1ADWA

Pseudoazurin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
123
structure length
123
Chain Sequence
ATHEVHMLNKGESGAMVFEPAFVRAEPGDVINFVPTDKSHNVEAIKEILPEGVESFKSKINESYTLTVTEPGLYGVKCTPHFGMGMVGLVQVGDAPENLDAAKTAKMPKKARERMDAELAQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pseudospecific docking surfaces on electron transfer proteins as illustrated by pseudoazurin, cytochrome c550 and cytochrome cd1 nitrite reductase.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords PSEUDOAZURIN
total genus 34
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1adwA00
1FA4A 1RZPA 4YSDA 2NRDA 4YSTA 2XX0A 1N70A 5PAZA 2BP8A 1BQKA 4F2EA 2JXMA 1EHKB 1MZYA 3PAUA 4AKPA 2XWZA 4JKNA 2HXAA 1AAJA 1PLCA 3AG3B 2GSMB 3RYMA 1ZIAA 3GDCA 1AZUA 1PAZA 2GBAA 3ABKB 4YVNA 1AG6A 2BWDA 3NJNA 4QKTA 2Q9OA 4YSAA 1SF5A 1DZ0A 3FYIB 1XB6A 3ZIYA 2HZHA 3N2JA 1KBWA 2Y1AA 3FU7A 3QJSB 3NJLA 2WO2B 3T9WA 2UX7A 4YSQA 1BXVA 5I6PA 1WA1X 4BK5C 1URIA 2J5WA 4A66A 2PPCA 4N8UA 1N68A 2XV0A 1A3ZA 5B7EA 1W6WA 1ASPA 4Q8BA 2DY2A 1IBYA 3QJVB 1OCRB 4MFHA 2XV2A 1M56B 2TSAA 4DP5X 3QJQB 5D4HA 2E86A 1PZCA 4ZK8A 2IH8A 2YARA 6PCYA 3T6VA 2PP8A 2ZOOA 1L9TA 5AZUA 4BDVA 3SQRA 4GP4B 3ABLB 1L9QA 2UXTA 2TSBA 1B3IA 4YSUA 5TK2A 1ZDSA 3FU8A 1PZBA 3CZUB 1J9RA 5I6KA 3WNJA 1KGYE 3NSDA 2BW5A 2JFCA 1GS6X 1AANA 4AX3A 3OMIB 4G70B 3EHBB 3WIAA 2N0MA 1J5CA 3WKPA 4A2FA 2CJ3A 2EILB 4DP2X 2XLLA 5TK4A 3TA4D 2AANA 4TXVB 1HFUA 1I53A 3X1GA 5I26A 3FU7B 1NDTA 1RZQA 4F2FA 1V54B 2OCCB 5D4JA 1L9RA 5B7FA 2X87A 3ASOB 2FQFA 4GYBA 4DP7X 1A4AA 4L0PB 2QDVA 7PAZA 3FYEB 3HB3B 3SBPA 4NB7A 1OCOB 3JTBA 2XVBA 3UAEA 2QT6A 2WO3B 4HHGA 4GY4A 2DWTA 1JZJA 4WKXA 1ADWA 2I7OA 1NWOA 2VMJA 2YQBA 3ERXA 1V10A 5I5IA 3ABMB 4DP1X 4DP0X 3HEIB 4GP5B 1WAEA 2YAOA 1SDDA 2HRGA 1L9PA 1J9TA 2GIMA 1JXFA 3V9EA 3GXUB 2RACA 3X1EA 4M3HA 2WSDA 3NYKA 4E9XA 2IDTA 1JERA 3DIVA 4HCIA 1GSKA 1ASQA 1NWPA 4FAAB 4AI7A 2DV6A 1ILSA 4F7KA 3NT0A 2BWIA 1ZV2A 3EH5B 3SBRA 3T6XA 1KBVA 3QQXA 2IWEA 1JVLA 2UXFA 1JZEA 2FQGA 4HAKA 1JOIA 2PP9A 1OE1A 1GS7A 1TU2A 3KW8A 2ZWNA 3GYRA 1NIAA 1AZCA 2CAKA 2A3TA 1JXGA 1QHQA 1SNRA 1AZRA 1BQ5A 9PCYA 2PPFA 1NIFA 1WA0X 1BQRA 2HRHA 4E9QA 1AS6A 3ASNB 4JHUA 3T71A 6PAZA 3IBOA 1NIEA 4G72B 1HAWA 3AG1B 1FFTB 5B1AB 2HX8A 4YSEA 1SFDA 2R7EA 2BW4A 2FQEA 5I5MA 3S8GB 2IDQA 1BEXA 2ZXWB 4Q89A 1CYWA 3NJIA 1L9SA 2BP8B 4CSPA 1KCBA 1JZFA 3FPYA 3WI9A 1PZAA 1PY0A 2FT6A 3AY2A 1IC0A 2FNWA 2VW4A 1M9WA 2VSMB 4UAHA 1PLAA 5AKRA 1OE2A 1ZIBA 1KDJA 3C75A 2Y69B 1BXAA 2FTAA 3NJJA 4HCFA 4KNUA 5AFAA 4A67A 4DP9X 3BQVA 2HX9A 2YAPA 2I7SA 3KW7A 4PAZA 1NPJA 3FSVA 5B3SB 4YL4A 3FQ2A 1DYZA 2VN3A 1ET7A 1OCCB 2UXGA 1ETJA 3FS9A 4KOCA 4PCYA 4A2GA 1YLBB 2H3XC 4QLWA 3EH4B 4YSSA 3FQ1A 4CSZA 5D4IA 3AZUA 2YAEA 3QJRB 1RCYA 4KNSA 2AZUA 3S3BB 2YAFA 1SHXA 1ZDQA 3U25A 4A2HA 4E9VA 1QLEB 4HCGA 5LDUA 1X9UA 1VLXA 3CDZA 4N4YB 1FWXA 1WS7A 1E67A 4WTQA 3X1FA 2XXGA 2GI0A 3X1BA 1PF3A 2P80D 4G7SB 3FSZA 3PAZA 2QPEB 4G7QB 1V55B 3FQYA 1TEGA 1JZHA 3AG4B 5F7AA 5FC9A 3UADA 5I6OA 4HHWA 2PCFA 2P80A 2MRYA 1ET8A 2J55A 3NJMA 2OJ1A 2CALA 1A4CA 2HLEB 4P5SA 3QPKA 2IDUA 2PPAA 2YAQA 3X2QB 2BZCA 1R1CA 3N55A 3MX0B 5E9NA 1OOWA 1XB8A 3NP4A 3T6WA 1EZLA 1MG3C 4UANA 2FJSA 2XV3A 1ILUA 4AKOA 3NJFA 3X1NA 1SF3A 2IWKA 1PMYA 3UGEA 3CVCA 4HZ1A 7PCYA 2FT7A 3H4FA 1NIBA 2LLNA 3OM3B 1IKOP 1OF0A 2EIMB 1OE3A 2H5UA 1AQ8A 1ET5A 3CDZB 3OQRA 1NIDA 2VM4A 1PNDA 1BYOA 3JT2A 1ASOA 2FT8A 2HX7A 1CURA 5PCYA 4G7RB 1AIZA 2UXVA 3NP3A 4KOBA 4A68A 4X4KA 4BXVA 3TBBA 1GYCA 3QJTB 2VW6A 2QPDB 4YSPA 2XX1A 1AZBA 2J56A 4UF7C 2GB2A 1A8ZA 4YVUA 2ZONA 1AOZA 2YAMA 1NICA 1AS7A 1J9SA 2FWLB 4DPBX 1GR7A 2FQDA 5B1JA 3WKQA 4E9WA 4DPCX 2R7EB 1AR1B 3OMAB 1NPNA 1WA2X 2VM3A 1HAUA 3TU6A 1QNIA 3S8FB 5ANHA 4DP6X 5F7BA 2XXFA 3S3CB 1AS8A 1T5KA 3IE9A 1MDAA 5B1KA 2YXWA 2MTAA 3NSCA 2VW7A 3TASA 2PLTA 3S3DB 1GY2A 4K9JA 1KV7A 3NSYA 1KCWA 4KO5A 4BDVB 3BVDB 2YXVA 4W1TA 3AG2B 3IEAA 1L9OA 1AACA 2IAAC 2EIKB 2BP0B 2BO0A 3PXLA 4FA7B 4GP8B 1E65A 3G5WA 4KO6A 2GC7C 4YSRA 2DYRB 2X88A 3FSAA 1AG0A 2H47C 2DYSB 3AW5A 1WS8A 1M57B 3CG8A 1UATA 4BXSV 3TBCA 2W8CA 4A2DA 1MZZA 4A2EA 2CCWA 1GS8A 3WNIA 5IY5B 3IN0A 4EF3A 1AZNA 2BP0A 3T6ZA 1SHWA 2Q5BA 4KO7A 1BAWA 3UABA 1SFHA 3PCYA 4M4RB 4HALA 8PAZA 3EF4A 1A4BA 1MG2C 1XMEB 2PCYA 4DP4X 2PP7A 1JVOA 1SDDB 4HIPA 4E9SA 5A7EA 3PLYA 5I6MA 2PPEA 1A65A 1JXDA 3MBWB 1BYPA 3H56A 3PAVA 1GW0A 3NJKA 3OMNB 3QJUB 4BWUA 3CVBA 5EHFA 4G71B 4BWTA 1J5DA 4JHVA 3DKHA 3UACA 2QDWA 4ENZA 2PPDA 2AVFA 3FU9A 2IDSA 4KO9A 5I6LA 3ZDWA 2W88A 1NZRA 2UX6A 4NAJA 1TKWA 3UAAA 1PLBA 4NERA 3D12B 4DP8X 4E9YA 1OV8A 2AFNA 1F56A 1JZGA 4GXFA 1OCZB 2I85A 1CC3A 4E9TA 1IUZA 3NJGA 3V9CA 1W6LA 3FSWA 3WG7B 2OV0A 5I5JA 3PPSA 3FT0A 1RKRA 3ZX1A 2J57A 1XB3A 2VSKB 4RH4A 3ABGA 4W9ZA 1GY1A 5I28A 5B1BB 5B7MA 3SBQA 1ID2A 2BZ7A 5B1JC 1X9RA 3OD3A 3ZBMA 1E5YA 1NINA 2BHFA 2CUAA 2IDFA 1IBZA 1E5ZA 3NJHA 2EINB 1J9QA 3H4HA 4YSOA 2IWFA 3DTUB 4AZUA 1PNCA 4KNTA 1BXUA 1CUOA 1SJMA 2JKWA 2YAHA 3EH3B 2XU9A 1JZIA 4AKQA 3IN2A 1TEFA 1W8EA 4BWWA 2B3IA 2B08A 1KYAA 3CVDA 5I6NA 4E9RA 4P5RA 2DWSA 1KDIA 4YSCA 1ZPUA 2GC4C 3L45A 1CYXA 1NTDA 2GHZA 2EIJB 2IH9A 1PCSA 2CBPA 3NSFA 2AZAA 1E30A 3FPXA 2XUWA 4DPAX 2XYBA
