1ADWA

Pseudoazurin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
123
structure length
123
Chain Sequence
ATHEVHMLNKGESGAMVFEPAFVRAEPGDVINFVPTDKSHNVEAIKEILPEGVESFKSKINESYTLTVTEPGLYGVKCTPHFGMGMVGLVQVGDAPENLDAAKTAKMPKKARERMDAELAQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pseudospecific docking surfaces on electron transfer proteins as illustrated by pseudoazurin, cytochrome c550 and cytochrome cd1 nitrite reductase.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords PSEUDOAZURIN
total genus 34
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1adwA00
2JKWA 2CCWA 5F7AA 3UAAA 2UXGA 1JZHA 2BZ7A 2BW4A 2HX9A 3D12B 1ZPUA 2CBPA 4HCFA 3ZX1A 1GS8A 3TU6A 3WIAA 3AG3B 2DYRB 4YSQA 3FSAA 2RACA 2P80A 1PLCA 4QLWA 3ABGA 3BVDB 1NIFA 2GC7C 2QDVA 2GB2A 2YAOA 3NSCA 2J56A 1X9UA 2PPFA 3UACA 4DP2X 6PCYA 2FQGA 2GHZA 1ET5A 5B1JA 2UXVA 3FU7B 2TSBA 3AY2A 2IDFA 1QHQA 1WA0X 2R7EA 2DYSB 2EILB 1R1CA 4E9SA 1A65A 3BQVA 3TASA 4AZUA 1NIAA 3IN0A 1EHKB 1AANA 1KDJA 4PCYA 1OE2A 1PZAA 2GSMB 3T6ZA 3V9CA 2VW6A 1GW0A 4DP7X 2H47C 2HRHA 4DP4X 4GP8B 2BHFA 2YXVA 3NSFA 1KBWA 1PNCA 2I7SA 2DV6A 4A2FA 1ID2A 1L9PA 2NRDA 3ZIYA 3ABMB 3NYKA 5D4HA 3CZUB 7PAZA 1J5CA 2OV0A 2EIMB 3PPSA 1GR7A 1QLEB 2BWDA 2PPEA 1KV7A 2YAMA 1J5DA 4HZ1A 5B1JC 4DPAX 2Q5BA 1J9SA 2YARA 4G7RB 3FQ1A 4JHVA 3DKHA 3G5WA 1NIBA 2H3XC 1PLAA 1AZCA 1SJMA 1IUZA 2BP8A 1L9QA 2LLNA 2IAAC 1CC3A 2FQFA 2X88A 2FQEA 2B3IA 5B1BB 2YQBA 4DP6X 5I28A 4AKOA 1PF3A 3AW5A 1L9SA 5F7BA 1MG3C 1PZCA 3GXUB 4BWUA 1FA4A 1IBZA 1L9OA 4YSPA 1OV8A 1B3IA 2PPDA 1NIDA 2VW4A 2BO0A 2MRYA 1AS7A 4YSEA 2FQDA 4F2EA 1RCYA 2MTAA 4ENZA 2ZWNA 2WO2B 1A4CA 1GSKA 4KO7A 4BDVB 2J55A 4UF7C 1CUOA 3AG2B 3SQRA 1URIA 1W6WA 3WNIA 4BK5C 3UADA 3QJTB 4A67A 2ZOOA 2IDUA 1WA1X 4WTQA 4W1TA 3GDCA 1AZUA 1MDAA 4DP5X 4YSDA 1WS8A 1DZ0A 3PXLA 4KO5A 2PCFA 1EZLA 4KO9A 1SF3A 5I5MA 3FSWA 3HB3B 1KBVA 2EIKB 1W8EA 2XXFA 2IH8A 3FQYA 1M57B 2QT6A 5I5IA 2DWTA 2BWIA 3FS9A 2XWZA 5B7EA 3ASOB 2VM3A 1JZJA 1AS6A 2B08A 2FWLB 3CVDA 1QNIA 3NT0A 1RKRA 1X9RA 1NIEA 5I6KA 2XVBA 2E86A 4HCIA 4JKNA 5AKRA 1SDDB 1CYXA 3X1BA 3UABA 4DP0X 3NJMA 2YAPA 4YSSA 3JTBA 3H4HA 2BZCA 4AKPA 4G71B 2BP0A 4YL4A 4E9QA 2PP9A 1W6LA 5I5JA 4CSZA 1T5KA 2VN3A 1GS6X 3T6WA 2YAFA 1RZPA 1AZNA 3WKPA 4BXVA 4K9JA 3FPYA 4HHGA 1NWOA 3EF4A 2ZXWB 3NJLA 5B3SB 1AIZA 1AG0A 4F2FA 1OCRB 2OCCB 3ABKB 1A8ZA 4E9WA 2XUWA 4FA7B 4JHUA 4TXVB 2JFCA 3UGEA 2HX7A 2HZHA 4ZK8A 3TBCA 2FJSA 2VW7A 4KNSA 3NJJA 4DP9X 1WS7A 2CALA 2FT8A 1BQ5A 3IBOA 3NP3A 1AZRA 2AFNA 4DP1X 1NPNA 5FC9A 4YSOA 2PCYA 3FPXA 1NPJA 3T6XA 1XB8A 1FFTB 3OMNB 1HAWA 4E9YA 4YSCA 4HIPA 4BXSV 2AVFA 3OQRA 2AZAA 1JZEA 2N0MA 3CDZB 2GBAA 3NJGA 4Q8BA 4RH4A 1PCSA 2UXFA 4A68A 1NDTA 1GY1A 2HXAA 1OCOB 4YSUA 3AG4B 1JERA 2YAEA 3UAEA 5PCYA 3DIVA 3EH3B 2BW5A 2W88A 5E9NA 4E9VA 4KNUA 2IWEA 1M9WA 2IDSA 4HCGA 4A2EA 1IKOP 1M56B 4KOBA 2PPAA 3JT2A 3IN2A 4KNTA 2IWKA 3IE9A 1UATA 2QPEB 2YXWA 4G7QB 4N4YB 3X1GA 1E5YA 4CSPA 1BYPA 1OF0A 1SDDA 2TSAA 4YVUA 1GS7A 3X1EA 1KCWA 3S3CB 3RYMA 2QDWA 3AZUA 2WSDA 3ZBMA 1AAJA 1PAZA 3NJFA 5I6MA 3V9EA 1NZRA 2VSMB 4UANA 3FSVA 1V55B 2XYBA 5LDUA 1N70A 1NWPA 4UAHA 2Y1AA 4NB7A 1PMYA 3NSDA 5TK2A 2JXMA 1XB3A 2XXGA 1AS8A 1ASPA 1BAWA 1E67A 3EH5B 1L9TA 2W8CA 4N8UA 2XV3A 4M4RB 1ET8A 3OD3A 2FTAA 1OCZB 5PAZA 2AZUA 4G70B 3EH4B 1JZGA 2CJ3A 4NERA 4AI7A 1F56A 1HAUA 2A3TA 1ETJA 3PCYA 2J57A 1OOWA 8PAZA 3GYRA 1KGYE 3NJKA 4W9ZA 5B7FA 3CVBA 1PNDA 3OM3B 3ASNB 5D4JA 1J9TA 1TEFA 3L45A 2DY2A 2GI0A 3FU7A 1ET7A 5I26A 3QJQB 1HFUA 5TK4A 2CAKA 3N55A 1E65A 1TU2A 3KW8A 3NJHA 5EHFA 2HLEB 4P5SA 1AACA 3AG1B 1XB6A 3N2JA 4E9TA 5I6NA 4G7SB 3QJSB 5A7EA 1DYZA 2XX0A 5B7MA 2VSKB 1JXDA 1WA2X 3FU8A 1AG6A 2FT6A 3QQXA 2Q9OA 1SHWA 3MBWB 1ILSA 5B1AB 2VMJA 3H56A 4BDVA 4BWWA 1ADWA 1KDIA 3OMAB 2XLLA 1CYWA 1MZZA 3C75A 1N68A 3WG7B 1JXGA 3S8FB 1BQRA 1VLXA 3NJIA 1TKWA 3U25A 2ZONA 3S3DB 3DTUB 2IDTA 2PP7A 4BWTA 3FQ2A 4A2HA 3CG8A 4DPCX 2XV0A 2HRGA 4GXFA 4M3HA 2IDQA 1AQ8A 4HAKA 3S3BB 1MZYA 4GP5B 3T6VA 4PAZA 3S8GB 3HEIB 4WKXA 1E30A 5AFAA 4Q89A 3QJUB 5IY5B 1A4BA 4E9XA 1E5ZA 3WKQA 4E9RA 2R7EB 3X1FA 1KYAA 1OE1A 3X1NA 4DPBX 2AANA 2PP8A 3FT0A 2PLTA 1ILUA 2IH9A 1NTDA 3IEAA 2FT7A 1ASOA 1XMEB 1L9RA 3TBBA 4KO6A 5B1KA 2BP0B 4GP4B 4X4KA 3T9WA 1BYOA 2GIMA 1YLBB 2QPDB 1CURA 1BQKA 3NJNA 1JOIA 3PAUA 3ZDWA 4YSTA 5AZUA 5I6OA 3PAZA 1ZIBA 2XU9A 3T71A 1SF5A 3TA4D 1IC0A 3FYEB 1GYCA 1ZDQA 1JVOA 2UXTA 4L0PB 1RZQA 1ZV2A 3H4FA 3QPKA 2EIJB 3PLYA 1NICA 3FYIB 3WNJA 2YAHA 1ZDSA 2WO3B 1BEXA 2DWSA 3FSZA 2Y69B 2H5UA 2YAQA 4MFHA 4A2GA 3ERXA 2EINB 4NAJA 1SNRA 1AR1B 1SFHA 4P5RA 2UX6A 3NP4A 1BXUA 3CDZA 1AOZA 1ASQA 5I6PA 4A66A 3MX0B 3FU9A 2OJ1A 4FAAB 3KW7A 1ZIAA 7PCYA 1TEGA 1AZBA 1J9RA 1V54B 2I7OA 3EHBB 2VM4A 3QJVB 4GYBA 2CUAA 4GY4A 4HALA 4YSRA 6PAZA 1SFDA 2HX8A 3SBPA 9PCYA 2GC4C 2P80D 1JXFA 1PZBA 4F7KA 1KCBA 5I6LA 1SHXA 2PPCA 4A2DA 3PAVA 1OE3A 1PLBA 1V10A 5ANHA 2IWFA 1MG2C 1OCCB 3X2QB 1BXAA 4EF3A 1GY2A 2XV2A 4HHWA 4DP8X 2I85A 3SBQA 1BXVA 4YVNA 4AX3A 3ABLB 1A3ZA 4QKTA 1NINA 3SBRA 1A4AA 3QJRB 1FWXA 1J9QA 1JZFA 4YSAA 1IBYA 3OMIB 1JVLA 2XX1A 3NSYA 1PY0A 2BP8B 2UX7A 3WI9A 1I53A 2FNWA 4AKQA 4KOCA 4G72B 1JZIA 2X87A 5D4IA 1WAEA 3CVCA 2J5WA
