1AE2A

Mutant l32r of gene v protein (single-stranded dna binding protein)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
86
structure length
86
Chain Sequence
b'MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQRCYVDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE V PROTEIN
publication title Analyses of the stability and function of three surface mutants (R82C, K69H, and L32R) of the gene V protein from Ff phage by X-ray crystallography.
pubmed rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 10
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ae2A00
4DR1L 2DUDA 2VS1A 3I7FA 3TQYA 2I5HA 1N36Q 4JYAQ 1LTLA 4WJ4A 4A3EH 3OW2A 3UDGA 2JJQA 3HOWH 5LMNQ 4A3BG 1JJGA 4JG2A 3H15A 4HIMA 5K36G 3CMEA 2JA5G 3K7AH 4DNIA 2KHJA 5FJ8H 3GTKH 1L1OA 3ULJA 1WCMG 3FHWA 5C0XI 1L2FA 2EQSA 4YHHL 1C0AA 1I5FA 4DV3Q 3L0OA 1IBMQ 1AE2A 4K0KQ 1FVIA 3FKIG 3OTOQ 4JI1L 3AYHB 5AJ3L 1T9HA 1D8LA 4GLAC 4LF9L 1OXSC 2EXDA 5JEAJ 1I50H 3G4SA 4BY7H 2DGYA 2CFMA 2K4KA 2VQFL 4IJLA 1Y1WH 2YYZA 3CAMA 3PUZA 4UPAA 2D0PA 5JJIA 4DV6Q 1TWAH 2XTIA 5C3EG 3M7NA 3BJUA 3CCMA 1S40A 3KF6A 2H5XA 5GROA 1VQDA 4DK3C 3I4OA 5LMNW 4A3KG 4H02A 3H3VI 3PCOB 1PVOA 4JCVE 3HKSA 2JA9A 3J81c 1QZHA 1FJGQ 2ASBA 4BXXH 4KHPQ 4DV6L 1N32Q 1KRSA 3F2BA 2AMCB 1RIPA 3EN2A 4DAYB 4R1JA 4GNXB 4DUYQ 1J5EL 1VQGA 1UE5A 3F2DA 4QJFA 1YHBA 3SGIA 4A3BH 2MO0A 4LUOA 3L2PA 2IHEA 4Y7NH 3CMAA 2C35B 1UE6A 4A3MG 4BBRG 2JA5H 2V1CC 2B63G 4R4CA 3AFQA 4LFBQ 1WCMH 1KRTA 1CUKA 1EIFA 5FLMG 1PYBA 3FP9A 1QVCA 2GN5A 2WB1E 2PQAB 1XMOL 2YTVA 4DV2L 1GO3E 3J81i 1E22A 4YWKA 3GTQH 3FKIH 4HIKA 2UUBL 4X64L 4JI2Q 1LYLA 4HJ9A 2WAQG 3U4ZA 4EQ5A 1H95A 4HJ7A 4JBJA 5HGQA 1BKBA 3PGZA 1E1TA 1SLJA 3M85A 4IJHA 3RN5A 2VZAA 1IZ6A 1V43A 3K80C 4A3JG 3D31A 3W1GA 3S1NH 2Y0SG 3H0GG 3UDIA 1E3PA 4JOIA 4X62L 3ULPA 4B3SQ 1Q1EA 3F2CA 3OYYA 2QGQA 2UUAL 4JI2L 3S16H 2EIFA 4PG3A 5IYDG 2D0OA 5C3EH 3CF5A 1G51A 3ER0A 3M4PA 2FXQA 5IWAQ 1R9TH 3I56A 4JI7Q 5IE8A 1IBKL 3T1HL 3BZKA 4A3KH 1YJ9A 2HHHQ 2A8VA 2L15A 1YI2A 2VNUD 5M5XH 4YY3L 4GKKL 2UXBL 1X9NA 2R92G 2NN6I 1X6OA 1ASYA 1C9OA 3GTGH 2R93G 1JMCA 2B29A 4JV5L 1KQSA 3K81C 2GVAA 2RF4A 3ICEA 4DR7L 3HOUG 3S2DH 1SE8A 3RZDH 3Q8DA 4JI3Q 2UXCQ 1DGSA 3UDFA 2UUCL 1CKMA 1G291 1KL9A 1OXVA 5DLQE 1VCIA 4LW1A 5J3BA 3KJOA 4DUZL 4BBRH 4X66Q 4DV7L 4A3MH 3CC2A 1PH5A 1VQBA 4LUVA 1I3QH 2B63H 1Q12A 4NXNL 3CXCA 4LF7L 4LF4L 1BVSA 1E24A 4IPHA 2JEAI 5FLMH 2ZJPA 1Q82C 1EYGA 2Z6KA 4QY7A 1AE3A 3K7UC 2YTYA 4X66L 1YJNA 4GNXC 3KOJA 3RZOH 1VQ6A 4JYAL 3GTPH 2F4VL 1IXRA 1HNZL 1NMFA 1OXUA 4GN5A 3LGJA 2QA4A 3GTMH 2PNHA 5HY6A 4P72A 3J81j 4DR4Q 4DR1Q 1O7IA 5IP9G 4A76A 2A19A 3KFUA 2IX0A 2PMZE 3STBC 1IYJB 1I94L 4A3JH 1XJVA 4JI0L 4X6AH 2CQOA 3H0GH 3CCUA 3AEVA 2AWOA 2OCEA 1QUQA 4OXPA 4GOPB 1XTDA 3TS0A 4DV1Q 1VQMA 1W2BA 4B3TL 2NVQH 2UXDL 2Z0SA 4POGA 5IYDH 4X65L 3RN2A 2K5HA 2R7DA 1JJCB 1Z47A 4GLVB 3RLFA 4YHHQ 1Z9FA 1YBYA 3TRZA 3CC4A 1Q81C 1PHJA 4NPSA 5FLXc 4DR5L 3NELA 4DV1L 2R92H 4QQBX 2K75A 3S24A 1S72A 4PZ6A 2R93H 4IOCA 2WB1G 3CCVA 1UEBA 2KCTA 4JI1Q 1VQ5A 5AJ3Q 1GD7A 5C4XG 2JA7G 3RLOA 4AQYL 4LF9Q 3J7A5 3TEHB 5EAYA 3HOUH 1P8LA 4UY8C 4BBSG 4B3RQ 2LXJA 4KLKA 5C44G 1VQNA 1X65A 2VQFQ 1WJJA 4OX9L 2UU9L 1EQRA 1U0LA 1GM5A 3KF8B 2E8GA 4PMWA 3GTOH 2KHIA 3M3YH 4JI4L 1VQ7A 2WFWA 1N34L 1XPRA 4BA2I 2F52A 3F8TA 3E9IA 4JI6L 2YV5A 4B3RL 4WJ3M 3A0JA 3A5ZB 4IPGA 3S17H 2LXKA 1PH3A 3D0FA 2CWAA 4DR3L 2K5VA 1A63A 1PA6A 3CCSA 2N3SA 1EOVA 1VQHA 4DAMA 1K3RA 4A93G 4QIWE 3F1ZA 1NMGA 4L5SA 1HNXL 1YVCA 2GVBA 3J7ZC 2OTLA 1J5EQ 5IP9H 1NJIC 1KIXA 1CSQA 1WI5A 4BY1G 1VQ9A 2E2JH 3GO5A 1J6QA 3I2ZA 1VQIA 3U58A 4L5RC 1XNRL 3KLWA 1SRUA 5ELNA 5M5YH 2Q2TA 4NXML 3TS2A 2MO1A 1EFWA 4OO1G 3G6EA 4P73A 2VW9A 4JI8L 3CCRA 1K73C 1CKNA 3AQQA 3CCLA 4ME3A 5GAEC 3CD6A 1JB7A 4B3ML 3T1YL 1XMOQ 2I5MX 3PO2G 3U4VA 4DV2Q 1K0RA 1UE7A 3UDXA 3HOYG 2JQOA 1UWVA 2HIVA 4DV0L 2K52A 3KDFA 2UUBQ 1PH8A 1CKOA 4X64Q 3A5UA 1HR0Q 1NE3A 3GD7A 5C4XH 4AYBG 2JA7H 4BBSH 4GOPC 1PH2A 5IYBG 1QZGA 2I0QA 4A3IG 5C44H 3PUYA 2MNAA 4Y52H 3CCQA 4GN4B 4XIGS 5IYCG 1S3OA 4X62Q 1QVGA 3ULLA 3S1RH 3M4QA 4J15A 2UUAQ 3L7ZC 1M90C 4LFCL 1HR0L 1EIYB 3S1QH 3PF5A 4MTNA 2YU9H 5GADC 1NY4A 1IBKQ 3IRBA 3T1HQ 1VQOA 2K14A 3JAMc 4YY3Q 4GKKQ 2UXBQ 3I4MG 4A93H 3HKZE 3S14H 2QEXA 4DV5L 2JA6G 1HH2P 2IX1A 4JV5Q 3K0XA 3G48A 4A3CG 3E0EA 5C0XG 4A4IA 4DR7Q 2KBNA 2ZTDA 1Q1BA 3HOVG 3CW2C 1L1OB 2ZJQA 1LUZA 1MJEA 4BY1H 2UUCQ 5JJLA 4UP8A 1G6PA 4A3LG 4DUZQ 4DV7Q 3PUVA 1IL2A 2ALYB 4YWLA 4NXNQ 2AWNA 1SMXA 4O0AA 4JI5L 2BH2A 2JE6I 1FGUA 3M9BA 4LF4Q 4LF7Q 4IFDG 4LF8L 3CCEA 1VQJA 1HZ9A 3JAMi 1VQKA 3I4NG 3PO2H 3HOYH 2JEBI 2K5NA 3W5OA 2F4VQ 1TWFH 1HNZQ 2N78A 1HNWL 1D7QA 3DLLA 4PZ8A 1IBLL 3NBHB 1HZBA 4IO9A 1PH6A 5IYBH 3A74A 2I5LX 1TWGH 3UE0A 4A3IH 1OXXK 1UE1A 1I94Q 4JI0Q 3KF6B 4B3TQ 2RHQB 2JA8G 2ZTCA 2UXDQ 1VQLA 2BH8A 4X65Q 2ES2A 2JK8A 4GN3B 1V1QA 1KXLA 3J80i 1K9MC 2IHFA 4GNXA 1KC8C 1B8AA 2E5LL 3GDEA 3STBD 1SROA 4DR5Q 2E2IH 3I4MH 1XMQL 1CKNB 1YHQA 4DPGA 1MKHA 4LUZA 4GLXA 2JA6H 3JC66 1Q8KA 2MFIA 4A3CH 1YITA 1EQQA 1OXTA 1I6HH 3HOXG 2VQEL 2HIXA 3E9HA 5JJKA 5LMUQ 4AQYQ 2OWOA 3KDFB 4OWWB 4OONA 4C3IH 4DR2L 1KHIA 4LF6L 2MQHA 4POFA 2RHSB 1N9WA 2PQAA 4OX9Q 4L5TA 2UU9Q 4A3LH 1X56A 3WWVA 1Q7YC 4A3FG 5M5WH 4JI4Q 2K50A 1N34Q 1HJPA 3BU2A 1XPOA 4NB3A 4JI6Q 1NBWA 1MIUA 2WAQE 5IT9c 1N33L 2RCNA 2ID0A 2XGTA 1LM0A 2CWPA 4PZ7A 4RG1A 1VQEA 2PI2E 4DR3Q 5H1SE 