chains in the Genus database with same CATH superfamily
5FK9A 2OX5A 4NRZA 1KPRB 1SOSA 2OMWB 3N44F 5D2NE 1ZSDB 2NRDA 5KSUB 4WWID 2F53D 4QHUA 1VERA 3DIFB 1U3NA 2Y2TA 3GF8A 1U8HA 3SGJC 3VXOB 3WLWC 3B1UA 1JPSH 1QG3A 5AVZB 1TVHB 2HKHL 3DYOA 4HUXB 3VXTA 1H8SA 4DEPB 3QUGA 4AG4L 4AYMC 2LAAA 2B77A 1BMGA 3HS8A 4A7GA 1JP5A 3QEQD 2R1YB 1QSED 2YA2A 3NCCB 3EDJA 4DKTA 1ZKAA 1SOXA 1DFXA 2FWOB 2HZHA 3L3IB 2AQRA 1OB1B 4E41E 5A16A 1RULL 1HJCA 5EZLB 6FABH 4JZJA 5AWNH 1EA9C 2AJYL 3G6JE 4F57H 3DK2A 1U8JB 4TUJA 3N40F 1E4XL 1DEEA 3IGKA 4FQLL 3CH8A 1UZ6E 3FFDA 3FOMA 2HJFB 4N8VG 4ZUTA 3SBWC 2GTQA 3QK0A 3MBEC 3IDGA 2E9GA 1B0GB 2PTTB 3ZE1E 5HYIA 2ZKHH 4J39A 2DDQH 3FU5A 1IV8A 4DN3H 4DGVL 1S9YA 3TIDA 3EO9L 3GI8H 2OK0H 1E2VA 5AD0A 4FF9A 2H3NB 2YARA 4HUUB 4JFDB 3U79A 1IEHA 1G0YR 5LQBL 2JJSC 2VZOA 1IT9H 1WHOA 1I8UA 2F9BT 2R1WA 3IJSA 3L5HA 3UG3A 3V95A 4PRHA 2UXTA 2BY1A 3G08B 4JE4B 4DKDC 1AR2A 4AVKA 4WEBH 3KZ8A 4DK6A 3LKSB 4XX5A 4EXKA 3M17A 4ALAH 2AABL 2CKNA 2O4EA 2Y7QA 3HG1D 5L2KE 5FYJD 2IWGA 1J18A 5CEXB 2WLZA 4JM2A 4I1RA 2N7SA 4HU2A 1J5CA 3FB7B 1J05A 5DJYA 5AENA 1SUHA 2OYMA 4TXVB 5D1ZI 2AXGB 4JL1A 3N43B 3W39A 2FD6L 3LB6D 3L1GA 1QA9B 1BVLB 4P57B 2A9BA 4WLCA 2K6WA 5GRVL 5C92A 4PJBE 2IMNA 2OCCB 4XB7A 3K2KA 1PAMA 2ZCZA 4FHKA 4L37A 3UJTH 4BFIB 4L8CB 1A4AA 4IGBD 3KCWA 3QYCA 2G2PA 4UT6A 3ZPDA 4D0DA 4AQOA 1AGBB 5L2JA 1HQRB 1OALA 2MPAH 5EBWA 1N2RA 3OC8A 5F3FA 1CLCA 5TGBA 2AK4A 2OULB 4RMWA 1NWOA 2WHVA 5I5IA 2GYSA 5K1NA 3P9LA 32C2B 1FE8H 2DQUH 3IXAB 4Z7OB 2MTPA 4DUXA 4YE4H 4PBDA 1XGTB 1RIUL 1O9WA 1A7BA 2DKUA 3RWGB 3MLVH 4OJDH 2JJTC 4WI8A 2YPKA 1IBGH 2VN5A 4OFPA 5AZEL 4FAAB 4H8PA 1FO0H 3KPRE 4C83A 2XWTA 3L1FA 4G1MA 3QFJE 1SJEA 2P5EE 2R2HA 3FHQA 4P48A 4PRPA 1BVKA 2WKGA 4HAKA 4DFIA 2V37A 1R3HB 4I4WB 2OMWA 3KW8A 4S0SD 1SXBA 1BJ1H 4Q9CA 1AZCA 1UM4H 4KTDH 1BECA 3IDUA 4F7TB 1AO7E 1JRHI 3ZYZA 2PXYC 4LCWD 4Q6IC 2V5RA 3K1KC 4FYQA 3WXWL 5AVRB 2ICWA 2I25N 1KLFA 1AS6A 1J7VR 5GS3A 4R2GC 3MRLA 2F08A 1QBLH 1LEGA 5LUMA 3ET9F 5IJVA 4Z76B 3A5VA 2MCMA 3FT3B 2C8NA 2FJGB 1CGVA 3MXWL 3FT1A 1HHIB 2P5WA 4RA3A 1G5GA 2I60H 3F83A 3ZSSA 1UWGH 1UWXK 3P02A 1PY0A 2O5YL 3WI9A 1MRDH 1DSWA 3EOAA 4OQTH 2CXKA 3K2UH 4MHHG 2E0PA 3BJLA 5LGKA 5IFJB 4U6YA 3DMMD 5C0GA 1JXJA 4HG4J 1ZE3C 2Y69B 4GKSA 2Q6WB 3U4BH 4AJVA 4H0IA 3IBEA 4XP1H 1M7IA 4Z3FA 2ZUXA 1N8ZB 2W07B 3D51A 2NNXA 2ESVD 4JGMA 5DJZB 2HT3D 4P2OC 1BW8A 2VDQL 3BWZA 1OAYL 2P28B 4HETA 4OV6F 4WTXA 1AH1A 2G5BB 3HMXA 2WM0A 1YLBB 2Y7MA 1MH5B 3LRSB 4XMLH 1QQDA 1SQ2N 4I0CC 3HAEH 2PR4L 2E7DA 3PWPA 4GAYB 1N5YH 3GSVB 4RFEA 4JUSA 2ZX8A 3EHBD 5E1AA 3BVTA 3PL6C 5EC1A 5CHNA 1I7TB 1FIGL 4NQVB 1EZUA 1JDCA 4ANVA 2DH2A 5FUZL 4NO2B 4KMTL 3F8UB 4NQDD 5B4MC 2R8SL 1MFNA 2AAVA 2B9BA 1JI1A 2N7AA 4JJHA 2G30A 1D5ZA 4FADA 5JYMA 4NWUL 5JQ6H 3BKJH 4FL4C 3WFBL 3W39B 5FA3B 1KTCA 1TEGA 1G6RB 2XC8A 1X5AA 1FL6A 3LPWA 3LZRA 2W59A 5FC9A 3BISA 4MB5A 4HKZA 4B95C 4RETB 4F7EB 3V2AR 2GJPA 3O2WL 1MJJA 1PZ3A 2F74A 1QKZL 4HUVA 5C0AE 4C56A 1A4CA 2XWJB 2WTPA 5IK3A 4A7VA 4I0PB 3HMXH 4MJ5B 5F9OH 1D9KD 2PPAA 3KLHD 4AV0A 5IIEA 3IGFA 4KXDA 4ABVA 4LHUG 4MNHB 2UV3A 5CZVL 4LESA 2JE8A 4FA8A 3HW7A 3NPZB 3ZDZF 1HNYA 3GMNA 2H7WA 1I1AA 1YG9A 1JGUL 1V05A 5GRYA 1MG3C 4OFQA 2X9ZA 2WTRA 4UANA 2LFEA 2WCPA 5TQ0H 1V3JA 4EBQL 4IOSA 4AKOA 3L7FA 1XGQA 2E4FA 2RMNA 4HUKB 1J87A 2KKQA 4MLIA 4MZIA 3VUAA 3W81A 2NR6D 7PCYA 2WINA 4FJ6A 1QATA 1RUPH 4PI2A 1IKOP 5JQHC 2GTWB 1X6NA 2XWTB 2W95A 1GZPA 3X3GL 2EIMB 2N0KA 2H5UA 1NCDL 1UB5B 1ORQA 1P6FA 5J3HC 4M5YL 4XP6H 5EWIL 3UAJC 4QHNA 4PRAB 1MNNA 3LHPL 1ASOA 1S7UB 4AYBA 1FGVL 2P1YA 3U0TB 2W9DL 1MXGA 1KFAL 4FN0A 2Q8AL 2W38A 1N0XL 4RIRA 1S7QA 3V4UL 2DL2A 2HLAB 3VXPA 4PJ5A 3LDBC 2J88H 3ISRA 1M2OA 1A8ZA 2J8HA 2ZONA 4JCMA 3WV0A 5I0DA 4CILA 3CBJB 2GJRA 2YRBA 3A21A 3L9RB 3UERA 5IB1B 3EJPA 3MROA 4KK5D 1AD0A 2YKKA 3JV4A 3SOBL 3TU6A 4WTWA 3D34A 1WITA 4LOFA 4P2QA 4L3AA 1KSRA 2GJ6D 4YHNA 1Z5LB 1IGYB 4ZPVB 4JHBA 4JW3A 4KMLB 1NDMA 4M6OH 5ANME 5KW9L 4P3CH 5DJ8A 1QTPA 3L9YA 4E41B 2AQ3A 3NJXA 3N04A 4GRMB 5DJ0A 3ZOAA 3KPRB 1WZMA 3O9WC 4PTUA 3KCPA 3GLDA 3OXRA 4JRWA 5J56B 2VDKL 2NR6A 2XZAH 2XFGB 4KKCD 3FC8A 5C7ZA 4AOFA 5KSAB 1JV2A 4TRPH 1A2YB 3ZKQD 4I18C 5IR1A 2LQRA 3FF8A 3PHAA 4OCRH 1S6NA 4YZFF 4YSRA 1Y07A 5DSCA 3FSAA 4JKLA 1TVDA 2GEEA 1CT8B 1FCGA 1IZJA 1I1AD 3OG4B 1MZZA 5J57B 2R1WB 2CCWA 1GS8A 2VDRB 4OIAA 5CIPB 4EF3A 2FSEB 3N6YA 2C1OA 1NCJA 3V5KA 3PWJB 3BVWA 4PGCA 2AEQL 5LAPA 1WFIA 2JELL 3IRCA 4KI5C 3TNMA 3NESA 3L1OL 4JN1L 1FYTA 4JHZA 5G5DB 1NCAL 1T4KA 3FRPB 4M4RB 1RZKH 1NC2A 1MCPL 2YGNA 5IHUL 3ZYOA 1ITBB 3POCA 4K7FB 5TPWH 5DJXB 3SDAC 4WCYH 5CGTA 3LZLA 4WW2F 3KLAB 1U3HD 1XAUA 1ED3A 2AEPH 3B9KD 4MWFB 3HI6L 1CVSC 2PCXA 4ODTH 3KAAA 5TD4A 3BE1L 1DFBL 2EEBA 4OGXH 4LLWA 4MDJA 1RZIA 5E5UB 1WZ1L 5E2WH 3NCJL 2R69L 1LP9A 2W88A 2X70A 4JFEA 1JZ4A 2QADC 5FO8B 1JZ6A 1KG0A 2DM4A 1VCAA 4YPGB 4YNYA 2BNQA 3Q1EA 5DI8B 1KZYA 5B3JE 3ZSTA 1HIML 4QRRD 2Z91A 4XMKL 3IMVA 4HS3A 4FKHA 3ETSA 4LVHB 3FMGL 5JIMA 1CC3A 4KVNL 3DWTA 3PE9A 3PWPD 3RDJA 5I17B 1IIIA 4LPCA 5BV7L 3QQNA 1HSAB 1TFPA 