2TH 3T6VA 5GRVL 3N41F 5I1EH 1VFMA 1S6NA 4R4FL 4U1LB 4YPGB 5HBBA 5D5MB 3V4PL 5IVZB 2PCFA 5EF1A 3H2WA 4OD1L 4XN4A 3PF2A 2P48B 2UY7B 2Z31B 1YEWA 3APMA 1S9XB 3B8YA 3BH4A 5MENE 3CV5A 4YXKL 3WNIA 3DX6A 4RQQB 5T1KA 3O2DH 5DVOA 1GVIA 1MWAL 1A7QL 3F05A 4IJTA 5LN4A 3W39B 5J9PA 4X7EC 1OW0C 2NUTB 5IF0A 3D85A 3ZKXB 1NCOA 4JDTL 5B1AB 3MROA 3ZOAA 3LKQB 5EUOA 1MLBA 2IOOA 4ZFGH 3QFDB 2X9ZA 1GZPA 4FL4C 1LWJA 3D39D 1MRFL 4AX3A 5JMOC 3QVAA 4XX1E 4F7MA 5E8DL 3B7YA 1BD2B 2ICCA 1JDCA 3BUBA 3E8VA 3JV0A 5ESVA 2E46A 3SDCD 3K2UH 2WVVA 4PJ8D 1ITCA 2ODHA 1L5GB 4PLJC 4F9LC 3QUML 2QVTA 1AQKL 3U79A 3INUL 1A6ZA 5EZLA 2Y1ZA 5IEHA 5T33L 3G5VA 3V0FA 4NRYB 4BZ2A 4EDWL 4PD4K 1FFTB 3IGAB 4OBSA 3H1ZA 3BN9C 5IVXE 1CE6A 5AYTA 3NJFA 3R0NA 1WWCA 3WIHA 3SGJC 1JPTH 5F3BB 5DZJA 3IDYC 4R4FH 3BO8B 3OPUA 5EOCH 2OLDA 5D5MF 4OD1H 3BD3A 3PPEA 1G7QA 4QRSB 3ULVH 3H54A 4A7QA 2WNWA 1JNLH 4IBSA 4YXKH 1KMGA 5E95B 5AOKA 3ELAT 4G6AD 3VTAA 4IU2A 3HPLA 1A7QH 1CFQA 1U95B 1UKQA 5CBAB 5D6CB 2Q6WB 1IEHA 2W9DH 1QFWI 1I8LC 2A77H 4JDTH 5KVDL 3TXAA 5C3TA 4U3SB 1CDHA 2ARWA 1CPUA 3O6KH 4X7SL 3U0PB 2DWDB 5J1AA 4AYID 2XQ0A 1BBJB 2UUDH 3ECVA 3ARQA 3NESA 5E8DH 4GRWE 4XTRD 3HG4A 2WQ8A 4GOSA 4WW2C 1JWUB 4NPYA 4P9HH 1VFBA 3QUMH 4PRHB 1RU9L 2D3VA 2YZ1A 4GUQA 4XI5C 4UBDD 2L7QA 2W88A 2FUTA 3QFJA 1E28B 2I69A 3INUH 3V4PB 1UXMA 3VXUD 4CNIA 5GGSB 4F58L 1VPOL 3QIBC 1CTNA 2GTQA 4ISVB 1IZKA 2H26B 4EDWH 4QY8B 5GRVK 4CVWA 3UYOD 2VDKL 4QRRA 1MVFA 4G7VL 1RZKH 4NZ8A 4JRYD 4FQXA 4K8RD 1MWAB 3SD5A 3QQDA 1FNEB 4OY9A 3GIVB 1S7SB 2XCMC 3RDTA 5GGUA 4U6HB 3IXAB 4I1PA 2N01B 2ZXCA 5CJ8A 1EPFA 3VVVA 5IBLC 4XNQA 1HZLA 1L4IA 2E7BA 