1SR3A 1KD1C 1BBUA 4L5QA 2PI2A 3I4NH 3B6YA 1E1OA 5C4JH 5BR8L 3PIOA 5GAGC 2Q2IA 4P71A 5JEAG 1L1OC 4HIDA 1X55A 3CQZH 3MXNB 1PH4A 1HNXQ 3EIVA 4LF5L 2HT1A 3H3VH 3HKZG 4C3JH 3VDYA 1VQFA 1PH9A 4LFAQ 3NENA 2NN6G 3I55A 1A8VA 2AHOB 2BA1A 1N36L 1XNRQ 5GQOA 4NXMQ 2JA8H 2NZOA 5LMNL 4JI8Q 4AH6A 3S2HH 1X3EA 1MJCA 4KHZA 1XPUA 4JBMA 4LFAL 4B3MQ 2IY5B 3KJPA 1E7ZA 2B3GA 3AFPA 2OQKA 4R4IA 3U50C 2NZHA 3T1YQ 2NVYH 4A3DG 2D62A 2ZM6Q 2ZTEA 1A62A 3NEMA 5IY0A 4DV0Q 1Q86C 4IFDI 2KENA 2Q2HA 1EWIA 3PF4A 4IPCA 2BA0A 5M3MG 3RNUA 4DV3L 1YIJA 1IBML 2NVXH 3HOXH 4K0KL 5ELOA 4OWTB 3OTOL 2VY3A 3HOZG 1PV4A 3PSIA 2ZM6L 4C3HH 3G71A 4TVAB 3CPFA 3CP0A 3GTJH 4A3FH 4LFCQ 5E7NA 4DV4Q 1GKHA 1V9PA 1JE5A 2R7FA 2OTJA 3MEFA 4APVA 3CPWA 1JT8A 4GKJQ 4MNOA 4RMFA 5M3FG 4R4OA 1WFQA 1XNQQ 4GKJL 4GOPA 4DV5Q 4DV4L 1AH9A 3S15H 1QUQB 1YJWA 1PYSB 1FJGL 4KHPL 3GTLH 4DR6Q 1N32L 1JJ2A 1NTGA 1PFSA 1B7YB 1Y1VG 2E2HH 1XNQL 1B70B 4DUYL 1K83H 2A1AA 1VQ4A 4HJ8A 4R4QA 4TQUS 1PH7A 2HQLA 1A0IA 3CCJA 4XTCS 1VQCA 4JI5Q 4KI0A 4LNQA 4DR6L 4OWXB 1TWCH 3ZJYC 2NVTH 4BA1I 4GS3A 4LF8Q 2CCZA 4FDBA 1HZAA 1CSPA 4LFBL 4A3DH 1N8RC 2YTXA 4JOIC 4UP9A 2WP8J 1VQAA 1SFOH 1OTCA 4JBKA 2VUMG 2R7ZG 1HR0W 3PUWA 1X3FA 4P75A 1HNWQ 3PO3G 5M3MH 3J80c 3CC7A 4ALPA 1IBLQ 1BBWA 3KYHC 1TXYA 1U5KA 4LWCA 4DK6C 4EX5A 4A3GG 2AKWB 3HOZH 1FL0A 4R4TA 4QL5A 1GVPA 1L0WA 5IP7G 1VQ8A 1HZCA 3BZCA 1K8GA 1C7YA 4A3EG 1SN8A 4IPDA 3HOWG 5C0XJ 2IT1A 1TWHH 1K8AC 2R6GA 3RLNA 4B3SL 3DM3A 4YCWA 1M1KC 2LSSA 3UE1A 2Q2UA 4QGUA 5LMUL 2E5LQ 5FJ8G 1Q46A 4JI7L 5IWAL 3PIPA 3RR5A 1KAWA 4P74A 5IYCH 5M3FH 1YHAA 1XMQQ 3EBEA 2HHHL 4IOAA 3K8AA 2CKZB 4MZ9A 5GAHC 4HJAA 1QVFA 4IFDJ 2ZJRA 4AIMA 1X54A 2VQEQ 4O2DA 3ERSX 4A75A 2Z6KC 4DR2Q 4LF6Q 4OO1I 1ASZA 3HFZB 1W3SA 1Y1VH 1WOCA 4BY7G 4DKAC 4JI3L 4HIOA 2UXCL 1Y1WG 3W1BA 4YCVA 1N33Q 3M4OH 4AYBE 4HJ5A 4JC0A 3HOVH 2F3IA 2N49A 2VL6A 4YCUA 1YNXA 1RL2A 1EUJA 4YWMA 1P16A 2VUMH 2R7ZH 1YZ6A 5BR8Q 1WYDA 4C2MH 3PO3H 2N8NA 1VQPA 4BXXG 2OQ0A 2KCMA 1VS0A 3PUXA 3TREA 4UP7A 4LF5Q 3S1MH 1X3GA 3PV0A 1Y14B 4A3GH 1YEZA 4JBWA 2ATWA 2Y0SE 1PH1A 4DR4L 5IP7H
chains in the Genus database with same CATH superfamily
1K28A 2I5HA 2WKDA 2VB3X 1NR2A 3OW2A 2JJQA 1SNMA 5LMNQ 3H15A 3GTLB 2JA5G 3RUZA 5IGEA 5FJ8H 3GTKH 1L2FA 2EQSA 4YHHL 3SVMA 3ZYYX 1I4XA 2NVTB 1KDAA 1FVIA 3OTOQ 2F0GA 4JI1L 5JJZA 2KEDA 3L9AX 2EVBA 1D8LA 5JEAJ 3U9OA 4ZLTF 4M8AA 1TY2A 1JOOA 2CFMA 2DGYA 2D0PA 5CV4A 1TWAH 2XTIA 3I90A 5C3EG 3H94A 1UAPA 1SAPA 1S40A 4A3KG 4DK3C 3H3VI 3I4OA 4DN4M 3IL8A 1FJGQ 1FYCA 3F2BA 2A74C 2AMCB 3EN2A 1VF5C 1CA6A 4R1JA 3EJIA 4GNXB 1YNNC 4ZYSA 4DUYQ 1U4RA 1J5EL 1T5XD 1CQFA 2AQ3B 3L2PA 4DU9A 4A3MG 4XYQA 2V1CC 3QWNA 5CC4A 4QCLA 1BCPD 5AFWA 1Q3LA 2K7VA 1KRTA 1TU2B 1CUKA 4ID6A 1QVCA 5IGDA 3DXJC 3MXUA 3J81i 2J0TD 3BDCA 4YWKA 4HIKA 2UUBL 4X64L 4DXFA 2VUMB 4YIJA 4JBJA 4HJ7A 4FF4A 1VMPA 4IJHA 3K80C 3S1NH 1V1PA 3W1GA 2Y0SG 3H0GG 1E3PA 2L9HA 4JI2L 2QGQA 1O7YA 2XRQD 2F0HA 3S16H 1KLGD 5IWAQ 2FXQA 1ENCA 2IX3A 1IBKL 3T1HL 2A8VA 2DN8A 2R92G 1X6OA 4KD3A 1I4HA 4N9PA 2CHBD 1JMCA 2B29A 4JV5L 1KQSA 2EJMA 5D14A 3ICEA 2LS01 4DR7L 1HFNA 3Q8DA 1G291 1KL9A 4LW1A 5EBDA 4DUZL 1LT5D 3CC2A 2B63H 1VQBA 4LUVA 4JYAQ 3CXCA 5KNBA 2JEAI 1BVSA 1E24A 5FLMH 2ZJPA 4N8FA 1PFMA 1Y1WB 1BBXC 2YTYA 4RAUC 3RZOH 4GNXC 2F4VL 1HNZL 4XQNA 2SOBA 4P72A 1GHJA 3J81j 4FF1A 3OMGA 5IP9G 5EKIA 1XJVA 5EKLA 2TMPA 5COYA 1HUNA 1XTDA 2NVQH 3ERQA 2Z0SA 4POGA 5IYDH 4RHSA 4JK1C 5DNFA 1JJCB 3HS0C 3MAQA 2XNAC 3I91A 4QQBX 2JA5B 3OMCA 2WB1G 3CCVA 1VQ5A 4DK1A 3RLOA 1HTPA 1SYEA 3TEHB 4BBSG 4B3RQ 4UY8C 1VQNA 4O42A 4KKTA 1WJJA 5C44B 1EQRA 1U0LA 1GM5A 1T5EA 4PMWA 1H9MA 4JI4L 2WFWA 5IODA 1V1PB 4JI6L 5I2YA 3A0JA 4IPGA 5IOCA 2CWAA 1PA6A 3CCSA 2EJGC 2N3SA 1EOVA 1VQHA 4DAMA 3NBHA 4HR7B 4A93B 2QCPX 1EY4A 1D5XC 5C3EB 1SXTA 2OTLA 4KN7C 5IGGA 1SMYC 1KIXA 1CSQA 2Q8TA 1VQ9A 3MFYA 1J6QA 3SHLA 3I2ZA 1VQIA 1F77A 4L5RC 1XNRL 3GTGB 3KLWA 2I07B 5E3FA 4OO1G 4K14A 2K28A 1DOLA 2KHSA 5M9OA 2VW9A 2NBFA 1K73C 3AQQA 3BDLA 5EPJA 3CCLA 2AQ2B 2I5MX 2PCFB 3TMEA 1B44D 1II3A 4A3MB 4DV0L 1I3QB 2KCNA 1CKOA 1JWMD 1VF7A 5JVG3 2RSOA 3W3AA 2B2VA 4IUUA 3CKIB 5C4XH 1HR0Q 4HMIA 4AYBB 2RA4A 5CV7A 4XT1B 1ONLA 2MNAA 2X6GA 4Y52H 2Q8RE 2F0WA 1JOKA 4X62Q 1S3OA 3GTPB 1QVGA 3M4QA 2UUAQ 1M90C 2F3VA 4B08A 3EA6A 3PF5A 5CR3A 2K14A 5IGCA 4CBVA 3JAMc 1O78A 2Y0SB 4IUPA 4YY3Q 2UXBQ 1ZKOA 1EOTA 1YNJC 1VDZA 2QEXA 4DV5L 2IX1A 3G48A 1M4VA 4A4IA 2KBNA 1B1ZA 3CW2C 1L1OB 2ZJQA 2MJ8A 2RDGA 2UUCQ 1LACA 2B2UA 5LL6S 2R92B 1EEID 2F0SA 3JAME 2A6HC 2ICIA 3C46A 2BH2A 3M9BA 3BVGA 2A68D 3CCEA 2MP1A 3OWFA 1FNVA 3PO2H 3I4NB 2IW3A 2JEBI 3GTOB 4X3SA 3W5OA 2BDOA 5E1FA 1JC7A 3NBHB 3S17B 1D1KA 3EVQA 4IO9A 1PH6A 4OELB 4IUTA 4A3IH 3KF6B 1Y8OB 4B3TQ 3A54A 1VQLA 5A35A 1HRJA 1AP0A 2BH8A 2ES2A 2JK8A 4GN3B 2L11A 4DXGA 1KXLA 1J9OA 1LT6D 2E2JB 1V1OA 3Q22A 1F9QA 1MKHA 2JA6H 4G57A 4CDDC 4A3CH 1OXTA 5JJIA 5JJKA 3KLSX 5C0XH 4AQYQ 2WV6D 4DR2L 3QOJA 1I4PA 4G7HC 4POFA 1SSOA 4OX9Q 3H91A 5CV8A 4A3LH 1X56A 4C3HB 1PTOB 4A3FG 2WB1B 1ICFB 1B2TA 3BDOA 4H44C 1EWHA 1MIUA 2XGTA 4PZ7A 2Z4HA 2CWPA 4BBSB 1QG7A 1CHPD 1VQEA 5DAUA 2K05A 5C4JH 1Y8PB 2Q2IA 1FNWA 3X3NA 1L1OC 3S15B 3MXNB 3EIVA 2HT1A 3HKZG 3VYRA 4C3JH 1VQFA 3OOCA 3AU7A 2AUKA 4LFAQ 3NENA 1BF4A 3K59A 4X3KA 5LMNL 4JI8Q 1TWCB 4C1NI 1IL8A 2IY5B 1AH9A 3T1YQ 1E7ZA 2B3GA 5DEHA 3U50C 3D4RA 4A3DB 3L3OC 2D62A 3PF4A 5M3MG 1KNEA 3OTOL 1B53A 5JPMC 