4ZX6A 4N5UA 5IW1A 2FJUB 1NQBA 5D7IF 1L5GA 4OLZH 4WU5A 5I30L 4ZFOL 2DI8A 1PX4A 4X6DE 4ZOAA 5ICZB 1GY1A 1XGTA 5I75B 1ETZA 1XGQB 1QBAA 4ZUSB 3A4EA 3I75B 2BHZA 1E5ZA 1E27A 3B7UX 1S78C 4XC3H 3TJEH 4XBEH 1N19A 3GBEA 4YSOA 5EA0L 4N3UA 4AZUA 4U05A 5E8NB 3OAZK 1F3JB 1WVZA 5K9OA 2PKDA 4RGND 4QHNB 3ULSB 4ZO6A 4JPWH 1G5AA 4NQQA 3U0TA 5DJDA 2VRQA 4LBEA 4Z7UA 3CVDA 2A2QT 5CD5C 5IMOB 3CBRA 4ELKB 1QUNB 2O5ZL 1K3ZA 5HYEA 2QR0B 1KCRH 4U1NA 1CI3M 2Z7WA 4FLSA 5C3TA 5HGDA 1ZHBB 4XB3A 4QOKE 5FGBC 1USQA 2AJ3A 3L7EB 5LNEA 3HKZA 3GJFH 5A2AA 2ZKYA 1T7VA 2G4GA 5C0CD 3WIHL 1RZGB 3GHPA 1ITCA 2PN5A 4CVXA 3KWUA 4Z76A 5CJQL 4JG9A 1D6EB 4Q7DA 2ZCHH 2AK1H 4KX8A 4DKAA 1HL5A 4JG0H 1MUJB 2XKUA 3MJ7B 3MNZA 4Z78A 4K9EC 3FONB 2CR3A 3K7UA 4OGAC 1MVUA 4TPRL 3RYMA 4AW7A 3RVUD 4MJ6B 5GQBA 4N90D 3KBFA 3GZQA 4JM4L 3KPRA 5KVFH 4KDVA 5I76A 5LGJB 1JWSB 4R90H 3LEYL 3KJ4B 4I3RH 2DBLL 4J2QA 1HQ4B 4QKTA 2P5EA 4YXHL 5KYWA 3EAKA 2DIEA 3O6KL 5GS2D 3CSYB 3WIFA 1ZXKA 3K72B 3OKOA 3W0WD 4YHIB 4OSUH 1WE5A 3D50A 4BK5C 3G5ZB 3EGSB 2J1ZA 1AC6A 4NQCA 2Q86A 4UTBA 1ESOA 2YFOA 5DJ6B 1N4XL 1WTLA 2OW7A 5F89B 1OT1A 5KTEH 5I2IB 1BVNP 1RU9L 3FOLA 3P77A 4TSBH 3TYFB 1EJOH 3Q8EA 3N41F 4HJ0D 3UEZA 5DRWA 3L08A 3S34L 1R3IH 2Z7YA 3O3BA 5F9WB 4PGEA 3QXAA 4JLRA 2EIEA 2GITB 3FFCD 3WEMA 1EBAA 4K7FA 1TG8A 5I6XB 2ZP0T 2EIZA 1UUSA 5DMKB 5JOPE 2PP8A 5C3LD 1KTBA 2LOEA 2BIMA 5HHPA 2NXYB 3OKLB 4BINA 3UZEC 5TTRA 1T21B 3ZZSA 1N7MH 3K8KA 3P1VA 3S3SA 3KDMA 5D8JL 2OMYA 1SMOA 2WJ5A 1J0HA 4NNXB 4JM2D 4ABUA 4WV1B 4WI2A 1NC4A 4HS8H 1WIUA 4DAGL 5I1EH 4KI5F 4XPBH 2QQKL 3W82A 4N8VA 1Y18B 4RWYL 2DH3A 1I82A 4FTVB 4JO4H 5CR8A 5IT2H 1MHCA 3F12A 4N2NA 4N86A 4PGDB 2WN3A 4U0RB 5TK4A 1WT5C 2QVIA 3S37X 4APQA 2FJFA 1RK1B 4LCCB 4P2OB 5I17A 1BQHB 1MKFA 2C4FU 1KPVA 2JJTA 4Y8AA 5BO1H 4AEHH 1R47A 1U3HA 2DQTL 1LHZA 5A40E 2WTRB 2OMXB 4X7DC 4A37A 4PJDE 4YLBA 4DZ8B 2E74C 2Y5TB 4BRVA 3MNVA 1YAIA 1YECL 2XWBB 5KBMA 3L7FB 1S46A 1PLGH 1I8KA 5I0YA 5JIKA 4OGYH 3UAEA 2VLLA 1T66D 4M93C 4B7LA 2E7LC 2WO3B 4MD0B 2IIJA 4P2RB 2VO5A 1NBYA 1ADWA 3V6FA 3RWHA 2VLJD 4D3CL 3BE1H 1KZQA 3ILQD 1KCUH 4NKQB 4GSDL 4ILDA 1H3PL 4B9FA 4PRAA 2YAOA 4JRYB 2FX7L 3CFQA 4RGOH 1CDBA 1WDAA 1AXIB 3BGMA 4R83A 4KZEL 1RZJH 5L4JA 3U30C 3KEDA 4EOWH 3HE7A 5DHMC 5HGGS 1JYNA 1P7QD 3O6FB 1IMHC 2A83A 1VGKB 4AT6A 1RJZB 2QGCA 3HRZC 2DV6A 3LIUA 1PX3A 5ABDE 3AUVA 4PJGA 2B16A 4UQIM 2X0VA 1UT2A 4RCAA 1L0XA 3SDYH 2X40A 5HHOA 5KVMC 2PP9A 2ZOLA 1TU2A 1MF2H 2EO1A 4ZMZA 4ZG1A 4WGVB 1D6EA 2EDMA 1SMAA 4BFOA 1C08B 1BD2D 1U92A 3S7GA 1WA0X 4B9JA 5F44A 1KXTA 5K39B 1A6VL 4LBAA 4O2FB 4JHUA 3UZQB 1T1YA 1U21A 4G1EA 4BIKA 3CLEH 2MH4A 1MHPH 4G6MH 3UXFA 2ZUWA 4M6NH 5LAXB 3HZYB 4J8QA 4Y9FA 2B1HL 2UWEB 4E5XB 1NBQA 5E6SB 5AG9A 1AYOA 1ZGLP 4OQTA 5K9JL 5DK0A 3NABL 1K8DA 2Y06H 1UZ8A 4CSPA 5KTEL 4LCIH 4N28A 4XZ4A 3UC0L 4Q0XL 2EEFA 2O72A 5CLXA 3N3EA 1ZGLB 2YMXH 3VDCA 4P59H 5IV2A 3BP4B 1R6VA 5MHSD 3E1ZA 3OVUB 3D2UD 4KTEH 4P9HC 4UTBL 2E8YA 3TN0D 2W0FA 1R0AL 2MQ0A 5EC2B 4YXHH 4DP9X 3WU1A 4YWGL 4XNQA 4P4KD 4L8BA 5EUOF 3QXAB 5DK2B 5JHDD 4I3SH 3SE6A 2LVEA 4PCYA 4WRLA 1AD9A 3O0RH 4UILL 1BZ7A 1GOHA 2Q8AH 4ZTOH 4FHJA 5JXEC 1MW2A 4PJEF 5CNHA 2FNBA 4JQIA 2OL3L 4BSWB 5HXMA 3WD5H 3M1BB 3OSKA 3P4MB 4NT6B 1GYUA 1KFGA 1SEQL 3LZOA 2BNRA 4NC2B 4PGBA 3LXAA 3WIHH 5KVEE 5FHBL 5AVVB 1QLEB 4IBQA 3APNA 4XX1E 3UYRL 1FWXA 3S96A 3FTGB 3I02A 4HISA 5FWQA 1QSZA 2CR0A 3DX3A 5DEGA 3B43A 4WI4A 2BSCA 3KVDD 2ZOKA 3FB8A 2OA9A 4P2QE 5E1IA 1RUAH 4B27A 1LGVA 4F5CA 2P48B 3PAZA 1DN2A 1LNUB 2O5ZH 2QGBA 2X4TB 3SBWA 1BOGB 3FBKA 1BZ9B 1FNEB 1LP9F 3APMA 3L3OC 5F3HB 4R7NB 2XTJD 1KTRL 2G9HA 3GZOA 3CPLA 3W0WE 2A74A 1P4LA 2K45A 2YJLA 3T0EB 4Q9QH 2AMGA 4M7ZB 4LLYA 4QUOA 2DBJA 1B90A 3ARFB 3QNXA 4TQ8A 2J6EA 3QE5A 3D3VA 4PJGF 3LTVA 3SKJL 3CX5J 3F65A 4XBEL 3D69B 3HG1B 5EBMA 1NGYB 3FH8A 1OAKH 3G5XB 2FL5B 5A6LA 2F15A 4ES8A 4PWKA 1XB8A 2WXJA 1UXWA 1WG3A 5I30H 3GJFB 1DANT 3V5HB 1W0VA 3BKJL 5K9QI 1LO2L 1C8PA 4NWUH 5JQ6L 5D72L 5KVFE 4BFNA 3BUTA 4CMHB 4H1LB 4KKRA 2YHGA 3DECA 4YUEL 4HEPG 3WDHA 2KLSA 2W65B 1SN0A 5BZDA 4H20H 2ESVA 2VE6B 4NKOA 1UXSA 2H0FA 2JI1A 3PV6A 2OJZL 1BZQK 4LDOB 1EDQA 3L2MA 4WY7L 1J11A 2X3AA 3EBGA 3QT2A 4N0RA 2VM4A 5BO1L 3MODL 1DSYA 4G80B 1M4KA 3RWCA 3MV9E 3DX7A 4PTTB 5SV4A 1FFOB 2AV7A 4U3SB 4WK4B 5KJ7E 3ARGC 3GM0A 1KTLB 4LHUD 3B2DC 3DUUA 1IGTA 1WJ3A 2VJ0A 1CL7I 4IGBC 4J3OH 5IP4A 2E9JA 4V1DE 5FV2A 3ZTNH 1I85C 4JO4L 1LTXA 3D30A 5CEYA 4K3HA 2DLEA 2HFFA 2C9VA 1S7VB 5C0AA 4NJAL 4XPBL 2BIQA 4JRXA 1BWMA 1Z2KA 4YHMH 1NICA 1AMYA 3EYFA 3HBPA 2Z1PA 2XV6B 2YEQA 1NPNA 2R2BA 2OR9H 1GRWA 4G11A 1HQ4A 4PCSA 4WJ5A 1XIWD 4IEFB 3N1FC 3NCYP 1FNGA 3I84A 5J13B 3EH2A 1EPFA 3K91A 3LEXA 4R3SA 5HYJA 2X2IA 1MDAA 2Y1ZA 1FNAA 2BNRD 4OV5A 4WU7B 2VLJE 4K9JA 5FLUA 2JKXA 4XNYL 3IMRA 4UZUA 3JYCA 5AUMB 4QIRA 4HWEH 3S34H 1PTZA 4W1TA 3WSQL 2K7QA 2X2UA 3B2XA 3II2A 4G7VL 3RX8A 2FECI 1YA5A 3RY4A 4FQ2L 4BQ6A 4KZDH 2HJKB 4G43B 4UYQA 2VO8A 2ADJB 1IJNA 4WO4B 3QDME 3MLPA 5B39B 3QDJE 4MJIA 4IRSB 3T3PE 4R5VA 3FQRA 3TN0A 2BPBA 1T04B 3CN0A 5GGVY 5A2CA 3IFOA 3T08A 4ZOCA 2G5UA 2A9AA 4LHJB 4X6CF 4ZW7A 2WANA 1F4XH 3OPZH 3FTWA 