2FWOB 3GPSA 2HTLD 3BVVA 3HC2A 1PYWB 2HFTA 1BREA 4AGQA 4JGJA 3DIFB 1RLBA 2DQIL 1EEZB 4LCCA 4OI9A 3QUMB 3UYPA 4BFIA 2WXHA 3QO1B 2UUDK 3F6IA 2APSA 4K5OA 2EACA 2YXWA 1AHWA 3GXMA 1JRHH 4MLSA 3VD2A 5EZJA 3BH9A 4YHIB 5KWYC 4H5SA 2C3HA 1EAQA 5DWUL 1E4XI 1RU9H 2C9UA 3FO1B 2BJML 2BNRD 2WSDA 3RGVD 5E5RB 4LVOB 1KTDA 5D8JL 4F58H 1VPOH 5ECGA 3L3IA 3H6AA 1LE5B 1AO7D 1CD1A 4G80A 4Q74A 2Y23A 5AL8A 5HVGB 3FB7B 2VLJE 3REVB 2CGRL 3UG3A 5L88L 4G8IA 2ITEA 4M8QA 3MV7D 3EYOB 4IBQA 4Y9FA 4KQ4L 3QUYB 1KIRA 4QRRE 4B9FA 2D2CC 2XPGB 1BJ1J 1OQOA 4K5NA 1SUHA 1BQHG 3VFUB 1QW8A 3S4SG 1QATA 2IADB 3RNKA 2AV7B 2PO6B 3MN8A 4RFOL 3CVHA 4QXTA 2XFGB 3U36B 2CUIA 2DQIH 4K3JL 3ZKNC 3CH1A 3S36L 3F5WA 1Q72L 3HI6L 2B4CL 2GUOB 4Y4HB 3WEXA 3X13B 3IVKA 3HB3B 3CHQA 5GSVA 3AUVA 3HC0B 4Q6KA 5GSRA 3OXRB 2WIMA 5EU6E 1GW6A 3VI3E 5DWUH 5HJGA 4ZMNA 1U8PB 2VDKB 2IBZX 2BJMH 3ML9A 5E9AA 4X6BA 4EF3A 5ALBH 2A2QT 4QF1A 4GG6A 3UZVB 4UTBA 5D8JH 1BQRA 2BSSB 4UUJB 3O4LE 1VDGA 4PJDE 1E5YA 2G2NA 1VADA 1NBZA 4LDOB 1E5ZA 3MV8D 1AXTL 1OT4A 1H6FA 2YAOA 2DIAA 2CGRH 2ETWA 4FQXC 5L88H 5FXCH 2NR6A 3IMSA 3C09C 3EOBB 5D2LB 3RDTC 5BS0D 4X4KA 3IPEA 4XNXH 3AG4B 2OMXB 2R0KL 1DSFL 1L3NA 2OJ1A 4OJFL 1QFWL 1G87A 1V10A 3ISWA 1D7BA 4MZ3A 4XOAA 4FI6A 2NDGA 1OGSA 4G42B 2ZYRA 5DLLA 4RFOH 1R3LA 2ATPB 3QJFB 4LCCC 1PG7H 3S36H 3ROOB 1UZ6F 5C8JB 1Q72H 3HI6H 2B4CH 3QNXA 2YD9A 4RISL 1DFXA 2WGXA 1AHWC 4RFEB 5GRUL 5L2JB 2NY7H 3JZ7A 3LQAC 4WFFE 1BFSA 4Q0XL 1GS7A 2OL3H 5DRZB 4F7EA 4YDLB 1D5ZA 5I17A 2JI3A 3AUWB 2ZG3A 2PETA 4DUVA 2G2PA 2YD1A 5J12B 1L9PA 2BZCA 2J5LC 1MLCB 4AKOA 2B5IC 3ZIYA 3R4DA 4GRMA 5JW4Q 1Z2KA 4IJ3B 4GRLD 