1ADWA

Pseudoazurin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
123
structure length
123
Chain Sequence
b'ATHEVHMLNKGESGAMVFEPAFVRAEPGDVINFVPTDKSHNVEAIKEILPEGVESFKSKINESYTLTVTEPGLYGVKCTPHFGMGMVGLVQVGDAPENLDAAKTAKMPKKARERMDAELAQVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOAZURIN
publication title Pseudospecific docking surfaces on electron transfer proteins as illustrated by pseudoazurin, cytochrome c550 and cytochrome cd1 nitrite reductase.
pubmed doi rcsb
molecule tags Electron transport
total genus 34
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1adwA00
2R7EB 5I5MA 5B1JA 2W8CA 4ENZA 1AOZA 3NSCA 1FA4A 2XX0A 1NZRA 2FT7A 3X1NA 1ASQA 1TKWA 1PZAA 2QT6A 1BQ5A 1ZIAA 4HCGA 4A2GA 2OJ1A 4DP6X 1IC0A 5A7EA 2GHZA 3FSWA 1ID2A 1AIZA 4DP9X 1CYXA 2EINB 2ZWNA 1XB8A 1SFDA 3TBBA 3CZUB 1JVLA 2I7OA 3DIVA 1A65A 2B08A 1WAEA 2H47C 3TBCA 2P80A 1T5KA 2GC7C 3NT0A 1NIAA 3OD3A 1QNIA 3NJKA 7PCYA 2Y1AA 4AKOA 5I5IA 1GY2A 3UAAA 1L9RA 1AZCA 1PLAA 1E65A 4F2EA 6PCYA 1RCYA 2YAHA 3FU8A 2PPCA 1PF3A 5B1BB 4YSSA 4DPBX 4NERA 5I6MA 3NJNA 1V54B 2YAMA 3DKHA 2DWTA 2I85A 2WO2B 4KO6A 1A8ZA 3X1FA 1IBZA 1X9RA 5PAZA 2ZOOA 1J5CA 1PLCA 4BWUA 1MG2C 3FYIB 4YSCA 1B3IA 3AG1B 3GXUB 3H56A 1BAWA 1QLEB 3NYKA 3OMNB 5I6OA 1CYWA 1X9UA 2PPFA 4HHWA 4WTQA 2UX6A 3NP3A 3QJTB 5B7MA 1ZPUA 5PCYA 4BWWA 1BYOA 3WI9A 3OMAB 3CVDA 3FU7B 3PCYA 4Q8BA 5D4JA 3QQXA 4YSTA 4YVUA 1KCWA 3FQ1A 1KV7A 2ZONA 1AANA 1GS8A 4HCFA 1XMEB 1NIDA 1J9SA 2DY2A 4Q89A 4HCIA 1AR1B 1GS7A 4N8UA 4GP4B 2J56A 3N55A 4P5SA 3T71A 4AI7A 2CJ3A 2PCFA 5D4IA 2YQBA 4DP7X 2B3IA 1AZBA 1E67A 4YSRA 2XV0A 1ADWA 3CG8A 1PZBA 2IDTA 1PY0A 2OCCB 2GB2A 1PAZA 2DV6A 3EH4B 1ASPA 1OCRB 4GP8B 3FT0A 4YSDA 4A2DA 1IKOP 2Q5BA 3IBOA 3PAVA 4HHGA 5EHFA 4W1TA 2JFCA 1URIA 2VN3A 2QDWA 2HX9A 1HFUA 1ETJA 1KBWA 1TU2A 3EH5B 1NPJA 4HALA 3WG7B 5I6KA 3QJRB 2VSKB 3OM3B 4ZK8A 1V55B 1SDDB 4X4KA 4E9XA 2IDQA 3NJFA 3CVBA 2IDFA 4BDVB 1MDAA 2PP7A 3L45A 2XXFA 3QJUB 1PZCA 2BWIA 1SHWA 4BXSV 3H4FA 2WSDA 2GIMA 1JXFA 1ZIBA 2NRDA 2AVFA 2HX8A 3CDZB 3T6WA 2PP8A 2YAFA 1OCCB 1W8EA 2XXGA 3SQRA 3AY2A 1BYPA 1BXVA 1HAUA 2FT8A 2IH9A 3NSFA 3UGEA 2BP0B 3FSZA 5F7BA 4E9WA 1SF5A 4AKQA 2OV0A 2XLLA 1E5YA 1XB6A 2BW4A 1J9RA 2LLNA 3ABKB 3FQYA 4QKTA 1ZDSA 2FNWA 1W6LA 2FQFA 2J55A 2IWEA 2MTAA 3S3DB 4L0PB 4G71B 2X87A 3FPXA 2I7SA 2VM4A 1J9QA 2QPDB 3BQVA 2J5WA 2FT6A 1E30A 1KYAA 1DYZA 1QHQA 2YAOA 3NJIA 2BWDA 3ASNB 2HZHA 1OV8A 4AZUA 3WKPA 2BZ7A 2AZUA 1A4BA 1BQRA 1NIBA 1AS7A 1A3ZA 1BXAA 2EIJB 2JXMA 1PMYA 1ILSA 2IDUA 1NIEA 5B1KA 1WA1X 3IN0A 3AG4B 3S3BB 1OE3A 3WKQA 4G7QB 4MFHA 4UAHA 5AKRA 1MZYA 2FWLB 2BO0A 4DPAX 1SFHA 2QDVA 3UACA 4CSZA 2DYRB 5ANHA 4DP0X 2TSBA 4E9RA 1M9WA 1IUZA 1NIFA 3GYRA 4KOCA 3IEAA 1NWPA 1WS7A 2YARA 3NJGA 4YSUA 2IDSA 2E86A 3EF4A 1GSKA 5IY5B 3EH3B 1OE1A 5I6NA 4TXVB 2BP8A 1SJMA 2VSMB 1PNCA 3T6VA 1TEGA 1SHXA 1BXUA 1UATA 2VM3A 1AAJA 2PP9A 1PNDA 2HXAA 1EHKB 4KO9A 3ABLB 2XUWA 4BDVA 4DP5X 1L9SA 5B1JC 3KW8A 2XVBA 3T9WA 3ZDWA 4F2FA 3G5WA 2VW6A 2X88A 3FU9A 1KDIA 1MG3C 4RH4A 2FQDA 3CDZA 2VW4A 3AG3B 2BHFA 4YSQA 1JZEA 2CAKA 3MBWB 2HRGA 3SBRA 3AZUA 1SNRA 2YXWA 3UAEA 4AX3A 1FFTB 2J57A 3EHBB 4M4RB 1L9TA 3WNIA 3NSDA 3WIAA 2PCYA 2UX7A 3T6XA 4HAKA 9PCYA 2R7EA 4DP2X 2BP0A 4A66A 1JZFA 1WA2X 2TSAA 1BQKA 2H5UA 4YVNA 1J5DA 3ASOB 3NSYA 2UXVA 2XX1A 2P80D 4A68A 5I28A 1WS8A 3KW7A 3QJVB 4A67A 2XV3A 4A2FA 1NINA 4G7SB 1PCSA 2CALA 1V10A 2AFNA 2YAPA 1I53A 4YSOA 5AFAA 3UABA 4E9QA 1CURA 3D12B 2YXVA 3X2QB 1JVOA 2HX7A 2FQGA 2AANA 4F7KA 4PCYA 3FS9A 3PLYA 5F7AA 2GI0A 3V9CA 4DP1X 1W6WA 4E9SA 4G7RB 3FYEB 4YSAA 2CCWA 3HEIB 1WA0X 1R1CA 2XYBA 1JXDA 1MZZA 3TU6A 1AZRA 3BVDB 2JKWA 4KNUA 3NJHA 4BK5C 2PLTA 2Q9OA 4QLWA 2EIKB 1RZQA 2WO3B 1KGYE 2RACA 2EILB 1JERA 5B3SB 2UXFA 1JXGA 4YSPA 4GYBA 5I6LA 3FQ2A 3V9EA 1AACA 1A4CA 3X1GA 1KCBA 4KNTA 7PAZA 3HB3B 1VLXA 2YAEA 1JZHA 5TK2A 5B7FA 4G72B 1L9QA 1L9OA 4DP4X 3CVCA 3FU7A 1YLBB 3PAZA 5D4HA 1FWXA 1L9PA 4YL4A 4A2HA 3S8GB 4EF3A 1ET7A 4G70B 4JHVA 5LDUA 4E9YA 1GY1A 4KOBA 4UANA 3NP4A 2AZAA 1OOWA 1AG6A 3AW5A 4K9JA 4KO7A 1N70A 1ILUA 2H3XC 1AS6A 3N2JA 1SF3A 4E9VA 1AZNA 3NJLA 2IWFA 1IBYA 3ZIYA 1EZLA 4NB7A 2DYSB 4FA7B 3PXLA 1AG0A 4A2EA 1CUOA 2FJSA 1ET5A 2XU9A 3FSVA 3X1EA 1HAWA 4NAJA 2IAAC 3X1BA 2FTAA 1CC3A 1JZJA 2GBAA 2XWZA 3ZX1A 4DPCX 1F56A 1AS8A 1PLBA 1SDDA 2A3TA 2CUAA 2N0MA 3NJMA 1KBVA 1XB3A 5B7EA 4P5RA 2PPEA 5TK4A 1OCZB 8PAZA 1ZDQA 2ZXWB 1NTDA 1KDJA 3C75A 1A4AA 3MX0B 4AKPA 4DP8X 3T6ZA 3JTBA 5I26A 1GW0A 4UF7C 4YSEA 1OCOB 3ZBMA 3ABMB 2XV2A 4HIPA 2HLEB 3S8FB 3JT2A 3QJSB 4JHUA 4W9ZA 3RYMA 1RZPA 1NICA 2GSMB 3NJJA 4JKNA 4N4YB 5FC9A 1M57B 2UXGA 1DZ0A 3H4HA 3U25A 1NPNA 2DWSA 2MRYA 2YAQA 1NWOA 3QPKA 5I5JA 2IWKA 2VW7A 3OMIB 1GS6X 3PPSA 4GY4A 3IE9A 1AZUA 3OQRA 5B1AB 3GDCA 4GXFA 5AZUA 2FQEA 1N68A 1NDTA 1E5ZA 2BZCA 2BP8B 1OF0A 1TEFA 3SBQA 3TA4D 3PAUA 1RKRA 4WKXA 6PAZA 3DTUB 1GYCA 5E9NA 1OE2A 1ZV2A 2IH8A 4CSPA 1JZGA 1JOIA 3TASA 1ET8A 4KO5A 2W88A 5I6PA 2GC4C 3SBPA 1J9TA 3WNJA 3UADA 2CBPA 2BW5A 1ASOA 1JZIA 1BEXA 2UXTA 3FSAA 4E9TA 2HRHA 4FAAB 4PAZA 3QJQB 3IN2A 3ERXA 3FPYA 3ABGA 4KNSA 1AQ8A 1GR7A 4HZ1A 3S3CB 4BXVA 1M56B 2PPDA 4GP5B 3AG2B 4M3HA 4BWTA 2PPAA 2VMJA 2QPEB 2Y69B 2EIMB