3D8GA 1WTQA 3M4YA 1MSGA 1G91A 5BN5A 5KNCA 3G71A 3CP0A 3T51B 4LFCQ 1I4RA 5ELBA 1GKHA 2R7FA 2OTJA 4APVA 1JT8A 3HRZC 2K33A 4KD4A 4RMFA 5M3FG 1MSHA 1HXYD 2K6AA 4GOPA 4ULLA 4DV4L 1EY9A 1QUQB 3OPOA 3P1HA 1PYSB 1AN8A 1SNOA 5EKKA 1FJGL 3A8IE 3GTLH 1HA5A 1PTOC 4N9TA 1Y1VG 1A3TA 4DUYL 2A1AA 4HJ8A 2HQLA 3HZXA 1VQCA 4XTCS 2MPMA 2PZWA 4DR6L 1I6HB 2NVTH 3M4OB 4BA1I 2CCZA 1HZAA 3VR6A 2A69D 2F0TA 2YTXA 1GUNA 4JOIC 2VXWA 1HQRD 1OTCA 2R7ZB 3T56B 3KF8A 4ME5A 1HNWQ 3PO3G 3CC7A 5LHY1 2LFNA 1TXYA 1U4LA 1JR0D 2AKWB 2AUJD 3V05A 4K5XA 1L0WA 1JQYD 1F2MA 4A3EB 1WTPA 2IT1A 3H09A 1TWHH 2B8GA 4QIWB 3DM3A 5KGUA 3UE1A 1IW7D 5IWAL 2NUCA 1NSNS 1KNAA 3KK7A 2E75C 2ZJRA 4AIMA 3ERSX 3TZUA 1ASZA 4DA2A 1W3SA 1WOCA 4NDXA 3S9WA 4BY7B 4HIOA 3EROA 1F9PA 4QF4A 3W1BA 2NVXB 1N33Q 3VA7A 2F0IA 3HOVH 4F87A 5EBCA 4YCUA 1YNXA 2FFKB 4JVZA 2VUMH 1E2VA 1ESFA 1EYCA 4CKEA 2M00A 1VQPA 3PUXA 1VS0A 3Q0AA 4LF5Q 1CI3M 1RTOA 1X3GA 3NUCA 1Y14B 3PV0A 3IKJA 4RKBA 2IPKD 1PH1A 5IP7H 2EY6A 3I7FA 4XQJA 4TRDA 1LTLA 4A3BG 3TN2A 5K36G 3CMEA 1S5DD 3HKZB 3WDNA 2KHJA 4C1NK 4HSVA 1HPCA 1A2TA 2E2HB 2B2TC 1WCMG 3FHWA 1DM0B 5C0XI 4DV3Q 1KDCA 1S4ZA 3X3MA 5CBAE 4K0KQ 2K01A 3FKIG 3GTQB 2F0LA 2F0DA 3KLRA 1FR3A 1SFOB 3KBGA 2D9UA 1V8QA 2L1BA 4KKUA 2XVSA 2QILA 4R8NA 1Y1WH 4IJLA 5C6AA 2KOLA 4UPAA 4DV6Q 1B9MA 3CHBD 4V190 1H9RA 1R9TB 1JOQA 3VYTA 1VQDA 4H0LC 5LMNW 3O13A 2A6EC 3NWSA 3VA5A 1B50A 4JCVE 1QZHA 3J81c 1CHQD 1N32Q 1KRSA 4IUVA 5M3FB 4DAYB 2MUYA 2SNSA 3RZDB 1UE5A 1STHA 3SGIA 2CW0C 1UE6A 4BBRG 2JA5H 4IALA 2B2WA 3J81E 4CDCC 1Y1VB 1EIFA 4RA8A 2GN5A 1X3QA 2PQAB 5FKAC 1NCVA 4TKOB 3VYSA 2B2YA 4KY6A 3GTMB 1H9SA 3U4ZA 3FPUB 1EZ8A 2WAQB 2HCCA 3SXHA 3NQIA 3PGZA 3RN5A 1EFID 2F0OA 2VZAA 2F0UA 3J80L 4A3JG 3D6CA 3D31A 3PO3B 4KHVA 5J22A 1ILQA 3FDTA 4X62L 4B3SQ 2UUAL 3MWYW 2EY2A 4K2KA 2EYLA 3CF5A 5C3EH 5LMUQ 1TS4A 1U9RA 4A3KH 1YI2A 2VNUD 1G8ZD 4YY3L 2UXBL 1ASYA 3GTGH 5A2QE 2R93G 2EOTA 1JCKB 2F0MA 4ZKCB 1SE8A 1EU3A 4JI3Q 1DGSA 2UUCL 2HCIA 5J3BA 1SYBA 4KY5A 4A3MH 3I4LA 1I3QH 3M3YB 2PPBC 3KLSA 2QW7A 1RTNA 3N6RA 1M8AA 1Q82C 1GHKA 1LTRD 4QY7A 1RKNA 2NYZD 4X66L 1YJNA 3KOJA 1XXGA 1VQ6A 3GTPH 3T53B 1R4PB 1EY8A 1DOMA 4LJZC 4U68A 1ICWA 3G6JB 3E3XA 4DR1Q 1Y8NB 5D3DA 2L5TA 3BS1A 1PRTD 3KFUA 2B8FA 2IX0A 2PMZE 2K03A 3STBC 1LT3D 3CCUA 3H0GH 2AWOA 1D1IA 2F0KA 3TS0A 4KK7A 4OXPA 4ABNA 4B3TL 1BQQT 2K32A 3K0YA 4HAEA 2K5HA 2R7DA 1Z47A 3RLFA 1WTWA 4CJ1B 1Q81C 4A3BB 1QE6A 4DV1L 1C4QA 2R92H 5FOBB 4IOCA 1GD7A 1WCMB 3DEOA 4EQNA 2JA7G 4FP5D 4AQYL 5JPNC 5C44G 1HFGA 3QR8A 2VQFQ 2NB0A 4OX9L 2O2LD 2E8GA 1ENFA 3FKIB 3GTOH 5C4HA 1PTOF 3E9IA 4WJ3M 3QJYA 2QKIC 3S17H 3D0FA 1A63A 2HQEA 2LMCB 3DWPA 3NTIA 1K3RA 1EYDA 4A93G 3A7AB 3TP8A 4KN4C 1E2ZA 3F1ZA 3QB3A 1NMGA 5D65A 2EYPA 4CDFC 3J7ZC 4EQOA 5IP9H 1NJIC 1X32A 1TR5A 4BY1G 1GUTA 5M5XB 2EZVA 2E2JH 1STBA 3U58A 2BOSA 3DWAA 5M5YH 4DNRB 2MO1A 3G6EA 2FMMA 4P73A 4JI8L 5FO8B 3CCRA 2EYJA 1CKNA 1YNND 3T1YL 1KDBA 4DV2Q 1UE7A 2RCFA 3UDXA 2JQOA 4BBRB 1UWVA 2HIVA 3HOYB 1G2TA 1PTOH 1U4PA 1NNXA 1RCVD 4WORA 3VR3A 3GD7A 4AYBG 4BBSH 1ZEQX 4H13C 2I0QA 1QZGA 4J1MA 1NUCA 2G9DA 1LTGD 2R3ZA 3CCQA 4GN4B 4K8JA 4XIGS 5IYCG 3S1RH 1OO9B 4J15A 1D5ZC 3L7ZC 5CORA 4LFCL 1WTRA 1EIYB 3IFTA 3D6WA 3TSSA 1QCBD 2G9HD 2KEEA 4A3JB 4HSPA 2EPBA 1PMRA 1FGBD 1HH2P 3SDZA 3K0XA 3E0EA 3AMUA 2ZTDA 4RHRA 1LUZA 1QOHA 4DV7Q 2R93B 1IL2A 2ALYB 4OO1H 5M5WB 4O0AA 1SMXA 2JE6I 1FGUA 1SJED 4RFBA 4IFDG 1PYWD 3E6ZX 3CRLC 1HZ9A 1EY6A 3I4NG 3TBIB 1HNWL 3MXGA 3SR1A 2A5HA 3DLLA 2KJXA 1Z6HA 1HZBA 3K57A 1L0YB 2N55A 1HHVA 2I5LX 3DM1A 1I94Q 3P20A 1K8MA 4WRDA 2QDBA 3OWEB 2XSCA 2PZUA 5C5LA 2Z8LA 4X65Q 1XX8A 1UEAB 3J80i 1K9MC 5CYUA 2DY7A 1CM9A 1B8AA 3GP7A 5C3XA 4MN3A 5IIFA 1CKNB 1YHQA 2C5CA 4GLXA 5BN4A 3JC66 4CDEC 1I6HH 3E9HA 3HOXB 4OONA 1EIGA 1DOKA 2RHSB 5BN3A 2UU9Q 4C3HG 4XT3B 3WWVA 1DZ1A 3K5MA 2K50A 1SNCA 1N33L 2JA7B 5IT9c 1E0BA 2ID0A 1LM0A 2DNEA 4DR3Q 1W6KA 1SR3A 1F9SA 5JEAG 3C1EA 3S1QB 5F2DA 1HNXQ 1SDFA 4LF5L 2LY7A 3NSWA 5IT9E 1PH9A 2NN6G 3Q6SA 4HTHA 1STYA 4NXMQ 1XYIA 2NZOA 1EL0A 2VB2X 4QB4A 3I72A 1X3EA 4PNYA 1XPUA 3E5SA 4RWSC 1TY0A 4B3MQ 4BY1B 1SMYD 1TS2A 4A3DG 3R3OA 2O4XA 2ZM6Q 3NEMA 3WOFA 4IFDI 4DAVA 1EWIA 4IPCA 3RNUA 3VR2A 4DV3L 1ESRA 1YIJA 2NVXH 4K0KL 5ELOA 1SE4A 5KYLA 2VY3A 3HOZG 2F0FA 4NP5A 5HURA 3CPFA 1TWFB 4A3FH 1A15A 3NTHA 5E7NA 2XWJB 1JE5A 2IJ0A 1Y69U 1TWGB 1XNQQ 1EWCA 3D4DA 1SNDA 3BYTB 3DEPA 1QILA 1N32L 3JAML 3LWEA 1NTGA 2DJFC 2Z4IA 2EE1A 3OHXC 4X3TA 2HDMA 2E2HH 2E2IB 1TS5A 2N88A 2ZXPA 1A0IA 3T16A 3CCJA 4JI5Q 1YNJD 4I7AA 4LF8Q 1IKLA 1CSPA 5JOBA 1N8RC 4KJNA 1SFOH 4UP9A 4JBKA 1VQAA 2R7ZG 1JB3A 3PUWA 4FXDA 3K5NA 3SK8A 5IGFA 2A6HD 5M3MH 1IBLQ 1RDPD 3TDQA 1FD7D 4EX5A 4DK6C 1STNA 1FL0A 2XRSD 1HZCA 1ZXTA 1K8GA 4A3EG 3PQIA 3CQZB 4G4KA 3HOWG 2Z1CA 5C0XJ 1PLFA 2IL8A 1KTKA 4B3SL 2XIWA 1NR4A 3A8JE 5LMUL 4FYDA 1Q46A 3GTKB 5M3FH 1KAWA 2F3WA 5HGTA 2F0VA 1S5BD 2Z6BA 4E6IA 5GAHC 4HJAA 1QVFA 3S2HB 2K5DA 2VQEQ 4A75A 2H1EA 4L63B 3PIO3 4N8X1 4OO1I 1Y1VH 2OEOA 1F9RA 4BY7G 4JI3L 1X3PA 2ZT9C 2E74C 3OW7A 2F3IA 2N49A 1RL2A 2DJGC 4I7ZC 1YZ6A 5BR8Q 2WKCA 3PO3H 4BXXG 2OQ0A 2KCMA 4UP7A 4HCEA 2L4NA 1YEZA 4JBWA 2ATWA 1XWEA 4ZAIA 4DR1L 3TQYA 2K5WA 4WJ4A 3UDGA 4JG2A 4HIMA 4IQZA 4HCSA 2O5JC 1PFBA 3K7AH 4DNIA 2P5ZX 3DUZA 1U4MA 1K83B 1I4QA 2F1MA 2JN4A 3WOEA 4ZK9B 1DJRD 3A8KE 1AW7A 1CK1A 3SK6A 4EQPA 3AYHB 5DM73 1T9HA 3C2PA 1OXSC 2EXDA 2VQFL 4KJOA 2YYZA 3CAMA 