4ODUB 3MI6A 4UAOC 5T3ZE 4ETQA 2N7BA 4EDXB 3FQYA 2P52A 1JN6A 4BKTC 1TJHH 4J7RA 1YQVL 4P04A 2Y7LA 5D2LF 2XLLA 1OTUC 1DJZA 1QRKA 2BOBA 4PRNA 4CVZA 1DSFH 5I30L 5E99H 4KUZL 4NZRL 3CIAA 3IDJB 5CUSL 5LBSH 3KPRE 5E9DB 4YXHL 5A2FA 3AVEA 1HXYA 3NJKA 3T71A 3Q9QA 2EYSA 1X5HA 1NIBA 5TPWL 5HHMB 5GRUH 4NN6C 1KCSL 4AVKA 1YY9D 5DFVC 1EBPA 1T0NB 1UZGA 3TL5A 1QI3A 2W81C 1DJGA 5SX5H 1YPZB 2BZDA 4NT6A 2Z1KA 4UQ3B 1GCYA 1NQBA 3WMQA 3ILQD 1Z5LA 3SODB 1ZVYA 3SGDH 2YD0A 1CJYA 2IOIA 5AVXB 4QHKJ 4YHLL 1QBMH 3SO5A 2I9LB 3MRNA 4LLYB 3KPLB 1JDDA 1HH9A 2BY2A 5BOPA 1ZA3B 3B2UD 5EO9B 1HHHA 1SXNA 1Z9MA 4R2GD 3B7RL 4P46A 3GC3A 3QJSB 2OA9A 4CVUA 4JO1L 5GS1B 2NR6C 3DC0A 1JGEB 1JPST 3F7KA 4QLRA 1RFDH 4NO3A 1GMIA 5I30H 2UZIL 4YL9A 1UWEL 1M7DB 4KUZH 4NZRH 3PHAA 3ARGD 2LOEA 2Z4QA 5MENB 5IMOA 2XA8H 4YXHH 1INDL 5L4JA 2PN5A 3N2JA 2DAVA 2XVLA 4M62L 3ROLB 4OLVL 5TPWH 3C5ZD 5FECA 2W9LA 5SX5K 3TN0B 4JJOA 1KCSH 1HJBC 3WTWA 1KCKA 2SODB 3LVTA 2IH3A 5E1IA 2FEEI 3O2WL 2PTTB 4NFDA 2VXSH 2G30A 4C4BA 4YSQA 1K6QL 3RUGE 3ML8A 2MTPA 4ORGB 5T1MA 3VG9C 4KKQA 4AVJA 2CALA 4JFXA 2P24B 4JBSA 2IV8A 3DURA 3D87B 3U2SA 3C75A 4Q89A 1BXVA 5D7SL 3QEQD 1AP2B 4KUCD 4EZKA 3RYMA 1SEBB 1WAPA 2HAZA 3N9GH 2BHZA 2R1YB 1V3MA 4DCQB 5GZOD 4GRWH 5IVXB 4OFYD 2R29A 1AD9A 1O7DC 5F9OH 1DUYB 4Q97A 1PZDA 1L9MA 1LO4L 3KLKA 5D1XE 4Y16C 1CTMA 6TAAA 3RVUD 1XF3B 4BWTA 1UWEH 4YQXL 2KQNA 2A6KA 2Y7NA 5TFSL 4J3SA 2K70A 3NTCL 3ZQ9A 4CL7A 3WXVL 3CN4A 4JO5A 4NBZB 4AK1A 3MJ9A 4M62H 2MEJB 3P9MA 2Q20A 1NBYB 5T5FL 3WLBA 1DVXA 3DX1A 3O2WH 1UYWL 4ODHL 1B4RA 5JYMA 2P5WA 5JMRA 2EXTA 1K6QH 2B9AA 3RE0A 4KNQA 4ODXB 3IJEA 3BP6B 5MEOA 