chains in the Genus database with same CATH superfamily
4OLWL 2R7EB 3JV6B 4UDUA 5ESAB 4BSWA 1KXVC 1I8MA 4FQJL 4CMMA 5BPPA 1ZVSA 4I9WE 1PD6A 2QR0A 1KG0A 2DD8H 1PZAA 4JKPL 4PJIE 1TETL 1G6RH 4JANB 2CKBL 1HKLH 2DQIH 4WI2A 2AK1H 2P8LA 1JF1B 1E7UA 4AQAA 3MRPA 1BXXA 4Z7OF 3GLDA 4BZ2H 2O6PA 2EUZA 1NIAA 3EG9A 4NZ8A 3ZTNH 2EYTB 4EQ3A 2E7LA 5E9AA 4MJIE 4M6NH 4LOUD 3CJJA 1PLAA 4YAQB 4JFFA 5A16A 4UMSA 2F7QA 4D8PA 4PS4H 2F1BA 4PWKA 3H3KA 1WBXA 1OGAE 3MMEA 5A2KH 1V54B 3O6FA 1FL5B 5F70A 4GI9A 5I1KH 3V4PH 3X1FA 5I30H 1EDHA 3O41A 1ZA3B 2YJLA 4HLZH 3AWEA 4HJUA 4MJ5B 4PLJD 3O6LL 2O5YH 1I9RL 4O02B 4DO6A 1Q0XH 4PJ9B 2ZD0A 5K9QI 1I1YA 3MLUH 1P5UC 1SHSA 5TTRA 2MJWA 4F7TB 1W8OA 2R29A 2WXHA 4PP2B 4U1MB 5JZ7C 1DUYB 1CFNA 1BJ8A 1GMIA 4F2MB 5HY9B 2YOAA 2DI7A 2WMPA 4JNXA 1DBAH 5AD0B 5DVKA 3LEVL 3FB8B 3MGOB 4LBAA 5LGKA 3T4AC 1RIUH 4LCWA 5FGCE 4NUPA 1KCWA 2EAEA 4GRWB 5T3ZL 4Y4HA 3LDBC 1NGYA 5JXEC 3CLFH 3E8UL 4NRYA 2Y7QA 4CW1B 4Q89A 3GMLB 5TE6L 4E0RB 2F19L 1NCAH 1WSST 3NK4A 1NMAL 2W94A 1A1OB 4GP4B 1IAOA 1Z5HA 2IBGA 2VLME 3AMKA 4JAMA 1HSBB 2VDNH 1HCFX 4UB0H 4B6ZA 4KMTL 2VDLL 5E2VH 1T22A 2K9UA 5HDWA 4YBQD 5T33L 2NX5B 2X2YA 2RB8A 2VDMH 2O6EA 1B90A 3FOLA 1OIOA 2QGEA 2WJ5A 1JHKL 1LQSR 4F8PA 4ZMTA 1KELH 3FTVA 1KCSL 4LK4A 3MRBB 3X3FL 3LN4A 1G9NH 2H9GB 5GQBA 1XGRB 5T1KA 1XAKA 4HALA 2RA1A 3DC0A 2BXYA 3TBSA 2VAAB 2LFGA 1YG9A 3O9WC 1QVOA 4LEOA 4G8EA 4PJCB 4IGBC 4UM9B 4FQLH 3ENEA 4PRHB 1UA7A 4PJDF 3WFZA 4ONGL 4TSAH 2JB6A 4NUGH 2NY2B 5ABAA 5IVXE 4HOZA 1CT8A 3DHUA 3R4DA 1ZA6A 5C6WH 2X1XR 4P2RB 5FYJE 4Z7WA 3TYGL 4XAKE 5FHAH 4LLAA 3UAJD 3MLYH 1QABA 2W9LA 3EJYC 3V6BR 5EUOA 3G5XB 2RR3A 2ZCKH 3B3IA 4IKLA 4ZPTB 3AFLA 3V0DA 2J6EL 4PIRF 2XZZA 4I2XA 1UT1A 4ES8A 2VC2L 3BGMA 1MCOH 4QY8B 1JG9A 3V0WH 2J55A 5D7LA 2WXMA 3IRCA 1PZSA 2X87A 1OKEA 1F1GA 5I74B 2VJ0A 3EYUH 5KSBA 2RH0A 4Z8FL 3NSXA 3V5HA 3BP7A 5ICYB 5EF3A 4L1SA 2FIKB 4OAWB 4PG9B 5D2NB 5CSZA 5E9DA 3S35X 1N64L 3C6LC 3HNVH 1WFUA 1FL6A 3NZ8B 3HG2A 4H8WL 3TEXA 3TA3D 2Y4SA 1OHQA 2OCFD 5ESVA 1CFSB 5MI0C 5HI4D 4YBLB 1BPLB 5DF0A 3N40P 1K2DB 4I8DA 5HSFA 3NZUA 1YUHA 4OI7A 1U8PB 4Z7NB 1A0QH 3CSFA 1CF8H 4YGAB 5E8DL 3C6EA 2X4NB 2HJLA 4PJFB 3AUVA 1I9IH 3Q43A 3NPZB 1PFOA 2JI3A 4DEUA 5ISZE 4L0YA 1NBZB 1BEYL 2WD0A 4HF5H 5D7JB 1PVHA 2WNWA 1L3NA 4G7YL 4HQQH 4M6OL 1M9WA 4NO0D 3IJSB 5AW4B 3CFQA 5F0LB 5T5FL 2APXA 2E74C 3VXMD 3U1SL 1BIIB 2QMJA 4P59L 3N91A 1CR9H 4XOEA 3GSWB 5D7IE 2X6CA 3MJWA 4BFFA 2X4OA 2NY1C 3DX6B 3GLAA 3QBTB 4IDLA 4K94C 1PKOA 3QEUA 4MLIA 5MEQB 5FW6A 5AAMA 3TBYA 2BVOB 4KX9A 1I1FB 5EC1A 4U6XB 4Z6AT 1UKQA 2ZSWA 4I1PA 3FO0L 1T21B 2GUOA 5MHSE 2Q10A 3MRQA 3O4LD 1MW3A 2CO2A 5JDSA 4LCVA 2L3BA 3D85B 4HIXL 3V0AC 3CH8A 5DR5H 3CFDB 4ANKA 1AO7D 1CZ8L 2GIXA 3S5ZA 2YBGA 5CEXB 2VABB 4OGZA 1F4HA 3AG3B 4MS6A 2BHFA 3QI9C 5DJXA 3ZTJG 1GGCH 4J4PD 2Y0SA 3EJUA 3OKMB 3QJHA 4AX3A 3SDAB 3JUYA 3FCTB 3BSGA 2F54D 3SKMB 3TWCL 1D2OA 5G55A 4APQB 2WQVA 4YDKL 3DMMD 4G6FD 3H0TA 3KPQB 3RDJA 5IB3A 1RIVL 1VEOA 1CBVH 1E4WH 1DSFL 2AGJH 3ZYJA 5I2IA 1CGWA 3LB6C 3BUTA 3DUSA 4JHAL 2YMTA 1JHTB 4OB5L 4EI6B 4FDWA 1W0YT 1I3UA 4L4VA 3CX5K 4JRYB 5FWRA 3WD5L 4AGLA 4UZUA 3CFKA 1DJXA 4UT7H 3EOYG 2DQGL 2V37A 4GKSA 4X50A 2YAPA 5CIPH 4AV0A 5AFAA 3SE3C 1CURA 1IFGA 1SN2A 2YXVA 4ONFH 4ZOEA 3BSZA 3IJ9A 1VADB 1FLTX 2PO6B 1F4XL 3DSFL 3QFDB 4RRPG 4J27A 3TEWA 1SQMA 1BOGA 2LTQC 1AKJD 3R0MA 2P28B 3GMMB 4P57A 4YE0A 1H9DA 3WN5C 3CVHB 1EBAA 4E9SA 5FECB 3BQUD 3IFPA 2ZOTA 1CCZA 2Y2YA 4HULB 2ADFL 1KJ2H 1XCWA 2E0PA 3O81A 5E8OB 2EXYD 4DVBB 3NIFB 3H7BA 3QXUA 1VFOA 3KHQA 2YC1B 1LMKA 2WO3B 1QUPA 2WQAA 4PM1A 1M05A 3D3VA 3BPNB 3C5SA 2FZ3B 3ZT7A 4J5VA 4YPGA 1MPAL 1NCIA 2FO1A 4C4UA 5IK3B 3VCLA 3OXSB 1I75A 3IDNB 1F2XK 3D30A 3ELAT 4ZD3L 1INEL 1WBZA 5T5NF 2FSEA 5CP3H 4ZJ9A 5KVGL 1VLXA 5TE4L 3B9KA 3WMQA 1JZHA 1HE8A 2E59A 3GEWB 3ULVD 3U7WH 3EAKA 1LVEA 1FWXA 4DOHE 1B88A 3K2UH 3RJQB 4JHVA 2PR9A 4E9YA 4O9HH 2CIKA 3MREA 2AQ3A 4E41D 4FYQA 3NP4A 4JFDB 5EOTA 1ZHLA 1SHMA 1AG6A 1ZHKA 1FJ1A 1YN7B 4U1LB 1VCBC 1ERNA 1RULH 4PGZA 1CPUA 3QUMA 3QFJB 2GJZA 4LPYA 1DN0B 5AVRB 2CUMA 4NQDE 2I5YL 5CUSH 3PGCA 3HB3D 1CXHA 1KIRA 2FEEI 1INDH 1NCNA 2B1AL 3HLKA 4FQ1H 4UTBL 4MGXA 4KJWD 1AP2B 2CDEB 3P4NA 4HJIA 2B9AA 1OB0A 1J1XL 2WY3B 5C07D 4PW4A 1O6SA 4P48A 4GKNB 5DRNB 4ZT1A 1Z3GH 1LILA 1LLAA 5FA4A 3NBNA 3UROR 2ZOLA 4JPWH 4L3EE 1DLHB 3A22A 1U8KB 3QXAA 5EOCL 2P3YA 3LZRA 4FQXA 5DJAB 3VFUB 3VI3E 4J8RA 1RUQL 4MAYA 5C0EA 1HHKA 2MCG1 2ZCLH 1AI1L 1DBJH 2EXWC 3OWRA 1AXTL 5F3BA 8PAZA 4E5XA 4YHLL 4KVPA 4OIIL 1AXSB 2Q6WB 12E8H 2VUYA 5DVPA 5C09E 4Y16A 4DQAA 1MUJA 4P4KA 5IF0A 1EDYA 1XSJA 2IV8A 5I26A 5E2JA 4B60A 5D7SH 1IGFL 1ZWIA 2H32B 3T6QC 2E27H 2FHCA 4Q9RL 2GBTA 1T03L 1TO5A 3O6ML 5DD5H 3SYCA 4PJ9C 5EBGA 4PJBE 3MFGB 2CUHA 1F86A 1UCTA 3HHMA 1A2YB 4H1LB 4LAJH 2HG5B 4POZC 3OG6B 3MNZB 5LAPA 4W6YB 5IM7B 4JKNA 1MRCH 3PE9A 4IOIA 4FNPA 3L1FA 4XPBH 3MRIB 2MRYA 5CGBA 5CBEB 3IDMB 3SDCA 1VCAA 4PJDA 3SE8L 3VXRA 5B1AB 5A6IA 4LARH 4R0LB 5FYLD 4LMQE 5AZUA 3TTYA 2YQ2A 4NZUH 2XPGB 5FGSA 2D9QB 5I0YA 1HU8A 1UWXK 1R3HA 4NO3B 