chains in the Genus database with same CATH superfamily
1ONQB 4OM1H 4IU3B 4F7TA 8FABB 3V7AG 2ZCZA 4AWJC 1ZAGA 1ZPUA 2IH3A 1A1OB 4Y2DD 3ZX1A 4AQAA 1IFGA 4YFEA 5HYSA 2DYRB 1I8LC 1RJLB 3B9AA 4FNPA 1HE8A 2COQA 2B2XL 4KY1L 5ALCH 1FH5H 1U95B 3QZPA 5LWYH 2WXNA 4Y1AB 3ALPA 2WQ8A 2OLDA 2QELA 4HVBA 3WIIL 3ETTA 4EO5A 3WCYA 2XCMC 3ECUA 1WV7T 5G2NA 1YHPA 1URLA 2VQTA 3CX5J 3X14B 1C5CL 1NCIA 3TASA 1D6EB 1ZHKB 4RAVA 2CG9X 3RBSA 3SY6A 3PL6D 4M6NL 4U05A 5JHDB 1CU4H 3HB3D 4ZMNA 2WBXA 4NWUL 5FV1L 4B9CA 5ES4B 5AL0A 4ZFOL 1FZKA 3DIDA 1K3ZA 1KXTA 3V6OC 1ZVNA 3OKNB 4DP4X 5I1GH 3DYPA 1TU2B 1AI1L 3O6KH 4AVHA 1YECL 4BE6A 5JHLH 2XETA 4JGMA 4P4KB 4UDTA 5I1DB 1MLCA 3KL0A 3RHWK 3ZO9A 4EDXA 2H3NA 2YWZA 3DPBB 3BX7C 1MAJA 3UJIH 2GFBB 5E5UB 3ZY7A 1E4XI 1D3CA 1GZHA 2DIEA 1NCBH 2VERA 4OLXH 2NUPA 4PIBA 1INDH 2P1YA 1RIUL 2BVQB 4NFDA 4UNTA 3Q6FB 4Z7UE 5GS3A 5FXCH 4A7GF 2FJFB 3WEBA 3P0YL 5F71A 4AM0B 3W39B 3HN3A 3QO1A 3V6FB 2HFEB 3EYFA 4BFOA 2ARJQ 4CNIB 4KMTL 1HTYA 5EMYA 4Z0XA 3QNFA 4OCXL 1QQDA 1M05A 4EI5A 1UASA 4X98A 4K5MA 2B3IA 3TM6A 4U3SB 2YQBA 3MRCA 3CV5A 5ESVB 3AW5A 1A1OA 1UHVA 3VMOA 1F45A 4MB5A 1WSST 5E7BA 2P26A 3T4AA 3RVUD 1UWGL 5F2FA 1V27A 5DQJA 1XGPA 2LFEA 3CDCA 4NQEA 2D9CA 2EYTB 2VDML 2WO2B 5E6YA 3P73A 2EO1A 3NCMA 4FQLL 2J1YA 3QXAA 3R06A 3UTTD 3FT4A 5GS0C 3GHBH 5HYQB 1G9ML 1BF8A 1IM9B 3LTVA 5HGDB 3UADA 4W70A 3KBHE 2VLJB 2IDUA 4LRNL 5BUAA 2ROYA 3R8QA 3VO0A 2VC2L 4TNVF 3B9KA 1YVLA 5GPRA 4DP5X 1PG7H 3L3GA 1D9KB 1UUSA 1G9NL 1SRDA 5DT1H 1A7RH 1ADQL 1YO4A 3GM8A 4ZSOE 3VRIA 2KPWA 5INCB 1KXTB 3HZ3A 5A1AA 1KBVA 2EIKB 2A9NH 3OKOB 2BJML 4MVBD 4JFFD 2LFGA 1D2OA 3ES6B 5FGBA 4NO5A 3V7MA 3M07A 5F44A 2JLLA 1EEUA 4HWBA 5JHMA 5DMKB 4GW1A 2W9DL 3ZVVA 4WI9A 3AU0A 3PGCB 5IROA 4QY8A 4J6RH 1XEDA 1BQHB 4PLKD 1K4CA 3B7UX 1IC4H 5AB0A 3N44B 4PJDE 2FWLB 1Z3GL 5DJDA 1KGCD 4CC1A 2DM3A 3LS5H 1X9RA 4LLAA 1EEZB 5FA3A 3X3GH 4UDUA 3UIYA 3D39B 4JKNA 1OZTG 1AIFA 1ZTXE 4JEGB 4WGKA 4F7EA 5BRZD 2QVFB 3STLA 1T03H 2H0JA 4WHCA 1GPOH 2J6EL 4AGPA 3TONA 4CJ0A 5LBSH 3QNXA 4WV1B 4EDWH 3F5WB 4GSQA 3FF7A 5GGSB 5ITFB 4EIGB 4JHWH 4E9QA 5JNYB 5I5JA 5CINL 1T5KA 3NA9L 2XIIA 4UIKL 1AHMA 4WWKA 1HOCB 4L3EA 4XVUD 4XCFL 2P4AB 5HGAB 3T4YB 4ACPA 4XVTH 5IHWA 4MWFA 3GSWA 4ZFZA 4PB9H 3P9LB 4XNXL 2X53A 4PRPE 4B3EA 3BKYL 2G75A 3IDXL 1AI1H 3O6KL 4L23A 2KZBA 1TYEB 2NNAA 1PBYA 2XVGA 4DQAA 2IIJA 2JE8A 4PH8A 4D8OA 2H2PD 4TULL 4ZOEA 4TNGA 3TBCA 3C5ZD 3CFMA 1WS7A 1IQDA 4NFCA 3CFCH 4PVMA 4YSOA 2J88H 4MHHI 4FTVA 1T5XA 4UTAA 1C5BL 1NEPA 1BFOA 1XB8A 3PDOB 1FFTB 1NDMB 4JN1L 3UPCA 2PR4H 2KL6A 1DJWA 2VZOA 3KGTA 4BD4A 2JNZA 3RNKB 5EF2A 3LIZA 25C8L 4Q4IA 2PWDA 3QULB 1WHOA 4KRPB 3KJ4B 4OCLC 2Q86B 4ATWA 4HUVB 2EIEA 1QRNA 2VTFA 1OGAE 3OC5A 4A04A 2ZXGA 3DLQR 4HD5A 2W60B 3TJEH 4XWGL 4GW5B 4OLUH 4R3SB 3F00A 5AG8A 4ZMZA 5MI0B 3S97C 3FT1A 5CIPH 4BSVB 2WNWA 4WW2A 3MLSH 4MAYC 1IZJA 4WUUA 2XA8H 3ULVC 3P54A 3QFJA 4ZUWA 5F9JA 4OZIB 2VQUA 3I75B 4YH6A 3OSVA 3Q5OA 3S37X 3UJTH 1KTDA 5D7SH 2AI0L 4Q9CA 2OK0L 4IK7A 3QUMA 5IB3B 1CFQB 2WLIA 2Y6SD 3HR5B 2OMWA 3IDJB 5FYLL 3RYMA 2ZUVA 2QDWA 4JKKA 5AW9B 2CKBB 5KSAB 3ZE2F 4F92B 3QDGD 3B7TA 4KK6D 2V7NB 2QQQA 1TT6A 2HJLB 2XTJB 2EH8H 1KTKE 2AEQH 3V0GA 1J88A 5DJCA 1BHGA 5FO7B 3LQZA 1T1YB 2VXTH 4C59B 1A9EA 4NC2B 4XB8A 4YR6A 4N6QA 3TO2B 1VKXB 3QDHA 4JFQB 4ZFZB 1XB3A 1AGBA 1JBJA 2FO1A 1ASPA 4BUQA 1G6VK 32C2A 3Q8FA 4KQ4L 4QOKE 4X4YA 4Y4FC 1T89C 3KPPA 1NBZA 3EDJA 4UYQA 1OEZW 4XBEL 4O2FA 3SDDC 4F27A 1JGEB 4ODWA 5FHAH 5GSRA 2VE6B 1FZMB 2VMEA 4LMQE 1HJBC 4J1UB 2K4AA 1E2ZA 3O3DA 5DA0B 1NLBL 2C4FU 2VQ1B 2ZCHL 2W9EL 4K23L 4BFIB 3O4LA 4OFKA 3IGLA 5FLUA 1YQ2A 5C6TL 1AKJA 5IESH 1PNDA 3HMXL 4HZLA 3RFZA 1CI5A 4CVZA 2X4PB 3OJMB 3DSNA 3APDA 1T5WA 5DC2A 2A9ML 2ZXCA 4LP4A 3QZWG 3G08B 5DUMH 2PCFB 4KNQA 5E2VL 2VJXA 1UZGA 4FQ1H 2HKHH 1LO2H 4QRPD 3HLAA 4XPTL 4KKCC 5D9SA 3HZYA 2R1YB 1Z7JA 4M03A 4U3SA 4V1DA 3HI5L 1DYZA 4AH2A 1UXMA 5K9JL 4QKXB 1WF5A 3MLUL 2JELL 4L4JA 3Q43A 1OALA 3ZYOA 3ULVE 1VEPA 4XCYA 5HI3D 3QNYB 5I8EB 4G9FE 2AV7A 2Q9OA 4P5KA 1YEGL 5F7KC 1IGTB 4N6RA 5TF1L 1KLGB 2P8LB 4PREA 4ZG1A 4MCZA 3EGXB 3J7HA 3FT4B 3AFLA 3AUWB 4FLHA 1MHCA 3AWGA 2F7PA 5CSZA 3BSGA 1VLXA 3K6SA 2F53D 4IOSD 2ARJA 5T3ZL 5DK3A 1WCBB 4NHCL 3RKDC 1A1NA 4JB9H 3HBGA 2J8UA 3S3BB 1CFNB 4OFYA 5GS0L 4Q2ZA 5IW6B 3CQQA 2GSGB 3FN9A 2BRRL 3G5VB 3RIKA 5EC2B 2ZOUA 4WKXA 4Y2OB 5DZ9A 2HMIC 5AFAA 2P8MB 2FUQA 2G9HA 3MBEC 4HJJL 2BVOA 4KXCA 4L8BB 1WE5A 4IQHA 5AKVA 1DEDA 3NN8B 4YPGA 3VU1A 4QTIL 2L3BA 5IMLA 1K6QL 5T1LB 3BLBA 3FT0A 1R3HB 3C09B 2NY3D 3PYCA 1U2CA 4QRSB 3LH8A 5I8CA 3QRLA 2X89D 2QTVA 4I0CC 2CLRA 4K71B 1G9EA 5CGYC 2AQ3A 5ITFA 3CUPB 2B3RA 1B4JL 2EDKA 4MQ7B 2WB1A 3RY4A 5D1ZI 5E2JA 3V0FA 4L48A 5L8KB 4TQPA 4FCHA 2W95A 3FUMA 2EDOA 2EEBA 5CINH 2XICA 1UD6A 2J2ZA 1E9PA 5BUGA 3QORD 4GBXD 4RDQF 5G5DB 4DKDC 4TTGA 4KJYA 3BVVA 5JZ7D 2OPCA 5KVFE 4PJAB 1CT8B 2VZVA 3VXSE 3GMLA 4TVSa 3FSZA 3O2VL 4UV7L 4CBZA 3B7SA 6TAAA 2F1AA 2OL3L 1ZLDA 3ZZSA 2NT1A 3L5WA 2BINA 1BG9A 3TF4A 1BXUA 4E41B 2BIPA 4RGNB 1OM3H 4CW1B 3UP6A 2BSSA 2N1KA 5EBGA 5HVWA 4RDQG 