1X5IA 4G6FD 3PQYD 1I8UA 5DVLA 2B59B 4X7TA 5D7SH 4MJ5B 1MCPL 3X2QB 4OZ4B 1H3XA 4FYTA 4N26A 4KK5D 3RVXD 3D69A 1G0YR 2AQ2A 1KDIA 4FE9A 4C59B 1JZJA 4P46C 5IVXF 5LXGL 1WICA 4XPTL 1X5GA 2XIBA 5FF6A 4XCCL 2WXIA 3SZKC 3DRTB 4QKTA 5MI0B 1J87A 1ZV9A 1KCLA 4FAAB 2YS4A 4YQXH 4TVSa 5C0BD 2BWIA 2D3LA 2HT4D 2CJSA 5F89A 2MCPL 3DOSB 5TFSH 3DNKA 3NTCH 2NYYC 3GI8H 5LGHL 5JW4M 3NK4A 1WF5A 2YMTA 3ARYA 2NY4D 3KNBB 2IWFA 5B1BB 2ZSVB 5T5FH 2LAAA 2AP2A 3L6FA 3WN6A 9CGTA 2F1EA 3BAEH 1MUJB 1T4KB 1T5KA 1UYWH 4ODHH 2NOYA 4AEHL 3UO8B 2MQGA 1PZUB 2IDTA 4GAYB 3EFOB 5FS5A 5EULV 1ZE3H 4PV9A 4AE0A 2EIKB 4BELD 1JK9B 3DYOA 4ZOCA 2XZQL 4WFGE 2VXVL 1S7RA 3GLEA 4LT7A 1FZKA 3RVTD 1GMEA 1NMCC 3QDJD 5EH1A 4KKRA 3ULSA 4A38A 4DO6A 3IJ8A 4JFYA 1MAKA 4HK3N 1URZA 2VLJB 2YA1A 4XCCH 4APQB 3SO3C 1MCRA 4QRUB 3GF8A 2BSED 5EU3B 2FSEB 3B1TA 3LKPA 3VMPA 2BX5A 3HKZA 4R4ND 3RQ3A 5CP3H 1MCKA 2Y3AA 2OQJA 4PGBA 5T3ZL 5JHBA 2QGEA 3IPFA 3MMEB 3SYOA 1A65A 1SRDA 3GSUB 1H3PL 3S7GA 3FTYA 2YMOA 1AE6L 1SZNA 5MEQA 5FO7B 3A3YB 2FEEL 2EP6A 2O5NA 2FLRT 4JFPB 1IIKA 4TXVB 3U0WL 3GB7A 5DD5H 5K1JA 3C6SA 5LB1A 3TO2B 3HE7B 4I0PB 2AAVA 1KBPA 2ZWZA 4I5BB 4OD2B 4YEFA 5FO8A 4J3OF 3KLAB 2BO0A 1ZSDA 4KY2A 5EU6B 4LU5L 2H0FA 4AIZA 3VI3B 2KHAA 1VFAA 1WZ1L 4TQIA 2XV6B 2F2HA 3EH4B 4DGVL 2XZQH 2ZOOA 1OAZL 3KLSA 4D0DA 2VXVH 1EEQA 2YSSB 2WMPB 3FN9A 1Q9OA 1HSBA 2ZOLA 2KZBA 1ETJA 3O4LB 4PJDB 3CVHH 1QYGL 2NQCA 3BXNA 2OBGA 5IB1A 4KQ0A 3DUUB 3TONA 1NAML 5FOBB 3GSVA 5G2NA 3LRKA 2A7BA 4LEBA 1CFVL 4ZFFA 4ZO8A 5IJBC 1UM6L 4AYGA 2AK4A 2BNQE 4L4VA 5T3ZH 4N1CA 1T1ZA 4IRSD 2D03L 1TQCB 4JZJB 2F53A 2DQFA 4NO5B 1BM7A 1H3PH 2G3MA 