3QUKA 2AC0A 2ALWA 3BUDA 5JPMB 3ULUH 1COBA 1DP0A 1BD2E 5E8DH 5CR1A 5HYSA 2WNKA 2K4WA 2WLHA 4PG2A 1C1EH 1LWHA 3X14A 2L7JA 3QS2A 2HH0H 1MG2C 1IAIL 3I6SA 2PCYA 1MCFA 3LS4H 5B4MD 2Y9RT 1XR9B 1FNHA 3BWAB 2Y6SD 1FNSH 3MNDA 2IPKB 1SRDA 3DHPA 1IAOB 2BVQA 4NFCA 4NZRL 2YMXL 3OMNB 2WB1A 4F1ZA 1CLVA 1PYWA 2HT3C 1QI3A 3E3QE 5EHFA 5T3XD 1J5DA 2QKSA 4P5TD 2W9DH 3FUJA 3ZE2B 2OZ4A 3JTSB 2AVFA 3FU9A 3O3EB 1MCNA 4N0YH 5HGHB 2BXYA 4F7PB 3OJDB 4GI6A 3C6LA 1V3MA 1NGZB 1H3GA 3AWFA 2JB6A 4ZMTA 1NCDH 2HKAA 3QNXB 1TZAA 4EI6A 3Q01A 1OSZA 4P2OD 2PABA 3D69A 3HG1A 4X83A 2V2XB 5KOVC 1OW0A 2R23B 3D52A 1XVSA 5FFOA 4YMPA 1AR1D 2OSXA 1WGVA 4NFBA 5F93C 2R29H 2FL5A 3VXRE 3QDGE 5IWLC 3L5XL 4ZX4A 3QZWB 1OPGL 1UG9A 4LPWA 4MAYB 3V5HA 3RPBA 2ILLA 3DVNA 3RFZC 4YK4B 1CLYH 2V7HA 2COVD 5DWPA 4X6CA 3I3DA 3WLBB 4GAJL 4FYTA 3EJTA 4L3EB 4PJ8B 2OZNA 4M8QB 5ANMB 2JK5B 1BXUA 3IJHA 3APFA 4YGVB 1S9WB 3WHXA 3CFEA 1ZT1B 4MA1C 5IB4A 4EOWL 5AD0B 4G9DA 4BFJA 2WXPA 3L95B 4GRWB 3RQ3A 2Z7UA 3FN0H 1S9XA 4UOW0 1A7OH 3IPFA 3OZ9H 4QXTB 5FR3A 3P3RA 4A7UA 2XN0A 1S7VA 1ADQH 1KXTB 4PLNC 4XNUH 3TBSA 1PKQE 2BS71 3FT2B 4EZJA 4F33A 2W0KA 1QEWA 1A47A 1AQDB 3LQAL 2LHAA 4R97B 2FX8L 3V10A 2CA4A 5BS0D 1A1NA 4K9EH 3U7WH 3IMTA 5D70H 4RLDA 1A6PA 5HJ3B 4XODA 3HI6H 3VXSB 1OGAE 2VLRB 2WKOA 4XO4A 1OCWL 2C3VA 4WU7A 5EU6A 1SYVA 1RV6X 4UT9L 3HR5B 4BZ1A 2JH2A 1B0RA 3QEQE 5L8JB 1J48A 4FNPA 2GBAA 5D2LF 4NN5B 4NUJB 4YSAA 1SF5A 2W0FB 1MFVA 2CIIA 4U4IA 4XPGL 2V5SA 3ZIYA 4K2UH 2H6PB 2WXHA 3FU7A 3RGBA 4AE1A 2XA3A 4I0PC 5DK2A 1VPOL 4AGLA 32C2A 5C0RH 1CR9H 1YEEH 2J25A 1F4YH 4LOVA 2YR3A 4ZAKA 3D9AH 4J28A 4N8UA 1KY6A 3H9YA 4XE5B 4YLQT 4M8UA 5CD5D 3KM2A 2AKRA 5AVXB 3ZR6A 5EUOB 2MWCA 1KOAA 2G2RA 2BSEA 2PF6A 4KV5F 3D85D 1ASPA 1GC1L 4YDKL 3QWRA 4J6RH 5D2NC 1BEYH 1OY3B 3U1QA 4MB3A 4LP5A 4M5TA 3T04D 3TF7C 3S96B 4X7TB 1XR9A 3QUYC 1M1XA 3IJ8A 3TFBA 2BIOA 1KJ2L 2FJHB 3L9BA 4IBZA 4CKVX 3VXMD 5EUKB 3KPRD 3D25A 1UACH 2JF1A 3GZPA 3DBXB 3FQWA 4UB0H 4ZNCD 3VRLF 5EU7C 4BKLB 5KG9A 1RP8A 5I1IL 2BVPA 2O5NA 3L5IA 3HPJB 2ZPKL 3EJCA 1CD1A 3F58H 4OJYA 4QHPA 4YEFA 1HVXA 3T0EA 5IJVB 5TH2B 1GYWA 2J88L 4NUPA 2YRZA 5DVLA 2WXOA 1MAJA 1MFEL 2EILB 2OTPA 5CWSA 4DP2X 3V4UH 4GBXC 3VG9B 2Y72A 5DTFA 3KPLB 1IFGA 3GJFK 2GBTA 3T77B 3THMH 4QYAA 5C0EA 5I19H 5IB3A 3NEXA 2NDFA 1JV5A 4PJIE 1FGVH 1B3JA 1RZQA 2NCEA 1M9SA 4DP7X 4XP6L 2AK1L 3SY0A 4MNQE 3U2SA 3UTTE 1W8OA 3ILPA 2W92A 4BRJA 1TKWB 4G7YL 5CJQH 4ZFOA 1EGJL 4JMXA 4IRJA 3O4LB 2LE9A 4I85A 1IGCL 4GKSB 1H8LA 1JCKA 2CPUA 1EZSA 1MCEA 3W9DB 4HDIA 5E1QA 1TR7A 2V9QA 4TNFA 3I85A 3MYJB 5DZ9A 1OPOA 3AQDA 4QNPF 1NFDF 4WVRA 5F1SA 3C5XA 1ZS8B 4MD5B 4ZO8A 1XF2B 4WUKH 1IIKA 2NYYD 3RWCB 5KN5B 2V7NA 3KYMA 1GGBH 3QPXL 4OZFA 2B5IC 4GQRA 2F8IA 5ESAA 1OP4A 2VQUA 1BVOA 3V9EA 4KMQA 4KJWC 1RZ8B 3RUGB 4XXDA 3B2UC 5EC1B 1QPPA 4HUWB 4PRDA 5M94B 3P11L 1B0IA 3DVGA 3LKQA 1H3WM 3L6FB 3U6RB 4Y16B 3PV7A 3C5SB 1JYWA 1QEWB 4MBRA 4PV8A 1JZEA 5ESVB 1PQZB 4QRUB 4KKNA 3PL6B 1VAHA 2Z92A 4WEBL 1JWMB 2CAKA 3EBHA 1OAQH 4Z7NE 2GJZB 1M3JA 2WKOF 2ZJSH 1CGSH 3LZFH 3GS0A 1QA9A 3Q13A 2WXGA 2HRHA 3EBIA 2WUBL 2WZ0A 3TEWA 5TJWK 4N85A 1EHAA 4BA0A 1TO4A 4KAQL 1B0RB 4JM2B 2CHDA 1WAPA 2BNUA 3DSNB 5TE7L 2G4EA 4AQ1A 3EDEA 4NOFA 4U1LB 5HGAB 5JXEA 2BDNL 4N24A 4K5OA 4Z7WF 5D55A 5IJKC 4AGNA 4JDZB 1F8TH 3RBSA 4Y5YB 3HTLX 4OLVH 1YY8A 5AAMA 3V6OC 3EFDL 3QUXB 4GSRA 1T0MA 2XZZA 1T0PB 1X5XA 3TX4A 4DQOL 3OGOE 1TQCB 5ID1A 4Z8FH 2FE0A 1LO4H 1ZVHA 1ZV5A 4P49A 5IW6A 4Z7QE 4A67A 1OAJA 1BHGA 3MYZA 3PGFH 2A0LC 3BUBA 2BSBA 4BFKA 3MCKB 2DTSA 5DD3H 2MOQA 3L1OH 3PWVA 4TUOB 1UKTA 4B7IA 3UDWA 4EUPB 3UJIL 1QFHA 4LVNB 3UYPB 4PSRA 3GMRB 1JF1A 1F3DJ 3NN8B 4OUUA 4U6HB 4AG4H 4LCUA 4B9KC 1RI8A 4IRZL 5A2BA 1S7UA 1S8DB 2QMKA 1PSKH 3ZL2A 1SJHA 4MA1B 2A74C 4PJBA 1MCWM 2WSPA 3HBQA 4GW5B 4HWBH 4RMRA 5T33L 2NYKA 3IDJA 2CBQA 2DQIH 1OAUL 2YPKB 3T8XA 3DGCR 2Q7YB 4GUQA 4PUBH 3QXDA 1FHNA 4KROB 1KLFB 3Q2NA 4E9VA 4XXWC 4ES9A 1JHKH 2DF3A 3FZUD 2WSKA 1T7XA 1DCEA 1KJVA 2AK4E 1KXVC 1MJ8H 3FU0A 1NMAH 2X53A 5T1MB 4Y4HC 1N12A 4IOFC 1NKOA 1OT2A 1T1ZA 4X98B 4OZGA 4F2MA 1L6ZA 2Z8VC 2EE3A 1NUFA 4D8PB 4JZOA 5DRNA 2GJJA 1FCCA 1ZA3B 3BP7A 1FNLA 3MRQA 2G75B 3LNDA 3IU4H 1KT2A 4I8DA 1XBRA 4LMQE 4RNRA 1I7UA 2XETA 1GPOH 4RZCA 4L4VD 4KK9C 1I4FB 3W9DA 1DANU 2A38A 4HC1L 2MQGA 2I5YL 5JHLL 5FX3A 3H9HB 1MNUH 1N8ZA 2LAGB 2W07A 5E9NA 1RIUH 2XHNA 3QSKB 3WUWA 1JRHH 4HOXA 1G1YA 2C3WA 2CSPA 1RVFH 2YC1A 1BVZA 1OOAA 4OZIA 4MJID 1UJ3A 5CEZH 4ZXBC 4U1SA 4NZFA 5HY9A 1G9MC 1A25A 1VSCA 4JB9L 3AITA 4N25A 2NYYC 3WE1A 4M5YH 5EWIH 3UGEA 5L7XL 3DMMC 1MJ7L 3OAYK 1F3DH 5CHNB 1YEGH 4U1MB 5C09B 1F58L 1QVOB 4MQXD 4ZSOA 2AV1A 2FYYB 1ET5A 3OQRA 1SHSA 4Z3TA 3VU2A 1C16B 1N59B 5DJ2B 2HX7A 5IQ7H 1T4WA 2NT1A 4UV7L 2DQHL 4CDGC 3JSSA 3DK0A 5A3ID 1CF8L 4OU3A 1T1WA 4IIQA 1KN2H 5CCHE 3RTQA 6TAAA 3VGAB 1MLBB 1VEOA 3VXSE 1AZBA 4N26A 4UF7C 5C0DB 4PWEA 2F19H 4C56E 1KJ3H 2YD0A 3BEVB 4X6EA 3HMXL 5F9OL 4HEPA 4JFYB 4TUKH 2BNQB 3WKQA 5J4MA 2F18A 4UOQA 3DX0A 1OTTC 4MJ5A 43CAB 2XQBH 4PJAF 5KBLA 1H9VA 4QOKB 3Q8CA 4W4OA 1YUHB 4J3WA 1F6FB 2OM5A 5DFTA 3MLWL 4QTHB 4WKZA 2JQAA 5MENB 1YPZF 4ANWA 4HQQH 