5FS5A 1XH3A 3OV6A 4EIZC 5IIEB 3IDGA 3UAFA 4N0YH 3N42F 3VXUD 5BV7H 5LNGA 3FRPB 4ZYKA 3L13A 3QIBC 3DJTA 3FTGB 2OMXB 1XCWA 2GC4C 2J25A 3L3HB 1TPXB 4E5XB 4ZX5A 1KN4L 4JFEB 3FU5A 1SHXA 4MB1A 4EZKA 5FPIA 5IEHB 1OWRM 2BM3A 2Y72A 2N59A 2UY7B 4GKZB 4EF3A 4YBLC 4N2EA 4MA7L 4DP8X 2M83A 3EJQA 3V4VA 5TQ2H 1MWAB 3S88L 5M94B 2EXWC 4QGTA 2OL3A 2ZWKA 2YEQA 4Z78B 4G7YL 4PRBA 4OCWH 2AI0H 3EZJB 5F70A 2NY7L 3UTZA 1NEZA 1V7NL 3MUZ1 3QO1B 3V6FA 5FYKD 5SWQB 4U0QB 4TM9A 2H6PB 3TNMA 1EQWA 2V7NA 3RWJA 4LKCB 2PWEA 3LXBA 3RL1B 4FMFA 1Z5HA 1VESA 2CCWA 2YWYA 4LPCA 3BKCH 4LOVA 1A47A 2NY5H 2E46A 4ZO8A 1ODUA 2HX9A 5D1QD 1Q1JL 3TIEB 3B2VL 1EANA 1RZ7H 2R0ZH 4M7LH 2YGVA 3AREB 4N26A 5DLLA 3NAAL 4JPIB 4NO3B 4ODVH 4S0SD 3BSHA 2KZWA 5C08B 4B9PA 3HG1E 3CBJB 2Z92A 2N7SA 2LTQC 3BEWB 3S5LA 3UZVA 5HVGB 1NCWL 1OT1A 1REIA 2FUTA 3V5KA 4QWWD 2OR7A 1ZSDB 3K4ZA 1ET5A 4K3DH 5CCHE 5IJKC 2EDMA 3W5MA 3MJ8A 3A6BH 1JRHI 3LIZL 4KJWC 4YHLL 2BSSB 1FCGA 1S7QB 2DYSB 1YC8A 3C8HA 3NCYS 4CGUB 1IC1A 1IGYA 2EKSB 4WEEA 4JN2B 1W72H 4X9YA 5DO2C 2JKJA 2YS4A 1AANA 3NH7H 2WP3T 1NAKL 1TQBC 4K94H 4YZFF 4BJLA 4F3FA 1P4LA 3ZE0E 4L5FL 4GSDH 2HRHA 2UZYA 4ELMA 2H0PA 4GP8B 1XCTB 1CR9L 1CXEA 5JPMC 4LSVH 1KWKA 3B7RL 1V7ML 2C26A 4NUMA 5E6ID 1UOVA 5DEZA 5JA8B 4KZDH 2F53E 4YBLB 1IM9D 4XVSL 1MCSA 1ZT4A 5KSVA 2LLLA 2YGOA 1JNNH 2DQDH 1DO5A 4H2CA 1LGVA 4HJ0C 3WLBB 3O41B 2VAAA 4ZXBD 5FF6B 2DMCA 2ZF9A 2EC9U 3SQOH 1KCSL 4EUPG 1JGVH 4G8EB 5ILTH 4JMNA 4JRYA 1U92B 4LEOB 3W82A 1QSEE 4M5TA 4L2LA 2BNQD 1QKZH 3BKML 3B2MA 3ARUA 3OR6B 1J9SA 2XPGB 7CGTA 4APXA 3Q06A 4DGYH 1QD0A 3ML9A 1NBYA 3S36H 3SO5A 3FB5A 5FYKL 3KEDA 4K3JL 4BZ2H 5KWYC 3JWDC 1I3GL 2HT2D 1AZCA 3MRNA 3OR7B 4MD4A 4MAUH 4GB9A 4X4ME 4FA8A 1YEKH 2HTLC 5AVWB 4LVHC 4P9HL 1RLWA 2D7MA 5IB4A 1Q1PA 2MNJB 5IR1B 2JIXD 5DQDH 1K3IA 1MG3C 5DZLA 4H88H 1L9OA 1MUJB 5GZNC 3VYOA 3AROA 4F2EA 3ZE1F 3T0WA 1T21B 3MUGA 1W2KT 3CVHA 1GSKA 2ZE0A 2P45B 4KO7A 5LN8A 2J4WL 4HUWA 4XMWA 5DUPL 4ZFGH 3BSZH 1I1RA 2Y7QB 2YUWA 3KBFA 3IDNA 5BUPA 3PREA 3O0RH 2CRIA 3WLWC 4P2YA 5EIVA 3GDCA 4NZUL 4J3XA 2Q6WA 5HPMB 1K9TA 2QVIA 4LL9A 4R7DB 2H41A 4Y4KC 5FYJE 4L0ZA 3S5ZA 1SF3A 4N68A 4MNQD 1ECZA 1SM3L 1MCNA 2R27A 1G6RB 1N8OE 5E8OB 3HB3B 3C6LB 1W8EA 2WLHA 2Q7YB 1WWWX 3ZOAA 2QT6A 1WC7A 3BP4A 1JV5A 4Z0XB 3GMOA 4A37A 2X4UB 3ASOB 4DAGL 5D7LD 1VSCA 2I60L 1MFAH 2Z0BA 5JXEA 2FHBA 1DBAH 4PJGF 3OKMB 5JOFB 4YHOL 2G30A 2OS7A 1RHHA 5F88A 3F8UB 4BH8B 4ERSL 1MCWW 3EJJX 1BBDL 3OLIA 1RH8A 3AWFA 2P5EB 3SE8H 2ZIDA 1NIEA 1NQBA 2H3KA 5T1KA 5D1ZC 1DVSA 3KAAA 3KPMA 4ERSH 4UNUA 3EOAA 5DD3H 5J0BA 4N2NA 3RRQA 3GSVA 5AW6B 5CEZH 1IX2A 4JO4L 2LVEA 3FFCD 1ITBB 3UABA 2D3VA 3TBVB 3JTBA 4JKPH 5A2CA 3F83A 1E8YA 4M6ML 4PLKC 1L7TH 1MNNA 1XBRA 4OLVL 1ONQA 1W6LA 1H15B 4FQXC 3MOBL 5EZJA 5CP7B 4G9DB 1GAFH 2HVJA 2GSIB 5IJBC 3RZWA 4FHKA 2Q76B 4OD1H 1QBLH 3FL7A 4ES8A 1RERA 2AAVA 1IGFH 4K9JA 2CJSA 1C5BH 3DX7B 4QHKJ 5DEJA 2OQJA 1FNGA 5BPPA 3DNKA 1NBZB 1TZ8A 3GMQA 3QRBA 4RFOL 1I7ZA 4LCYB 5ADPL 5FUZL 5B8CA 4ODHH 5CU5A 4H40A 1DVQA 1VFAB 3D5OF 4JFHD 5LKNA 4JRXB 5IBUB 2NX5A 2Y7QA 1X5XA 2VDQL 2ZCKH 4WO0A 3L7FB 1U3HA 1D6EA 2VW7A 5I8KL 2VLMD 5L9DL 1YNKH 5GGUA 1JV2A 4P5TD 4TUUA 2VDQB 2YSTA 4M00A 3QQ4A 4XP9L 3VXRD 2H2SC 3LRKA 3FTWA 4YSCA 2WZPD 4FABH 4OJYA 4IKNA 2R2EB 1MF2L 2H6PA 3OKEB 2LTQB 3CHOA 2E74C 2HXAA 3FQWA 2W1NA 3AG4B 5B39G 3KM1A 4IRJB 1J18A 5HI5C 2NY0D 4NFBA 3FT3B 1U21A 5I71B 1GZQA 2DH3A 2E27H 4OUUB 4JDZA 1DBML 4KNUA 1SXSA 4A2EA 4EBQL 2PPAA 4Z7OF 3L4XA 2Y24A 3I9GL 4NO3A 3NSJA 2WVUA 2OMTA 2D4FA 3WKNA 2VC2B 2RAMA 1RIVH 4LSPH 4BK8A 3E8VA 1BYPA 4G8GE 5C0AD 2GTWB 3R0MA 3G6DH 1RZ8B 5SWZE 4V1DD 2HH0L 4JKMA 4U7KA 2RH0A 1G87A 2R69H 2VIRA 4ZX4A 4FQXB 4PPTA 1QQDB 5I6MA 2CDFB 4JAMA 4R96B 1ZK5A 1RZJH 2YZ1A 2ICCA 4AYFA 2DWYA 5E9DA 5IMOB 5I76B 1BZ7B 1S7UB 2I27N 1HL8A 2VDOL 1P4LB 3MLVH 1L6PA 4HLZH 2QQKL 1S78D 3B2UD 4KJYB 4DVRH 1B3JA 3ULUD 1J0JA 5K9QI 1XF4B 2Q8BH 3QFDA 2YQ2A 5E2WH 3NA9H 5PAZA 4QHKI 2OW7A 4WAFA 3FULA 3ZUNC 2LQRA 3WKMH 1EFXD 4MHHG 4Z7WA 5CJXC 1JYWA 5AW0B 4N2DA 5CBEA 4TVPD 4BUHA 4AEHL 2K6ZA 1ETJA 3K5RA 2J57A 4EQ2A 2X12A 5SWSB 4LB8A 4JFZH 1HHKB 3E38A 3DPDA 3CMOH 5IK3B 2AEOA 4G43B 3S8WA 4PJXF 4K5NA 4JVPA 4APXB 4N3UA 5K9OB 2CU9A 3VQMA 2DY2A 3M86A 4NQSA 5AW8B 2DQFA 2QSQA 3FQWB 3TZVD 2APBA 2P44B 3VG9B 4LCWB 5AAWC 5ID1A 4EI0A 5JXAH 3LB6C 3AG1B 5FO7A 1AGEB 5FO2A 5E0QA 1CIDA 5EU6A 5I1JH 3M88A 4U6XB 3VFGL 3I2CL 1CYGA 4FN0A 4X6CE 5ECJE 3ZL4L 1HE7A 3U2SA 1N3NB 3CBKB 2NSXA 1XL6A 3TN0A 1O6VA 3VFSA 4BA8A 1SLUA 3WXVL 2DWEA 1VRSA 4NKMB 5C0IA 4H88L 3TPUB 3L3OB 4PRHB 3WJMA 2MOVA 4ZTOH 1C1EL 4RBPK 3FONA 3HI6L 3MOAL 3D6GA 3N85H 5FFLA 3MV7D 1E43A 4AC4A 4KKAD 1ZWIA 4YGVA 2QQNL 4I48A 3D3VA 4PD4J 4QRRD 4TUKH 4DZ8B 2NNCA 1QACA 2CGRH 1AGDA 4KKZA 2BOLA 4L3FA 1LO5B 4ZYKB 3SN6N 3NCJL 3IKKA 1DR9A 2MNWA 5L2KD 4L1BA 4NI6A 4PJ7A 4Y4HD 1RUPH 3EGDA 1EGJL 4JFEA 4TLKA 1FO0L 3VWJD 3RJDA 1IGCL 3MLWH 5DHMC 1EGJH 1E30A 2I60H 5TH2A 4AVKA 1CXKA 4X9BA 3NFPB 4MQTB 4ELKB 3O6FB 1D5IL 1HS6A 3PUUA 4X6CF 3ZKNC 3DUSB 1OE1A 1WBYB 1LE5A 1E28A 2X4SB 5E94B 5AD0A 5J11C 3EOAB 2FYYB 5C07B 3QFGA 4KKRA 3QI9B 4AM0A 2NW2A 5IT2H 