3PAUA 3VGFA 3LQAH 3DX8A 4X0KB 3OZ9H 5DHYB 3S36L 2CH8A 1DDTA 1VZGA 3ORJA 3TBVB 1VKXA 2FR4B 2XBZA 3UZEA 3UADA 2YPLE 4L8SB 3ZGIA 3IM1A 4L18A 4OUUB 1YAIA 3KBFA 4FAAB 4UWQB 1IFHH 1CE1H 3A67L 3IMRA 1T1ZA 5D1ZI 1J05A 3INOA 4XNYL 1AQ8A 1OT2A 3S3CB 3QPXL 1GZHC 3TV8A 2BY1A 5K9KB 2PCPB 3P1VA 5E4AA 2QPEB 5IG7B 3FRPB 4WI0A 1DQDL 2N1KA 3O2DA 2NY2C 4JGMA 5BQDA 1ZCRA 3QUXD 1OY3B 4P3CH 3WTXA 5I1EL 1BFVH 4QKXB 2V2TA 3D06A 1INQA 1CL7I 3O8XB 3I6GB 3FQWB 4JJOA 3VXNA 1HNGA 4QHMB 4R7LA 1MHCB 3WFBL 5DQJA 3V9FA 3IAGC 1FO0B 2AXGB 1S7SB 2R15A 3PJLA 1FGNL 4XPFH 2XKNA 4K2UL 3QZWB 4KUZL 1DVFB 1YPZF 2K78A 2YMXH 5FX3A 3UGUA 1C1EH 2AJVL 1JYVA 1XSIA 2WBJA 3WS6C 5I74C 4N0UB 2C3VB 2WB1A 3Q06A 4PRID 5L2KD 1G9HA 3RGVC 4ZZFA 5DZLA 1ZSDA 5D2NC 2YLKA 1KENL 4ZSOB 1XBDA 1OZUA 5DU7A 1S7TA 3WLWC 1MFMA 1CS6A 2R1XB 4I48B 5E1AA 3T0WA 5PAZA 1TQBB 1P4IL 4ZO9A 3PGDA 4D7PA 1W0VB 2AK4D 1JI1A 1PLCA 2YBRB 3PXJA 5EDXA 5ILTL 2OMUA 4HXAH 1J12A 1BAWA 4MXQD 3ZL1A 5KEZA 4XN8A 3KPSA 3OPZH 3ROOB 3KJ6H 1L7TL 2KKQA 3VRJB 1E4JA 2BIOA 3NCJH 3RUGB 2Y25A 2Y24A 4BWWA 3QQ3B 2FIRT 4JZJB 4NQXB 5HGHA 3IDJA 3PHOA 3OMAB 2X7LA 3PCYA 4K23L 4FNTA 1N5YL 4R4BB 4WCYH 4WI3A 1V3KA 3ZDZB 4L05A 4BGLA 3EO0A 3QQXA 1KYOJ 4ZW7A 1YEIL 5DTFA 1WFNA 4IBYA 4DGWC 1DQML 4OQ1A 2AJSH 3KPRB 5H8DA 4U2ZA 1LEIA 5EPMB 4N25A 1P84J 2VLKD 1FNGB 4JQVA 4XH2A 3HZMB 3UZVA 5LGJA 4ADJA 1ACCA 4DP7X 1U8CB 1FORL 1WAAF 1IO4C 1WGVA 3ARVA 3EGSA 3LKSA 1OQXA 3SE9L 4F7MB 3EH4B 1JPSH 3WKML 4NRXA 1ASPA 4JFOA 3ULVF 4WEBH 1IX2A 2V5TA 3IBOA 4GSDH 2ZOKB 3DGGB 3MUGB 1BP3B 2F61A 3MA7B 1G4MA 4JY5L 4P99A 2HCZX 4FFVC 3K46A 4M6AA 4JRXE 3HI5H 3VXTA 1KJMA 3EYVB 3HR5B 1A9VA 3KWXA 1HXYA 4MJHA 2NW3A 1M9SA 2WZ6A 3PWJA 3GSXB 4G8GB 2F5BL 2QADB 3QEGL 4LZKA 5D2LB 1GIGH 5IQ7L 2ZYHA 2NRDA 4RETB 2W9EL 1NQBA 3VFGH 1OCCB 1CD0A 2IFFL 2F58H 4H2AA 1RHFA 2Z8VC 2WCGA 4NWUH 4D0BB 1DLFL 2VITB 3RWFA 5I1IH 2WWKT 5B4MC 1S7WA 4NEHB 1R5IB 3UEQA 5J1AB 3OZKA 3ZZQA 2MKWA 2G30A 2WC7A 3POHA 4K3JL 2OK0H 2C4FU 4IKNA 2HUHA 5ABZA 4NN7B 2GBUA 4M48L 1IAKB 4OGAD 4QNPF 2FLMA 5L8JB 1YQ2A 4PRPB 3ULUL 3MO1B 2OSYA 3L4TA 4FKHA 1YMHA 3AB0C 4K8RD 3FPXA 5EZOH 1C8QA 1NFKA 3TH2T 4Z7VA 1SBSH 4LLUB 3UJJL 2D0HA 3QIBD 4BYHA 4PB9H 2NUPA 3GJFB 5F3HB 5IW6B 1QHQA 3SBWC 1F02I 1J1PH 3DX4A 3VFOB 4JN2A 4QRTB 3SJVA 2HAZA 4IOFD 3MXVL 3BPNC 3BEWB 1LO4H 1A3ZA 4LBEA 1ILSA 5KBLA 1OPGL 3AG4B 5FO8B 1OE3A 4IRZA 1KC5L 4AYBA 4MFHA 4XN1A 3R8QA 4UUJA 3F65A 2BO0A 3STBA 1J0YA 3Q48A 2MMXA 1V05A 3MROA 4YEFA 4ELMB 2A83B 3GBEA 3BDBA 4Y2DC 2Q3XA 5FM4A 4ZW5A 4V2CB 4IBQA 3CLEH 2GUYA 1IL1B 2JCCF 5AYQA 1KYDA 5SWSE 3UAJA 3T0XA 4PB0L 5HDQH 1HXMA 3LKOA 1AGBA 1CIDA 1HH6B 2B3RA 4I1RA 4TXVB 4ZS6D 1TFPA 2FVNA 1PLGL 3X14A 1WCQA 5TPWL 1BBDH 4MA3B 2CJTA 1TJGH 3F7YA 3MCG1 3VFMB 4Y1TA 3FTZA 5BZDB 2DYPD 5DD3H 1PG7H 2RIKA 1UOWA 4I18C 4B5ZA 5C0JB 4ZXBA 3VFPA 4M43L 4J3SA 3JTTA 2DMBA 2Z0BA 4V1DE 4XZUA 1FO0L 3LRLA 3O6KL 4QXGL 2ZUWA 2QSQA 1UXSB 2QTEA 3MRRB 5TDOA 3BEVA 4B0MB 3IU3B 3N43B 2IH1B 1A4KA 1TTRA 2KPWA 4PP1D 1UGKA 2IGLA 1B9ZA 3GNML 3U7YL 3TA3A 3RVWD 1J10A 1UEYA 5F1OB 1DFBH 2QSTA 5EU4B 3VMOA 3DRQB 4YVNA 5F7HA 3ASOB 4HWUA 1PTZA 3KEDA 3NSYA 3PL6A 1K3IA 5DJDB 4KKAC 4OJFH 4A68A 1UZ8B 2BINA 3U36B 2Y23A 3RIAK 2V17H 4NP4H 1H3GA 3IDIB 3RPIB 1NCBH 1OP4A 1FBIL 4YXKH 3HRZB 5EN2B 4GRLD 1XSKA 3O0RH 3ULUC 3DWTA 3BT2L 2PYFA 5KS9E 2ZWKA 4MB3A 4ZW3A 5L4IA 3TVMD 1DQIA 1KGUA 2H7WA 1QNZH 4UIKL 3D12B 4UOW0 3D2UB 1JVOA 1P4LA 1UH3A 3VXMA 5GS2H 4RGNE 4UM8B 3F12B 1IARB 3HKFA 3IWUA 2WPGA 3P0YH 2PXYA 3BVUA 4YGVA 1JGIA 3LQZB 3CZFB 3QDJA 4RFEB 3D2TA 4P06A 3H3PL 4HUVA 1JZ4A 1WA0X 1O9ZA 4ZTOL 3HG1A 1TQVA 3HS0A 3WXWH 5A2LH 4XGZA 3BVDB 4TKWA 5DS2A 1PGRB 3NJHA 4JHZA 3QYNA 3ESVF 1KGYE 2J2ZA 2VQ1B 3CWGA 3LH8A 3UZQB 2XICA 4LE8A 1JS4A 1Z9SB 1YSOA 1X4XA 4PCKA 1AO7A 1FC2D 3JV5A 1GAFL 1KSRA 3EIFA 1X5HA 4L8SC 3CN0A 2FLRT 1FVDB 2CGRH 2O5NA 5TK2A 3I50L 5EIIB 5L2JB 1TZAA 4BQ8A 1L9OA 4UZGA 1M7DA 1PKQE 3L4XA 5A2BA 2F54A 4LDCA 4JLRB 1X5JA 2FLBT 1LTXA 1BECA 1X7QA 2K6ZA 2VDKB 4NM8L 4U6TA 1RMFH 3MV8B 4K3EH 3DMMA 3T77B 4AEHH 5LDUA 4JFXB 3FT4A 3OF6D 4PTUB 2VXQA 4ZODA 2APTA 4ZBJA 2ICEB 4GH7B 2A0LD 4OZFB 3AREA 2O72A 4R4FH 1TJHH 2UZXA 4LU5L 3LKQA 1WGOA 4F9PC 4AENB 1KIPB 3DO3A 2IEPA 1V3MA 2P24A 1FZOA 3ETTA 3PXLA 5F8QC 3MOBH 5TFSL 5T1LD 2IPTL 3THMH 2KPNA 2WYZA 3SOBH 2H45A 4HH8A 4GKZB 2FWUA 5EU6D 3VWJB 1DVFC 3HC0B 3BQUA 1JZJA 4H1LG 3UCQA 3D6GA 4PUBH 4D0CA 1OAKH 3MRGA 2QTVA 1JGDA 4WI5A 4DPCX 1KYUA 2CUAA 3QDME 5C1MB 1ZLSH 3NCBB 3X3GL 4PJXB 1XB3A 1BBJA 3A6CL 3K8MA 3L3HB 1JPTL 4KQ3L 3L3JB 4RESB 3SDDC 4ATTA 4YHYB 3SDYL 1M7XA 3V6ZB 2BNRA 1Q9OA 1WEJH 3STLB 1A22B 2NY7H 4TUOA 4AKPA 4OZIF 4GQRA 4Y5VC 3QCVL 1TQBC 3F5WA 1KB5B 3QPQD 5ETUA 3U83A 4YSEA 3D34A 4Q4IA 1JCKA 1IC4L 2E4TA 2J7LA 2RHEA 4L37A 1R47A 1U42A 2P7TB 1XF2A 4OLUL 3K1KC 4TQEL 3UYRH 4IRSB 5E0QA 4H88H 1RZ8B 4E36A 5IEHB 1UVQA 1JN6B 5FUZH 2AQ2A 2H2SD 1Y07A 2WIIB 2D7TH 4JM4H 5IBLC 3SKOB 4Z3EA 1N6QL 2J8UE 3U25A 3NA9L 1UH2A 2FB4L 3QPKA 2ZP9A 4M61B 4FQQB 2LW3A 2G3MA 1JWSB 4PR5B 2F68X 5ID0B 1BVLA 1AZUA 1Z2KA 4DKAA 1SM3L 4XPHL 5ITBL 4R7DA 3MLZH 4KXAA 1MCKA 4UCFA 3SKJL 1U41A 3ZY7A 