3PUZA 1RHPA 1JORA 1EY0A 3HOZB 3M7NA 1F2LA 5GROA 1PVOA 1PFNA 2EYHA 3R8BA 3HKSA 4KHPQ 2QF7A 3BVMA 2NTTA 1TKWB 3RD4A 1VQGA 1SE3A 1LABA 2J7ZA 2B2VC 4A3BH 2J4XA 3TP7A 2C35B 5K36H 2K04A 1UNSA 3MC0B 1PTOD 1WCMH 5T1IA 4FNFA 1PYBA 4ZKBB 2HDLA 1RODA 4DV2L 2OF1A 5FK9C 1E22A 3BG3A 3PIP3 3RZOB 4NMZA 1I4GA 3FKIH 4JI2Q 1LYLA 4HJ9A 2WAQG 3DMUA 5CV6A 1H95A 5HGQA 3QO2A 5I9OA 1SLJA 3M85A 3UDIA 1HA6A 2OT2A 3ULPA 3W2DA 3F2CA 3OYYA 2NVQB 2EIFA 4PG3A 1AFPA 4JI7Q 3ER0A 2B2UC 3M4PA 5D3IB 3RMHA 1BXTA 3BZKA 2HHHQ 2L15A 2R61A 3HOWB 5M5XH 3QG1A 4L6TB 1C9OA 4KTAA 3ITPA 4KMUC 4OIKA 2C9OA 4PV1C 3SEBA 3VYUA 3HP3A 3HOUG 2BE5C 4X3UA 1CKMA 1OXVA 5DLQE 1KLUD 5L37A 1GUWA 4DV7L 4BBRH 1PH5A 1KAAA 1I50B 3NXWA 2Z6KA 1A2UA 3K7UC 2XN9C 4JYAL 1IXRA 1NMFA 1OXUA 4GN5A 2QA4A 1WTOA 5HY6A 4R9WA 4DR4Q 4RCNA 2EY5A 4FO2A 4A76A 1I94L 1IYJB 4OL7A 4G7ZC 4A3JH 2CQOA 4GOPB 1VQMA 4LMQD 4MHEA 5TSSA 3E0JA 4X65L 3RN2A 4GLVB 1Z9FA 2L55A 3TRZA 3CC4A 1H9KA 1PHJA 5FLXc 4Y7NB 3DWQA 4LK1C 1CZWA 2HD3A 4PZ6A 2R93H 1EQTA 2KCTA 4FXKC 5AJ3Q 5C4XB 4LF9Q 1SNQA 5KEEA 2UU9L 3EFXD 3KF8B 2KHIA 5FLXE 1VQ7A 1KABA 1GUSA 2YV5A 4B3RL 2KQ3A 3TZDA 4DR3L 2K5VA 4O1NA 3SK5A 2L12A 4HN7A 4L5SA 3D3RA 4Q0FA 2CH4A 1HNXL 2GVBA 4CHTB 1J8IA 3A55A 5CGKA 3J81L 2CQAA 2A6ED 1DYQA 3MVVA 2Q2TA 4NXML 1EFWA 1NAPA 2I46A 1QB5D 3S2DB 5GAEC 3CD6A 4B3ML 1XMOQ 1HTLD 3PO2B 3HOYG 2CW0D 2K52A 3KDFA 1DD2A 2F0PA 1NE3A 2JA7H 4GOPC 5IYBG 1CTMA 4DGZA 3CU7A 1ZYRC 5C44H 3PUYA 4OEMB 3KUPA 3K5OA 4UHVA 1HR0L 3S1QH 1ILPA 3NK9A 5GADC 1NY4A 1PRTB 3IRBA 4F88A 5A2QL 4DFAA 4QUCA 4GKKQ 4OHJA 3I4MG 4A93H 2Z9HA 4B9WA 2B39A 3M7GA 3OIPA 2JA6B 3DHQA 5ELEA 1SYDA 2EJFC 1Q1BA 4C3IG 3UI2A 3HOVG 2JP1A 1MD2D 1MJEA 4BY1H 3BVZA 4UP8A 1G6PA 4EGVA 4L8JA 3PUVA 3V96A 5LL6X 4YWLA 4NXNQ 4JI5L 4LF7Q 4LF4Q 1C8CA 3HOUB 4LF8L 3EQLC 1VQKA 2RDFA 4TSSA 2K5NA 1TWFH 4FF2A 1D7QA 4PZ8A 1IBLL 3A74A 3C3LA 1TWGH 1OXXK 1UE1A 4JI0Q 3I3CA 3D4WA 2IWHA 2RHQB 2JA8G 2ZTCA 2UXDQ 1CQVA 1V1QA 4PMBA 4NW2A 2E76C 4U673 4GNXA 4B9XA 1KC8C 1ET9A 4DAPA 3GDEA 5KNDA 3STBD 1SROA 4DR5Q 2E2IH 1RD9D 4DPGA 2JSOA 4LUZA 1Q8KA 3I70A 1YITA 3HOXG 2VQEL 2HIXA 1BR9A 4ODGA 2OWOA 3KDFB 1MHWC 1KHIA 2MQHA 1N9WA 2L0CA 1E2WA 1IYVA 1BCPB 1SYGA 2XWBB 1N34Q 4MIUA 4CKCA 1XPOA 1NBWA 2H4OA 3R93A 3K6OA 4IFDH 4DK0A 5H1SE 1H9SB 1BBUA 3J7AF 1PZID 3ND8A 3I4NH 1E1OA 4K6DA 5BR8L 4DNTB 1G6ZA 1X55A 3CQZH 2KECA 2YU9B 1CA5A 1EEFD 2V4DA 3S14B 5GQOA 5CV5A 4G7OC 2E2DC 3A56A 5G3LF 3AB9A 3S2HH 5ELCA 1SYCA 2CH4W 4JBMA 4LFAL 3KJPA 5I2XA 2NZHA 2SDFA 2SNMA 5IY0A 2Q2HA 1PZKD 2BA0A 1K0SA 1S5FD 3I8ZA 2RKSA 1PV4A 3PSIA 4C3HH 1Q90A 1STAA 1SEBD 3FPPA 5EJWA 1WTVA 2EY1A 4DV4Q 1TWHB 2X6LA 1V9PA 1LTID 3MEFA 3ND9A 2NTSA 4MNOA 2PQEA 4F8MA 4EVOA 4H7BA 2B2WC 4WFN3 5JEAH 2PMZB 3S15H 2RVLA 1B3QA 4KHPL 4DR6Q 1BCPC 1AZQA 1RF2D 1JJ2A 1PFSA 1DONA 2NN6H 3I4MB 1K83H 2B2YC 4R4QA 4KI0A 4LNQA 4JPBW 4OWXB 1A3UA 1TWCH 3NPPA 3SK4A 3ZJYC 4GS3A 4C3IB 3HOVB 4FDBA 1Q8IA 3K58A 1SJHD 4A3DH 4QUFA 1HR0W 2PYKA 4P75A 4ZUJA 2X69A 3KBXA 4ALPA 4UDUC 3J7YW 2BCOA 3KYHC 1U5KA 4LWCA 3LX0A 4A3GG 3HOZH 1JWSD 1CZGA 4ILWA 1R4QB 4FVMA 1K8AC 2R6GA 3RLNA 4YCWA 1M1KC 1GJXA 2E5LQ 1EZ6A 5FJ8G 4JI7L 2FMCA 3RR5A 3NE5B 1GUOA 1YHAA 1XMQQ 2HHHL 2KCCA 2JA8B 5JAVA 5CV9A 4IOAA 3K8AA 2CKZB 1X54A 4O2DA 4CJ0B 2G5DA 4DF7A 1K3BC 4LF6Q 2NZ1D 3HFZB 2NVYB 3LWUA 3GQBA 5FO9B 1EIHA 1D5MC 4YCVA 3M4OH 1STEA 4AYBE 4HJ5A 3IFDA 2VL6A 1O7ZA 1P16A 1PZJD 3HEJA 1B3AA 5E4WC 5ELFA 4YWMA 2R7ZH 3FEWX 4I65A 3GTJB 4K5WA 5IT9L 2N8NA 3TREA 2RSNA 2F0JA 2Y0SE 4DR4L 1LV9A 2DUDA 1QWYA 2VS1A 3NP8A 1N36Q 1TIID 4A3EH 3HOWH 4IN3A 1JJGA 3F2UA 2PW7A 3H6MA 5DM63 1SYFA 2WIIB 1L1OA 3ULJA 1EYAA 4RGNA 1C0AA 1I5FA 4ZQ3A 3A7LA 3L0OA 1IBMQ 1AE2A 2ENBA 2JYOA 1BUVT 5C4ZA 5AJ3L 4GLAC 4LF9L 3G4SA 1D6EC 1G2SA 1I50H 3MA2B 3FMCA 1A3VA 4J8QA 3H3VC 4BY7H 2K4KA 3NHHA 1LO5D 1S5CD 4RCOA 2F0QA 5KRUA 3BJUA 1C48A 3CCMA 3KF6A 2H5XA 4GKJQ 4A3KB 4H02A 3PCOB 2JA9A 2ASBA 4BXXH 1UUPA 4DV6L 3QIAA 5E4XA 2MGSA 1RIPA 4CKBA 3HGBA 3MZ5A 1MBYA 3F2DA 4QJFA 1YHBA 2MO0A 4LUOA 3CMAA 2IHEA 4Y7NH 1A6XA 1VMCA 2B63G 4R4CA 3AFQA 4K2LA 1W6JA 4LFBQ 4OGQC 1QNKA 5FLMG 4XYOA 3FP9A 2WB1E 1XMOL 5EQ0A 2YTVA 5JVH3 2A73B 1GO3E 2F03A 2LKVA 3GTQH 1GXDC 4EQ5A 1BKBA 1E1TA 1TQOA 3BZDB 1IZ6A 1V43A 4C2MB 4CJ2C 5C5MA 3H0GB 3S1MB 4JOIA 3MXNA 5K5PA 1Q1EA 4A3GB 3P7JA 5IYDG 2D0OA 1G51A 1R9TH 3I56A 5EGTA 5IE8A 1YJ9A 1QJOA 1LTTD 1PRTF 4GKKL 4V0BA 1X9NA 2NN6I 1STGA 4RKLA 2A68C 3K81C 2GVAA 2RF4A 3S2DH 3RZDH 2UXCQ 1B9NA 3UDFA 2F0EA 2NWGA 1VCIA 3KJOA 4X66Q 4RGMA 2D5DA 5J39A 1Q12A 4NXNL 4BS9A 4LF7L 4LF4L 1B4OA 4IPHA 1EYGA 1ET6A 3V2TA 1AE3A 2JXMB 2Q8IB 4M1UB 4HMJA 1TWAB 1EY5A 4ZUIA 2O5IC 3GTMH 3LGJA 2PNHA 1O7IA 2A19A 4XDXA 3HG9A 2RBMA 4JI0L 4X6AH 1O7LA 3AEVA 2OCEA 1QUQA 1W2BA 2PW5A 4DV1Q 5M5YB 2UXDL 3NBIA 1PDQA 4Q5VA 2KUMA 1DCZA 1D2BA 3U9SA 4YHHQ 1YBYA 1Z7TA 4NPSA 5I6YA 2K1BA 3NELA 4DR5L 3MHBA 1DXMA 2K75A 3S24A 4ZRZA 1IYUA 1EU4A 1S72A 1UEBA 4JI1Q 2HUGA 4K6LA 5C4XG 1LTAD 3J7A5 5EAYA 3HOUH 1P8LA 2LXJA 4KLKA 1X65A 2B2TA 3BYYB 1F2YA 1SBBB 3M3YH 4BA2I 3S1RB 1N34L 1XPRA 2F52A 1BCPF 3F8TA 3A5ZB 4PQXA 2LXKA 1PH3A 1H9JA 3S1NB 2ZXRA 4CGYB 4QIWE 1SE2A 3S16B 1JE4A 3R2TA 3NQTA 1YVCA 1J5EQ 5CBEE 3IAYA 5NUCA 1WI5A 1LT4D 3GO5A 4K5VA 5ELNA 1SRUA 3CRKC 3TS2A 2F0NA 1TVXA 4ME3A 1JB7A 3PO2G 3U4VA 4K8IA 1K0RA 1ML0D 2B63B 2EXZA 2UUBQ 1PH8A 4X64Q 3A5UA 2FINB 1S5ED 1TS3A 2K5QA 1CFMA 1PH2A 3VR5A 4A3IG 2D2CC 