1CL7L 3V5HB 5E99L 3L2MA 3UTQA 3EG9B 2O6EA 4A6YA 2R0WH 5GRJL 1NGXB 1E9OA 4MA8H 1KELH 3V0VA 3KXFE 4GG6A 3OG4B 2NXZD 3ISRA 3LQAL 3CVHH 4FFWC 2NPLX 4NNPL 2CR3A 1MCCA 1XD0A 1YYCA 3NJNA 4I13B 1TOXA 4JPIA 1ZLSH 3PAZA 2EXWD 1NKOA 1J11A 1HHHB 1QNZH 1EUUA 1GPOL 2J6EH 3D25B 3HJ0A 2XTJC 4MNHB 4XVSH 1MEXH 3VD3A 3BEWA 3S5LB 3UZVB 3WUWB 1U91A 4DVBA 4RAHA 2DYPB 2EIBA 2V9UA 2L7EA 4WHYH 4QXTB 1CR9H 4NQVA 4NXSA 1BEXA 3IFLL 5FYJD 3CFNA 3QWNA 5TE6H 3UTTA 2FEEL 3QDGA 3X17A 4JG0L 4P5RA 5AZEL 4BCYA 5ICYA 1HH6A 1IGYB 3QSKB 1AOZA 1PKQE 3KH3A 2LU5A 3S36L 4BZ2L 5CEZD 3U0PB 1SN0A 4NT6B 4RA0C 3SDDB 2V2XB 4MXWL 4LHUD 5F1KC 2HA1A 4F3FB 1KYDA 2DL2A 3HZVA 3NEXA 4PG9B 6PAZA 2DMBA 4UQCA 2HX8A 2VUYA 4R5TA 5SWZB 1T1XA 4QRRA 4I88A 5AVUB 3RWHA 1OAYL 3LEYL 3FF8A 4Z7QF 1YN6A 4LHJB 5GRXG 3BN3B 1G7MB 5BOZG 3TEWA 1MF2H 5E03A 2ZX5A 5FHBH 2OSLA 4KJPC 3VFTA 1T0NA 4HHWA 4ZO6A 3BUPA 4P5MA 4ZS7H 1KXVC 5KYXB 5IVXE 1MJ7L 2D7PA 2LU7A 4LVEA 1UYWL 4Z5RB 3HG1D 4M61A 2VLKE 4KZEH 2WSKA 2YMXL 3DUUB 1MH5A 1H8SA 5FB8A 1A4AA 5TE4L 4YSAA 3WBDA 2YXFA 2H1LM 1IBYA 1UM6H 4J3BA 4R7LA 3TEXA 4ZMVA 2F54E 1BPVA 3MRBA 5IG7A 1UM5H 2CWRA 2QKSA 3VI3E 1RIHH 3ZPDA 1GGUA 4GEJA 1TKWB 1Z9MA 1DN2A 2FK9A 3G6DL 3CVCA 3S4SG 1IJ9A 4BA0A 2EXYC 5H2BB 4EAEA 1NCAH 4X0KA 5KVEH 5EU7E 3CFIC 1MUJA 4K7FB 1QHPA 4WTXA 3F85A 1UEYA 3NRQA 1X9QA 1GS8A 5BRPA 4YSQA 4RNRA 4OI7A 1CLOL 2P46B 1H3VA 2XTSA 1KBGH 4E5XA 2I07A 2Y3NA 5D5MA 3OXSA 2H32H 3MKKA 4KQ0A 4KK8D 1UACL 1OCWH 4GRLA 3U6XA 4KGLA 1P2CA 1OD7A 1TJXA 1A22B 4BRJA 5DWPA 4AC2A 3MRPA 1J5OL 3CCHB 4TUJA 3P0GB 2WJ7A 4RMQA 5ISZE 5C0BB 5T3ZD 4EI5D 2Y7SA 1GOFA 1XBDA 3MRJA 1FL6B 1O5PA 4JG9A 3CIQA 3HNSH 2XHNA 3D50A 4GW4B 2GSMB 4L29A 3V9CA 4M43H 3VDCA 1SLVA 4DP7X 3U1QA 5CUSH 1T1WB 3QG6B 3RB7A 5FM5M 5AVTB 4RGOH 4OVVA 3NRFA 4GAYA 3UH8A 1JZ4A 4ADIA 5F1OB 3ZMRA 1XIWD 4AYSA 3NCXA 5GRYA 3W0WD 2R4SL 1J5CA 2OBGA 2KPNA 4LLUA 3KHQA 5AWNH 2AJUL 3NFSH 1J7VR 1VZHA 2KT6A 1JZ7A 2A73B 1TFPA 4UOW1 3RWIB 4XPHL 3I74A 3H9SE 3ME0A 2WYIA 3S34H 4TOYH 1EHXA 4OCYH 2H3XC 3REWB 1F86A 3ETSA 3OX8B 2JJVA 3V4PH 1AD9B 5H37H 4GRMB 2YK1L 2IAAC 1JP5A 4GFTB 5FYKE 4ZW6A 2CNZA 5DJXA 2FX9L 2VNCA 3D9AL 3MO1B 1WYJA 3DX6B 3QCUL 3QJZA 2YUZA 2FATH 4BWUA 1Q4NX 4ZUSA 4XO8A 2KHAA 1WTGT 2X6AA 3BPOC 4P99A 2EYTA 4HXBH 3BWAA 3HS0A 3SDXF 5J11B 4S0HA 4HUVA 3MA9H 1NFDA 1Q72L 1Q8MA 3I02B 4ENZA 3QQ3B 4HT1H 1IARB 3MHZA 4NQXA 4AJ0A 2J55A 2Q0ZX 1CIUA 4PJBF 5DEGB 4LCUB 2Y06L 4TQEL 2A74A 2G4EA 3CHRA 2K3HA 1XH3B 4R4BB 2HPTA 4Q56A 1MVYA 5CCGE 4MA1B 3L2LA 4TQEH 2K9FB 3BQUA 3C2AL 3DTXB 5IB3A 2R69L 3OZLA 4DOHB 3O11A 3LKOB 2KMWA 1UZ8B 3QG7L 3FU3A 5DC9B 1EERB 4BQ8A 4G6JL 4GAFB 3LIZH 3N1FC 4GAYB 2XWZA 3MRKB 4U6TA 1HCZA 4F7MB 4OUUA 3ULVF 3CVHL 1DBKH 4HGKC 1QR1B 3Q48A 4EXKA 5F1NB 1A6VH 3CLFH 1KFAH 1AGBB 2EAEA 2DLTA 2R2BA 1DSYA 1H3PH 4LLYB 4FX5A 4BSWA 2ZOKB 1DLHA 3TZVC 4AG4H 4DZBB 5J1AB 4PGCA 3VJ6A 1FYTB 2WSPA 4ESKA 1AP2A 3BP7A 4JPKL 1TETH 4MAYA 2C1PA 1QSFB 5IVZB 3SJVB 4WNQA 2XFXB 3RAJL 5HD8D 4M8UA 1OP3H 3CSYB 1VCAA 5DJ0B 4N0UA 3OJDA 4PJXB 4HLEA 5IJDC 1JPFB 2QTEA 2ZUSA 3O8XA 4P8QA 3OAZK 5EU6E 1BMZA 1I8MB 3WKPA 1TPXC 2ZPKH 4HWEL 1TTRA 3MLUH 1NWOA 5KUMA 1IQWH 3FRUA 1ERNA 4UT6A 5B4MD 5C09A 5F7NC 2GVYA 3K91A 3V5KB 4MJID 4BH7A 2VLRD 1CPUA 3T3ME 4UDTB 5I1DA 2BHYA 4RISL 3QARA 2E7CA 5LNEA 4KUZH 2AC0A 1WISA 2JCCE 4N2FA 5IM7A 3WS3A 2HFTA 3WNOA 1GGYA 1BQ5A 1LO4L 1WWCA 2HTKD 2AFNA 4ZNEA 3GHPA 4J4PD 4OF6A 1T2QL 1MCKA 3K0YA 1IO4C 3GSVB 5C2BH 3K3QA 4JPWH 1S5IL 5CAYB 1MVFA 3W3BA 3GUTA 4LQ1A 3BKJH 2CPUA 4OFYD 1ICTA 3OQRA 1X5KA 4Q8BA 4DW2L 4ACTA 1MCRA 2DTSA 4IGBA 3LNHA 1J0YA 1G7QA 1HSBA 3P3RA 3UJTL 5JHLA 1I4FB 1IGIL 3HE7B 4I85A 4WUUB 1ZRUA 3MV11 3AS3A 3JBG7 4ZOAA 4BSJA 4HCGA 1M9WA 5EEUA 5HI5D 3A3YB 1LE5B 3ATEA 2Y1VA 1TMQA 1E9PB 4ZX3A 5EA0L 4PMFA 4H7VA 1MPAL 4WZ9A 2PNDA 3X1GA 3OR7A 1YCSA 3L5JA 1YPZB 3B6SB 4ETYA 3SEPA 1CLOH 5T5FL 4FCAA 1CFVL 3VUAA 3V0WL 3AZUA 3U7WL 4NS0A 3ETBF 3QJHA 4OQTA 1J0KA 3S9DB 1EBPA 2DTML 3W81A 4O2EA 4D2NA 1G7LB 3EFDL 3MFFB 2C9RA 2VR4A 3TO2A 3S88H 4Q9QH 5FUCC 4QRPA 3L1GA 3U9UB 1GRWA 3UGXA 1JMZA 1PIFA 2ROXA 1A6WL 1G1YA 3L4WA 2WGNB 3H8NA 4H8UA 4IIQC 1YMME 4AIZA 4JO2L 1PEZA 1X5ZA 4U3CA 3BMVA 3G5XB 5CEYB 1Q94A 5CEXA 1DCLA 2MKWA 4N8UA 5F7WC 1BWMA 3OD3A 2VISB 4NERA 5MHSD 3UP1A 2ZWSA 1LVEA 1A7PL 4OJDH 3EJTA 3JV6A 5E2TL 4FA6A 5HDBB 1MHPL 1F56A 4PJ5A 5L2KA 3LRMA 4JANA 4PY7A 5H4YA 1GGIL 3U83A 1PX3A 1U8NA 3E80A 4P2RE 2C34A 2C3VA 5C0JA 5G5DA 2QGEA 1KGYE 3LNDA 5JIIA 4HK3J 4AG4L 1YPZF 5IQLA 5CD3A 4PR5A 4Q14A 5D4JA 4UOZA 2X0UA 5D7IB 2X5PA 4LL1A 1KZQA 2A6DB 4XP5L 3F12A 3QJQB 3E6HA 3EO0B 3TH3T 4LZKA 4BELD 5A7BA 2NY6D 3GMMA 3VD7A 5DJAB 1JGVL 1O6SA 5AYUL 4XCNB 3E6FA 1P4IL 1XB6A 2X4TB 1MJUL 2YGPA 3DX6A 4GMSL 4LOFA 3MNZB 5HDWA 4FFTA 4M1GL 4O51A 3RJQB 4OVUA 1E4JA 2BS71 4PJGB 2R4RH 2D2OA 2AQNA 2BVPA 3FU8A 4FD0A 1II4E 3DTDA 1S7TB 2WYZA 3GSQA 1QLFB 4G6MH 4HV8B 4QAMB 5HJGA 4WHTA 3QC6X 1T22B 2F8OA 1EZVY 2A7BA 3M8OH 1ADQH 2PO6B 5D70H 5DRNA 1N68A 4R4BA 4X6EB 3VXMA 2AAAA 1BQRA 4OLZL 2YEZB 4FG6D 4P3DB 1BM3H 5EZOL 2KQNA 4TLTA 1BZDA 3DTUB 2XG4A 2YPLE 2A1WL 4MRBA 4CKVX 3QZWB 1K8DB 4DHLA 3PWPA 