3SYOA 1A3RH 3RVXD 3UBXB 4P2OD 2VRKA 1HIML 1BQLL 3DTUB 4OTXL 1YNLL 5D1QE 4J3OH 4CSPA 4NUJA 5ADPL 2XG4A 4TPRL 1ZT4A 3TO4D 1BZ9A 1BJMA 2MHAB 1UA3A 3M1OA 5GPRA 1C5DB 4MCYB 1CICD 4OD2B 2LAAA 4ZS7L 4N0RA 4PIBA 1NL0H 4R7NB 2DF3A 2CBPA 5HYJD 5F6HJ 3MAWA 4X7CC 1RJYB 2ORBH 2OMWA 1MJUL 1V8HA 4M7KL 4EZKA 4GQ9H 2HVBA 4ALAL 4H4NA 4NO5B 5DO2D 2PPDA 2ZSVB 3MLVH 3QZWG 4BWTA 1AYRA 2PPAA 2ZYRA 5B21A 2LU3A 3Q1SH 3KS0J 3PV6A 4LASL 5FOJA 3IGKA 1OTSD 1TZGH 4ZFOA 1QSEA 2XBDA 3DPBA 3ETSA 3NSCA 4PJ8C 5E5RB 3S8WA 3BMWA 1MCQA 3X1NA 4YR6B 3QXWA 1D5BB 5DD0L 4MJJA 3KAAA 2ZQKA 4IHBA 1AHMA 5LBSH 3CFBB 3FF8A 4C57C 2DL2A 4ZTEA 2P8MA 2PWGA 2A9AA 3FN9A 4PJGE 2VLRE 4FG2A 4J39A 1CFVH 1E2VA 3OR7B 5ELIA 5I18L 4Q9BA 1T5KA 1KXQE 4MNHB 2VLLB 4UBDD 3Q1EA 1OF2B 4RWYH 3FFCA 2V7HA 2XRAL 5IFJB 4XP5H 3NFNB 3OAUH 2Q86B 3MCKB 4G7VH 4L8BB 5E95B 4NQCB 3KPLA 3G6JB 4X5LA 2XZQL 5EA0L 2OR7A 3V4UL 3ZL4H 1BLIA 1IT9L 3L3OB 5IHUL 4HLJA 4AITA 2G75B 2JCCA 4JQIH 3VG9B 2X1WL 1QBLL 5I75B 1PF3A 2EDBA 4DPBX 3DX9A 4FA6A 3WS3B 5HGGS 1YEEH 4GAFB 3A4DA 2NPLX 1AQDB 3MRFB 3NOIA 3MV7A 3O3DB 4G3YL 4M1GL 1RFDL 2CO4A 4NLAA 4EI5D 1FFPB 2YK1L 4HXBH 5JTWA 2ID5A 1BLNA 4BWUA 1MG2C 5JW5B 1KZQA 1DL7L 3OLDA 4NKMA 1AHWB 3GXUB 5J13C 1LP9E 4P4RB 4NC0B 4WTQA 6FABH 4JB9L 5IR1A 4K7FB 4X8JB 2O6FA 5HHVL 1BOYA 3RILA 4JZNA 1ZPUA 1JDAA 1G5GA 4KAQH 2FJGA 4Q8BA 3L3GB 2WTOA 1DSYA 4PRAA 4Q58C 1Q38A 2WLJA 3HI6H 4HLEA 3DSNA 3D39A 2XWTB 2FX8L 3CD4A 4R6UA 1HHIB 4YIQB 4TQIA 5E5LA 3SZ6A 43C9B 2GTWA 3QQ4A 4FTDA 4BINA 4KFZC 5K9JH 2VXSH 4GG6E 2VR8A 2B20A 4A6YL 1XDTT 4N68A 3SY0B 3DBXA 4C83B 1HINH 3GIZL 4YHOL 3TZVD 1AZBA 1I4FA 1XR9B 3EOBB 1ZLWH 4FFWD 3RU8H 2IANB 4DSYA 5GSRB 5BQ7B 5EF2A 3PJSB 2HT4C 1QRNB 5IMMB 4J28A 4UILH 5JPMC 1HH9B 4Z5RA 4QXWA 2WN3A 4A2DA 2XA8H 5HGDB 1NEZA 1E4KA 3BI9X 3JWNH 3WEXA 3F62A 1OW0C 4LHUB 1DBBL 4WSKA 2HFTA 3HUJF 2VZTA 4L3CB 2GW5A 5AYUL 1KWKA 5DA0B 5FGBA 4BQCA 1R5VB 4P23B 3BJLA 4DK3A 1UB6B 5ITFA 1MREL 2O30A 2LOEA 3NCFB 5DYOB 2AJ3B 2PP7A 3TNMB 3W0WE 4RX4D 1BPVA 5C0IB 3QUZB 4TYUA 5FO2A 1A4JA 5JIPA 5KTEL 3H4FA 2FH6A 4TTGA 4G8FB 2O61A 1FV1A 3GDBA 3DYMA 2NSQA 3EYFA 2IXQA 3CDZB 5KOMC 5HHOD 4LCCB 3T6WA 3VXPA 3T0ED 4A37A 4DGIH 1A6UL 4L9DA 1GJUA 4MZ3A 4P5TB 1SXSA 2L0DA 1LK2A 1QSFB 2BOCB 4U3SA 4Q56A 3W11D 2FT8A 1M7IA 3NSFA 2XTSA 4CVXB 1FVCB 1JPST 4J3XA 3DOIA 4A7UA 3QIUA 4D9QD 1MWAH 1NEUA 2NXYB 3LPGA 1GXEA 4X6BA 4Y9EA 3ZE2F 3RKDC 2Z8WC 1Z5LA 2KLRA 2Z8SA 5D9SB 5BZZA 4G71B 3SE4A 3SGJC 2I7SA 2VM4A 3FQRA 4EVNB 1IIIA 2WWMC 1P9MA 4KI5F 1U3ZA 1UQSA 4JKPH 1TETH 1NMCC 1KYAA 4E2OA 2Z4QB 5F6IC 4NQTA 2YAOA 3CX5J 3PWUB 3WXVL 4QHLA 4AV5A 2Q2LA 1GZQA 4N24A 4YOKA 1CFQA 2W5PA 3L5WB 4AZUA 4BE6A 3N5AA 3GIVB 4B9PA 3MJ7B 4HUXA 3CFJB 3K74B 5A2AA 1GCFA 2XTJC 4FXGB 2GAZA 2TRHA 4H25B 1KLUB 1DR9A 1MVUB 3LXCA 1BMGA 1RZGB 3GSNL 1G84A 5BVJB 5IMKB 3AROA 5IESL 2QZ5A 2A74C 4XCYA 1D6VL 1MF2L 1SMOA 3EJSA 3BYTA 4ODWB 3T0AA 5LWYL 2FX9L 8FABA 5DJ2B 4F27A 4ZAKB 3UTSB 4ELKB 3MI6A 2PYED 1OGAD 2X4TB 3ABZA 1KTBA 3NDZE 2DBLL 3PWVA 4KRPD 2VISB 4TN9A 5BW7A 2ZWYA 1B3JA 3HLAA 3TONA 2X41A 5LN8A 2Z31C 1NBYB 1T80A 4Y4KB 3ZKMC 1SYVB 3OAZK 3RAJL 3O6LH 1I9RH 1YY8B 4LF3A 2OI9C 4X4ME 2AKRA 4F93B 2CZNA 1WT5A 3VW3L 4OZIA 2EE2A 1RJLA 4PBXA 3DJSA 2UWEE 4UQAA 5K9OA 5HHMD 3JWNE 3U0WL 1TEGA 5I76B 3GBDA 4L8DA 4UV7L 4WW2F 1UATA 3CFEA 3DX7A 4FFYL 5C6TL 3V0GA 2AJZA 3LEVH 3MFFA 1IM9A 1EHKB 1PZDA 3CHOA 4U1NB 1WZKA 1M6UA 5KBMA 5T3ZH 4XCFL 2AITA 2IH3B 3E8UH 1I7RA 3RIFK 5TE6H 1NGZA 2F19H 3B9EA 4OF8A 5IB4A 1NMAH 3ZT6A 3ARGB 1UZGA 2VW4A 5AKVA 1YEFL 3QHFL 4UOQA 1UXWB 5DK2A 1VDGA 5J1SC 1RIHL 1E9OB 4M1DL 3PJNA 3PQYA 1CFTA 5T33H 4K94H 4LNRB 4WWOA 1F58L 1Q1JL 4UT9A 3ILQD 4YHYC 4NQEB 1YDPA 1EJ6A 1J8HA 3DOSA 4R90L 1BQKA 4NENA 2OMVB 1FFQA 1LEKA 1OP5H 4IIQB 4I5BA 4KITB 3DVGB 2P80D 3QNZA 2KUTA 3AS3A 5DRZA 1JGVL 4A2FA 4HH9A 1U95B 2Z1KA 4JO2L 3RDTC 5LBVA 2EEAA 4ONGH 3TFBA 2X38A 2HFFA 3HTLX 3LKPB 5DJCA 3CZJA 1Q4NX 3OXRB 4XE5B 1NFDF 5HYSB 2ADIA 1LYQA 3BW9A 4Q2ZA 4M62L 2N7AA 3TYGH 4ZUSA 5IB2A 2J1XA 4N2LA 4MCNA 5FYJD 4TMPA 4F3FB 2NW2A 2OQJB 5D6DA 3KCPB 3GMRA 4APXB 3B6SA 3AU0A 5J3HC 4HWZA 5BRZA 3ZXAC 4ANUA 3EDFA 2J6EH 5E1QA 1H8SA 1HSAA 1X5AA 2D7OA 5CLTA 4AOFA 2GVYA 2VC2H 5H37A 1UJTA 5L0QC 5IJVA 3LPPA 2ARJA 2DYPA 1QACA 4GKLA 4L5FH 4OZFG 1JXGA 4RVBA 3WNLA 1R24A 2BERA 2C7UA 3L4WA 2FD6L 4JFPA 4Z76B 1PEWA 5HYEA 2R69A 4LSQL 2DMKA 4DO5A 1NAMB 3ZUNC 4Z8FH 2V9TA 2WJ7A 2G9KA 4S2SB 4FYTA 2DTSA 2YSSB 4X7DC 1MFVA 4ABWA 2E7MA 2I07B 4DAGL 5B7FA 1L9QA 4XC1L 4U6HB 5CJXA 3P9LB 4PJ7A 4DN4L 2XWJA 4J3BA 3QYMA 4ETQA 4OY9A 5LGYA 1XVSA 4ISVA 4GXUM 4JFUA 4WNQA 4LCIL 5LJYH 1T0OA 4ODXB 3VB9A 4GS7B 5A2IH 3GPEA 4O00A 3TFKC 4ILDA 4EN3B 1FYHB 1G7IA 2MTPA 1KBGL 1UC6A 3MBEC 3FU0A 4EBQL 5CZVL 4LB8A 3RWEB 1SOKA 3LNGA 2BNQB 4JDVB 5JW4M 1JWUB 1FZJB 5DI8A 5CJQL 5T3ZE 5E8DH 3ZE0E 3IGLA 4U1GB 1TQWA 1EAPA 3E9UA 3ZIYA 1IBGL 3OGCA 2ISDA 1KY7A 3SD2A 1BEYH 3TVMA 4FQHB 1XIWB 2APWA 3ILDA 4M6OH 4OZHF 5E94B 3NFPA 2H1XA 1V3LA 4BEIA 3L08A 5T5FH 4X7FC 4M4RA 4BSWB 1J1OL 4QXVA 3U1SH 1EEZA 3OKNB 4OQTA 4P59H 1LWJA 4CMMB 1ZVSB 1A1NA 1KG0B 2XN9E 3TN0A 25C8L 3HI1B 4HWBA 5GS3A 1MSPA 