1I1AB 2C3XA 1TNMA 1A1OB 2GY5A 4RDBA 3ZQXA 2ZXCA 3FFOA 5AW7B 3UTQB 4ZAKB 1KN4L 1PJ9A 2BLFA 3EOBB 4FFVD 5AOLA 5L9DH 3VDAA 3PWUA 4BDVB 2YXVA 1ETZB 2APWA 4HJ1A 3OF6A 1ORSA 3NMEA 4NZJA 1UCTA 2BP0B 1CZ8H 4N90E 1KB5B 3WNPA 1H5BC 4Y9CA 3GM8A 3G5VB 1NBVL 3O3DA 2HG0A 3QDAA 2DYRB 1WFTA 1VGEH 2H47C 3TWYA 1XH0A 4EPSA 3KHOA 2CDFB 3TBCA 5EV7A 2BXZA 2PR4H 1QYGH 5F9DC 5T3ZD 3JQOB 5LN4A 2F53E 4Z23A 1A21A 3IN0A 3FB5B 3GLAA 3VFOB 1T89A 2ZE0A 1OAYH 3N1PC 3L4YA 3P0VL 3TO4A 5KYYB 3ZDXE 5GGSB 3D3VD 3U82B 4U7MA 2EC9U 4BUQA 1EUUA 5IB2A 1TCRB 3TXAA 5GSRB 1JZ5A 4YAQA 4JFXB 4X9YA 3CIQA 2F19L 5MEND 2IO5A 1LQBC 1E2ZA 4X9IA 1F1AA 2BC4A 3G6DH 4ANUA 2XIBA 5HHXH 1NPUA 2K6ZA 2OZ4H 3KPQA 2KDYA 3QWNA 4R5TA 1QFOA 4XMWA 5I8OL 3B2VL 1QR4A 3TLRA 1SY6L 1BYPA 3BUYA 5DT1L 4C4UA 3IDIB 5H37A 2I9TA 5BRZD 1I1YB 3F7VB 4G71B 3ZL1A 3HNVH 2ZXBA 1XCXA 2QDWA 3IE4A 1OHZA 1IGYA 1AIFA 4ZPVA 3PNWB 2ZTBA 1AQKL 4YE0A 2X41A 2ZOTA 1DJHA 1IBDA 4XH2B 4NKDB 4KY1H 1BZOA 2QLYA 3GIVB 4HW6A 3D12B 4NUGL 5IQ9B 1JWSA 5IHZA 1P7KA 4OM1H 1R46A 3QUZD 2JJUA 2E6PA 5KSAA 4E9TA 2A6DA 1C7SA 3EYVB 3MTXA 2ADFL 5HYJE 4QRFA 1DQJB 2Y4SA 2VISB 3OPUA 5ERWB 2HWZL 4PJ7B 1KJMB 5EZIL 4PWJA 1IBZA 2I9LB 3O41A 2OYKA 4PGCB 2EVJA 3WEXB 3S36L 2X4SA 1AZZC 2CHNA 3VFTB 3VE0A 3RWDA 1ODAA 4CVZB 3F6IA 2EDNA 3QULA 2FGZA 5I71B 5E2VL 5EFIB 3ZHFA 1M05A 2BJMH 4BQ9A 2X7LA 3BH4A 1OTUC 4LSPH 1TJHH 4GBXB 2J8OA 2F7RA 3VG9C 3D0VA 5ABZA 1BAFL 1PW3A 1MJ8L 2V2WB 1PCSA 2Y36H 1BA9A 1JPST 1HXMB 1O9ZA 3G04B 4KDTA 3WUWG 3A24A 3WFDL 2BMKA 1Y18A 1CMOA 5DRZA 3GKWL 2A9DA 1IM9A 1QLFA 4OZFG 3EDDA 3KGUA 3V0DA 1MLCB 2X1PA 1JFQH 5PAZA 4S0TD 5HGAA 4WGKA 4FQQB 5KWYC 3JV6A 2JXMA 3LN5B 3PQYA 5KOMC 5CCJA 4P9MH 2JJWA 2ZX9A 2DQCH 2WWNA 3BZEA 2XWZA 2X0UA 2PMZA 5HHOD 3SDXF 2R15A 4Q4IA 2HXAA 2R56L 3TNNB 3IDNA 4W9CC 5I1LA 3LEVL 1JK9A 5D7JA 3UTOA 4MGXA 5FO8A 1TPXB 2B59B 4NKMB 2YQGA 1N8OE 5EIIG 3ABKB 1Q4NX 5DI8A 4X7CC 1DQMH 4AM0A 2BWDA 3R8BB 3TZVC 3R0MA 1DZ0A 4IBUA 1EBPA 2CLRB 3N2JA 3HC3L 3VI4A 2Y1AA 1LM8V 4L3CB 1UWEL 4G8GB 1BXVA 1NANI 1Y6MR 3GMRA 3NN8A 1JGLH 4U6HA 5DZPA 3CHOA 3V0HA 1SMDA 5E51A 1S8DA 1T3FA 2VKXA 1G1OA 1DVFD 4R7DB 4XNBA 1F02I 1S2EA 5TF0A 4R2GD 3DC0A 3O6FA 3BYTA 3MOBH 1YHPA 3ZLQC 3D4ZA 3V6ZB 4AT6B 2ADYA 2DDQL 4DN3L 1SLWA 4YHLL 4DP5X 4R4FH 3OL2A 4YAQB 1BBDH 1V3LA 4TSCH 2JKTM 4FXKA 4IRZA 1XDTT 2GSIA 1EEZB 3EYOB 4OTXH 4TF4A 2PTVA 3DARA 1CGSL 3LZFL 4HWUA 1GZHA 5E56A 4F2ME 1G94A 3AM8A 4N0UB 5IMMA 5TK2A 4NQTA 5KS9A 1W16A 2FWOA 6FABL 1UH4A 4PR5B 1JJUA 3UOAB 4UOW1 5EZLA 5E6YA 2LLLA 2DWEB 4R7VA 2JLLA 5DK3A 2IGFH 1ZA3A 3BP7B 4XNZB 2XZQH 2MEJB 1DQLH 1CDIA 1GA2A 3QYMA 5IHZB 1CFSB 1XAKA 2E7BA 2CJ3A 3TA4D 3MV9A 3O3UN 1KIPB 4AK2A 2XA8L 3RFRA 3G6AB 1Q9OB 1S9YB 4MXWH 1V54B 1A3QA 5JHBA 1KCLA 2FAUA 4KX7A 4I2XB 5A2JH 4XBPA 1A4JB 5E4EB 3TBTA 4WI9A 4OCSH 1VFAB 2CK0H 4MYPA 3MLSH 3UAFA 2DWDA 1BD2B 1K4DA 4L1DA 5LBVA 1YNTA 5AVQB 5IOPA 2ADGA 5I2IA 2YPVA 3FTSA 2QT6A 1JDDA 1YNKL 3RU8H 4B53A 1Q72L 4WKXA 2VXTH 5JMOC 3O3BB 5MHSE 2X1QA 4JFFD 4AEFA 1WAEA 4AUJA 2EIZB 2YXMA 3NIDE 3KL5A 2YD3A 1AXTH 3G5YA 5I19L 1J1OL 2RACA 4MNQA 4G9FD 2BY2A 2WSDA 4XO5A 5BVPL 2VR8A 4Y4HB 5JHDE 1N5AA 5C08D 5EU4A 4AITA 4X6CE 5I9QB 1A7NL 4RFNC 3K2IA 3HG2A 3JWNH 1UURA 1HHHB 4BFIA 3SDAD 4H8WC 4UIKH 2IGTA 3UO1L 2RGSA 1J1XH 3I50L 3KYKL 3TYGL 3EADA 1MI5D 4GT0A 1UVQB 4EI0A 4NO3B 1P4UA 5HHPB 1NIAA 3BN9C 3V6OA 3GEFA 3VSTA 4K8RC 2GQHA 4BUGA 4LLVA 1ES0B 1UOLA 3BDYL 3S98A 3BZEB 5A2FA 4L4TB 4HAFA 3T71A 3ULUC 1RPKA 3MBED 4FQJL 4YS4A 4ODXA 3AG1B 2F5AL 1FFTB 1WT5A 2APBA 1INDL 4KVCL 5I5MA 4AM0B 2CBTA 1BEXA 1I8KB 1UCBH 4BFRA 2AQQA 1A6ZB 1DVYA 3QXTA 3M7OA 1KCBA 4X9HA 1AQKH 1KJ2B 1YEHL 1U3HC 1BQHA 1RUKL 2DQJL 3FPYA 4NX0A 4JPKL 1MIML 3VWJB 4KBPA 5T1LB 2EH8H 2BIHA 3D05A 4PRPB 3GTVA 4N1HB 4AZ8A 1OE2A 4XVJH 1PBYA 2NYZA 3GWJA 4I4WA 2EZ0D 3QW9A 1Z66A 3CFIC 3VXQA 5IFAH 4UWQB 5SX4H 1HXKA 4GW4A 4LFHG 4HCFA 3WTVA 2CG9X 3T3MF 4AJYV 4R2GB 4L2LA 5GGSA 1HH6B 4V11A 5HGBA 3U2IA 2Y0SA 3VAEA 2QSVA 5ACZA 15C8L 1BQUA 3PHSA 4NBYB 2OMUB 2VXUH 1FPTL 3OHXA 2O30A 3UIYA 5IHWA 2KQMA 4HBQA 1U6AH 1XH2A 1B4JL 1MAMH 3EGXA 3QRBA 4TVSa 1FORL 4ZUUA 2IEPA 3EXLA 3QIUC 5EN2B 2ZYHA 1QYGL 3NFPA 1I31A 1WAAE 4RQQA 1IGTB 4R4NC 3CDFA 1YYML 1N67A 4ZFZA 5KS9B 2YAFA 5FWRA 4ESKA 1UJ3C 4JQXC 1U92B 1WD9A 1A7PL 2IOIA 3PRZA 4C59B 4RA0C 4W4NA 1OK8A 5D6CB 2VQ1A 2O26U 2X1WL 4H0GA 5FA4A 3GMPA 4A2HA 5LDUA 5J3HD 2H4EA 3CIAA 4KU1A 4WFEE 1WS7A 1GHFL 4WTQA 1XL6A 3W0WB 5LXVA 1VZIA 4KTYA 1SLXA 2DTML 4Z9KB 4I9WE 3MV9B 4JO2L 4CC4C 4Q6KA 1VEMA 5DZOA 2A6DB 4W9GC 4OBRA 3NH7L 4N9GB 5H94A 1P1ZA 5CSZB 4QJ3B 5E9DD 2X89A 1LD9A 4P2CG 2RAMA 3FCGA 4L8SA 1KUMA 3ARVA 2OYPA 2TAAA 1U0QA 1FYTD 4TUKL 3ECBA 4ZPTA 2DYPB 5BZZA 2IF7A 4B5EA 4EI5C 4LEEA 3E8UL 1D9KC 4ABWA 5IWLA 1Q9KB 2DPKA 3A22A 5SWSA 2ITEA 5DFVD 2NTFA 2BP3A 2UZYA 2V9RA 1EZLA 3QCVH 4XOAA 4NI6A 1I9RL 5LG6A 4QYOA 1U8PA 2A1WH 4G9FE 2EDYA 4P46A 4L3ED 5DF0A 3GXNA 3FHAA 5HVHC 3NZHL 4Y4KA 3EJUA 5EC2A 4XB8A 3CVHB 3U0WH 1F58H 1XCTB 2QKIA 1CQYA 4L8BB 1OE3A 3FUIA 4G42A 1NMBL 4FG0A 2SEBB 5E6ID 1MI5E 1UOVA 5IGXL 4XAKE 4HFWA 4OCWL 2YD2A 3EO1A 5LG1A 1HEZB 2BVQB 1IGFL 3C5JB 