4YS4A 3HG5A 4P4KA 1VFAA 4NX0A 3WU1A 3GT6A 3ZHLA 4HSQA 4CSTA 3UYOD 4ZMAT 2OA9A 1ZVYA 1QSED 2A6JA 3MRFA 2E56A 4OB5L 4FE9A 2G3ZA 4MSWA 1E5ZA 3TP4A 3SDYL 1MKFA 5SX4I 1KYOK 3F62A 5FOBA 5C0CE 4MYPA 4YIQB 2KKQA 4L3CB 4HKZA 1EDYA 4Y0GA 4LEOA 2O5XL 1BG1A 3CNKA 4ELDA 5CD3B 3PP4H 2LHAA 2IH9A 3ZGHA 5HHQA 3BRDA 1FZJA 1RSYA 1ZT7B 4FC3E 3BESR 1A25A 3MRRA 1J1PL 1J0IA 4ZD3H 3MQIA 1EAPA 3FQUB 2VDPL 4ETQA 2GJ6B 1CLZL 2ZAHA 4U4BA 4FFYL 4IBVA 4HGMA 5KBMA 1P6WA 2RD0A 5GISL 1IGMH 3U1SL 3ZKQD 1D7BA 1KLUB 1EZSA 1P7HL 1SYSB 3CFDA 1CTOA 3IJEA 3REVB 1D5XA 1ZIBA 2BVTA 4ZTPL 2WQAA 5G55A 1IC0A 3KPSA 1SBSL 4GMTH 1JVOA 3MLRH 1UXWA 2DMGA 4JKPL 5TDPA 3QPKA 5L88L 4FJ6A 2WVTA 3T2QA 4QCIA 5JO5A 2AABH 3MLPA 1JHKL 4Y2NA 3FQRA 5GRUH 5KSBE 3EW3B 1DDHA 5AB2A 4ELKA 1HCVA 4F8NA 3L7EA 4JM0A 1YUHB 4MNQE 3L3GB 1CF8L 3WNKA 2CCVA 3VFGH 4YXLH 4HG4J 1HT6A 25C8H 2Q6WB 5HPMA 1BYNA 4WWKC 1QSFD 2ZYSA 3LHPL 4HFUH 4AMKH 1JF1B 4UILL 3GMRA 3U4EB 2YD6A 4OCRL 3K5SA 3EHBB 3QUYD 4O4YH 4TVUA 5EFIB 5JIKA 3BD5A 1SFDA 4XWGH 1PYWB 4IRJC 2VJ8A 5EC1B 3VE0A 1UA7A 1N12A 3B3IB 3CSTA 1LXMA 3F7RA 5E8PB 4GOSA 1Z2KA 1KPVB 3KDMA 5LGYA 3IDYB 5EO9B 2YPVL 1GGTA 2HVKA 5JOFA 1B4LA 5T1MA 4MNGE 4GKLA 3SPJA 4HJEA 4PRBB 1W0WB 2VDNB 3RFRA 3HFML 4F20A 4YVNA 5EU3B 3UTZB 1WWBX 4OJFH 4QKTA 5EIIA 2JQZA 3QPXL 3FQXB 3BIKA 2E9JA 3D51A 4W6WB 5KOVC 1G1KA 1FWXA 2D3NA 3WN5A 2EH8L 4MCZB 4Y7OC 5FGBC 5K59E 1AHWA 4JGUA 2BVYA 1YEDB 4AKQA 3SYQA 1CGUA 2JIXA 3WO3B 2DIBA 3DBXA 1CDIA 3UJJH 1F42A 4A55A 3MO1A 4FHBD 4G9DA 4JFDE 1BVOA 1NCCH 1JPEA 1WGVA 4NIYE 1PQZB 5EEZA 1DQLL 1DVZA 1LEIB 3NAAH 3QWQB 5IT2L 1IBFA 2BW4A 4IKLA 4B53A 3WSQH 3FRPG 3TNNB 2OM5A 5BV7C 2IBZX 5C0DB 3FSAA 4WFFD 3X12A 5E70A 3LV3A 3LN5B 1BVLA 5KVFH 4HH9A 4QRAA 3ISWA 4Y5XC 4LAQL 5ERWA 4NQXB 2Q7NA 3QHTC 3Q1SH 1F6AA 1DN0A 3BVTA 3V0EA 4ES9A 1GMIA 2FSDA 3BHBB 3OB0K 4YHLH 5F88B 4DEPB 4D8PA 4YN3A 3OJDB 5IHZA 3BJ91 2R4SH 1JV2B 3MV8D 3SCMD 4IJ3B 3PP4L 1UJ3C 5I9QB 4QRQB 4A6YH 2WXQA 2HRPL 3W39A 1U58A 3AXIA 1D5ZB 1M42A 2C3GA 5B3JF 2NMSA 2F5AL 2IANB 3PAYA 4XAWH 2VW6A 2ZF8A 2YQGA 3PJNA 2H1XA 1V7MH 2AW2A 4DEWA 1AJ7L 4FS0A 2F08A 2W9DH 4QJ5B 2NR6C 3JTSA 3QZBA 4NSKA 3GMMB 4BSVA 1AO7B 1CL7I 4QO1B 1GZQB 1P7KA 1FORL 1DVXA 2ALAA 2BSRB 3FN0L 1A0QL 4HKBB 1WZMA 1QFOA 4F7CB 4K8RL 4M5SA 4TPRH 2EIZB 2HCZX 5TPWL 4OZGA 2PPEA 1ZA3B 5B1JC 4Z7VE 1TENA 2E8YA 1H5BC 3OXSB 5KSAA 2AJYH 4YAQA 3I9PA 2FB4L 3DKHA 5LQBL 1DVFC 5EULV 2O61B 1FPTH 1RFDL 5D7IF 2D0HA 1SJMA 2EDXA 5DUBB 1IUZA 2WP3O 3W5NA 3K71B 4PJEF 3UEQA 1W9XA 1CGSH 4RGMC 5IR1A 1PDKA 4R4ND 1NDGB 1YJDH 5GGVH 3VXMB 2VJ0A 2Z1PA 1HC1A 1O0VA 2JB6B 4PRNA 1XXDC 2FQEA 3NQIA 4X6FB 1U8HB 4Z7QB 3MV9B 2YMOA 1MW3A 5D72H 1BVLB 2FQDA 3NDYE 3ZN6A 3EUDA 5A3ID 2N1TE 3HUJE 1HQRB 5ICZA 3HCVB 3ETBJ 2G3XA 1LEKB 4NQCD 5IM7B 2EE0A 1A14L 3FK3A 1OLLA 4GPVA 3T08A 4FQ2L 2ISDA 3O3UN 2XVKA 5SWSA 5ESAA 2AK4E 3MRGB 1UA6L 3Q2NA 3UG5A 3QI9C 5DC4B 2G5UA 3SGDH 1P6AB 4MJIA 3S35H 3LZPA 2GJZB 4J3OD 3MI6A 5DF0A 2QHLA 1WG3A 3STLB 5LGJB 5KBDA 3ZL2A 3EFFB 1EZLA 1KY7A 1PJ9A 1RXLA 1DVYA 3VXUA 1XR9A 2DQJH 1FIEA 4I0PA 3QEUA 2X2IA 4TLSA 1AGEA 3OKMA 4C58B 1KTLB 2Z35B 2BSCA 2EECA 2PN5A 3RUGF 4YXKL 5GZND 5J1SC 1RPQA 2NX5D 1LWJA 1NCDH 3P9LA 1H8NA 1OT2A 2Q7AA 1B4RA 1I3VA 3DO7A 2X1XR 3K2UL 2ZPKL 5DMYA 3RX9A 1T3FB 2ZXBA 2ADGB 2HT3D 4AW4A 4L8DA 1IBDA 3Q9QA 4CBPA 4EI5C 4L8CA 4FHJA 5IBTH 5T33L 5H35A 1N7ML 3FTXA 3GLAA 3S5YA 5BS0D 2R15A 2X10A 4NIKB 5A3IC 2BZCA 1H8LA 4YDLB 1DBJH 3L17A 5CP7A 3SDAA 1ZLSL 1F3JB 1MI5B 2O5NA 1IMHC 3QE5A 4P2OD 1SQMA 4C55A 2YAFA 1RZPA 2YKKA 1M7XA 2VDKH 5F9OL 3DX7A 4DO4A 2G0KA 5ETUB 4PEEA 3M1BB 4AT6A 5K69A 1CD0A 3S3PA 5I23A 4YX2L 4U0RC 1G1OA 1AE6H 3DJZA 3VFWB 2WNXA 1U0QA 4PUBH 5BS0A 4ONGH 3FCSB 1YNKL 1DJXA 3C9NB 4JY6B 5EUOE 3VACA 4HIEB 3C60C 3NCCB 2E7LC 1UA3A 3LKRB 2ZCKL 2XUWA 4GXUM 5EO9A 2VZTA 3C60D 3F3HA 4YE4H 1JS4A 4JHUA 4GAJL 4UB0H 3SPIA 4ZK8A 2JK5B 4WFFE 3O4LE 4UTAH 2FJSA 4KNSA 1HI6A 4XO9A 4PW3A 3P1VA 4BSWB 3IFPB 3QUMB 2Q8AH 5C9KA 5IBLD 4GW4A 5FC9A 3FT2B 3BGMB 1NBYB 3BP7B 4LSVL 4OAWB 3VSVA 4ELME 3M17B 2Y6SC 1MQKH 3CUPA 1BFTA 5E00B 3V6ZA 4EBQH 3BZFA 4RH4A 3KWWB 4IW4C 4KJPD 2KH2B 4OF3A 5DZVA 3BVNB 1KF9B 3NSXA 4XCNA 4MS8C 3NGBC 4XH2B 3TV8A 4ZQTA 3FFDA 1YAZA 2DEWX 4NRYB 2ZG3A 3VFRB 1T6VN 5IOPA 3NPSC 3IDMB 5DD3L 1I3RA 4RZCA 1T21A 3RWIA 4MAUL 1QBML 2QPEB 4E0RB 5GGRY 3EO1B 4CSPA 5JHAA 3WHXA 3D87B 3FB6A 3GMPA 3L5WB 1KCWA 3C8KA 4X2UA 3DX3A 4CILA 3ARWA 4GRLC 5KSBF 4K23H 5F89A 3QIBB 4NP4H 5HHVH 4HIHA 4X6EA 4YDIH 1N6QL 1HNYA 1FGNL 1IJNA 1XTLA 2BNQE 4AOFA 3IVKA 2V2XA 2YOCA 3UTTE 5IHUH 4AZ8B 3FB8B 1TEYA 3L3JA 5AZ2L 1IM3D 5KSUA 1LD9A 4PRHD 5BZWB 4WDIA 4AE0A 3HMWL 1TDQA 4X9GA 1KGUA 2G2PA 4FJZA 4WSJA 3VFWA 1NFDB 1MAMH 3ZKXC 1X9LA 4D3CL 5TDPB 2J1XA 4L1TA 4CMMA 2E4FA 3GDBA 3J8F7 1U4FA 4FULA 5CZXD 5FKAA 3SDXB 2EC8A 2NXZC 2J12B 1HHJA 4XCEB 2OTUB 2IPTL 3KYMA 3CZJA 4GIAA 1BMGA 4ZQKB 5A16A 2AMGA 1D5MA 1GC1L 1M6OB 3KPMB 8PAZA 3GYRA 5JW5B 1CDHA 3II2A 4W9ZA 5SWQA 3L3DA 4YAQB 3ASWA 4JFDD 5I74C 3TBVA 3OTTA 2RB8A 3F6JA 3ATFA 4RMRA 1RUQH 1NCGA 4WU7A 4Y1SA 3V0AC 5CCJA 5SWSD 5ICYB 4ABVA 5I19L 3MYJB 5EUKA 3O6LL 5EHFA 3L4VA 