3VR4A 3ULLA 2EDGA 4KV6A 5G3LD 2FHTA 3GV3A 4MTNA 2YU9H 1IBKQ 1BO0A 3T1HQ 1VQOA 3NWTA 1WVLA 1PXUA 4ZCKA 5FO7B 3HKZE 3S14H 3R2IA 4IURA 4UAIA 2JA6G 3J7AV 4JV5Q 4A3CG 2DNCA 5C0XG 4DR7Q 2M9VA 4IUNA 2A69C 4QMGA 3FVQA 4S3SA 5JJLA 2ZXOA 4DUZQ 4A3LG 1LTBD 4XXEA 1BDOA 2AWNA 3G7LA 1WD1A 4IUQA 1RJTA 3MFGA 4IZ8A 2TSSA 1VQJA 3JAMi 2BE5D 3NTKA 2CVRA 3TP6A 3HOYH 2F4VQ 1HNZQ 2N78A 1IW7C 4C3JG 5IYBH 3UE0A 2GA4B 5I9PA 4RGOS 4DAYA 2PNRC 2IHFA 1HUMA 3OIQA 2E5LL 5T1GA 2MHVA 3I4MH 1XMQL 5EPKA 4F7XA 5J1ZA 1SNPA 2MFIA 1EQQA 5ELDA 3OSOA 4OWWB 3N52A 3P75A 3Q23A 4C3IH 4LF6L 5FLXL 2PQAA 1LTSD 3GV6A 4L5TA 1Q7YC 1HCZA 5M5WH 4JI4Q 4A3FB 4FXGC 1HJPA 3BU2A 3URYA 4NB3A 4XQQA 2FJ2A 2WAQE 4JI6Q 2RCNA 4RG1A 2PI2E 4Z9CB 1KD1C 1EY7A 4L5QA 2OXPA 2PI2A 3B6YA 1EQVA 3PIOA 5C3WA 5GAGC 4P71A 4HIDA 1PH4A 4RGTA 2RDHA 3H3VH 3VDYA 4HEDA 2QDLA 3I55A 1A8VA 2AHOB 2BA1A 2ICEC 4MTKA 4PMCA 1N36L 1XNRQ 2EYOA 1MGSA 2JA8H 1BOSA 1TT2A 4AH6A 1MJCA 1MI2A 4KHZA 2QEJC 3AFPA 2OQKA 4R4IA 2NVYH 4KY7A 1AEXA 2ZTEA 1A62A 4DV0Q 1Q86C 2KENA 1JICA 5M3MB 1IBML 1CT1D 1K8OA 3HOXH 4BWGB 4OWTB 5CMDA 5I4DA 5EPLA 2EYFA 2ZM6L 4C56C 2SEBD 4TVAB 3GTJH 2WACA 2KVMA 3T13A 3CPWA 3MTSA 3Q24A 1WTXA 5I6WA 2EYMA 4A3IB 1IHZA 4RH6A 1ZYRD 4R4OA 1WFQA 4GKJL 4WJWA 1XTCD 4DV5Q 3ONAB 1YJWA 4NKLA 1GUGA 3C1FA 2DY8A 1WD0A 2KA7A 1B7YB 1XNQL 5KIXA 1B70B 4GZYC 1VQ4A 4TQUS 1PH7A 1L0XB 3FRPB 1LLRD 2RQXA 5ISRA 3MEHA 4LFBL 4R8IA 2VUMG 2WP8J 3MXPA 1X3FA 1I6VC 3J80c 1GOZA 1BBWA 1FNUA 2M2LA 4P2CB 5IGBA 4R4TA 5C4JB 4QL5A 1GVPA 5IP7G 1VQ8A 4JW0A 2AQ1B 3BZCA 1C7YA 3QOLA 1SN8A 1JWUD 4IPDA 3TP5A 4KKSA 1HQMC 2BDNA 4C3JB 2LSSA 3J80E 2Q2UA 4QGUA 3K7AB 3PIPA 4P74A 5IYCH 1F2ZA 3EBEA 4J6HA 4MZ9A 4IFDJ 3K5LA 2WINB 2Z6KC 4DR2Q 1QNUA 2PZTA 2PO4A 1O80A 3LNNA 3T4AC 4DKAC 2UXCL 3SE0A 5KYIA 1Y1WG 1BNZA 2F4IA 4JC0A 3PMFA 1ENAA 1EUJA 1PRTC 1WTHA 4LAAA 1IKMA 1WYDA 3I73A 4C2MH 1AZPA 3S1MH 4FF3A 4A3GH 4OIJA
chains in the Genus database with same CATH topology
4DR1L 2DUDA 2VS1A 3I7FA 3TQYA 2I5HA 1N36Q 4JYAQ 1LTLA 4WJ4A 4A3EH 3OW2A 3UDGA 2JJQA 3HOWH 5LMNQ 4A3BG 1JJGA 4JG2A 3H15A 4HIMA 5K36G 3CMEA 2JA5G 3K7AH 4DNIA 2KHJA 5FJ8H 3GTKH 1L1OA 3ULJA 1WCMG 3FHWA 5C0XI 1L2FA 2EQSA 4YHHL 1C0AA 1I5FA 4DV3Q 3L0OA 1IBMQ 1AE2A 4K0KQ 1FVIA 3FKIG 3OTOQ 4JI1L 3AYHB 5AJ3L 1T9HA 1D8LA 4GLAC 4LF9L 1OXSC 2EXDA 5JEAJ 1I50H 3G4SA 4BY7H 2DGYA 2CFMA 2K4KA 2VQFL 4IJLA 1Y1WH 2YYZA 3CAMA 3PUZA 4UPAA 2D0PA 5JJIA 4DV6Q 1TWAH 2XTIA 5C3EG 3M7NA 3BJUA 3CCMA 1S40A 3KF6A 2H5XA 5GROA 1VQDA 4DK3C 3I4OA 5LMNW 4A3KG 4H02A 3H3VI 3PCOB 1PVOA 4JCVE 3HKSA 2JA9A 3J81c 1QZHA 1FJGQ 2ASBA 4BXXH 4KHPQ 4DV6L 1N32Q 1KRSA 3F2BA 2AMCB 1RIPA 3EN2A 4DAYB 4R1JA 4GNXB 4DUYQ 1J5EL 1VQGA 1UE5A 3F2DA 4QJFA 1YHBA 3SGIA 4A3BH 2MO0A 4LUOA 3L2PA 2IHEA 4Y7NH 3CMAA 2C35B 1UE6A 4A3MG 4BBRG 2JA5H 2V1CC 2B63G 4R4CA 3AFQA 4LFBQ 1WCMH 1KRTA 1CUKA 1EIFA 5FLMG 1PYBA 3FP9A 1QVCA 2GN5A 2WB1E 2PQAB 1XMOL 2YTVA 4DV2L 1GO3E 3J81i 1E22A 4YWKA 3GTQH 3FKIH 4HIKA 2UUBL 4X64L 4JI2Q 1LYLA 4HJ9A 2WAQG 3U4ZA 4EQ5A 1H95A 4HJ7A 4JBJA 5HGQA 1BKBA 3PGZA 1E1TA 1SLJA 3M85A 4IJHA 3RN5A 2VZAA 1IZ6A 1V43A 3K80C 4A3JG 3D31A 3W1GA 3S1NH 2Y0SG 3H0GG 3UDIA 1E3PA 4JOIA 4X62L 3ULPA 4B3SQ 1Q1EA 3F2CA 3OYYA 2QGQA 2UUAL 4JI2L 3S16H 2EIFA 4PG3A 5IYDG 2D0OA 5C3EH 3CF5A 1G51A 3ER0A 3M4PA 2FXQA 5IWAQ 1R9TH 3I56A 4JI7Q 5IE8A 1IBKL 3T1HL 3BZKA 4A3KH 1YJ9A 2HHHQ 2A8VA 2L15A 1YI2A 2VNUD 5M5XH 4YY3L 4GKKL 2UXBL 1X9NA 2R92G 2NN6I 1X6OA 1ASYA 1C9OA 3GTGH 2R93G 1JMCA 2B29A 4JV5L 1KQSA 3K81C 2GVAA 2RF4A 3ICEA 4DR7L 3HOUG 3S2DH 1SE8A 3RZDH 3Q8DA 4JI3Q 2UXCQ 1DGSA 3UDFA 2UUCL 1CKMA 1G291 1KL9A 1OXVA 5DLQE 1VCIA 4LW1A 5J3BA 3KJOA 4DUZL 4BBRH 4X66Q 4DV7L 4A3MH 3CC2A 1PH5A 1VQBA 4LUVA 1I3QH 2B63H 1Q12A 4NXNL 3CXCA 4LF7L 4LF4L 1BVSA 1E24A 4IPHA 2JEAI 5FLMH 2ZJPA 1Q82C 1EYGA 2Z6KA 4QY7A 1AE3A 3K7UC 2YTYA 4X66L 1YJNA 4GNXC 3KOJA 3RZOH 1VQ6A 4JYAL 3GTPH 2F4VL 1IXRA 1HNZL 1NMFA 1OXUA 4GN5A 3LGJA 2QA4A 3GTMH 2PNHA 5HY6A 4P72A 3J81j 4DR4Q 4DR1Q 1O7IA 5IP9G 4A76A 2A19A 3KFUA 2IX0A 2PMZE 3STBC 1IYJB 1I94L 4A3JH 1XJVA 4JI0L 4X6AH 2CQOA 3H0GH 3CCUA 3AEVA 2AWOA 2OCEA 1QUQA 4OXPA 4GOPB 1XTDA 3TS0A 4DV1Q 1VQMA 1W2BA 4B3TL 2NVQH 2UXDL 2Z0SA 4POGA 5IYDH 4X65L 3RN2A 2K5HA 2R7DA 1JJCB 1Z47A 4GLVB 3RLFA 4YHHQ 1Z9FA 1YBYA 3TRZA 3CC4A 1Q81C 1PHJA 4NPSA 5FLXc 4DR5L 3NELA 4DV1L 2R92H 4QQBX 2K75A 3S24A 1S72A 4PZ6A 2R93H 4IOCA 2WB1G 3CCVA 1UEBA 2KCTA 4JI1Q 1VQ5A 5AJ3Q 1GD7A 5C4XG 2JA7G 3RLOA 4AQYL 4LF9Q 3J7A5 3TEHB 5EAYA 3HOUH 1P8LA 4UY8C 4BBSG 4B3RQ 2LXJA 4KLKA 5C44G 1VQNA 1X65A 2VQFQ 1WJJA 4OX9L 2UU9L 1EQRA 1U0LA 1GM5A 3KF8B 2E8GA 4PMWA 3GTOH 2KHIA 3M3YH 4JI4L 1VQ7A 2WFWA 1N34L 1XPRA 4BA2I 2F52A 3F8TA 3E9IA 4JI6L 2YV5A 4B3RL 4WJ3M 3A0JA 3A5ZB 4IPGA 3S17H 2LXKA 1PH3A 3D0FA 2CWAA 4DR3L 2K5VA 1A63A 1PA6A 3CCSA 2N3SA 1EOVA 1VQHA 4DAMA 1K3RA 4A93G 4QIWE 3F1ZA 1NMGA 4L5SA 1HNXL 1YVCA 2GVBA 3J7ZC 2OTLA 1J5EQ 5IP9H 1NJIC 1KIXA 1CSQA 1WI5A 4BY1G 1VQ9A 2E2JH 3GO5A 1J6QA 3I2ZA 1VQIA 3U58A 4L5RC 1XNRL 3KLWA 1SRUA 5ELNA 5M5YH 2Q2TA 4NXML 3TS2A 2MO1A 1EFWA 4OO1G 3G6EA 4P73A 2VW9A 4JI8L 3CCRA 1K73C 1CKNA 3AQQA 3CCLA 4ME3A 5GAEC 3CD6A 1JB7A 4B3ML 3T1YL 1XMOQ 2I5MX 3PO2G 3U4VA 4DV2Q 1K0RA 1UE7A 3UDXA 3HOYG 2JQOA 1UWVA 2HIVA 4DV0L 2K52A 3KDFA 2UUBQ 1PH8A 1CKOA 4X64Q 3A5UA 1HR0Q 1NE3A 3GD7A 5C4XH 4AYBG 2JA7H 4BBSH 4GOPC 1PH2A 5IYBG 1QZGA 2I0QA 4A3IG 5C44H 3PUYA 2MNAA 4Y52H 