4DCQB 3HS9A 1CFNB 4IRJC 3PWPE 3TH4T 4HZLA 1Y0LB 5AOMA 5TDPA 3UEQA 4CU6A 5BZWA 15C8H 3LQZB 4BH7B 2BNRB 3V4PA 4PRIE 2DEWX 4D9RE 3VU1A 1MQKH 1PG7L 3NQKA 5JXAH 3T0VA 5I1LB 5H4ZA 5TE4H 4EI6B 4E9WA 5FOJA 1HNGA 4HHAB 4OF5A 2BSRB 1IC7H 3MRKA 4OZFH 2Z6FA 3KL0A 1F4XL 4O4YH 5D1XA 5IZ7A 1U3ZA 1MIMH 3QZBA 1BOGA 2CUHA 3OB0H 2HT4D 3ZDYE 4L3CA 3QJFA 5F3HA 1ORQB 1UXWB 5CN3A 3FAWA 1JVKA 1GY2A 3SKMA 1J5OL 3BAIA 3AWEA 4HV8B 4J4PC 2FSDA 4R7XA 1AOHA 3NA9L 4KVCH 4ADGA 4R7LA 2CO4A 5DD5L 1H3TA 1JS4A 2P43B 3QRFM 5DEFB 4IIZA 2FBJL 4G2AA 4ICWA 3CMOL 3EYSL 4Y89A 4YXKL 4YZWA 4A6YA 4DKEH 3MJWA 2X88A 3NIDB 1W72A 3KD4A 4OJCA 4Q56A 5AVSB 1M57B 4JZJB 5AZ2L 1CICD 5ID0B 1E5AA 5HPOA 2JTDA 3W9EB 3W3BA 1LEKA 4ECNA 3C6SB 3GSWB 5E1GA 1SXZA 5JW4M 2YZ1A 4N0UA 2Y7LA 3TBYA 1F4AA 5I1HH 2VDOH 4NBZB 4UDUB 4XAWL 1H6FA 3CDGB 4F7CA 2X6VA 2VDLB 3L8QA 1M1SA 1T20A 2A9NL 3PGFL 3Q2CA 4PP1C 1HZLA 3FNKA 4NDMA 3ARGA 1FP5A 1ULVA 4HWNA 6CGTA 2NZ9C 5KYUA 2W94A 5G4OA 1BX2B 2H3NA 2WK2A 4U3SA 3OX8A 2NX5B 4X5XA 3GSNH 1YPZB 3DUUB 5DHXB 3NCYS 3PAVA 4YX2H 3V4VH 4Z3JA 4KITB 3NIGB 3QJUB 4EAEA 4ZFGL 1U8KA 2YEVB 3IETA 5AQ0A 3W37A 2CMRH 2YD8A 3BSHA 43C9A 2DD8H 4L1LA 3I3BA 5AKSA 2PPDA 3OLGA 4FTVE 2IDSA 3RWIB 4N2HA 4UTCA 3QIUD 1U2CA 3IYLW 4NQDA 3QXVA 3OKDA 1QPKA 2G9KA 2YK1H 5L2KB 4NAJA 3TBTB 4P23C 2PNDA 5E94A 1AGCA 3ZHDA 4QNPE 3SSGA 3WBDA 3S35X 3MRMB 4PJ7F 1X3DA 3NDYE 3QUYD 3WG7B 4LSVH 2OYLA 3MV8A 2XBTA 3Q06A 3WJLA 3P2DA 1NC2B 4YFEA 5JHMA 1JNLL 1WTGT 4EZMA 3OKMB 4F8NA 5B1BB 5H37G 1OAKL 3L3DB 3EXJA 2VR9A 3VH8A 3ZKND 3TONA 3TJPA 4Y4KB 2KI6A 3NJHA 4PJCA 1ZT7B 3QUKB 5GGRA 1XCTA 1IGML 5E0QA 1ZLVK 1DBKH 4LSSH 5D1QE 4ZFFA 2JKWA 4LKXA 2DLFH 4G8EA 2O61B 4JFEB 3AADB 2PYFA 1KG0B 3PGDA 1QO3A 5JDSB 4UNUA 2Z9TA 2EIBA 5I6NA 4P5RA 2G0LA 1IGIL 5I1GH 3BT0A 3OAWA 2WP3T 1DVTA 1B6UA 4Z0XB 4YHPB 4LVOB 1SBSL 3SDCD 1WH0A 5DHDA 3P4NB 3WFZA 3EG9B 1O6SB 2YBRB 3BLKA 3DVFA 4I18A 1J8HD 1FV1B 2CCVA 3NCEB 2HG5B 4M9OA 3IVKA 3MTRA 3NVQA 1DJYA 2OBGA 2B1OA 4XZUB 4TLSA 5CJ8A 4PYHA 1XHHA 1RZPA 3FN9A 2JIXB 2PO6B 1T1XB 5SWSE 4JMNA 4GXVH 3KPLA 1MHHA 2F54D 3VTMA 5DLLA 2NZ1A 4HKBA 2K78A 3P9MA 4N0FA 4W70A 1BQKA 1ZAGA 2OL3H 3KPOB 4OGZA 2N7BA 4LASH 5BUPA 3G6JA 5TF1H 1T66C 3QIBB 3POHA 1OAZL 4PGJA 5C09D 4WO4C 1EEQA 2EXSA 3U48A 3AJ7A 2A9NH 3GBML 3GDCA 3MRLB 5DU7A 5CEZE 3K6SA 2XTSA 4XHQA 4XTRD 4JFSA 3O11A 4YOKA 2C5DC 4JUTA 4PJIF 2ZPKH 4M29A 1G7LB 5IM7A 1WLHA 1AYRA 2P24B 4Y1SA 2FATL 2J73A 2XWDA 3V5DA 3PUUA 2CO6A 3JVGC 3UTTB 3CFEB 2ZNXA 2NOYA 2ORBL 4B41A 3D2UB 2H0JA 5FYLH 3SO3C 3SD5A 4OFYA 5F88A 3SDCC 4XPHL 2WZ6A 3ARPA 3H8NA 4CVXB 2EDEA 2NNAB 4H8WH 1WFJA 5MEQB 3CN2A 5DHVH 4XGZB 4EDXA 3TTSA 3GRBA 5K9JH 4ODUA 4XVTL 3U9UA 1UEMA 1NCOA 1YJDC 2K9UA 1T5XA 5B39G 5K9KB 1WD8A 4XC1H 4PRID 2ICEB 2O5XH 5FO7B 3SE9L 4ZK8A 1R3KB 1UA6L 4M3JA 3UL4A 2ITCA 4TV3A 3ZKNC 2HJLA 3L3HA 5AZUA 5KVGH 3PY9A 2Z35B 5E2VH 3GUTB 1NJ9A 1GTNA 2NUTA 4ADJA 4KZCA 5IQNA 4J3BA 5CN2A 3BAKA 4GRLC 1EXGA 3C5ZA 1JD7A 4OI9A 3AREA 3PDDA 5E08H 4TLUA 1MI5B 2WOBA 4HIEB 1PG7H 4TTDD 3C60A 1IAKB 2F7QA 2IH3B 4R8WL 4KI5E 5JIPA 1XGYL 4M1GH 3MA7B 5GGSY 3ARDA 4KROD 1EGJA 1CG9B 3LKOA 5AYUL 5HTSA 1JTOA 3QDMA 4WW1B 4ANXA 4ERSH 1OCWH 2VLRA 12E8H 2X6BA 5ISZD 3QORD 4D8OA 4KZEH 5IKCA 2CE6A 4PGEB 4F2FA 3GMQA 5AB0A 3C09B 4Y19A 5B7FA 3BCDA 1AGEB 5E6UB 4L0PB 1FHGA 2V17H 4G8IB 3QUXA 5LGHH 4JFFB 4OLWL 1UQSB 4MNGB 2OMBA 1C5BL 1ZTXH 2MQCA 2M2DA 2NZIA 3LQAH 3HE6A 4M1CC 1T83A 2GCYB 4YHOH 1ZHKB 2Z65C 1PLGL 3CVHA 2VLKA 4DESA 4MB1A 2YWZA 5D7LD 4J8RB 5JORB 3GMNB 1G7JB 4GMTL 3UYPA 5T1DL 4AYSA 2DQTH 2HA1A 3LVEA 3EYQC 1EDYA 3LPOA 1CGXA 3BO8A 4F91B 2ZKMX 3DPBB 2YLHA 4HLZH 3MKGA 3C5JA 4DCQA 3D8MA 1G0DA 4I3GA 2WINB 2WW8A 3C5ZC 1WUNT 3H3PH 3QEQA 1RAMA 2IANA 2NPLX 4U6TA 3EH5B 1FSKC 1T22A 3V0WL 4L5FH 2X4RA 4LO9A 4DERA 1PKOA 2W60A 2Y5TA 2EIDA 1YQVH 4NP4L 5CWSB 2X4NB 5D1XB 3HZVB 2F53A 2OMZB 5KJ4A 3ZGHA 3GSXA 2XNAB 1HE8A 2X1OA 2YSSB 1HHJA 5C6TL 3QJFB 4J1UB 2VUKA 2HTKD 1QUPA 4UT7L 4FULA 1IARB 4L8DA 2HLFC 3RL1A 3IJEB 1UD4A 1LMKA 3PWLB 2MJWA 4ZTPH 5GXBB 5ILTL 2X6AA 4OM0L 2CUIA 1KN4H 3HE6C 2WV3A 4M6AA 1CI5A 3P3YA 1E4KC 1RU9H 3WY2A 4HDIB 1CICB 4R4BB 1B4TA 3VXMB 3F7KA 1IVTA 2X4OB 3D6GA 2ATPA 3D4YA 1U6AL 1FBIL 4XHJC 5CP7B 4PMEA 5JR1H 1GGIH 2CU9A 3QDGB 2DICA 4MA3A 4AYDC 2QADD 2CJUL 2DJSA 1FL5B 1YCSA 4V1DD 5HI4D 3T2NH 3WJJA 3JWDL 1R3JA 4JY5L 2EO9A 5CN1A 4AQAB 4LCCC 3US0A 2KL6A 3LMJL 3LS5L 4NKIH 4N8CH 1A8JH 5JHAA 5C2UB 1KN2L 2LTQB 3A0OA 4FYRA 4OD2B 4YL4A 4MCNA 4X99A 3TFKC 5FYJH 1A6UL 5E00A 3BUPA 1I9EA 2PWDA 1OKEA 5D4IA 1ACYH 2GBVA 1MCOL 5EULV 3KE0A 1E8WA 4X9GA 2BFVL 2CLZA 3MRRB 5TQ2H 2JKNA 3CTTA 4FG2A 4DQAA 3TZVA 5SWQA 3T0AA 5BVJA 4NQXA 1AO7D 1TZIB 2J8UF 2HRPL 3MPCA 5GZOA 3RI5F 4JGUA 2NCMA 3E6HA 2JCCF 5F0MB 1AGCB 1QNZL 3RUGF 4AENA 3PU7A 4GXUM 4IBYA 3SPJA 3A6CL 4L4JA 3VFUB 4ZJ9A 4A2LA 3VX1A 4HK0B 3RX7A 2H8PA 4R5XA 4OI8A 5F7AA 5K1JA 2EDLA 4M7LT 3SJVE 2VNCA 2XG5A 3KYKH 5IUSA 2MRYA 2P8LA 3NOIA 2VDMH 3NJMA 4HC1H 2ZT9C 3S5LB 2YKLL 1TQBC 3UMNA 5F70A 5IBUG 3HBGA 3D18B 3S8WA 2CO2A 3HE6B 2NY6B 4I5BB 1IKNA 4CA4A 3MUGA 2P8MA 2YAQA 3W5MA 5C0FA 3MQIA 1XGUA 1CE6B 1GZHC 2WQVA 2XWRA 