4PW4A 5H2BA 4ATTA 4PRAA 1AACA 3FO1B 5GRZA 2FO8A 2R2BB 4IRZL 1FRGL 5I6NA 5IOKA 4YEFA 4UM8A 2F68X 2W0KA 4D0BB 4XPHH 4FJYA 4R4FL 3PS6A 3W0WA 4JQVC 4KK5C 4LSQH 4X6DB 1UD4A 2CXKA 5DS1A 1LLAA 5IB1A 1T7VA 1X6LA 3EOTL 5CSGA 2Z8VC 1UGNA 2X44D 2XPZA 4ZNEE 1YEDA 1T4KB 4ORGA 2FGZA 1ND0B 3W11D 2X4NB 3SDCA 2VXQH 4MDRA 1QAWA 1X44A 2WOBA 1VZIA 3N50A 1R3HA 1NDMA 4LF3A 2QSVA 3SPHA 2E59A 4JDEB 2E7LA 3SCMA 4GBXA 4ENEC 4OCSL 3S35L 2UWEE 3NEOA 3TA3D 2AJUH 2FNBA 3NFSL 5JLZA 2CJUL 5IVNA 4DK6A 2OXGA 4ZDHA 4LPYA 1NKRA 4I3RL 5C0AB 1JZ6A 1VEMA 3OKEA 4N5EC 4ONHB 1BQLH 1DSFH 4U6HB 3DYOA 1B0GA 1E0OB 4HIXH 4H1LA 3CAFA 1WZLA 3QISA 4BBWA 3MJ9L 4PAZA 3SE9H 1H0DB 1TVHA 2M26A 4H8QA 1VAHA 2WWMC 4WY7H 3GI9H 4AEHH 4YDLC 5B38B 1LILA 3FB7B 2ITCB 4G5ZH 1BEYH 2DAVA 5KANI 1OPGH 1H6EA 3HNSL 4GXVH 3GKWL 5I18H 3MACH 3PNWA 3F2LA 4GKSA 2BFGA 1TTFA 4RMVA 1OSEA 2V9RA 2CM6A 3QQNA 5I6XB 1GHFL 5D6CB 4TNWK 2PYFB 3CCHA 1RZKL 3N41F 1HZHL 5D7IE 3UC0H 3W9DB 4FQLH 4XNDA 2AXFB 3TBBA 2FD6H 2PMZA 5E08H 4FFWD 2B0SL 3QUZA 4PD4K 4JRXD 3FUJA 3P30L 1MFBH 4LMQI 1YLBB 32C2B 4LARL 4AENA 2APWA 4NKIH 4PVLA 1JPSH 1ROCA 3K2KA 3QFDB 4TUOB 5L2KE 1CDJA 3WFCL 2DJUA 3FCSA 3UBGA 1NC2B 3G7TA 4B9ZA 2ZX9A 1KPUB 4UTBL 4IYKA 3H55A 3P3TA 4CGTA 3W38A 1IE5A 4ZS6C 5JORB 1SY6L 3PL6C 4TSBH 2WLZA 1G7LA 3GWJA 3MFFA 3JWOH 3O3EB 3VSQA 4A39A 3VA6A 1MY7A 3LEYH 1MY5A 1C16B 5A6MA 3MX0B 1XGUA 3THML 1JPGB 3C6LA 4BZ1H 2FR4B 1HZKA 3QZOA 3QJVB 3RI5K 4FYQA 5JNYA 5E00A 3V6ZB 3AS2A 4G8FB 4JFSA 1EXGA 5F8RC 1C5DA 2C7UB 4PGEB 1IFHH 4ISVA 1PLBA 1XCQB 3JXAA 3V4VH 5I1KL 1R6VA 4RLDA 4KKAC 1MRDL 3U2SB 2WN3A 4G83A 2P8PA 5C2BL 1WEJH 1KCVH 1E5UI 1WFUA 4HHAA 3OJVC 4MMZC 2DWEB 2WCPA 4ILDA 4LGPB 3WUWG 4MAZA 2PW2B 3G6JE 2ITDA 1Y07A 3QUXC 3NSYA 3BO8A 3CSFA 2IMNA 2NY1C 3KCPB 1OAUH 3MBWA 4GEIA 2AXGA 1Z5LA 5EIQA 4RFNB 3DOHA 5ABAA 1TTCA 3LN9A 5LLIC 4GRWE 2IGTA 1E4HA 3WDIA 4WEBH 4NYLA 4Y9CA 4LLQA 3HN5A 1U3JA 1IAOA 3QGVA 1EZUA 1OF2B 3D4GA 3IFNL 4XZ4A 4PWEA 4G8IB 3HBZA 3CD4A 2FWUA 3QDJD 4QLWA 3T3MB 1CLZH 4JRXA 3R06B 5I75B 4XRCA 4NJAH 3BAIA 3RLSA 3ZLQC 5LB1A 2VH5H 1MFNA 1LEKA 1ITCA 2DKUA 4M6NH 4WI6A 3WLBA 1AY1H 3WEMA 4HPYL 4AIEA 2BOBA 3IYLW 3VXOA 2H8PA 3TBTA 4PV8A 1E2VA 2UYLB 3LNIA 4MQXC 5K9KA 5KSBB 2FLBT 1RUKL 2JI1A 3O2VH 3IS0X 4IRSD 2PR9A 1FZOA 4JRLA 4L4VB 3VWJB 2VL5A 4AZUA 4BKSC 2YIHA 4FG6C 4OF8A 1SDAB 5E6ZA 3CSGA 3QDJB 2H47C 4OIIL 5C9JB 3UZQA 5F1IA 2X9XA 2OYKA 2AABL 1T1YA 2CR0A 5GS2D 4JN1H 4BZ1A 4F7TB 3L1FA 8FABA 5FM5O 3DV4B 3T0EA 3MFGB 4LLUB 2MCG1 5CD5D 2EUZA 4Z1PA 5CMAB 1TJGH 4KC3B 4XBGB 5E6IB 1CF8H 5FA4B 1I82A 4NC0B 1RLBA 2Z4TA 3OKKB 3WUWA 2O1AA 5DGRA 1J5DA 4Q58C 5CZXC 1LO0H 1N64H 3VG0H 3NQKA 3VXSA 2Q5BA 1Q0YH 2V8LA 4G7RB 1BSIA 4PRIA 4LKXB 5DLMH 4U6YA 3FQ1A 1TFHA 1U8MA 2FATL 4ADJA 5FYKU 1W72L 5I1CL 3EAKA 5MP6H 4O9HH 2NY6C 3P11L 1ZHKA 2QLYA 3AT9A 5JIPA 4HC1H 2EDHA 4DSYA 3MLSL 4HYTB 2NYKA 4CN6A 2FQFA 1KLUA 2VMFA 4MCNA 4UIMA 2JH2A 2ENYA 1MCIA 3Q9PA 1RK7A 3WE6B 2V8MA 1KBGL 5IP4A 2ZTBA 5CEYA 5CEXB 5E5MA 5I0WA 4YSEA 1ZS8A 5IJVA 3ECBA 1EPFA 2ZWNA 1WD9A 1Z9SA 3MLWL 1YG9A 4KPHL 4LBAA 3EYSL 1HWHB 2DH2A 2NX5E 3T3PE 4YOKA 4CVXA 3MRQA 3CFBA 2HTLD 3AG2B 2XQBH 1NUNB 1ORQA 4OUOA 3QJTB 4MS8D 4UZUA 4A67A 4WKZB 2IH1B 3ZL1A 1AD0B 4MKMA 4FKKA 4NQEE 2DQGH 1R9FA 2XBDA 1VZGA 1OAQH 1MREH 2ADIB 5AAMC 4JZJA 3ZTJH 4NZTH 1OIOA 3NZHH 1G9HA 3OPZH 4KO5A 3CDGA 2DLFL 4RESB 5AW2B 4O02B 2LAAA 2XTLA 1ETA1 4U2YA 5I8OH 2DLFH 3L81A 3OQ3B 2AXFA 3C12A 5IBLC 1OP4A 1S9YB 1AQHA 2HVJB 2D3JA 4ZS7L 3DV4A 3FS9A 3T0EB 1OPOA 2C1OA 1QUNB 4FQXD 3P30H 2DQHH 1INEL 1Y6NR 2R1XB 4FDWA 4P59H 1UQSA 4C57C 4YFLI 4HUCA 1M1XB 3N44F 3TBYB 3V7AE 3GRWL 5BJTA 1NGQH 2CKBA 3V55A 5I0VA 3JVFC 3HPLB 2Q20A 4JHAL 4QNPF 5C71A 4Z3EA 4WNQB 5D1ZD 4RSVA 4EMZA 3II3A 2C9AA 1JWSB 4ZFOB 4JFUA 1U8OA 4JANB 3CZGA 4PY7B 1WT5C 1WPCA 4JN2A 4E41D 3IAQA 1FNEB 2NY0B 4RVBA 3SDYH 5F72S 5IF0B 3H7BB 5JA9A 2D0FA 4N25A 4KXDA 3RWFB 2AJZB 2VN3A 1HOEA 3T6WA 3IU3B 2QADB 2XRAL 2OXHB 1BZ9B 1AZNA 1JGUH 1NOFA 3LXCA 2BFVH 3GSUB 4OQTL 3U2JA 1FF5A 5BVPL 1BQHG 4JO3L 3EO0A 4LASH 2AQTA 1DVFA 4PGZA 2D31A 4Z3FA 3AXLA 2FB4H 2OMZA 4JW3A 4N5UA 1D6VH 2DJ4A 5IHHA 1KT2A 3WIFA 1GYWA 1ND0A 4DGVL 1A8ZA 3QAZB 5IFJB 5CP3A 2NR6A 3TA3B 2J20A 1FO0A 2W0FA 5DSCA 4D9RE 3V6OA 1L9NA 4X7DC 3LOWA 2X4OA 1HQ4A 2DIJA 4DKAA 2FYYA 3WNNA 2V5SA 5FGCB 2YPKA 4XN4A 2BNRE 4NQCA 4N86A 1G9MC 3T6XA 3BH8A 5ABDE 1HAWA 5CKAA 5DJZB 2N0MA 2YA2A 2IAND 3CDZB 4IU3A 3SBWC 3FQUA 4TKWA 1UZ6E 3WJJC 1AGCA 3B9KB 4WUUE 4K5OA 5B22A 1E9QB 3G6JB 4M7KH 2IALA 3T4YA 1RJLA 3KNBB 3GRBA 3PHSA 3MV8B 4G42A 5ADPH 2AERT 5ETUA 1ED3A 5J3HC 1BGXL 4YHKH 4PFEA 1IGTA 4N6RB 2E6QA 1HN1A 1Z3RA 3CMGA 2WKOF 3PWLB 5DHVB 2Y23A 1HILB 1ZV5A 3CIAA 3K1DA 2WZPA 4RMSA 4B9KC 4G7QB 1BBDH 4PLOB 4WK4B 4YC2C 4DEPC 3QXUA 2OKMA 4ZW8A 1JG9A 4AJYV 2B9BA 1GJIA 3FCBA 3VH8G 3II1A 3OWEA 5L4IA 1BW8A 2ZWLT 5EUOB 3IU3A 3MGTA 4FNLH 1NM9A 2C3WA 5FOJA 2VL5B 1CL7H 2OXGB 4UANA 3PDGA 5E6IC 4ZDHB 4BKTC 3NIFE 2MQCA 1K8IA 4Y5VA 1NWPA 4UAHA 5HI4C 3G5XA 1Z66A 4PB9L 4XNXH 1ZHLB 1RUAL 1T0MA 2XXGA 2R8SH 3QWOA 1HXKA 1LM8V 1T2JA 5LDSA 2WV3A 4AIOA 3TBSA 3EH4B 2CQVA 4MWFB 4EUPH 1MHHB 4N2CA 