3CCQA 4GN4B 4XIGS 5IYCG 1S3OA 4X62Q 1QVGA 3ULLA 3S1RH 3M4QA 4J15A 2UUAQ 3L7ZC 1M90C 4LFCL 1HR0L 1EIYB 3S1QH 3PF5A 4MTNA 2YU9H 5GADC 1NY4A 1IBKQ 3IRBA 3T1HQ 1VQOA 2K14A 3JAMc 4YY3Q 4GKKQ 2UXBQ 3I4MG 4A93H 3HKZE 3S14H 2QEXA 4DV5L 2JA6G 1HH2P 2IX1A 4JV5Q 3K0XA 3G48A 4A3CG 3E0EA 5C0XG 4A4IA 4DR7Q 2KBNA 2ZTDA 1Q1BA 3HOVG 3CW2C 1L1OB 2ZJQA 1LUZA 1MJEA 4BY1H 2UUCQ 5JJLA 4UP8A 1G6PA 4A3LG 4DUZQ 4DV7Q 3PUVA 1IL2A 2ALYB 4YWLA 4NXNQ 2AWNA 1SMXA 4O0AA 4JI5L 2BH2A 2JE6I 1FGUA 3M9BA 4LF4Q 4LF7Q 4IFDG 4LF8L 3CCEA 1VQJA 1HZ9A 3JAMi 1VQKA 3I4NG 3PO2H 3HOYH 2JEBI 2K5NA 3W5OA 2F4VQ 1TWFH 1HNZQ 2N78A 1HNWL 1D7QA 3DLLA 4PZ8A 1IBLL 3NBHB 1HZBA 4IO9A 1PH6A 5IYBH 3A74A 2I5LX 1TWGH 3UE0A 4A3IH 1OXXK 1UE1A 1I94Q 4JI0Q 3KF6B 4B3TQ 2RHQB 2JA8G 2ZTCA 2UXDQ 1VQLA 2BH8A 4X65Q 2ES2A 2JK8A 4GN3B 1V1QA 1KXLA 3J80i 1K9MC 2IHFA 4GNXA 1KC8C 1B8AA 2E5LL 3GDEA 3STBD 1SROA 4DR5Q 2E2IH 3I4MH 1XMQL 1CKNB 1YHQA 4DPGA 1MKHA 4LUZA 4GLXA 2JA6H 3JC66 1Q8KA 2MFIA 4A3CH 1YITA 1EQQA 1OXTA 1I6HH 3HOXG 2VQEL 2HIXA 3E9HA 5JJKA 5LMUQ 4AQYQ 2OWOA 3KDFB 4OWWB 4OONA 4C3IH 4DR2L 1KHIA 4LF6L 2MQHA 4POFA 2RHSB 1N9WA 2PQAA 4OX9Q 4L5TA 2UU9Q 4A3LH 1X56A 3WWVA 1Q7YC 4A3FG 5M5WH 4JI4Q 2K50A 1N34Q 1HJPA 3BU2A 1XPOA 4NB3A 4JI6Q 1NBWA 1MIUA 2WAQE 5IT9c 1N33L 2RCNA 2ID0A 2XGTA 1LM0A 2CWPA 4PZ7A 4RG1A 1VQEA 2PI2E 4DR3Q 5H1SE 1SR3A 1KD1C 1BBUA 4L5QA 2PI2A 3I4NH 3B6YA 1E1OA 5C4JH 5BR8L 3PIOA 5GAGC 2Q2IA 4P71A 5JEAG 1L1OC 4HIDA 1X55A 3CQZH 3MXNB 1PH4A 1HNXQ 3EIVA 4LF5L 2HT1A 3H3VH 3HKZG 4C3JH 3VDYA 1VQFA 1PH9A 4LFAQ 3NENA 2NN6G 3I55A 1A8VA 2AHOB 2BA1A 1N36L 1XNRQ 5GQOA 4NXMQ 2JA8H 2NZOA 5LMNL 4JI8Q 4AH6A 3S2HH 1X3EA 1MJCA 4KHZA 1XPUA 4JBMA 4LFAL 4B3MQ 2IY5B 3KJPA 1E7ZA 2B3GA 3AFPA 2OQKA 4R4IA 3U50C 2NZHA 3T1YQ 2NVYH 4A3DG 2D62A 2ZM6Q 2ZTEA 1A62A 3NEMA 5IY0A 4DV0Q 1Q86C 4IFDI 2KENA 2Q2HA 1EWIA 3PF4A 4IPCA 2BA0A 5M3MG 3RNUA 4DV3L 1YIJA 1IBML 2NVXH 3HOXH 4K0KL 5ELOA 4OWTB 3OTOL 2VY3A 3HOZG 1PV4A 3PSIA 2ZM6L 4C3HH 3G71A 4TVAB 3CPFA 3CP0A 3GTJH 4A3FH 4LFCQ 5E7NA 4DV4Q 1GKHA 1V9PA 1JE5A 2R7FA 2OTJA 3MEFA 4APVA 3CPWA 1JT8A 4GKJQ 4MNOA 4RMFA 5M3FG 4R4OA 1WFQA 1XNQQ 4GKJL 4GOPA 4DV5Q 4DV4L 1AH9A 3S15H 1QUQB 1YJWA 1PYSB 1FJGL 4KHPL 3GTLH 4DR6Q 1N32L 1JJ2A 1NTGA 1PFSA 1B7YB 1Y1VG 2E2HH 1XNQL 1B70B 4DUYL 1K83H 2A1AA 1VQ4A 4HJ8A 4R4QA 4TQUS 1PH7A 2HQLA 1A0IA 3CCJA 4XTCS 1VQCA 4JI5Q 4KI0A 4LNQA 4DR6L 4OWXB 1TWCH 3ZJYC 2NVTH 4BA1I 4GS3A 4LF8Q 2CCZA 4FDBA 1HZAA 1CSPA 4LFBL 4A3DH 1N8RC 2YTXA 4JOIC 4UP9A 2WP8J 1VQAA 1SFOH 1OTCA 4JBKA 2VUMG 2R7ZG 1HR0W 3PUWA 1X3FA 4P75A 1HNWQ 3PO3G 5M3MH 3J80c 3CC7A 4ALPA 1IBLQ 1BBWA 3KYHC 1TXYA 1U5KA 4LWCA 4DK6C 4EX5A 4A3GG 2AKWB 3HOZH 1FL0A 4R4TA 4QL5A 1GVPA 1L0WA 5IP7G 1VQ8A 1HZCA 3BZCA 1K8GA 1C7YA 4A3EG 1SN8A 4IPDA 3HOWG 5C0XJ 2IT1A 1TWHH 1K8AC 2R6GA 3RLNA 4B3SL 3DM3A 4YCWA 1M1KC 2LSSA 3UE1A 2Q2UA 4QGUA 5LMUL 2E5LQ 5FJ8G 1Q46A 4JI7L 5IWAL 3PIPA 3RR5A 1KAWA 4P74A 5IYCH 5M3FH 1YHAA 1XMQQ 3EBEA 2HHHL 4IOAA 3K8AA 2CKZB 4MZ9A 5GAHC 4HJAA 1QVFA 4IFDJ 2ZJRA 4AIMA 1X54A 2VQEQ 4O2DA 3ERSX 4A75A 2Z6KC 4DR2Q 4LF6Q 4OO1I 1ASZA 3HFZB 1W3SA 1Y1VH 1WOCA 4BY7G 4DKAC 4JI3L 4HIOA 2UXCL 1Y1WG 3W1BA 4YCVA 1N33Q 3M4OH 4AYBE 4HJ5A 4JC0A 3HOVH 2F3IA 2N49A 2VL6A 4YCUA 1YNXA 1RL2A 1EUJA 4YWMA 1P16A 2VUMH 2R7ZH 1YZ6A 5BR8Q 1WYDA 4C2MH 3PO3H 2N8NA 1VQPA 4BXXG 2OQ0A 2KCMA 1VS0A 3PUXA 3TREA 4UP7A 4LF5Q 3S1MH 1X3GA 3PV0A 1Y14B 4A3GH 1YEZA 4JBWA 2ATWA 2Y0SE 1PH1A 4DR4L 5IP7H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR1 L;  2DUD A;  2VS1 A;  3I7F A;  3TQY A;  2I5H A;  1N36 Q;  4JYA Q;  1LTL A;  4WJ4 A;  4A3E H;  3OW2 A;  3UDG A;  2JJQ A;  3HOW H;  5LMN Q;  4A3B G;  1JJG A;  4JG2 A;  3H15 A;  4HIM A;  5K36 G;  3CME A;  2JA5 G;  3K7A H;  4DNI A;  2KHJ A;  5FJ8 H;  3GTK H;  1L1O A;  3ULJ A;  1WCM G;  3FHW A;  5C0X I;  1L2F A;  2EQS A;  4YHH L;  1C0A A;  1I5F A;  4DV3 Q;  3L0O A;  1IBM Q;  1AE2 A;  4K0K Q;  1FVI A;  3FKI G;  3OTO Q;  4JI1 L;  3AYH B;  5AJ3 L;  1T9H A;  1D8L A;  4GLA C;  4LF9 L;  1OXS C;  2EXD A;  5JEA J;  1I50 H;  3G4S A;  4BY7 H;  2DGY A;  2CFM A;  2K4K A;  2VQF L;  4IJL A;  1Y1W H;  2YYZ A;  3CAM A;  3PUZ A;  4UPA A;  2D0P A;  5JJI A;  4DV6 Q;  1TWA H;  2XTI A;  5C3E G;  3M7N A;  3BJU A;  3CCM A;  1S40 A;  3KF6 A;  2H5X A;  5GRO A;  1VQD A;  4DK3 C;  3I4O A;  5LMN W;  4A3K G;  4H02 A;  3H3V I;  3PCO B;  1PVO A;  4JCV E;  3HKS A;  2JA9 A;  3J81 c;  1QZH A;  1FJG Q;  2ASB A;  4BXX H;  4KHP Q;  4DV6 L;  1N32 Q;  1KRS A;  3F2B A;  2AMC B;  1RIP A;  3EN2 A;  4DAY B;  4R1J A;  4GNX B;  4DUY Q;  1J5E L;  1VQG A;  1UE5 A;  3F2D A;  4QJF A;  1YHB A;  3SGI A;  4A3B H;  2MO0 A;  4LUO A;  3L2P A;  2IHE A;  4Y7N H;  3CMA A;  2C35 B;  1UE6 A;  4A3M G;  4BBR G;  2JA5 H;  2V1C C;  2B63 G;  4R4C A;  3AFQ A;  4LFB Q;  1WCM H;  1KRT A;  1CUK A;  1EIF A;  5FLM G;  1PYB A;  3FP9 A;  1QVC A;  2GN5 A;  2WB1 E;  2PQA B;  1XMO L;  2YTV A;  4DV2 L;  1GO3 E;  3J81 i;  1E22 A;  4YWK A;  3GTQ H;  3FKI H;  4HIK A;  2UUB L;  4X64 L;  4JI2 Q;  1LYL A;  4HJ9 A;  2WAQ G;  3U4Z A;  4EQ5 A;  1H95 A;  4HJ7 A;  4JBJ A;  5HGQ A;  1BKB A;  3PGZ A;  1E1T A;  1SLJ A;  3M85 A;  4IJH A;  3RN5 A;  2VZA A;  1IZ6 A;  1V43 A;  3K80 C;  4A3J G;  3D31 A;  3W1G A;  3S1N H;  2Y0S G;  3H0G G;  3UDI A;  1E3P A;  4JOI A;  4X62 L;  3ULP A;  4B3S Q;  1Q1E A;  3F2C A;  3OYY A;  2QGQ A;  2UUA L;  