4NJAH 5E5MB 1A66A 4GRWE 5LBSA 2YIHA 4JNXA 4BK8A 3QDJA 3G6JF 3HHRB 4MJIE 4CW1A 3QJZA 3F04A 2P52A 1NCTA 5GSVA 3TVMD 2LVCA 1YC7A 4FEMA 2J1WA 2QV4A 4WHYG 4LSUH 2Z93A 3IS0X 3HZMA 4XPTH 3P3UA 4QHUB 2IWKA 5H35A 5F7EH 1LNUA 4ZW6A 1EMTL 3UX9B 1NIBA 2LLNA 3IDJB 3EJZD 4Q2ZA 3RA7L 1S4IA 4QHMA 2Q7NA 3BW9A 4OCSL 3CPLB 3SB3A 1JDAA 1IQWL 5IG7B 5BS0E 1AQ8A 5HPMB 3VB8A 5IQMA 1WC7B 4NM4H 4NCDA 4GSUA 3GUFA 1CGWA 3ZDXF 1LO2H 4HPOH 4J4PA 1G0XA 4K5PA 1T2XA 2J1YA 4OZGB 3F6JA 3KPOA 3CE1A 1TJIL 2AEPL 1XCQA 3LB6C 4S1SL 4WCYL 5KANG 2AXJA 4F7MB 4PS4L 5BS0B 3W11D 1OZTG 2YAMA 4Y0GA 4F15B 1P53A 1F4WL 4F20A 2DW5A 3L54A 5I71C 4KXBA 3ULVL 1QNIA 1N10A 4MMZB 3IDGB 4BKSC 3VW3L 3B8SA 3Q6GL 1B0GA 2PTTA 5MEPB 3DPDA 1J0IA 1MUJA 1KXQA 5AW2B 1HSBA 4Y2DB 1ZHLA 4F92B 1CWVA 5CP7A 3L5WB 4GIPD 4Z0BH 4K7PX 4WHTB 1KCWA 1KT2B 3BHBA 3HS0C 4KO5A 4D7BA 1LE9B 1R9FA 1FL5A 2HJFA 1IM3D 2WZPA 3UYRH 5IHLB 3UGXA 5KYWB 3EF7A 5JLZA 5JDJA 5FHBH 3U9UB 2APTA 2AQNA 4KO6A 1GZQA 1QVOA 3SE8L 4N6QA 3AW5A 1UC6A 4YDNA 5TE6L 3TA3D 4WFFE 4A2EA 1MWAB 1KB9K 5DJYB 3GUTA 5AG8A 3VWJD 4OVUA 1FZKB 1H6TA 4GUOA 1H8NA 4TQHA 1R19A 4J7RA 1J8RA 1CTOA 2ZZUT 1JG9A 3SKNB 3P11H 5I1DB 3ILEA 5C71A 4ANKA 2GITA 4X2UA 2KLTA 5BCAA 2HFGL 1RSYA 3SDDB 1GGBL 2NY5C 1MLCA 3KPSD 1ZT4A 4JQVC 4N20A 4XNAA 2D7TH 5FEBA 1W0WA 1JFQL 2GAZB 1P2CB 3JV6B 4HOZA 2PR9A 3DKHA 1P4IH 1I8IA 4I1PA 4GKNA 3LVTA 2H6UA 5B39A 4AQ8A 3E2HC 2NSXA 1K9TA 2ATKA 3QC5X 3CN4A 3LNFA 4FGMA 5ITFA 3RWGA 4CADB 2FGWH 3PWUB 4NZDA 5GRVK 4YK4C 4DN4L 1JZGA 1NBZA 2Z31D 1M7XA 3EUDA 2VR6A 1ZOXA 2A7BA 1QI4A 4NEHB 4WZ9A 2L8AA 1IUZA 4JKMA 3CC5B 4HWZB 4WFHE 3HVDA 3WO4B 4G8GA 4Y1TA 5C0NC 1BAGA 4EDWH 4N2OA 3U4EA 5JORA 2R0KH 1X4ZA 4W9ZA 1T3FB 1MF2L 4L0ZA 3OSVA 4MA8H 3LYRA 3RPIB 5KSBA 2O93L 2CKBA 5B1JC 2V8MA 3P30L 2JQMA 2ODHA 3FB5A 4TNGA 2EXYD 4JREC 4I2XE 5JIQA 1ECYA 3VFRB 3DTUB 2X05A 4CC4A 4CVUA 3MRJB 3H53A 4C83B 1NAMA 3MUY1 3MRIA 1E3FA 3D39A 3BYYA 3P69A 4HGWB 4MD4A 5HPMA 5FAAA 1HILB 3OKEA 1RZJL 2GSIB 1KJ2H 2AJXH 2DWSA 1NAML 4JFFE 3RVWC 1NUNB 3DRQA 2VITA 3IDIA 1KCUL 1T2QH 1NTDA 4D3CH 4OIFA 1EFXA 2X4QB 3FT9A 3QZOA 4Z7VE 2W5PA 3AFLA 3QEHB 1JIBA 3NSFA 1R24B 3N9GH 4JN2A 4EIZC 2R8SH 3PPEA 4PJGB 1NOFA 3DV6A 4YC2B 2OSLA 3FPXA 4H40A 3ZU8A 2C1PA 2CRZA 2QSCH 3ZXAC 3H0TB 2EXTA 4BD4A 5IQ9A 1W91A 1OK0A 2AQPA 4LOUC 4X6CB 3WLBA 1JK8B 4TVPL 4XOBA 3HI1A 1F4YL 1OGAB 2VLRE 4HZAA 4PJHA 1LMIA 3VACA 5FDWB 5C0RL 4QJ5B 4F2EA 2L7EA 3BKYH 3PAUA 3L3IA 5DJZA 3RDTC 1MCRA 2IFFL 1LLAA 4JKNA 3T2PA 1TITA 5A16B 1X44A 4KH2A 1XCWA 4KC3B 5D7IE 3D06A 2QHLA 2ZQKA 2DWYA 2JB5L 4JFDE 1KJMA 3BAWA 1AG6A 4N68A 4MJJA 2VRAA 3NJNA 3VXNB 1P7KB 3Q8BA 4I89A 1HEJC 3HC0A 2CHXA 4OAWA 1M7IB 3O2VH 3Q1SH 4XMZA 2IFFH 1QMUA 2WO2B 3T9WA 5FUCC 4R97C 1KTDA 4JY6A 3EYVA 4UOJA 4YSQA 1HN1A 4GUPA 3A4FA 5IF0B 3EJJX 2I07B 3OJMB 3JWOL 4JCWA 4BEIA 3MV8D 4UV4L 3UTZB 1S78D 3V0VB 5EF2A 2DIBA 4GAYA 3Q9QA 3RP1A 1CZ8L 3EGDA 5HJ3A 3VGBA 3MLYH 4KXCA 1OW0C 4PW3A 4QRRB 1KGWA 1ZJAA 4MAUL 1INEL 4HIQA 3AMKA 4NM8H 4UQEA 5ALBH 4HJJH 5E70A 1TZIA 2D8KA 3KGRA 2HFEB 4MAYD 1GKEA 3DVIA 4DIXA 4FOMA 4DPRA 3BD3A 4XWOC 4LAQL 4ZOEA 2KZ1B 2ID5A 3L1EA 1G1KA 3P0GB 5F9WC 1QTSA 5DURB 1QZNA 4HJGB 1JNNH 4OZGE 1KNOA 1J05B 2EH7L 4FHBD 4M8VA 3C8KA 2C9XA 5GRXG 3QIWA 3K5SA 4XVUD 2BK8A 4NT6A 1CU4H 4LLVB 1J9RA 3OR6B 5IQLA 2VZSA 4A7SA 5KVDL 3CSBA 4PGBB 2WLMA 3DDFA 4L4TA 4LQFL 3UPRA 3O6KH 4TQPA 4W6YB 5D5MF 4AGMA 3BDBA 3WIAA 3NQIA 1CLYL 3WO4C 2OW6A 3QHZH 1UXMA 5DUPL 1SOKA 4LFHD 3MRBB 3M8OL 1UD3A 4LSQH 3U7AA 3VG0L 1JZ2A 2R0KL 4UV7H 3U7YL 4FQQA 4K3GA 4UT6L 2MCG1 5IESL 4KH9A 1G7IA 3H85A 4GS7B 4FP8H 4HJIA 1IC4L 5IJCC 4UTAA 4MA7L 1M1XB 3E3QC 4TNEA 2B59A 3FYEB 4IU2B 4R7DA 3QFJD 4MQ7B 3HZMB 4EI5B 4EE2A 2WMPB 3BP6A 4HULB 1USZA 1UM5H 2XY2A 3HG1E 4FFYA 4P0DA 5L2KD 1ZXQA 3VFRA 4RGNE 3MV11 4F9LA 4QHMB 2Z31A 4GI9A 1MCSA 5DZNA 4L05A 3TH3T 3GJFA 1RL1A 4OB5H 4ODSL 4WNQA 1M3IA 4NN7C 4H1LA 1RMFL 2YPVL 2V9UA 3QUMH 3VJ6A 3GXUB 3U7YH 2HFGH 5JHLH 1Y1UA 3QPQD 4GINA 4P2QB 1FAKT 4P8QA 2L04A 3L4TA 1PG7X 4NKOB 3IAGC 4FMFA 4FD0A 5EA0H 4LOUD 5B22A 4KK6D 4KUZH 3O6LL 5I0VA 3FCTB 3ATFA 3GJEB 3QQXA 4IRSC 2NMSA 3TURA 4ALAL 3CUPB 2D03L 3A47A 5DMYA 1CXKA 2FVNA 3EYOA 3FXIC 3BZ4A 2EKJA 5GGTL 4UTAH 1OGAA 4NO0B 4R96A 3WN5A 2JVUA 1SNRA 3MUJA 3T0DA 2OR7A 5FM8A 3QO0A 4OVVA 4FKEA 3PJNA 3ROOA 3G6AA 3R06B 5LQBH 1GSMA 2CDEB 1MFMA 1UWYA 2Q20A 1CK0L 3EOAB 1CT8A 1NIEA 1XF1A 2XCMC 2L7UA 4HJJL 4NM8L 5ALBL 4FI7A 4JFDD 4PUBL 4MASA 5B1AB 3ZZ1A 3KR3L 4ZPTB 3PJSB 2FQEA 4O9HH 1ROWA 2ZXWB 3MLYL 2CO1A 4Q89A 4V1DB 2Q6WA 4XXDB 1X5LA 5CD3A 2IBBA 4XWGH 3RVVC 1FNGB 5J7CC 2NXYD 1GZQB 1MOEA 4XBMA 5C0IA 4Y16A 1IM3A 4ORGA 3X11A 1HOCA 2VL5B 4WK0B 4XBPB 4YDZA 1BQLL 3LZQA 1KDJA 4ZS7H 2HVKA 2ED6A 1MCJA 2PYEA 2ADGB 1U8MA 4JDVB 1CDYA 2R69A 1NGWA 1RZKL 1LO4L 2Z8WC 4JKPL 3SDDD 2KZWA 1NLBH 4FG4A 2JELH 3FRPA 1FFNB 1I3GL 4M4RA 3IPEA 5EU3A 4GKLA 4A2GA 4XP9H 2XPYA 4XNZC 4YSSA 3O2DA 4MVBC 7CGTA 1TIUA 3QJRB 1XGRB 3DHUA 3TPUB 4XWGL 4FFZL 4MNQB 1CFNA 3MRPA 4MDIA 1P2CA 2VKWA 2D31B 1U58A 2X4UB 4HA1A 4JDZA 1HSAA 4BZYA 2XZAL 1L5GB 4KKZA 4OD1L 2PO6D 4FQHA 4ODXB 3CFBB 2XZCH 1BM3L 5ICZA 4FXGC 