1FYHB 2BH0A 4AI7A 3W9EB 1MFBL 1BDYA 4B3VA 4BQ6A 3ZDXF 4X42A 1FYTE 1MVUA 3D09A 1TCMA 1MNUH 3KXFB 3MRBB 5IG7B 2CLRB 3U82B 2B15A 3OM3B 2IFFH 4JO5A 3B37A 1SLXA 2AGJH 3VGBA 1AE6L 3PE9A 4WFGD 4M9PA 4XO4A 1BJ1H 2JIXB 3WN6A 4OLYH 1DJGA 2BLFA 3LZFH 3RHWF 5BW7C 2YKLL 5C07E 4HPHA 2ESVD 4K3DL 4X4XA 4HXBL 2OAAA 3RVWD 4AZ8A 4JVWA 4WNJA 4O9HL 4XHJC 5F97E 3DGDA 3D06A 1ZLWH 1WT5A 4EOWH 3UBFA 5JQ6H 4Y2OA 1OOAA 3F7KA 5T3XD 1U8JA 1UWFA 3MCYA 1ZGLA 1NUDA 1HK6A 3QHFL 5CJXA 2EKJA 2FT6A 2EDEA 2Z8WC 1GC1C 1KPVA 1OKEA 4OIBA 2DQTL 5T3ZE 3S0PA 1ZHNB 1EJOH 1FAIL 4PJDF 4QRFA 1V3KA 4ZXBB 1U8LA 2FH8A 3BE1L 5I0ZA 1D9KA 1NFIA 3FTZA 1KDIA 2VLKA 2XTJD 5KVGH 3OMAB 4LLMB 4PJHA 1LK2B 3RU8L 4DGYL 2F7OA 3WG7B 3NJIA 5ESQB 2ZP0T 5GJSL 4AUJA 4R0LA 2GJ6D 1PAMA 3HNVH 3OMZA 2ZKYA 3WTSA 3WAKA 2BOCA 3HNTH 5HI3C 2YFOA 3CDGB 2ATKB 5JW3H 3WD5L 1PGRB 1F4YL 3QR1A 2WVSA 2A38A 4HAKA 4PRHE 3OXRB 3TJHC 2R1YA 3HS8A 4GP5B 1E8WA 4JO8A 3T04D 4XHJD 1IKNA 3SKMB 3CQPA 3TT1L 4Z7NF 1UA6H 2WQSA 5I0XA 3QJUB 5E5LA 4F80A 1T4WA 2J71A 4GSDL 2ZKWA 1DBBH 2A73A 3UMNA 2VH5L 5BJTB 1UCBH 2CCLA 1J1XH 3QHZH 2PP8A 1LP9E 3ZDYF 5EU5B 4QHNA 3NIGF 1GCYA 1KTJA 4RBPH 1DDTA 1O7SA 2LVCA 2V2TA 3PWUB 3N91A 3QUYA 2CDFA 4JAMB 4JQIH 4JBSA 4R96A 5CSZB 5EOQL 5C8JB 2VSDA 1MAKA 1AKJB 1BXXA 3VWJC 3U48A 5B1KA 3SKJH 2X4RA 2EZ0C 3WN5C 1KB9J 5LGHH 3U9UA 3FU0A 1F8TL 4Y16C 5AUMA 1FZKB 3IETB 3S6CA 1H6TA 2PO6D 5FA4A 3QCTL 5CO1A 1TLKA 3LDBC 3FUEA 5I6OA 3DJRA 2VO5A 4G8IA 2IANE 3B9EA 2XU9A 5IREA 4RFEA 4MYWB 1I7TA 1QA9B 2CBMA 1LHZA 1RZQA 1ZV2A 1TVHB 3OF6A 5HYFA 3WNJA 3L7EB 1DL7L 1AQKH 1B4TA 1Q9LA 4LPUA 4PJ5B 4ADGA 5B8CC 4MD0B 3R1GH 1J05A 2DOCA 3QRGL 3KLQA 4MFHA 2YXMA 5CIPA 2ITCA 3SYAA 2ICWI 3SKNB 3VWJA 4WW1B 4WDIB 4S1RL 1S5HB 1R3KB 1WIOA 1L5GA 2NCEA 4NQDB 1PG7X 5DI8B 2NY6B 4JFXA 4PJAF 1GZPB 4HLJA 2F19H 2DQCH 1LK3H 1V54B 5A2IH 3R4DA 2BX5A 2DMKA 3MRLB 5EZLB 3N6YA 4OFQA 5LCVA 1YNTB 5I2IA 1MELA 1O7DE 2IOMA 1X7QB 3SQBA 5J3HD 3LY6A 1KCBA 4RIRB 4D9QD 3LPFA 4M48L 3COOA 3BPLB 5F3HA 1EBAA 1XX9C 3I3EA 4NNXA 5E9DD 4AL8H 4RETB 3OR6A 3VI3B 3UTSA 4GO6B 4U1KA 5ICXA 5DS8B 5B8CB 3V0JA 2JJTA 1CBJA 3BIKB 3VTAA 2GK2A 3APNA 3W2DL 3AY4C 1LNUB 1Z9PA 4XP6H 3ABLB 4LKXA 1EIBA 4TOYL 3QORB 5E4EC 5FM8A 4FLOA 2XWXA 4KDTA 4GRLB 2BVUA 3TIDB 1CZ8L 2AEPH 1JZFA 3T77A 4GKNB 2IV8A 4XNUH 3OMIB 5CN3A 4OW6A 5DJCB 4Y5YA 5T5FH 3FSOA 3OB0H 4Z7NE 2HAZA 3OZKA 1MLBA 4XNQA 4NO0B 4XVJH 3OHXC 3IDGB 1D9KC 2WYTA 3LPPA 4AQ1B 3MX0A 3BDXA 2R2EA 1XCTA 2BZ7A 4L4TB 1T20A 5KYWB 3D12B 1T1WA 3CVIL 3ARVA 4JO1L 5FHBL 2YJQA 3FKUS 4YDKH 5HYEA 3DROB 3CK0H 4LSSH 5FUCE 4D94A 5T1LD 1HU8A 4JM2A 5F1SA 1NIFA 4YE0A 2X1PA 1QTPA 4GJTB 4M62L 2X4NA 3KEHA 3QUYC 4GUPB 5TE7H 1F90L 2AF2A 2YMXH 4NENA 1NOLA 4YMPA 1HL5A 2PPFA 3M45A 4PJCA 3SGEI 3AQXA 3SCMB 5E2VH 5B1JA 4QRTB 3SIKA 3RWDA 3KPRA 4OGXL 5EPMB 1GZHC 1Y0LB 2B39A 3FU7B 4Y4HC 5TTRA 3TYFA 1QHQA 2CLZA 1MVUB 5E8OA 3WMPA 4HJTA 4Y4FD 2GY7B 1RSFA 2Q3AA 3JTSB 4JFWA 5I8KH 4WFHE 4V1DE 5LXGL 3HZYB 3MNWB 2B59A 5ILTL 3PGDA 5GJTL 2WWMD 1UH2A 1SJVA 1WFOA 1T1ZB 3SE3A 2N7BA 3WELA 3WO4C 1LDPL 3IJEB 2FZ3B 2E4TA 5ECGA 4C54A 1U95A 3NYKA 4JDTH 5B1CA 3ULVH 3KPQB 4P2QE 4J4PA 2CHZA 4Q6IC 1MAML 4JFOB 1LP9B 4HZ1A 4RISH 2VYRE 2VLRB 3O3AA 3TO4D 1AXSA 4ENED 4QD2E 1KCLA 3MJ9A 2XVLA 1EMTL 3RI5F 3W9DA 1I1AD 4HMEA 5JPNC 3UBXB 1MWAA 1KBKA 1PU0A 4YDJB 3VFMB 3DOSB 3HHSB 5DFWH 2GT9B 4PHXA 1OTUC 4R7NA 1WCBA 4QRPB 4NAQA 4DUWA 3P4MB 4FOMA 3ECVA 1FAIH 4HKXA 3DVGB 4KVCH 3PQYA 1KGXA 5IFHL 1P53A 2EDJA 4FXLA 2W81C 5EWIH 4A2LA 3RWHB 4WRLA 1GMEA 3JZ7A 5D55A 2P28B 4QXVA 1IBZA 3SJVD 4F1ZA 3O9WA 4XCCL 1HQRA 2VXUH 3MRKA 4F7MA 3BDYL 1OAXL 4JM2B 3FCTA 4I1RA 3ECWA 4P9HH 5FO9A 3FOLA 3GEWB 3EHBD 5TFSL 5JORA 4G6JH 3VSTA 3PQYD 5I1HH 4NUQA 1N3NA 4J2QA 1H8OA 1W0WA 1NOAA 1W6WA 4QXUL 3WNIA 5C0GB 1JNHB 1IFRA 3STZA 3ZRFC 1MCQA 2W9LA 4W9IC 1USQA 3BISA 4MB4A 4PRHA 1ADQA 4W1TA 4K5PA 5I6XC 3RGVD 4J8RA 3UAJD 2C1PB 4HUMB 2CBTA 3FB6B 4PS7A 5D2NC 3K81A 4FLQA 3BUBA 2Y1ZA 3N43B 3KYKH 4HS6B 2IH8A 3C09C 3D3VE 3IXTA 4WWPA 2FX7H 4GQPH 2HG0A 1LO5A 1FNGB 5FEBA 1ED3B 4M6OH 5LAXB 1A6ZA 1RUAH 5GGRB 4Y4KD 1FE8H 2A83B 5JUEH 4R8WL 5JIQA 1I7RB 1KXQA 2DI8A 1SDYA 2ICWA 1BOGB 1QEWB 2Y5EA 4F2ME 2DLGA 3KXFA 5ITBL 1FQ9C 5KSVB 1AO7E 1E6OH 3P9WB 3TVMA 3CC1A 2JF1A 2XN9A 4EJ1C 2FX8H 2VAAB 2VABA 4WUKH 5L8LB 3VFMA 3QZMA 1NGWA 4LSTL 5LBGA 3ZE0B 1JD7A 4D8PB 4NBZB 4QXGL 3FH5A 4P2RA 1AQMA 4HZLB 4IGBD 1FNSH 1ZSHA 1TNNA 4YL4A 1GOHA 1AXTL 5C07A 2A6KA 2WN2A 1RK1A 2RMNA 1T2XA 3GQFA 2WY3B 4EKXA 2MJWA 2EE9A 3VMPA 5DI8A 4K2UL 2Z4QB 4M7ZB 1ZVSB 2N7AA 1FHNA 4P5TC 1CFSB 1UURA 4YNYA 5ALBL 3Q1SL 3V4PL 1WH0A 5GQBA 1OB1B 3WKYA 2QL1A 5B3SB 3QK0A 5FHAL 5FLVA 3JWNC 4FRWA 1KENL 3KWXA 1XT5A 1NMAL 2C1OB 2MKLC 2OCCB 4HP5A 2NSMA 1XSKA 2UVEA 1I1AC 3F65A 3VXQA 4R84A 1XQ4A 3SYCA 4FA7B 4I18B 3P77A 4F7EB 1A1MB 3LZOA 2F58H 4JFDA 1H6UA 3IJ7A 4U1KB 5ICXB 1JWMA 4MBOA 5H94A 4AQ1C 4AXWB 4U3HA 2HLAB 4PREB 5DD1H 1B2WH 1PSKL 3OX8A 3B9DA 1R47A 3TN0C 3I50H 1RURL 2YD3A 3RZCA 4BFKA 2BIIA 1NPJA 5F7YC 2MCMA 3KWWA 1UD5A 3MMEB 4PJCF 3Q44A 3B2PA 3F84A 5DZAA 1E6JL 1CVSC 1ZT1A 1N2RB 1JZEA 3LZNA 4PBDA 1J9CT 1KACB 1F4WH 