4U7KA 1RURL 4HVBA 1G7PA 4RX4D 1LP9F 5AVSB 5CBEB 4YHNB 3F7YB 1FBIL 2C26A 1C5DB 2GY7B 2WWKT 4LRNH 3MRIA 2D4FA 4Y2OB 2P28B 4TQHA 1QZ1A 4LU5H 1A3LL 4M4RB 2VLKD 3MRCB 3VE0A 4KPHL 3GJEA 4L2LA 4UWQB 1IO4C 5JOFA 1MVYA 1T0OA 1OAZH 6PAZA 5C2BL 2EXYD 4TKWA 3W0WD 4G5ZH 4DGWC 2FX7H 3WE1A 1DQLL 4DESA 2J7LA 5I16B 2NZ9C 2ZKHL 1RJZA 2JJTA 2X4NA 4YDNA 4PJDF 3U7YL 1H5BA 1KZQA 1T1WA 1QYGH 1MJ8H 2XTLA 4CJ0A 5L0QB 1WO2A 1N19A 5H2BB 1KNOB 4WRLA 1NAMH 3ALPA 2JXMB 4JG0L 1AD0B 2X12A 4I13B 2FTAA 1CFVH 4EN3B 1ZDSA 2Z8SA 3LB6D 5IMMA 5L2KA 1ZS8A 3CX5J 3HZYB 2MSPA 5CN2A 1PZCA 4CC4A 1TTBA 3GXUB 3NP3A 1TU2A 3BHBB 2D03H 3LNFA 4Q2ZA 4AIEA 1L7IL 4I0KA 3BKCL 1RURH 3KPRB 3WE6A 2NXYC 1P7QB 4JY5H 3EXLA 3KDMA 1AGBA 2PR9A 4WF7A 1WUZA 3GMLB 4IOIA 3NCXA 2WBJB 4EBQL 1ZT7B 1OB1A 4U1IB 2V2TB 1FBIH 3NA4A 1VIWA 2CWRA 3FZUD 3VXNB 3IDXL 1I7UB 4ACPA 4ICXA 1CICA 1A3LH 2GSMB 4FP8L 1A4KB 3WDIA 2PCPB 4KPHH 1BOGA 1D6VL 3K5SA 5DUBB 2HLAB 2BNUB 1NAMB 4N1EA 3ARDB 3H0TA 4HIHB 3WY3A 3WY1A 1DQLH 2EKSB 4JO3L 2WLZA 5B39G 4OLZL 5I8KL 2WXJA 3GHEH 3VXSA 2EICA 2COQA 4GO8A 5EUKB 2DV6A 4L1HA 3JT2A 3I6LE 1NDGA 3G6AB 3P4NA 5DD1L 4PLNC 2ZZUT 5F7MC 4JG0H 1IKFL 4Q6IA 4DP8X 1BPVA 4LO9A 3PWJA 1TR7A 3ARBB 4PJIA 1MFDL 1TCRA 3H3BC 3HG3A 3CGTA 4XRCB 5I76B 2FE0A 4HZLA 2NY0C 2P45B 1TCMA 4N2AA 1CLZL 3VSQA 2C4XA 3WNKA 4YO0B 4DW2L 3LPWA 3RA7L 1F5WA 1MCNA 1MNUH 2J1WA 3TBBA 3DHJA 2TRHA 4ELMA 1ZHLB 5E4AA 2G5BB 5ICYA 2ADIA 2PCXA 2G75B 3RTQB 4EBQH 3NPSB 1VZIA 5BJTB 3VFSB 1WTLA 1KN2H 3RY5A 2G9HB 5L6YL 1UD8A 1H8LA 1AXSA 1WRFA 4L9LB 2BHYA 4P23D 4FP8H 4IM8A 1CGTA 3BPCB 1DLHA 4N2NA 1SN5A 2K3HA 3RUGB 5JLZB 1BECA 3AITA 3Q9PA 