1WITA 4AIOA 4HFUL 2B1HL 5M94B 5K1NA 3IRZA 2WM0A 5EF1A 3F7VB 1S4IA 1XZWA 2PPEA 3WIHA 1UM4L 1OCZB 4HK3J 2QHLA 2JMRA 1YY9D 3AJ7A 3FO0H 3L1EA 3UBHA 3LEXA 1KDJA 5MHSD 1BREA 5DWPA 4HIXH 5GZNA 3VTTA 4OFVA 5LO7A 2FJHB 1CZ8H 3P11L 1TOXA 3QR0A 2QFRA 3UBXG 3R7RA 4OU3A 4JFFB 2WXPA 5A16B 1N0LA 4JHBA 4D8PB 3C8KB 4K71B 5E6SB 3RYMA 3QK0A 1AFVL 1WFOA 3DXAE 3MOAL 3MMEB 2I9LA 4NKQB 1HQ4A 4IU2A 2FO8A 3TWCH 1RQ5A 3DUUA 2ATAA 3O41B 1L7IL 2UXGA 3HUJA 5C2UB 5HP5A 3VDBA 4QYOA 4H7VA 4Q14A 1RIVH 2ATPA 1T89C 1G0DA 4PJIF 1CXEA 4XX5A 5FF6B 4YC2B 2Q76A 1DE4A 1I1YB 3DOHA 4OLZL 4OB5H 4JHAH 2NY6D 3RZWA 3MLXL 4OFKA 3AY4C 3T0VA 5KYUB 3ARFA 1CFNB 5T1MA 3WD5H 3QZBA 1CFBA 1E7VA 1JV5A 4XI5C 2GJ6E 3GPSA 3UPCA 3WGUB 2I69A 4LCWB 4KK9D 4NFCA 2KDYA 3BAJA 3DSFH 1F4XH 1NGYB 4NRYB 1WO2A 2Y7QB 2GC4C 1EUUA 3EFDH 4I77L 5FW8A 3HE7D 3CU1A 2VUOA 2YQGA 3EHBC 3VXUE 5C08E 1XEUA 1XF3B 3JYBA 1IAOB 3R19A 1XTMA 2HN7B 3PXHA 3WAKA 3K2KA 1LE9A 3IN2A 3CDFA 2ADFH 2VO8A 3PABA 3BP4A 4Y4FA 2HUEA 4BXVA 4P23C 1FHNA 1A47A 2OL3A 4M3HA 2D0GA 1YEJL 1RU9L 3ARBA 3FOLB 4JGJA 5J1TC 5F7EL 3A0OA 4Q7DA 2YLHA 1KV3A 1MPAH 5LDSA 4LRIC 4FQIL 3QUZC 3LN4B 1R34A 4W9HC 2RQEA 4WWPA 4JFEE 4XBGA 4ZD3H 1INEH 3TBSB 3L2NA 1NZRA 1DN2A 5KVGH 3E7JA 2A77L 2CPCA 4G8EB 1TKWA 4MSWA 2B59A 1QQDA 3ATBA 4UQCA 2ZWNA 2DLEA 1Q1PA 4QXTA 4FKKA 1MRFL 4HJGA 3K5SA 4P2RD 2JIXB 4OZGE 1CT8B 1KPUA 1HEZA 1JVLA 1ZA6B 1UYWL 4S1DD 1WAEA 3ZHLA 2YUVA 4Y19D 4Z7WB 3E1F1 3W2DL 4N1EA 3H9HA 4B7LA 2NT0A 3I85A 1JGEA 4RWHA 3NJKA 2WXFA 3HMXH 4GFXA 3B3IB 1G9ML 2XCMC 4NO2A 5J6HA 2JVUA 4WTZA 1MDTA 3N1MC 4FF9A 4I2XB 4AYFA 4HMCA 3BGMB 3MGTA 1ZVYA 2XY1A 4NZDA 3US1A 2B1AH 3B34A 4UTBH 3QP3A 3Q01A 4LKCA 3NJNA 3IGAA 3NH7L 3RVUC 1J1XH 4P3WA 5ACMA 2ARWA 3N41F 1G1YA 1N26A 5JPNC 3J7HA 5CHNA 2Z4TA 5HYJA 2X10A 4G43A 4WW2A 3IKCA 4FXGC 4ZUUA 4H8QA 4JFYB 5CEZL 3DVFA 5I6XC 2Y72A 5E9DB 1IBHA 1R4XA 4OM0L 3R1GL 2YPVA 2JH2A 1FG9C 3D9AL 1W9XA 5EOCH 1A6ZA 1FL6B 1DQQA 1RUQH 5IVXF 4HAFA 4JG0L 4S1RL 1IB5A 1AI1H 4N86A 1ZTXL 1AXTH 5ESVB 4YHLH 4PD4K 1GJWA 4LCYB 4ZAKC 4OIIH 4TV3A 3P9MA 3QAQA 1YUHB 4U3HA 4LHUG 1AANA 2Z6FA 3FDWA 4M8UA 1IGFH 1HZHL 1O6VA 1RZFL 2DY2A 4HCIA 4Y4KC 5D7JD 3KLHC 3WTTA 1CG9A 3O6MH 1T03H 1QG3A 2HJLB 3SGKA 3W9EA 3TJHC 4W81A 5D7HA 3TV3L 1UUNA 3UDWC 3V0HA 2CR0A 2MNUA 3NCYP 4N1CA 1MQ8A 4RBPH 4ZMNA 2QV4A 1OAQL 1I8LC 3O4OB 4HMDA 4MD5A 4YZFF 2D7PA 3AAZB 4L4TE 1SMDA 5F89B 2WXNA 2X4OB 2Y5TA 2ZKXA 3SE8H 1SXNA 3BAKA 1YRKA 5G5DB 4HHGA 4PJHF 3QEUB 4W1TA 1YEGL 2XZCL 5E6IC 3TBYB 3I6KB 1HFUA 2IPUG 1SGKA 3DRTA 3EH5B 1MNUL 4P0DA 1WWAX 5EC1B 1B6UA 3RBSA 3O11A 3BP6A 3GXFA 2IAMC 2W0LA 4JMNA 1UXLA 3D85D 2O26U 4QOKA 5KVGE 3MRQB 4XNXL 1TYRA 4MS8C 3F2LA 3S36H 4MNGE 3CH1A 3QJUB 2JV6A 5ESQA 2WSDA 1N8ZA 5E24E 1CD1A 4EI5A 1JZ6A 1X5GA 4DN3L 2W0FA 1PZ2A 4WDIB 2ZKHL 5DJXB 5F96L 5GS1A 5AENA 3A67H 4MZRA 3QJHB 3QNYA 4APQD 4OD3H 3SEPA 3MRDB 4CN1A 1MAJA 1FAIL 3BH8A 4XNYH 2IH9A 3QPXH 4D9LL 4MQXD 3A4FA 3H0TB 5EWIL 2V2WB 5D7IF 1J5OH 1T2JA 1DQDH 2QSCH 4M3JA 2A6JA 2G5RA 2XPYA 3MKGA 5IEKB 3TT1L 2IWEA 1M7UA 2C3WA 4EDXB 2OMXA 3KG5A 2K4AA 4L4VB 3FNKA 1MFDL 1E8YA 5D6CA 5I1EH 3PU7A 3RZCD 4LGPB 3CFKB 3GKZA 5JOFA 2J5WA 4XWOD 2BCKA 4GKSB 2PO6D 3AQXA 1WG3A 3DTDA 1F13A 3KYAA 3ZE1B 1GC1C 2ZP0T 3WFBH 2XN1A 3TZVA 1TSHA 2DQEH 1XF4A 1R3LA 4S0TD 1BOGB 5FXCH 2XWDA 2AZUA 2NCEA 4P57B 1A4BA 1FGNH 3M86A 4K2UH 1YMMA 2EYSB 1UCBL 1GOFA 1PD1A 2JXMA 1R75A 1T1YB 4DGUA 4OZHA 1QW8A 2AJVH 3MSPA 1E8ZA 1H3TA 1WH0A 3AACA 4CMHC 4YH6A 2FWLB 2QDVA 4UYPA 3B8YA 1M05B 2DYRB 3D3VB 3C5SB 4JGNA 3WIHL 1KENH 4YPGB 3H42L 3BAYA 4KK6C 4TM9A 2NR6A 3QIWC 1KN2L 1U3HB 1S7VA 4BSVA 1P4IH 4GBXD 4H26A 4X6DA 5C0CB 4QI3A 2VR3A 2FSEB 2X0UA 4FOMA 3QQ9C 4XHQA 5HHOA 5ILTH 4CC4A 3B9KB 1VGEH 1B4TA 2XWBA 2DM7A 2ESVE 3D5OF 1QFHA 4RQQB 5IY5B 2PWFA 4EUPH 3AMLA 3EUUA 1ZXQA 2VSMB 4PJFE 1L7TH 5TE7L 1PNCA 3BZ5A 5KJRL 2EO7A 5AW6B 3WJJC 5F1KC 3MREB 4IRJA 1K6QL 1UENA 1PNDA 1VZIA 4K23H 3GLZA 4DZBA 4UTAH 1N5YH 1ZHLB 4E42A 2X09A 4D94A 4XC3H 3LS4H 1ZHKB 1FJ1B 1YEIH 3K1DA 3IMVA 3V5DA 5B3JE 1PCXA 2V5RA 2Y7MA 1DQMH 3D0VA 1A9BA 2XN2A 2C3HA 1FSKC 3RIFF 4HKJA 2EDKA 4X5XA 3HJEA 5D7LE 3PGCB 1IC5L 4UV4H 4PJIA 3NEXA 2RTTA 3LV3A 1KEGL 2F15A 5KSBE 3P4NB 3TEZA 1P7QD 4PWIA 2WLZA 3M17B 3MJ6A 1L9TA 1WJ3A 5HYSG 1FORH 1DP0A 1O6SB 1G7PA 3T6XA 1TYJA 1PG7W 1LDPL 2W60A 3C09C 4YEEA 3SE9H 4ATWA 3WKMH 5DK0A 5FA4B 4AGOA 5C6PB 3E9TA 1MI5E 3QNXA 1J11A 3GINA 4FQXB 2XX1A 2OXGA 3QEHA 4JY5H 1OM3L 4MJIA 4MAYB 4WU5A 4XOCA 1HHKB 3QJVB 1S9XB 5C0AB 4BIKA 4ETYA 5C0EB 2YGPA 5IGXL 3RWHB 5F3BB 1XH3A 5A2CA 4K71C 3EYOB 4JRXD 1W2KT 5AZEL 1OGAA 2YRBA 1PY4A 4XXWA 2DWXA 3TH4T 4GSXA 4P4KB 2AANA 1T6WA 2NNAA 2F5BH 3QEGH 3CPLA 3IT8D 5IQ7H 4PH8A 2WZ5A 5BJTA 4IOSD 4YC2C 2B39A 2E6PA 2DM4A 3ZVVA 5J6GA 4JRYE 5LCVA 2R59A 1DLFH 5KN5B 1EXUA 1YEHL 5HJGA 5E5MA 3RL1A 3P3RA 4TNVK 2LR4A 3VVWA 4HK0B 4K3JH 2PLTA 2Q9OA 2H32H 4DCQA 3HZYB 5ALCL 4AIZB 3UIZA 2UXFA 3SDCB 4M48H 4PJDB 3Q8AA 3LNIA 3ULUH 3VXRB 3DGCR 4N9GA 4WI4A 3FQ2A 3TOPA 4FERA 1LO5A 4B9IA 1KPRA 4YX2L 5FYJU 1EO7A 1E9PA 1NC4B 1KCVH 3UJJH 3QXTA 3BVTA 2YAEA 3MRMA 2C9QA 4OH2A 1RPQA 4ZFZA 4OFYD 1KTDA 2JB5L 