4JI2 L;  3S16 H;  2EIF A;  4PG3 A;  5IYD G;  2D0O A;  5C3E H;  3CF5 A;  1G51 A;  3ER0 A;  3M4P A;  2FXQ A;  5IWA Q;  1R9T H;  3I56 A;  4JI7 Q;  5IE8 A;  1IBK L;  3T1H L;  3BZK A;  4A3K H;  1YJ9 A;  2HHH Q;  2A8V A;  2L15 A;  1YI2 A;  2VNU D;  5M5X H;  4YY3 L;  4GKK L;  2UXB L;  1X9N A;  2R92 G;  2NN6 I;  1X6O A;  1ASY A;  1C9O A;  3GTG H;  2R93 G;  1JMC A;  2B29 A;  4JV5 L;  1KQS A;  3K81 C;  2GVA A;  2RF4 A;  3ICE A;  4DR7 L;  3HOU G;  3S2D H;  1SE8 A;  3RZD H;  3Q8D A;  4JI3 Q;  2UXC Q;  1DGS A;  3UDF A;  2UUC L;  1CKM A;  1G29 1;  1KL9 A;  1OXV A;  5DLQ E;  1VCI A;  4LW1 A;  5J3B A;  3KJO A;  4DUZ L;  4BBR H;  4X66 Q;  4DV7 L;  4A3M H;  3CC2 A;  1PH5 A;  1VQB A;  4LUV A;  1I3Q H;  2B63 H;  1Q12 A;  4NXN L;  3CXC A;  4LF7 L;  4LF4 L;  1BVS A;  1E24 A;  4IPH A;  2JEA I;  5FLM H;  2ZJP A;  1Q82 C;  1EYG A;  2Z6K A;  4QY7 A;  1AE3 A;  3K7U C;  2YTY A;  4X66 L;  1YJN A;  4GNX C;  3KOJ A;  3RZO H;  1VQ6 A;  4JYA L;  3GTP H;  2F4V L;  1IXR A;  1HNZ L;  1NMF A;  1OXU A;  4GN5 A;  3LGJ A;  2QA4 A;  3GTM H;  2PNH A;  5HY6 A;  4P72 A;  3J81 j;  4DR4 Q;  4DR1 Q;  1O7I A;  5IP9 G;  4A76 A;  2A19 A;  3KFU A;  2IX0 A;  2PMZ E;  3STB C;  1IYJ B;  1I94 L;  4A3J H;  1XJV A;  4JI0 L;  4X6A H;  2CQO A;  3H0G H;  3CCU A;  3AEV A;  2AWO A;  2OCE A;  1QUQ A;  4OXP A;  4GOP B;  1XTD A;  3TS0 A;  4DV1 Q;  1VQM A;  1W2B A;  4B3T L;  2NVQ H;  2UXD L;  2Z0S A;  4POG A;  5IYD H;  4X65 L;  3RN2 A;  2K5H A;  2R7D A;  1JJC B;  1Z47 A;  4GLV B;  3RLF A;  4YHH Q;  1Z9F A;  1YBY A;  3TRZ A;  3CC4 A;  1Q81 C;  1PHJ A;  4NPS A;  5FLX c;  4DR5 L;  3NEL A;  4DV1 L;  2R92 H;  4QQB X;  2K75 A;  3S24 A;  1S72 A;  4PZ6 A;  2R93 H;  4IOC A;  2WB1 G;  3CCV A;  1UEB A;  2KCT A;  4JI1 Q;  1VQ5 A;  5AJ3 Q;  1GD7 A;  5C4X G;  2JA7 G;  3RLO A;  4AQY L;  4LF9 Q;  3J7A 5;  3TEH B;  5EAY A;  3HOU H;  1P8L A;  4UY8 C;  4BBS G;  4B3R Q;  2LXJ A;  4KLK A;  5C44 G;  1VQN A;  1X65 A;  2VQF Q;  1WJJ A;  4OX9 L;  2UU9 L;  1EQR A;  1U0L A;  1GM5 A;  3KF8 B;  2E8G A;  4PMW A;  3GTO H;  2KHI A;  3M3Y H;  4JI4 L;  1VQ7 A;  2WFW A;  1N34 L;  1XPR A;  4BA2 I;  2F52 A;  3F8T A;  3E9I A;  4JI6 L;  2YV5 A;  4B3R L;  4WJ3 M;  3A0J A;  3A5Z B;  4IPG A;  3S17 H;  2LXK A;  1PH3 A;  3D0F A;  2CWA A;  4DR3 L;  2K5V A;  1A63 A;  1PA6 A;  3CCS A;  2N3S A;  1EOV A;  1VQH A;  4DAM A;  1K3R A;  4A93 G;  4QIW E;  3F1Z A;  1NMG A;  4L5S A;  1HNX L;  1YVC A;  2GVB A;  3J7Z C;  2OTL A;  1J5E Q;  5IP9 H;  1NJI C;  1KIX A;  1CSQ A;  1WI5 A;  4BY1 G;  1VQ9 A;  2E2J H;  3GO5 A;  1J6Q A;  3I2Z A;  1VQI A;  3U58 A;  4L5R C;  1XNR L;  3KLW A;  1SRU A;  5ELN A;  5M5Y H;  2Q2T A;  4NXM L;  3TS2 A;  2MO1 A;  1EFW A;  4OO1 G;  3G6E A;  4P73 A;  2VW9 A;  4JI8 L;  3CCR A;  1K73 C;  1CKN A;  3AQQ A;  3CCL A;  4ME3 A;  5GAE C;  3CD6 A;  1JB7 A;  4B3M L;  3T1Y L;  1XMO Q;  2I5M X;  3PO2 G;  3U4V A;  4DV2 Q;  1K0R A;  1UE7 A;  3UDX A;  3HOY G;  2JQO A;  1UWV A;  2HIV A;  4DV0 L;  2K52 A;  3KDF A;  2UUB Q;  1PH8 A;  1CKO A;  4X64 Q;  3A5U A;  1HR0 Q;  1NE3 A;  3GD7 A;  5C4X H;  4AYB G;  2JA7 H;  4BBS H;  4GOP C;  1PH2 A;  5IYB G;  1QZG A;  2I0Q A;  4A3I G;  5C44 H;  3PUY A;  2MNA A;  4Y52 H;  3CCQ A;  4GN4 B;  4XIG S;  5IYC G;  1S3O A;  4X62 Q;  1QVG A;  3ULL A;  3S1R H;  3M4Q A;  4J15 A;  2UUA Q;  3L7Z C;  1M90 C;  4LFC L;  1HR0 L;  1EIY B;  3S1Q H;  3PF5 A;  4MTN A;  2YU9 H;  5GAD C;  1NY4 A;  1IBK Q;  3IRB A;  3T1H Q;  1VQO A;  2K14 A;  3JAM c;  4YY3 Q;  4GKK Q;  2UXB Q;  3I4M G;  4A93 H;  3HKZ E;  3S14 H;  2QEX A;  4DV5 L;  2JA6 G;  1HH2 P;  2IX1 A;  4JV5 Q;  3K0X A;  3G48 A;  4A3C G;  3E0E A;  5C0X G;  4A4I A;  4DR7 Q;  2KBN A;  2ZTD A;  1Q1B A;  3HOV G;  3CW2 C;  1L1O B;  2ZJQ A;  1LUZ A;  1MJE A;  4BY1 H;  2UUC Q;  5JJL A;  4UP8 A;  1G6P A;  4A3L G;  4DUZ Q;  4DV7 Q;  3PUV A;  1IL2 A;  2ALY B;  4YWL A;  4NXN Q;  2AWN A;  1SMX A;  4O0A A;  4JI5 L;  2BH2 A;  2JE6 I;  1FGU A;  3M9B A;  4LF4 Q;  4LF7 Q;  4IFD G;  4LF8 L;  3CCE A;  1VQJ A;  1HZ9 A;  3JAM i;  1VQK A;  3I4N G;  3PO2 H;  3HOY H;  2JEB I;  2K5N A;  3W5O A;  2F4V Q;  1TWF H;  1HNZ Q;  2N78 A;  1HNW L;  1D7Q A;  3DLL A;  4PZ8 A;  1IBL L;  3NBH B;  1HZB A;  4IO9 A;  1PH6 A;  5IYB H;  3A74 A;  2I5L X;  1TWG H;  3UE0 A;  4A3I H;  1OXX K;  1UE1 A;  1I94 Q;  4JI0 Q;  3KF6 B;  4B3T Q;  2RHQ B;  2JA8 G;  2ZTC A;  2UXD Q;  1VQL A;  2BH8 A;  4X65 Q;  2ES2 A;  2JK8 A;  4GN3 B;  1V1Q A;  1KXL A;  3J80 i;  1K9M C;  2IHF A;  4GNX A;  1KC8 C;  1B8A A;  2E5L L;  3GDE A;  3STB D;  1SRO A;  4DR5 Q;  2E2I H;  3I4M H;  1XMQ L;  1CKN B;  1YHQ A;  4DPG A;  1MKH A;  4LUZ A;  4GLX A;  2JA6 H;  3JC6 6;  1Q8K A;  2MFI A;  4A3C H;  1YIT A;  1EQQ A;  1OXT A;  1I6H H;  3HOX G;  2VQE L;  2HIX A;  3E9H A;  5JJK A;  5LMU Q;  4AQY Q;  2OWO A;  3KDF B;  4OWW B;  4OON A;  4C3I H;  4DR2 L;  1KHI A;  4LF6 L;  2MQH A;  4POF A;  2RHS B;  1N9W A;  2PQA A;  4OX9 Q;  4L5T A;  2UU9 Q;  4A3L H;  1X56 A;  3WWV A;  1Q7Y C;  4A3F G;  5M5W H;  4JI4 Q;  2K50 A;  1N34 Q;  1HJP A;  3BU2 A;  1XPO A;  4NB3 A;  4JI6 Q;  1NBW A;  1MIU A;  2WAQ E;  5IT9 c;  1N33 L;  2RCN A;  2ID0 A;  2XGT A;  1LM0 A;  2CWP A;  4PZ7 A;  4RG1 A;  1VQE A;  2PI2 E;  4DR3 Q;  5H1S E;  1SR3 A;  1KD1 C;  1BBU A;  4L5Q A;  2PI2 A;  3I4N H;  3B6Y A;  1E1O A;  5C4J H;  5BR8 L;  3PIO A;  5GAG C;  