1U91A 2ADGB 3Q6FB 2A0LD 4JRXA 5F2FA 1F02I 4WTWA 3OQ3B 4LHUG 4OCLC 1A6TA 1N2RA 4QPEA 1MHCA 1DDHA 4JO3H 3SDAA 3ZTJG 2YO3A 2A3TA 3GUTA 4HGWA 2XICA 5I8KH 1X7TA 1KDJA 1TJGL 5C0CE 1LEGB 2FJUB 4LDCA 2IQ9H 3STLA 1H5BC 2D31B 2R4SL 1RKRA 2B14A 5CCHE 4EI5A 4A6YL 2PPFA 4HUWB 4NRZA 4ZPTA 3Q7JA 4JPIB 3KGTA 1IKFH 2XV0A 4KK6C 2VZ3A 1Z9PA 4P5KA 5D1XB 1MFDH 1Q9LB 3L5XH 2AFNA 2HJFA 4MB1A 3WFHA 5I1AA 4FYSA 4CC4C 2VLRD 2ZUXA 4YHKL 1UFUA 4DW2H 1CLZH 4G8GD 1G0XA 3RA7H 3QNYA 3MRQB 5CR8A 2R8SL 1TITA 3NMEA 4P2RD 2VQ1B 4OZHE 2AVGA 1A1NA 1C1EL 4U49A 3RWHB 3P73A 4PRAA 4UT7L 5DS2A 1FYTA 2P5ED 3ZLQC 5C0FA 2ZOTA 1M2OA 3DX0A 1IAIL 1ACCA 5L6YH 4P57B 1C16B 2R29H 1ZRUA 1THCA 2BSBA 1TUPA 4P99A 2UVEA 4ELME 2A83A 2F8OA 2D7TH 1HILA 3QH3B 1PLAA 3RUGF 4W9FC 2F7IA 1S5IL 1ERNA 2YC1A 4LVHC 3FTVA 3QC5X 4MDRA 3P4OA 2BVPA 3EBAA 2LLNA 5D55A 1DN2A 3CQFA 1U92A 3HMXA 4PH8A 4HG4K 2XYBA 1TZIB 1UB6B 1TJGH 4FG2A 3V0WL 1RJCA 2R4SH 3KM1A 5I1CH 4XBEL 3ZZLA 4NUJB 4MVBD 1BIHA 3ULUE 4UF7C 2RCSL 2V5RA 3GBDA 4E42B 4UANA 5CCJA 4WKZB 3TEUA 1ND0B 4AJ0A 3FAXA 4Q6IC 4HXBH 3E38A 1KIUA 1K85A 3LKNA 4PY8J 2C3WA 3SDDB 3RIKA 2DQUL 3MNVA 1K4CB 1YO4A 4YHKH 1KACB 4UNIA 5EF2A 4P5MA 4HAFA 1UUSA 3QIUA 1GYCA 2R39A 4FLOA 2R8SH 2APXA 1A6UL 4CSTA 1C1EH 5I6PA 5IV2A 4UT7H 3AABA 3VYOA 3NJXA 4HJ0C 2JWYA 2Y7QB 1IAIH 1J5OL 1I1AD 1WA1X 5FLVA 4J1UA 2Y69B 2QR0B 5CZVL 3NDZE 3QXTA 3KLHD 5EIVA 5T8IA 2MOGA 3DA0A 4NO2B 2P8LA 3PWVB 5HYQB 1PZ5A 3HE6D 3AGVA 3VXRD 4HJUA 3KXFD 1LWHA 1XB8A 3GM8A 1CR9L 4XB7A 4YDMA 3HJEA 4M5TA 4GEIA 4Z7UE 3SDAC 1NIAA 4Z77B 2WQVA 2P49B 1K5NA 2CK2A 1S7WB 4RBPH 5D1QE 3V0WH 2XFXA 3ECBB 4EI5C 1G7HA