3OMZA 5CP7A 3BRGC 5EDSA 4XN7A 3FQTB 5CD5D 1L9PA 1F42A 4HKBA 2J12B 4AG4L 4EF3A 3Q8BA 5JW4Q 5CN1A 3P2DA 4OCSL 2YRPA 4R2GB 4K55A 3MXVH 3B5HA 3VRLE 4DKDC 3ULSB 1RUML 4WO4B 1EAJA 3ZDYF 4D0DA 4XMLL 1GA2A 2AJYL 1OPGH 3S2CA 4U6YB 1T1ZB 1AS6A 1FN4A 1KC5H 3CLWA 2JLLA 2WXLA 2CBQA 2R1WA 3JQOB 2OLDA 1QATA 3GKWL 4QR7A 2KBGA 1BW8A 3UYPA 1KEML 3I6LE 4WI0B 1KACB 3N44B 1AG0A 4MB1A 3APCA 1A8JH 2VLJA 3TPUB 5KG9B 1TLKA 1XWVA 1G6RA 4Z3HA 4N26A 4OF0A 5IVXA 4DK6A 3L4UA 3V55A 3O8XD 2ED8A 4NAJA 1I1AD 3N04A 4PB0H 1YEKL 4J2XA 1L0QA 3TJEH 1LD9B 3VXNB 3FN0L 3ZX1A 5C9JA 2W59A 4DEWA 2OR8A 3VFVA 1MCHA 3HN8A 4K73A 2CQVA 2EDTA 4AM0A 5B7EA 4TNFA 1A6AB 1F3RB 3M7OA 5IJCC 1SOSA 4CILA 4TUJA 2XKNB 4OF5A 2BSRA 2WVVB 2XVGA 3FB7B 1A4AA 4QWWC 2VKXA 2WBJB 2N7SA 4M43H 3B1TA 3IGUA 3ZHKA 3HZKA 3GSRB 4H2CA 1QBML 3TM6A 1FO0H 3O6KH 4QXGH 3V4PA 4V1DD 5KYXB 3V0VA 1ZSDB 2VRAA 1HOCB 4BZ1L 1S7TB 2CPUA 1QR1B 3UPRA 3U7YH 3GNMH 1N18A 2UUDH 1WPCA 3M8OH 4N2MA 3F05A 4PI2A 1QZ1A 1RK1A 3PGDB 2AEOA 4WK4B 2NYZA 1IGIL 3D4GA 4EXKA 2R2BA 2C9VA 4AQ1A 5I0XA 2WWOA 3OQRA 5A2FA 5F0JB 1JNJA 1CGXA 3BDXA 3INUL 3KPSB 4ZTPL 3ULUE 2VMCA 2ZAIA 5IQOA 1FBIH 3IDXL 4X7TA 3L3DA 5IVNA 5HGHB 5HI3D 4HU8A 1S7UA 2XDHA 2X7LB 3BT2H 5B1BB 3TA4D 5HYIA 5ISZA 1RKRA 3L95A 3GSVA 4DH2A 3PIQA 3A21A 2YR3A 4UIKH 2IH8A 2DKSA 3P69A 5I1GL 1ES0A 5DTFB 1P1ZA 1T1WB 3GMOB 2DIJA 3KYOB 3ZIMA 3BXNA 3E6FA 1P6FA 3DDGA 3WGVB 3N1PC 1J9TA 1LEIB 3GZKA 4HDIA 5D7IA 4G2AA 3H3PH 4FTVA 4XH2B 2WKGA 3UZVB 3MRCA 4W4OC 4YXLL 4AUYA 4ZTOH 2DQCL 5AAMC 3Q05A 4PWFA 3BPOB 3S5YA 3RG1C 2V5SA 2KQNA 2NY0B 3EGSB 1HXKA 5F88A 4NRXB 4JFOB 3Q6GL 4XBEL 4XO3A 3RJOA 4RZCB 2EEXA 3FT2B 1UFUA 4RDQG 1UWGL 1GAFH 4KXDA 4B9KC 4PMEA 2AAVA 4LDLB 2FT7A 4YJZL 1ASQA 1AVAA 3VXTB 1KJMB 5IJBC 3I50H 3LY6A 1ZJBA 3S37L 4YN3A 1HXYB 3CUPA 1XHHA 2QADD 1WC7A 3V0JA 2NW3B 3PWJB 1JCVA 1SFDA 1Z9MA 3TBBA 4NM8H 4XBPA 1YNKL 1VFBB 3S5LB 1A65A 2GFBA 3NABL 3K2IA 1I8AA 1KIQB 1PSKL 2QSVA 1F90L 2F1AA 3VX0A 4G6ML 3VH8A 1Z1WA 2J1YA 3MV11 4N2KA 3L2MA 2VTFA 1MHHA 3NPSB 3RWFB 2EUXA 2HMIC 1S7WB 4LU5H 2MOQA 1OP9A 1WD8A 5LQBL 1TPXB 1E65A 3PV7A 4IIZA 4FLSA 4B3EA 1UG9A 5D7KE 3NSJA 2WXOA 3DKHA 1YMHB 4MQTB 2DQTH 5TFSH 1VSCA 3GUFA 4HS8L 2IQAB 4WJ5A 4FXTA 5EBMA 3HE7A 5BZWB 3MV9E 4WUUE 3WY1A 1A6WL 2NUPB 1M2OA 1Q8MA 3GMNA 5IHHA 1CYWA 4GRMA 3FONA 4YDNA 3FUJA 1P4UA 4RCAA 3WNKA 3QDMD 3QJTB 4NXKA 3A6CH 4JN2B 5ICUA 4KQ3H 5B7MA 4ZFFA 5BS0D 4OVUA 4YFLI 4BK5A 3SDYH 1WK0A 4Q74A 1PJ9A 4LBEB 1SXAA 3E80A 1GSMA 5KANG 4Y7OC 3GJFH 3P2TA 1U3HC 1MLBA 2IGFH 1C5BL 2VDOL 2ZPKH 5GGTL 4UUJB 1IC4H 1I8KB 4NJAL 1G7LB 1D5ZA 3T71A 2QVKA 4TQEH 3RUGE 1FUNA 3L1OH 3MROB 5DK3A 4K5LA 4P04A 4YHIA 5DC2A 5CF3A 1AJ7L 4GAAA 4FG0A 1N6QH 3LZNA 2Y3AA 1OO2A 3NA9H 5D1XC 4BFRA 3QS3A 5TF1L 1Q72H 1HXMB 1SM3H 3KPRE 2YA0A 3LKOB 4XPHH 5ITBH 4DJMA 2L04A 3TTSA 3X14B 1O5DT 3IE4A 3AS0A 3BN9D 3FUKA 1Q9WA 2D7NA 4HGKC 1J8KA 5EO9A 1QUNB 4NQDA 1HIMH 1P5VB 2PKDA 1BQLH 3QORA 4JO5A 4OTXH 1YNLH 4JM0A 5ADPH 3TCLA 5D1QD 4TPRH 3A24A 1T0NA 4ZXBB 3VFPB 4WTWA 5KVDL 5DJYA 1PZCA 2BWIA 2W91A 3RWGB 4ZS7H 2WQ8A 3JTTB 1XGUA 2O5XL 3FT1A 4KI1A 3ZL2A 4XN4A 5FB8A 3NEEA 4LQ1A 1T83A 2PP8A 2Y1VA 2W9DL 4O2FA 1MJUH 2GJJA 2F9BT 4M7KH 4L3EA 3AY2A 3F3HA 4MAYC 3VI3A 4QRRD 3RB7A 3TA3B 4AK2A 1S78C 4ICWA 1S7QA 5F7BA 5F9WB 2OV0A 3B1UA 3W57A 4LASH 3ABKB 5IKCA 5D2LE 2VXTL 2FNWA 3PL6B 2FQFA 2FWSA 3WL9A 5C09A 5CIPA 3HC2A 3RX5A 5GS0L 1T66D 2OJEA 4XHJC 4DVRL 1LEGB 4UINL 4FMVA 1ZRUA 5JYMA 4OGQC 4LESA 4BFIA 5DD0H 2PYFB 4PJBA 4GEIA 3FFDA 4ZO8A 4Q6IB 2AXFA 4AIEA 3QJZA 4QRUB 43CAB 4KH9A 3VXMB 2HZHA 2KZBA 5EEWA 4Y8DC 1KJ2A 4A1RA 5I18H 2RD0A 4YGVB 2EE6A 2PXYB 1KGIA 1MW1A 4M9OA 3ZYZA 2AK1L 4TOYH 3V0IA 2IDUA 2XRAH 4HUVB 4PSPA 2BM3A 5ENWA 3VFSB 3HG1B 3HS0B 4BZ2L 2I9TA 4HAGA 4XGZB 3U7AA 1OCWL 3V4UH 3WKQA 2XZQH 5EA0H 5E08L 3CXDL 1IT9H 1RLBA 1MHEB 5IHUH 3MTXA 1TT6A 2J2ZB 4U1HA 3NZSA 3GMQA 3O4LB 5CP3A 3SPVA 2TSBA 3IF1A 2BHYA 4KROD 1C12B 3TX4A 3BE1L 1AO7B 3RKPA 4M1GH 4R2GC 1MAML 4G3YH 3UZEC 3IWVA 4GOSA 2YK1H 1F0LA 4HUWA 2YPLA 2ROYA 4KKLD 3NJGA 4WO4C 1Z3RA 2P8PB 1DL7H 2IDSA 5KS9F 5HVHB 1YPZB 5I30L 1M7DB 3KPOB 2DH2A 1N4XL 1I85A 4JB9H 2F54B 4GG8A 5HHVH 3QH3A 1EHLL 3DV6A 1H8OA 1MIEL 1X7QB 3FCSA 3DMMB 1I82A 3CN2A 3UJIH 3BFQG 2XV6B 1MLCB 4M02A 4AE0A 3LN5A 4Z0XA 5JUEL 3WEAA 3T2PA 4W9JC 4J3OD 2WLKA 2UZXB 1DBAL 2FEJA 5KSUA 2RFXA 1QHPA 4WFHE 3UTZA 3EFFA 3LKQB 3RZCA 3LD8C 4OJYA 5EEUA 2YWYA 4MMYA 4E5XG 4Z7IA 2C1OA 1B0RB 1NMBL 1Y6KR 3BD3A 5INCA 2XJKA 4FRWA 4HPOH 5EZJA 3CLFL 2ZCHH 4A6YH 4Z7VE 1FFTB 4ZO7A 1AZVA 3VMNA 3P2BA 3VWJD 1AKJB 3L9RA 1BFOA 5GISL 1D5MA 2Z64C 4BQ9A 2HKHL 9PCYA 4Y1SA 4ES9A 4WWKA 1Q94B 3BQUB 1FZMA 2ICWI 1JNNL 4D0CB 3SJVE 3VYOA 2UXVA 1JGDB 1DBBH 3ECWA 4GT0A 5AYUH 1BBJB 2EE3A 2XV3A 2QPUA 5DRXA 1NINA 3C5ZA 2PW2A 1CK0L 2H0EA 5GS0C 4UT6L 4X4XA 1MREH 1Q9OB 4MTMA 5CJOL 3KNBA 5CGMA 5LKNA 2OFQA 4KRNA 4X99B 4YLQT 3W0WD 5KTEH 4W68A 5JMOC 2JKJA 3E2HC 3WJLA 3F5WB 3I84A 4F8TA 4GBXA 3V9CA 5CZXC 4RDBA 5CU5A 4J8QA 4IRSD 5I1LA 1A6UH 2PWEA 4OF3A 4YSAA 2PABA 3KLAA 3B56A 3HJ0A 1D7BA 1FFOA 2L8AA 3BP5A 3K2MC 5FV1L 2BIPA 3A47A 4TNVF 3U2JA 3MUJA 3ILEA 2X4RA 