2GBAA 4HFWB 4APQD 2VR8A 1Y7VA 5AEAA 1SLWA 1OCOB 3BZ4B 1ZE3C 3DRQA 1DQJB 1RIVL 4LSPL 2A2QT 3UG4A 2FBOJ 3LH9A 5CILL 3VFSB 4Q0XH 4G2AA 1YA5A 3DXAB 2VDMH 5SWZA 3IFOB 1I8AA 2WBJA 5HHME 4Z0BL 1DQQA 4B9IA 3BP4B 2C5DC 3H53A 4C56D 5CFAA 3JT2A 2KLRA 4EZLA 4C4UA 2AJSH 3IN2A 4KNTA 3U9PL 1JIBA 1JXJA 3NUKA 2WAQA 5D2NA 4HUUB 4LAQH 4LCUA 3FQ4A 1OF0A 5FGCE 1DLFL 5T3ZH 2J7LA 3HG2A 5DA4A 3ARFB 4XC3L 1AGDB 1E3ZA 1G7HA 1YMHA 5EBMB 1MHPH 5I30L 3KWTA 1EXUA 2DIAA 4WENB 2FR4A 1UYWH 2BOCB 2A4EA 5AW5B 4JFFB 4ZMYA 3BXNA 2XY1A 3MODL 2I9TB 1AYRA 3NSDA 1O5DT 2VZ3A 2XZZA 3E6HB 4N8VA 3ECBB 3BIBX 1D9KD 4R5XA 3ZDXB 4Y16B 4PJCE 3AS1A 4NPKA 1CXLA 1YEJH 1I85C 1ZLUK 5FO8A 1PX4A 3U36A 3DSFH 4M4RB 4D7PA 3VGGA 4CU7A 3ZGIA 2AK4A 3BKYH 3OVUB 2X4SA 5E94A 4K7PH 4XOCA 5BZDA 1KSRA 3OAYH 4PVNA 1RVFL 5DMIH 2GTZA 2E9IA 5HDBE 1JL8A 2HLAA 4GSUA 4QNPE 4XX1G 1S5HA 4ICXA 3HZKB 5JW4M 1V8HA 1AQKL 5BCAA 5DFVD 1Q0XL 3H1ZA 2WCSA 4GRWF 2OJZL 4JHWL 1CU4L 1J1PH 4WU7B 3L45A 3F7PC 5SWZD 1UXSB 1ET7A 3CJJA 1IEHA 4Y2DC 3UEZA 6CGTA 2GUOA 5TK4A 3KW8A 4ODBD 3ELQA 4Y5XB 1HHHA 3VWKA 1OGAA 4GUCA 4HH8A 2OR8A 3N2JA 2GBTA 3FOMA 4QJ4B 3EJYC 3NZUA 3ILPA 1RY7B 2GYSA 2W65A 4X8XA 4QTFA 1JGIA 4G8FA 3L1EA 5TDNB 1WA2X 3FT3A 4OLXL 4DQOL 1XZ0B 1L0PA 1NGYA 4B95C 2A6JB 3MRFB 1UT2A 1UM4L 4MBRA 1UJ3B 3IE4A 4MQSB 2AITA 12E8H 1BREA 1KIUB 4F9LC 5DVKA 2Z7WA 4Z7IA 3B7YA 3CN4A 3G04B 3U0PA 3BAWA 5JZ7C 2YPLB 2B5IB 2CO6A 1J48A 2WXFA 4XXDB 1NEZB 1DANU 3NACH 4JZOB 4GQZA 2PW2A 3BN9D 2XN9D 2I9TA 2BIHA 3E8UH 3ZYZA 1YEHL 4IS6A 5K9JH 2N56A 3FQ2A 5FWQA 3MLZH 1ZS2A 2DEYX 1JDDA 4U6XA 3RJOA 1QUPA 5C07D 3VCLB 4G9FB 2YN5A 1URZA 1GKOA 4XMKL 3T6VA 4NLAA 2BPBA 4X4XB 2FIKA 5D7JB 2CJTA 3LQMA 4LHUA 3QNYA 3WHE1 1O7VA 2NR6D 4OZGB 5L0QC 2EE6A 2GK0A 3WKQA 1JPTH 4XBEH 1G7PB 5A2KH 1JHLL 3EDEA 5C0IB 1SVZA 3ARGA 4QCIB 5JO5B 2Z0UA 3Q2LA 2VXVL 1NLBH 1BOYA 2ZCHH 3MA9L 3GSXA 5EBLA 4OIAA 4Y2DB 4EUPB 3OZ9L 3CZFB 4NJ9H 1M6UA 4HU2A 4Y8DC 5CJBA 3VG9C 5IKCA 2UYLA 5KYNA 1ASOA 1T5XB 4KI5D 2JB6A 4LCCB 1NCCL 2ZKMX 3Q6GL 3QO0A 3WL9A 4F2MA 4OGAC 1A3LH 5CWSA 2F8VA 5DD5L 4QRRB 5E6UB 4L4TA 4MTMA 4M7LL 3ZT7A 2DQFB 5EFIA 1Q94B 3PWVA 2XN9E 4HULB 4XNMB 5IB5A 4Z8FH 1T0OA 2VR6A 4HDIA 2XY2A 1VFOA 5TDNA 1HCFX 3FYEB 1ZDQA 3ALXA 3JTTA 2WWOA 1F2QA 1PD0A 3AT0A 3CLFL 1NICA 2F8IA 4I0KA 4QOKB 1FNHA 4X8JB 4PJCB 5AKTA 1WBZB 2P5WD 3DUUA 2IJ0C 1DVTA 5EPMA 2MQGA 1R4XA 1YMMB 3K6OA 1D7DA 3TCLA 3UROR 3L1OH 1DQKA 2Y36H 4XO3A 5J12C 4HCRL 4JDTL 3ULVL 3GBNH 3PP3K 1MCFA 3VGDA 2PCPB 4UNIA 4FAAB 3MREB 1KC5H 4LCWD 3NCBB 4X98B 4HT1L 4PI2A 1F4HA 4KHTH 1IVLA 2FECL 3GSNL 3WKML 2B1HL 4FZEH 2R0KH 3ZDZB 2P80D 2FWSA 1W0YT 4X0NA 4CAGA 4U33A 3LNEA 3O2DL 4W93A 3WDHA 3GHEH 4RNRB 4OZIE 3CMOL 3UO1H 5GGTL 2BVPB 1BXAA 4FFYA 4U2ZA 1JNHA 3L3KA 1JHKH 2F54B 3UZEA 1RZ8A 5ACLA 1PTZA 2FIRT 4HH9B 4PJ9C 5ERWB 1BXVA 3K6IA 5KS9E 3HAEB 1KCUL 3IK2A 5I71C 3UL4A 1SPDA 3BAYA 1NUGA 2EUWA 4LSSL 4L3ED 1LMIA 2GI7A 4JG1H 2Q3ZA 2NLJB 5JMRA 4CADB 4IJTA 4ZO7A 5LCVL 5TJWK 2KERA 1JZIA 4N2GA 3DVGA 2I5YL 4R2GB 4ZUSB 4XMPL 2V0AA 2OMXA 2JKWA 2IV9A 5F7AA 2MMXA 3UAAA 5EBWB 5TQ2L 4M5YL 5ADOL 3L5IA 2H6UA 1YEFH 4H1LB 3TZVA 1BQUA 2RA1A 4M5YH 1D5BB 5FV2A 5C0EA 2HN7A 5I66A 3BAEH 2OSWA 1V7NH 4PJ8A 2GC7C 3LNGA 4E41E 1CF1A 1LE9A 3SE3C 5HGBA 5FX3A 2ZG1A 2P5EA 4JPQA 3RUGA 1XMWA 1P4UA 2H0FA 3ZIMA 2WVVB 3IBEA 5CJQH 1WUNT 1L0XA 2F54D 2NDGA 2UWEA 3QAQA 3ZZQA 1EXHA 2XG5A 3ULVD 4WSGA 1GCFA 5GGSA 3TH2T 4E5XG 2DD8L 5D1XB 3F7YA 1NIAA 3FAWA 1FPTL 5IBUG 3W56A 1UACH 2ZYRA 2DD8H 3S4SB 1E7UA 4NN7C 2QV4A 4HS6A 5T3XE 2FX8L 2HSIA 5E4AA 2LU4A 3GKZA 4PIRF 2P9RA 3QUZB 4DAGH 2J72A 1RZ7L 2KS0A 3B2VH 1MCDA 5LAXA 2ARWA 2XWJA 3OKNA 2IPKB 4P5TB 1ID2A 1LO4H 2ZOKA 2ZZUT 5DFAA 5KUKA 4FEMA 3H9SA 5FAAA 4BYHA 5JHLL 3BI9X 1A9VA 1KG0A 1DQDL 1YMMD 3TH4T 1EFXA 4CVUA 2W91A 2O5ZL 2VRQA 1F3DJ 2OV0A 2R2HB 5D5MB 1Z5YD 5B39B 1ACZA 2G9HB 4XOBA 3UTPE 1JAEA 1YEIH 1HL9A 2H26A 3HC2A 4D0CA 4JFYA 3X13B 1AVAA 4IOIA 4O2CA 1EJ8A 3KLSA 3QIBA 4FI8A 5C7XH 2YRPA 1NIBA 4FTVB 5KAQF 4G7YH 4UTAL 3C08L 1KY6A 2ZUTA 1TXKA 1ZXQA 3OKDB 1WZ1H 3FU6A 4W4NA 4F15C 4UQ2B 4NKIL 1AZVA 3MGTB 3S2CA 3ZKND 5LGJA 4AL8L 3S48A 3K8KA 1NUFA 5D2LA 3NTCH 3ESPA 4NRXA 2H45A 1RURH 4MQ7A 3I84A 2EYRB 4GW5A 5FKAB 3C5SA 5CN2A 1PIGA 2JKSA 5TH2B 3PWJB 4CN1A 5A6IA 1B3IA 1LO2L 1XL4A 1F1DA 2DQIL 4QGYA 3FXIC 3VGAC 1P4IH 3IJYB 5DJ6B 4LDOB 2HUHA 5DVLA 3MCG1 5DO8A 2NXYD 2NQ3A 1F4XL 1MCEA 1OAQL 1A5FH 4ODSH 1MQ8A 2HFGH 5DQJB 3SDDD 4BDVB 1JWMB 4XE5B 1ZTXL 5H94B 3JWDH 3K6DA 3POHA 1QG3A 4R8WH 3RVTD 4N1CA 3BW9A 4NDMB 1RJZA 3FT9A 2GUYA 2X7LA 3VD9A 4AGQA 5LHDA 3S4SA 3K2UH 1DZ0A 4U49A 5DJ0A 2OMNA 5DDHA 3WTWA 4BFGA 2H2SD 3SY0A 4ZT1A 3U36B 2ADJB 1Y1UA 5AQ0A 4GI8A 1AC0A 3FZUC 2BWQA 1YNTF 2HJKA 2VLRE 1H9DA 3QFJD 2OP4H 5MENE 4LPXA 4CN4A 3JQOB 1KJ3L 3LZRA 1OY3B 3QG6A 5F9AC 1AS6A 1V05A 2PWGA 5DMKA 1A6PA 1ZLEA 4CC4A 4NQVB 3RG1C 3OHXB 5IFAH 5EOQH 1F13A 1CBVL 4XPTH 3JTTB 5GJTH 5HHXH 4BGLA 4MSWB 3GD1C 2B7DT 5D96B 3UGUA 1IBGH 4L3CA 3D7PA 5K9KB 4Q74A 3MA7A 4F58H 2VLKD 1X5AA 4PLJD 4UQ2A 1EJ6A 3BUTA 2B2XH 2NOYA 1DBBL 4EOWL 5EEWA 1U2HA 3QCUH 4MX7A 3QIWA 1MFVA 1XF2B 1CLYL 1MIEL 1HINL 4JPKH