4UM9D 2VXQL 4POUB 1WK0A 1T2QL 2QPEB 2FCBA 3U6XS 1BLNB 4BCYA 4TUOA 3O3EA 2IGLA 3ARFC 1S9VA 3NEEA 3FBQA 5SX5H 1FC1A 1N6QL 2EUXA 4O5LL 2G3ZA 5DO2C 2FBOJ 2JB6B 3O6LH 2EACA 2QMJA 4KUZL 2OX5B 4P2RD 4ZO7A 3SE3C 3SOBH 2V3DA 1LO3H 5JZ7C 3BRDA 4MQ7A 1HXYB 1IRAY 4JE0A 2JNZA 4PP2B 2BZCA 3I75A 5ADPH 2W0LA 4XXCC 3QUYB 1EXUB 5EZJB 2UZPA 1XMWA 2OTWB 2X3CA 2XRAL 2ZUQB 3DX9A 3BN3B 4PJHF 2J6EL 1RUMH 2GTWA 3QXDB 1A3RL 5I73B 1PZ2A 3VWKA 3WNLA 3Q3GB 1CXLA 3AS1A 4U1KB 4AV4A 4HGWA 4JG1H 4FZ8L 3JVFC 4J3OC 5DD1L 3SDDC 5I73C 4M7JL 1ONQA 5KBPA 5DJDB 1TZHA 2BOCB 3B3IB 4K71C 1XSKA 2EDKA 4X6DA 3X1NA 2R1XB 3Q05A 1XIWC 2EVGA 3GXTA 2H2PC 1OF0A 3HS0A 4Y5VA 3MJ7A 2NLJB 3FCTA 3GJEA 4IHOB 4FJYA 2ZUVA 1NIDA 1YAZA 4JO3H 4I7ZC 2JQZA 2AJZB 1RK0A 5D7IB 5TQ0L 4J5VA 3GI9L 1WISA 3PQYE 4UILH 4ZFQA 2CDGA 3HI1B 4YGAB 4IS6B 5DVPA 1HDMA 4R4ND 1MFEH 4WHCA 1ZVYA 3L4XA 3QHZL 1GYCA 2ENYA 3ROOB 2CZNA 2AW2A 4ODHH 5CSGA 3ZY7A 1E8YA 5HVGB 5FA4B 1KBGL 5FKPA 1I85A 2GHWB 1MVUB 3NAAH 3B4NA 2ZX6A 2CJUH 4U1SB 1J8HE 3N41B 2PXYD 1NCUA 3P4OA 1SPDA 4W9LC 4UB0L 5F7DA 1QBML 2DYPA 5C08A 3KCPB 4AL8L 4FTVD 3KPPA 5FF6B 4OF7A 5AOZA 2CBMA 2X44D 5DRWB 4OAWB 3VYNA 2YD1A 2BVTA 5D1QB 3OKOB 3DRTB 1KTDB 4JY6B 2XT1B 2JKRM 2YXWA 4H26A 2IPTL 4BHUA 5IF0A 1TYEB 4QEGA 4HT1L 4MYWB 3A3YB 2B1HH 2CD0A 2L3BA 4K15A 2VXQH 2VMCA 3BQUD 1BM3H 4FFVC 1EAOA 1GC1H 5CIPA 3W5NA 5B38A 4A39A 2J5LC 2GSGB 2JI2A 3ALWA 1E5CA 1BVLA 4P57A 5SX4I 2KQNA 3QIBC 4HFUL 1ICTA 2YEZB 1K5NA 3KWTA 4B9CA 5J6GA 2UZYB 1JNHA 2NTFB 4Z0BL 5F7UA 3B2UD 2QQLH 5BXFA 4FFZH 3SGKC 1THAA 1EXHA 1YQVL 2DJMA 2ZYRA 3KWXA 4L4VB 1T21A 4AE0A 3U30B 2P45B 2PWHA 1YNLL 4I18B 2ZUYA 1SFHA 5C0CB 3FSOA 4NHCH 4DKFL 1P6AB 4G6JL 1II4E 2BRRH 4HUNB 3WN6A 1N64L 4ZSOE 3EOTH 5CCKH 2VLMD 3GMOA 1NMCC 4HIPA 3DOIA 1NAKL 2PPEA 4ZDHB 1BMZA 3Q6FB 2BSRA 2K1MA 3I9GL 1WCBA 4XN4A 3BFWA 4JO1L 4IKJA 4TVPH 5BV7C 4MQXC 1X5IA 3MRNA 5J06A 2OAAA 3X13A 3PXHA 5KAQF 2VH5L 5SWZB 2BVPB 5EMYA 3CD4A 2BSDA 3K6SB 4DEUA 1L9MA 2YPLE 3ECVA 3I6LE 2OCFD 1XZ0B 3LN4B 4N2EA 2KC0A 1F11A 4CU7A 5HVWA 1CVRA 4LPUA 1OCZB 3LIZA 1DVQA 1VGKA 1W6LA 1HYSD 4M02A 5GGUA 3VI3B 3BFOA 4PWFA 3QDGD 4BH8B 2YZ8A 3CPUA 1EVUA 5AVYB 4KTDL 4M56A 2VSKB 2NNAA 3P2BA 5ALCH 1XGYH 4M1GL 2F58H 5JZ7D 3HB3D 4RWYH 4DGIH 1FVCA 3B3BA 2LGNA 5ELIA 3BKML 5E6ZA 2QVKA 3E8VA 2GIXA 1JUFA 3CZLA 5HGDB 5KJRL 5D7JD 8FABB 3MCLL 3VB9A 3K3QA 4L3FA 2P9RA 4AKQA 5CJ5A 3P0YL 4MXQD 2MCPL 2PW2A 3QUML 1RZGA 1RMFH 1KELL 3BAYA 3NIGF 3PQYD 4IMLA 4KXZI 4OUOA 4UQ3A 4E42A 5DK0B 4NO0A 1AKJA 1HDMB 2VDQB 5K33A 3VM7A 43C9B 4JFHE 1IEAB 1QRNB 3M86A 3B9DA 3QHTC 4HUWA 2CBPA 2CDEA 3IT8D 3F7YB 2IOOA 3FUFA 4JRXE 3L6FA 3U6RA 2HRPH 1SVCP 2IH3A 1OSYA 3AB0B 4KJPD 2NQCA 4PVMA 2GPZA 4LIQL 3P2TA 1IVLA 1IBHA 1XH1A 1NEUA 3FTVA 1IC4H 2I9LA 3O41B 1AKJD 1OSPH 1KB5H 4IOIB 1UZ8B 3IAQA 4OSUL 2WIIA 2FATH 2X4SB 4NIYE 1EHKB 3WIFB 4UT6H 3NIDF 1IAIH 3LS4L 4N0UE 4P99A 2XBDA 3EGSA 3AG3B 1KIQA 1NM4A 4NC0B 5JMRA 1OVZA 5L2KA 4G83A 2G3MA 2WXRA 3RVTC 2J7LA 4BFEA 1MQ8A 1E28B 2BS9A 1QFWI 4IHBA 2DM2A 4ZAKC 3SQBB 3QCTL 4I13B 4TNVK 1NGPL 2QZQA 3NSJA 5AKTA 1LWJA 2B2XH 4XBGB 1VFOA 5TE6H 4Y88A 2CQVA 2GEQA 1U41A 1NCCL 2PPCA 4WTZA 4HBCH 5JW3H 5DHVB 1T0MB 2EDDA 3ARBA 2J8UE 4I0PA 5E5RB 3BT2H 2ZXEB 2OK0L 1CDHA 2OMTA 4R0LC 3GSUA 5IW6B 4DVRH 4G7VH 3COOA 4O2EB 4LLQB 4X0KB 4MAUH 3ESVF 4WI7A 1KCRL 2TSAA 4XNYH 4J3VA 4CMMA 2OTUA 3R4DA 5FGCE 1EUTA 2OSYA 1EHLH 4XO3A 2PYFB 3PGDB 1X4XA 4NRYA 5JDSA 4AMWA 4Y2LA 1E4XH 1FAIL 4HKXB 5KBKA 4GKOA 3JWOH 1L9QA 4FNRA 4KPHH 2HTLD 3BSGA 2EEXA 4LEOA 1YYLL 4OD3H 1PZBA 1RULH 3P9MB 4YDLB 1BLNA 1NGQL 4ELMA 4H8UA 1IGMH 3WNJA 1R34A 3A6BH 4MXQC 2A74B 2CRYA 3BVXA 3BIKA 4I87A 1JPFA 2IXQB 1Q38A 3CFCL 3O11B 1XBDA 4NCC1 3KH4A 3MBWA 1TZGL 3T1FA 1HL4A 1T1ZB 1SXSA 2VB5A 2KBGA 2RBLA 5GRJH 2QSQA 3G6JB 2DQDL 1AXSB 1L9RA 4LHQB 3LKRA 3ASOB 3ZDZB 1WAAF 2QDVA 4HKJB 4KDTC 3CCHA 5T1DH 1HIMH 4XMKH 3MRQB 5C3IA 1B4RA 1U4FA 3AQZA 5CO1A 3C9NA 3N1MC 2B4CC 4RNRB 3DXAB 1EMTH 3HB3B 4WO4D 4XGZA 5B21A 5EEWA 2XVBA 5IMMB 2R1XA 5A6MA 4UMSA 4JQVA 1G9NC 3JVGA 4JDTH 4J6IA 2X6UA 2C3HA 3GHEH 3BD4A 2VMJA 3ERXA 1V10A 1OM3H 4NJ9L 3BKCL 1PEWA 4GXUN 4OGAD 1TPXC 4GP5B 4HUUA 4DW2L 4FCHA 3CSPA 4AK1A 2R2BB 2C4XA 2ICEC 3SQOL 4KQ3H 4M93B 1YEJH 4M1DH 4PMFA 3B6SB 3LEXB 2Y5EA 4FE9A 2VWEE 3VXME 4W9IC 2HFFB 2XTJB 5E2UH 3WNKA 4KGLA 3CZNA 2JJVA 3OXSA 5J0BA 4N1CA 3UIZA 2HPOA 4NHUA 3ZDZE 4JDEA 3H7BA 3GKZA 2WQ8A 4Y16C 1ZRUA 1FVDA 5IBLD 5I1AB 2FSEA 4ZD3L 3TO2B 5LLIC 2A3TA 2WXFA 2E27L 1E90A 1MY7A 3PWJA 1RUAL 5L8KB 3A6CH 4B5ZA 4GMSL 1SHMA 2YSTA 2A73B 4FFZA 4Y19B 1FDLH 1Q90A 1E6OH 2JCCE 4FQXB 4AQ1C 4D7PA 1PEZA 4MMXB 4XCEB 4LPTA 1MFAL 4G72B 1HAWA 5FYKH 4QXGH 2WC7A 3WS3B 2FGWL 1P5UB 1OP9A 2AXHA 4LPXA 2BOBB 4M62L 4HGKC 3SPGA 3VI4E 2XJLA 3ZT7A 4LDCA 3CK0H 2IDCA 3GPSA 2N1TE 2X2HA 5HYSB 2MCAA 3QUXC 3V0GA 1IC0A 4QHLA 3INUL 5FUOH 5FYJL 5IW3A 3IJ9A 1NKGA 5EO9A 4N2GA 2ITFA 2OQJB 4IKKA 1D5XA 2H1LM 2IPKA 2OI9C 2ZSVA 4XNMB 2BIIA 5H35B 3QEGL 1PGRB 2VABA 3FUDA 4AQEA 4L4VA 4RSVA 1U33A 3K4AA 2UWEE 1QHOA 4KTEL 4BHUI 2ZG1A 2WLJA 3O3DB 4TM9A 2ZUTA 4LVOC 5JW5B 1KGUA 2XQ0A 3FQ2A 5C07B 3U9PH 4UNTA 2UXGA