5EULV 2K6WA 4E41B 4AQZA 3OQ3B 3FXIC 2EILB 2VB5A 3OKEA 4NIKB 4NN5B 4PWGA 3QW9A 3WDJA 1BVLB 4KH2A 2Z7UA 3GK8L 3VI4E 3WFDH 1OP5K 3T8XA 2EH7L 1TR7A 4PVMA 4MBRA 1MCOL 3HB3B 3OB0H 4IEFA 4JQVC 3B2PA 3CC1A 3SYAA 3R8BB 4YFEA 3MLTA 3KPPA 1X5XA 2XG4B 1FFNA 4LSRL 3WXVH 1ZT4B 1P7QA 3W5MA 1R46A 1JP5A 1BZ9B 3FU7A 3BPOC 2VM9A 2WKLA 5D4HA 2XTJE 1OTTD 4Y5YA 4Z23A 1B2WL 3LRGA 3E3QC 3TNNB 4GUPA 2QLVB 4N2GA 1A3QA 1QR4A 3AW5A 3GSNH 2X5PA 5HJBA 4DUXA 5I17A 3FZUD 1DZBA 3RX9A 2J4WL 5IESH 4LOUC 5B38A 3N2JA 5C9KA 1D6VH 1MF2H 2J8UF 5LWYH 3QG7H 1FDLL 4Y0GA 4JRXA 4K4KA 2FX9H 3GGWB 3QFGA 2A9NL 5IB1A 4B9FA 2ENYA 2QJDA 4L1LA 2UZPA 3PV6B 1CF8L 2DBLH 3FQXA 2VR9A 4ZFOB 4AZ8A 1DANU 2ERJB 3DPBB 3QG6A 4QTIL 4PLJC 1ACZA 2NY3C 3RAJH 9CGTA 1N2RA 3G9AB 2FTAA 2DLGA 2WQUA 1BX2A 3NPSC 3VW3H 2JJSA 2J5LC 3AT8A 2A73A 2OMBA 1SDDA 1TPXC 2AQSA 3QDJE 1E3FA 1NC2D 2HT3C 3RL2A 1KBVA 4UV7H 4FFYH 4P5RA 4TVPE 4WW1A 5C6TH 3STZA 3N43F 4HFWA 4N5EC 3H3BC 3C75A 3HZVA 2Q1EA 5JLZA 2EDXA 4XCFH 5FKPA 3BVNA 3D0AA 3VQLA 1I3VA 4GAGL 3SSGA 5G4OA 3S4SA 1XV8A 2D31B 5AW8B 2JCCB 1YEFH 2CK2A 1DANT 2HLEB 3QHFH 3BX7C 1QFWM 2ZTBA 4ZYKA 1RZPA 1RIHH 1UFGA 5E6YA 4M1DH 4YBQC 1U8QA 2QZQA 5IFHL 2YPKA 2ED7A 3CN3A 2VN5A 1F58H 1GGCL 4P9ML 3MV7B 1TJXA 5DXWA 1DJZA 2FATL 5LXGL 3QC5X 4AVJA 4NNYA 4R90H 4NKMB 1MFNA 4NQVA 1GRWA 1HYRC 5IR1B 4PJGF 4EIGB 5HDRA 1WIOA 2QV2A 3ISWA 1JGVH 1E4WL 2GABA 2XA3A 1CLCA 2C9RA 3QWRD 2BCMA 1OF0A 3LRMA 2FJGB 4WVRA 4CC0A 3BHBA 4U0RB 3OL2A 1KWGA 4G6KH 3QJXA 1ZV2A 2M26A 2P5WE 2H1PL 1R33A 3ARDA 4PVLA 1JAEA 2W88A 2CLVA 2VXUH 4PD4J 4M62H 2ICES 2MSPA 1QFWL 3OLIA 5IVZB 1UJ3B 5SWSA 3ZHFA 1ROCA 5CGYD 2GTWB 3QQ4B 1WFMA 2H1LM 2VDQB 2ZKMX 3DBXB 2ZT9C 1I4FB 2DW5A 2Z93A 4PV9B 4Q52A 4BA0A 2HJKB 3MZGB 2X3BA 3GM0A 2JKRM 4KDWA 1LP9F 3S48A 4CU6A 1ZK9A 1MY7A 1NEZB 2FD6H 2GTZA 3OTTA 2DI9A 3O45A 3WEXB 5I5MA 4LSQH 4PRIB 5L2KB 3G6AB 4W9DC 2BNRE 5T5NG 5JW4R 4V1DA 3LEYL 1S3KL 4JPVL 1A7BA 3C6LD 4DAGH 2L7UA 1OAUL 4XX1G 2JKTM 2NQ3A 5DEJA 4DP9X 4DN4H 5EC2B 4J3OF 3TA3C 4FG4A 4LCIH 4C56E 2O61B 5HI4C 1FV1B 2NY5L 5F9WC 3EYFB 2NXZD 2IXQB 4EOWL 1U2CA 3VXPB 5D4QA 1QSFD 2BSTA 1MXGA 2XACC 4GG6F 1KBGH 3Q9QA 3VSQA 1ORQA 4LP8A 1LK2B 4EBQH 1GTNA 1MJJA 4LVOC 4M7JL 5CZVH 2XFGB 4U3SB 5CJQH 4BK4A 1HK6A 2NXYD 1IJNA 1QPPA 3KBHE 1R6VA 2KLSA 3TO2A 3ZRFC 2BJML 5KVFL 1FG2A 2VDPB 5KS9A 4Q6IC 2PPCA 1IMHC 4X6BB 1E27A 4KZDL 3E1ZA 4YDIL 2YGQA 1T5XB 4GW4A 4OCMC 4OBSA 4LGRB 4CKQA 1J1OH 1WWBX 3UYOD 4FJZA 1T5WB 1X9RA 5ICXA 5H94B 3RY5A 1U8NA 4XB8A 2XN9D 3AXLA 3GXTA 5F1SA 1J5CA 4KKRA 5EO0A 4HFUH 2B1HH 3BZFA 5F7DB 2CK0L 4OT1L 4CU8A 3W39B 4NCC1 4QHLB 4JL2A 1GZQB 1Z3GL 3H9SE 1CFQB 3NP3A 3EUDA 1P7BA 3P77B 4U1SB 5FCUL 2WLYA 5CNHA 1UM4H 3FTGB 4HUXB 1F8TH 2GAZB 1QFOA 1GOGA 4DETA 1CLZL 3GS4A 4XXCC 5FUCC 5H4ZA 4OLYH 3P11H 3QZMA 1KJ3H 4XCYB 5GIRA 5F3FA 3VRIA 3UTSD 5AB9A 2XG5A 3U4AA 5I1AA 4J4PC 1T20A 4NCDA 4M1CD 8FABB 4RGMC 3UAFA 3CFCL 1MIML 1AFVH 3MOAH 2BY3A 1BVKA 3PWVB 1JTPA 2ZJSL 3OX8B 1PKQA 1R0AL 3HLAB 2B3IA 1L7IH 3DMMC 5IJKA 1S3RA 4R4ND 1EHXA 4Q6KA 3GHPA 1U21A 2G60L 3FF7A 4AQEB 4KFMA 1S7RA 2AKRB 4UQBA 1E3ZA 4OLZH 2BVTA 3MLXH 3PAVA 3BUQA 3KDMA 4OZIB 3HBQA 4LLQB 3H7LA 1XBRA 5K9OB 2IIJA 3FFCE 1FL3B 3CFEB 3DX7B 4B97A 3WEMA 4MHHI 2ITDA 2ZWZA 2AJZB 3MFFB 1OB1B 1IFRA 2CO6A 2PR4L 1IM9B 3BLPX 2D3NA 3DYOA 5DJ8A 1QRNE 1I7RB 3ARGD 1NGZB 4XP1L 4OM1L 3L8QA 5GXBB 3BQUC 3VXUD 3KYNB 5C08D 2VRQA 4GSRA 1CDHA 5DK2B 3VWKA 3HR6A 3L54A 3PQYB 2NY5C 4TUKL 3MUY1 5CD3A 2EXYC 4JY4A 1V5JA 3QDMA 2VH5L 2GSGA 2E9BA 1MCEA 3D87B 1L0XA 4I4WA 4KX8A 3V6FB 3VQ2C 4RBPK 1IFHL 1YDPB 1RU9H 1YEJH 4TL5A 5F7EH 5L6YL 1J8HB 3DOSB 5E4EC 4KPHL 3RHWK 2BSED 4FQIH 5IV2A 3M1CA 1NKGA 2F74B 4NDMB 4TQ8A 3WDIA 2UWEF 2WSPA 5I1JL 3QNZB 5DRZB 4CKVX 1D7CA 4X5QA 3TT3L 2NYYC 2A77H 1OAYL 3ULVC 2MNJB 1MCBA 2HFFB 1MRFH 4Z7QF 5K39B 4WI8A 4RMUA 2VN4A 2QPSA 4WI6A 1UYWH 2BZ7A 3BW9B 4I0PA 3MX0A 2UYLA 5IB2B 4ZUSB 3W2DH 4NN5C 5KVEH 3ARPA 3RWCB 2NW2B 2P5ED 3D4YA 1ZSHA 2HKFL 3C12A 1DQTA 5DEGA 5B1KA 3GMRB 2Z8RA 3B6SB 1G9MH 2XSKA 4HWZB 2NNRA 2OSXA 5BRZB 2VWEE 4FNSA 4IKKA 3LTVA 4UAHA 3HNTL 5CCKL 1LE5A 3HB3C 4AMWA 2AJUL 4NKDB 4MASA 4CSZA 5IJVB 1GKOA 2ARJB 2DYPB 4AC2A 5KSAA 5D1QA 1EERB 1B6DA 5JHDE 4BCXA 3NH7H 2C7UB 4R5VA 4EDWL 1IUZA 4OV5A 1B4JL 5LNEA 1WWWX 3CFUA 3KM1A 5AVZB 5BOJA 3ATFA 1GC1H 2EC9T 2VDRB 4MNQA 4X9YA 3U46B 1EJOL 3SPHA 3V8CA 4OM0H 2R56L 3R1GH 3FTUA 4GUOA 1BD2E 3MNWA 3D9AH 5D93B 4QRQA 4P49A 3N1FC 4MJ2A 4PJ7B 2G2RA 4BE5A 4JG0H 5F9JA 4S1RH 3RVVD 4K07A 3HE6D 4X8XA 5EH1A 5IHLB 1BG9A 4FN0A 3AS2A 4ISVB 1HCZA 1ZTXH 4EN3D 4HXAL 4HJ0D 2VM3A 1NAMH 4XCNB 4JHWL 1DVSA 1KCRL 3B7YA 2BNQD 3EYQD 3FU5A 4HIHB 2X9XA 2XUWA 5TDPA 5DD6A 2ERJC 4D9RE 1HZHH 2JK5A 5DI8B 4X2UA 2ZOWA 4P3DA 3ZDWA 3FTWA 3MJ8A 4JPQA 1EAPB 1XIWD 4JREB 2X6BA 2BVPA 4RH4A 3AT0A 4CU7A 1B0WA 1QO3A 3TV3H 3TVMB 5KBNC 3IS0X 5D96C 1CI3M 3NFPB 4R26L 1IAIM 4M4RB 4PJGA 1OAQH 2VLRA 5H2BB 1EEZB 2EABA 4LDOB 4ZDHA 1A1NB 1KXQA 2BP0A 4A66A 4MWFA 4L4TD 5L88L 2N3JA 4WFEE 5A7BA 4N3TA 3J27A 2VDPL 3GB7A 5BRPA 3J07A 2GCYB 1YEGH 3NIGE 5JNYA 2AQPA 4CN6A 5M95B 1MNUH 4L1BA 5D1ZA 1GGUA 4F33A 4JO4L 1FZKA 1M3IA 1QTYT 1UD6A 3T2LA 1JZ2A 1Q9LA 2UZYB 3LEXB 1D9KA 1FF5A 4XNXH 4KTEL 3ZR5A 1H15A 5IQ9A 4EIBA 1NUGA 1NJ9A 1ZPLA 4IKJA 4I3GA 4I0KA 3HI5L 3ZE0F 3K6OA 4HEPA 3P4OA 4DN3H 4JFHE 1Y1DA 1N0LB 1FYTE 2ZKHH 3K72A 3O6FD 5F96H 1G9EA 4MQ7A 2LE9A 1IAIL 3GC3A 1LP9A 3ASWA 2I9LB 1HQ4B 1BZEA 1FAIH 2F18A 1GGIL 3KWWB 4IU2B 4RMSA 5TH2A 2AQRA 1HYSD 1OSPL 1VFMA 2AEIT 1VGKA 1UB5A 2JKWA 4XMPL 3MRHA 2Z7ZA 3HUJB 4LSSH 4D9LH 3NTCL 3OC8A 5EWIH 1JI2A 1FNEB 2CHZA 4U0RC 2ATPB 1L5GB 1HTYA 1A7NL 4LCUA 3UTTE 3OR6A 3IPBA 4KWUA 3QUXC 3TT1H 2DWDA 2W95A 3ECBA 1F18A 3JVGC 4Z3GA 3ARFB 5DJZB 1MFDH 3BUIA 1L6XA 2E7DA 1JK9B 2V2XA 3AABA 1UJ3C 4U33A 4M7ZB 1WAPA 5C0DA 3DBSA 4Y4HD 2LV4A 5CEZE 4JKMA 3CC5A 4GG6A 5D8JL 5T1LB 4YL4A 4BCZA 3REVA 3HZ3A 1HEJC 1UCBH 1ZTXE 4WZ9A 1DJHA 3V5KA 2VGLM 1E4KC 3UCRA 1X7SA 3ELQA 4N0YL 4NNPL 2ZAGA 1KJVA 3ZE2B 3RGVD 3BP4B 4N8CL 2JSFA 1CQYA 5J12B 4ZX3A 5FGBC 3NJLA 4K8RL 2IWFA 1NGXB 4KDTA 1KTRL 5DZAA 4B9GA 4CC1A 3H42H 3KLLA 5T1KD 3DV4B 3W0WA 5EF0A 3N3EA 3BZEA 1QZNA 5AB1A 5HHNA 5LBSA 3PP3H 4AMXA 4JCWA 3I3DA 3COOA 1TKWB 2P45B 4MSWB 2DTML 4QD2E 2GBAA 4GO8A 4MXQC 2ESVD 1Q0YL 5TE7H 4HJGB 1EVTC 3ZMEA 4UMGA 5KJRH 3QEQA 1MFBL 1KPUB 1HEZB 3G9VA 3GMPA 5GGUB 2OYKA 4Y1AE 1K6QH 5GGSB 3H9HB 4CRPA 1JGEB 2PN5A 1KXVA 4GW1A 5EU5B 2F5AL 4BFGA 4JQIA 3GTNA 3LNHA 5HDOA 2PTVA 1BFSA 2WBKA 4WO0A 3SE4C 4NO2B 3O2VL 4RFOL 5I1DA 1BGXH 4FMKA 1IGTA 4UF7C 4LKXB 4AYFB 3HRPA 2P26A 5DD3L 4P2OB 2LLLA 3QCTL 3MGTB 1F4AA 1IC5H 3FB6B 5D7LD 4XNDA 4YDJA 1TJIL 1IZJA 1KEGH 1Z7JA 4LKCB 1RZJC 3IGAB 3LZFL 4H8VA 3MLRL 3L9YA 1B0GB 1ZKAA 4K3GA 3QS2A 2D3JA 5CHNB 5HYJB 4WW2B 1LDPH 3GS0A 3IKCB 4ZUUB 1OEZW 1GHFL 1PZ5A 1A3LL 2VNCA 1MI5D 1A6ZB 2W0PA 3BPCA 2C9UA 1OM3H 1DQQB 4OZGF 3X12A 3FSOA 5IGXH 2FQEA 3VE0A 2DIBA 3EDEA 5IW3A 2X70B 5I19L 4QRPA 5A6MA 1SYSA 3VVVA 4TL4A 5AZEH 4X9HA 3BKCH 4WGVB 1YQVL 2FGWL 3P9MB 4R8WL 3UMTA 5BW7C 1NEZG 1U93A 1BIHA 2OMTA 2R1YA 1JZGA 3D8MA 3R4RA 4UU9A 5A3ID 3MRJB 4BCYA 2EJ1A 5INDA 3E6HA 1REIA 3WNJA 4KKBD 2BW5A 1QNZL 1EV2E 1P5UA 1ZGLM 4X4MA 3W9EB 1UM6L 1WT5C 4E9TA 4JFZL 4WTXA 5DQ9A 5T1DL 3MDJA 4X6EA 1YEHH 3RX8A 2DEXX 3P0YL 5DJ6B 3C5JA 1IKFL 1NC2A 2R2EA 2XY2A 2X42A 4HZ1A 3BUYA 5CWSA 1F41A 1C16A 1II4E 3T4AA 4OF6A 2UUDK 4PLKD 4XTRC 5FKAA 4R9HA 5ALCH 3S96A 1QLFA 1NM9A 2DL9A 3C6SA 4HZLA 3CSGA 4RLDA 5CFHA 5JXEA 4K8RC 3CAFA 3BLBA 4PJEA 3FUIA 3QHTC 4XCCL 4R84A 4YX2H 1ZEAL 3DRTB 3RWIA 1P7HL 3QIBC 1U30A 1Y7VA 3O11B 3BP6B 1QLRA 4QOKB 3ARQA 3CZEA 3ZW3A 2JB5H 3Q0HA 2A5UA 3QUHA 1CD8A 4KX7A 5FFGA 1F1AA 2NDFA 3T09A 2R0KL 3CH1B 3QDGE 4CVUA 1BMZA 2VL4A 4LPCA 2ZICA 4TULL 5DC9B 5ESQB 4AG4H 4FXKC 4IOFC 4OCSH 1CD1B 4EI5B 2H47C 2W0FB 3N1QC 3M6DA 1RUMH 4AV4A 4XMLH 2ZF8A 4EKXA 2A1WH 2AJYH 1PPIA 3GO1L 4HSAC 3QNYB 3QUYD 1JYNA 2YXFA 1EAOA 3EBIA 4J3UA 1MWAA 3O9WA 1L0PA 1WIUA 4IGBA 4X80H 2WLIB 3OHXA 1KEMH 1KCUL 1VHPA 2YAHA 2FCBA 4FEIA 4HP5A 3WIFA 3IDYC 3X11A 3I6LD 4R4FL 1H0DB 1T7WA 4G9FA 3TCTA 4I13B 1FVEA 4L4VD 2A6JB 1RUPL 3PFQA 2CKBA 1A8ZA 2OMXB 1K4DA 2XXMB 2ZXCA 3G5VA 1TQTA 3KXFE 4R5TA 2N7BA 1YEKH 4QRFA 4MB4A 2CSPA 4ZS6C 3FN0H 2AV1A 4O2EB 5GRWA 3MQIA 1HEHC 3TZVB 1B4RA 3BVWA 3DO7A 4GJTB 2IADA 1BYOA 1YMMB 5KJ4A 5EG6C 1AGEB 1ZLSL 3RFRA 4OZHB 3MXWL 2MQGA 1HQRB 2ZONA 4X4YA 1GS8A 2WB7A 1OVZA 4DTGL 3IMBA 1DVXA 3BSZH 4N20A 1QBMH 1WEJL 1MCIA 3LZQA 3C6LA 4UNTA 2F8IA 5D93C 4QJ5B 3Q13A 4Y19E 1RL1A 2CJ3A 4PP1C 4BZ1H 2HTLD 1MY5A 3NMEA 3RVWC 3VD3A 1IGCL 3TIEA 5EZLB 3B9KD 2JJUA 3L81A 4H26B 4X6DB 1ADWA 3L3KB 2IDTA 5HHOB 4QO1A 1JPGB 2GB2A 4PWEA 2DV6A 1A1MA 5AQ0A 4ERSH 4GP8B 4JM4L 4YHML 2Q5BA 3INUH 3WFHA 4ZTPH 1XZ0A 5E2UH 1D7DA 3MA9L 5EZPA 4GRLC 3WG7B 5IQLA 5I6KA 4TLTA 4CADA 4HKXB 3HPLB 3TVMC 3FO2A 4H0GA 5DUML 4E42B 4E9XA 3T4YA 1UT9A 5I1GH 1JDCA 1YYMH 3MRNA 2NDGA 3V5DB 1GW6A 2OULB 3D0VB 1A9BB 1UWYA 4M4PA 4HKJB 4AXWA 3C87A 1FH5L 3QULA 4FA8A 1HI6A 2XN9A 5CBAB 1U36A 4PJIB 4YXLH 3IDGA 5EORL 3LV3B 4JN1L 4LSVL 2OZNA 4JPIB 3DIFA 3SO3B 1XFPA 3OKDA 4F80A 3NCWA 3GFUA 1R3KB 1G7PB 4U7SA 1R3IL 4E9WA 1QI3A 4FQXD 1CXKA 3H8NA 1RXLA 3Q6GH 4GMTL 2NCMA 3QNXB 5DSCB 1FFRA 1G43A 2ZG2A 1A5FL 4OJDH 2Z65C 5C0BE 1UWGH 4HG4K 4WU5B 1X6NA 2GK0A 3QI9A 4HIJA 4X9BA 5DVLA 5EUOF 5H37G 3BQVA 5MEOB 2D03L 4Y16D 3VB8A 2ED9A 2EDOA 4P4KD 4PVNA 2PYEB 1OGAB 2Y07L 4PU2A 2A2QT 5SV3A 4KRPB 3DXAA 5B3JF 2ADJB 2Q2EB 2YFNA 1TVHA 5EFIA 2BY0A 3HFFA 1OV8A 3A5VA 3CPLB 3NABH 3TYFA 5GRXG 1NCGA 2J6EA 2P4AB 2J1ZA 1NIBA 2JQZA 5KW9L 1NBCA 1F90H 1HS6A 5K1VA 2A0LC 4G6MH 3RTQC 4N28A 1PMYA 5AL8A 5J6GB 3Q44A 5KSBF 5I0VA 3S34L 5E5MB 3RL1B 1ZV5A 4L3AA 4G7QB 1Z32X 4MZIA 5LQBH 5J4MA 4M7ZC 3S2AA 4Z7AA 1V7NL 3KR3L 3SDCD 1TO4A 1QFWI 3VXRD 2XHNA 3Q8CA 5ABDE 3OAUL 2GJ6A 4OD1L 4C8XA 5GRJL 5D7KD 1I9JH 5FGCB 3DYPA 4HS8H 3WN5A 1JV2B 5E8NA 2YQ3A 2VSDA 1LO5B 1ZMYA 3IEAA 1KPRB 2DQFA 1EZVY 1E9PB 1XX9C 2JWYA 3VXUA 3MV9D 5C08A 4WUUD 1A6WH 3MRMB 3KVPA 4ZFZB 1KTDB 2QVMA 4WRLA 3EJRA 2BP8A 2PW1B 5J12C 3SDDD 2KC0A 1JUFA 4HKBB 3H85A 5ANME 1RPKA 2FRGP 2WV3A 4YHZL 2PP9A 4RAUB 2BSEA 3Q6FA 4D0DB 3GLEA 4Z7OE 4KO9A 4Z18A 5J0BA 1I1CA 1WV7T 4JUSA 3QPQC 2VDOH 1C5BH 1FN4B 4JFEA 4J6RL 3N41B 2R1WB 5T5FA 2DWEA 3BZ4B 4NJAH 3UYPB 5BV7B 2WLHA