2Q2I A;  4P71 A;  5JEA G;  1L1O C;  4HID A;  1X55 A;  3CQZ H;  3MXN B;  1PH4 A;  1HNX Q;  3EIV A;  4LF5 L;  2HT1 A;  3H3V H;  3HKZ G;  4C3J H;  3VDY A;  1VQF A;  1PH9 A;  4LFA Q;  3NEN A;  2NN6 G;  3I55 A;  1A8V A;  2AHO B;  2BA1 A;  1N36 L;  1XNR Q;  5GQO A;  4NXM Q;  2JA8 H;  2NZO A;  5LMN L;  4JI8 Q;  4AH6 A;  3S2H H;  1X3E A;  1MJC A;  4KHZ A;  1XPU A;  4JBM A;  4LFA L;  4B3M Q;  2IY5 B;  3KJP A;  1E7Z A;  2B3G A;  3AFP A;  2OQK A;  4R4I A;  3U50 C;  2NZH A;  3T1Y Q;  2NVY H;  4A3D G;  2D62 A;  2ZM6 Q;  2ZTE A;  1A62 A;  3NEM A;  5IY0 A;  4DV0 Q;  1Q86 C;  4IFD I;  2KEN A;  2Q2H A;  1EWI A;  3PF4 A;  4IPC A;  2BA0 A;  5M3M G;  3RNU A;  4DV3 L;  1YIJ A;  1IBM L;  2NVX H;  3HOX H;  4K0K L;  5ELO A;  4OWT B;  3OTO L;  2VY3 A;  3HOZ G;  1PV4 A;  3PSI A;  2ZM6 L;  4C3H H;  3G71 A;  4TVA B;  3CPF A;  3CP0 A;  3GTJ H;  4A3F H;  4LFC Q;  5E7N A;  4DV4 Q;  1GKH A;  1V9P A;  1JE5 A;  2R7F A;  2OTJ A;  3MEF A;  4APV A;  3CPW A;  1JT8 A;  4GKJ Q;  4MNO A;  4RMF A;  5M3F G;  4R4O A;  1WFQ A;  1XNQ Q;  4GKJ L;  4GOP A;  4DV5 Q;  4DV4 L;  1AH9 A;  3S15 H;  1QUQ B;  1YJW A;  1PYS B;  1FJG L;  4KHP L;  3GTL H;  4DR6 Q;  1N32 L;  1JJ2 A;  1NTG A;  1PFS A;  1B7Y B;  1Y1V G;  2E2H H;  1XNQ L;  1B70 B;  4DUY L;  1K83 H;  2A1A A;  1VQ4 A;  4HJ8 A;  4R4Q A;  4TQU S;  1PH7 A;  2HQL A;  1A0I A;  3CCJ A;  4XTC S;  1VQC A;  4JI5 Q;  4KI0 A;  4LNQ A;  4DR6 L;  4OWX B;  1TWC H;  3ZJY C;  2NVT H;  4BA1 I;  4GS3 A;  4LF8 Q;  2CCZ A;  4FDB A;  1HZA A;  1CSP A;  4LFB L;  4A3D H;  1N8R C;  2YTX A;  4JOI C;  4UP9 A;  2WP8 J;  1VQA A;  1SFO H;  1OTC A;  4JBK A;  2VUM G;  2R7Z G;  1HR0 W;  3PUW A;  1X3F A;  4P75 A;  1HNW Q;  3PO3 G;  5M3M H;  3J80 c;  3CC7 A;  4ALP A;  1IBL Q;  1BBW A;  3KYH C;  1TXY A;  1U5K A;  4LWC A;  4DK6 C;  4EX5 A;  4A3G G;  2AKW B;  3HOZ H;  1FL0 A;  4R4T A;  4QL5 A;  1GVP A;  1L0W A;  5IP7 G;  1VQ8 A;  1HZC A;  3BZC A;  1K8G A;  1C7Y A;  4A3E G;  1SN8 A;  4IPD A;  3HOW G;  5C0X J;  2IT1 A;  1TWH H;  1K8A C;  2R6G A;  3RLN A;  4B3S L;  3DM3 A;  4YCW A;  1M1K C;  2LSS A;  3UE1 A;  2Q2U A;  4QGU A;  5LMU L;  2E5L Q;  5FJ8 G;  1Q46 A;  4JI7 L;  5IWA L;  3PIP A;  3RR5 A;  1KAW A;  4P74 A;  5IYC H;  5M3F H;  1YHA A;  1XMQ Q;  3EBE A;  2HHH L;  4IOA A;  3K8A A;  2CKZ B;  4MZ9 A;  5GAH C;  4HJA A;  1QVF A;  4IFD J;  2ZJR A;  4AIM A;  1X54 A;  2VQE Q;  4O2D A;  3ERS X;  4A75 A;  2Z6K C;  4DR2 Q;  4LF6 Q;  4OO1 I;  1ASZ A;  3HFZ B;  1W3S A;  1Y1V H;  1WOC A;  4BY7 G;  4DKA C;  4JI3 L;  4HIO A;  2UXC L;  1Y1W G;  3W1B A;  4YCV A;  1N33 Q;  3M4O H;  4AYB E;  4HJ5 A;  4JC0 A;  3HOV H;  2F3I A;  2N49 A;  2VL6 A;  4YCU A;  1YNX A;  1RL2 A;  1EUJ A;  4YWM A;  1P16 A;  2VUM H;  2R7Z H;  1YZ6 A;  5BR8 Q;  1WYD A;  4C2M H;  3PO3 H;  2N8N A;  1VQP A;  4BXX G;  2OQ0 A;  2KCM A;  1VS0 A;  3PUX A;  3TRE A;  4UP7 A;  4LF5 Q;  3S1M H;  1X3G A;  3PV0 A;  1Y14 B;  4A3G H;  1YEZ A;  4JBW A;  2ATW A;  2Y0S E;  1PH1 A;  4DR4 L;  5IP7 H; 
#chains in the Genus database with same CATH topology
 1K28 A;  2I5H A;  2WKD A;  2VB3 X;  1NR2 A;  3OW2 A;  2JJQ A;  1SNM A;  5LMN Q;  3H15 A;  3GTL B;  2JA5 G;  3RUZ A;  5IGE A;  5FJ8 H;  3GTK H;  1L2F A;  2EQS A;  4YHH L;  3SVM A;  3ZYY X;  1I4X A;  2NVT B;  1KDA A;  1FVI A;  3OTO Q;  2F0G A;  4JI1 L;  5JJZ A;  2KED A;  3L9A X;  2EVB A;  1D8L A;  5JEA J;  3U9O A;  4ZLT F;  4M8A A;  1TY2 A;  1JOO A;  2CFM A;  2DGY A;  2D0P A;  5CV4 A;  1TWA H;  2XTI A;  3I90 A;  5C3E G;  3H94 A;  1UAP A;  1SAP A;  1S40 A;  4A3K G;  4DK3 C;  3H3V I;  3I4O A;  4DN4 M;  3IL8 A;  1FJG Q;  1FYC A;  3F2B A;  2A74 C;  2AMC B;  3EN2 A;  1VF5 C;  1CA6 A;  4R1J A;  3EJI A;  4GNX B;  1YNN C;  4ZYS A;  4DUY Q;  1U4R A;  1J5E L;  1T5X D;  1CQF A;  2AQ3 B;  3L2P A;  4DU9 A;  4A3M G;  4XYQ A;  2V1C C;  3QWN A;  5CC4 A;  4QCL A;  1BCP D;  5AFW A;  1Q3L A;  2K7V A;  1KRT A;  1TU2 B;  1CUK A;  4ID6 A;  1QVC A;  5IGD A;  3DXJ C;  3MXU A;  3J81 i;  2J0T D;  3BDC A;  4YWK A;  4HIK A;  2UUB L;  4X64 L;  4DXF A;  2VUM B;  4YIJ A;  4JBJ A;  4HJ7 A;  4FF4 A;  1VMP A;  4IJH A;  3K80 C;  3S1N H;  1V1P A;  3W1G A;  2Y0S G;  3H0G G;  1E3P A;  2L9H A;  4JI2 L;  2QGQ A;  1O7Y A;  2XRQ D;  2F0H A;  3S16 H;  1KLG D;  5IWA Q;  2FXQ A;  1ENC A;  2IX3 A;  1IBK L;  3T1H L;  2A8V A;  2DN8 A;  2R92 G;  1X6O A;  4KD3 A;  1I4H A;  4N9P A;  2CHB D;  1JMC A;  2B29 A;  4JV5 L;  1KQS A;  2EJM A;  5D14 A;  3ICE A;  2LS0 1;  4DR7 L;  1HFN A;  3Q8D A;  1G29 1;  1KL9 A;  4LW1 A;  5EBD A;  4DUZ L;  1LT5 D;  3CC2 A;  2B63 H;  1VQB A;  4LUV A;  4JYA Q;  3CXC A;  5KNB A;  2JEA I;  1BVS A;  1E24 A;  5FLM H;  2ZJP A;  4N8F A;  1PFM A;  1Y1W B;  1BBX C;  2YTY A;  4RAU C;  3RZO H;  4GNX C;  2F4V L;  1HNZ L;  4XQN A;  2SOB A;  4P72 A;  1GHJ A;  3J81 j;  4FF1 A;  3OMG A;  5IP9 G;  5EKI A;  1XJV A;  5EKL A;  2TMP A;  5COY A;  1HUN A;  1XTD A;  2NVQ H;  3ERQ A;  2Z0S A;  4POG A;  5IYD H;  4RHS A;  4JK1 C;  5DNF A;  1JJC B;  3HS0 C;  3MAQ A;  2XNA C;  3I91 A;  4QQB X;  2JA5 B;  3OMC A;  2WB1 G;  3CCV A;  1VQ5 A;  4DK1 A;  3RLO A;  1HTP A;  1SYE A;  3TEH B;  4BBS G;  4B3R Q;  4UY8 C;  1VQN A;  4O42 A;  4KKT A;  1WJJ A;  5C44 B;  1EQR A;  1U0L A;  1GM5 A;  1T5E A;  4PMW A;  1H9M A;  4JI4 L;  2WFW A;  5IOD A;  1V1P B;  4JI6 L;  5I2Y A;  3A0J A;  4IPG A;  5IOC A;  2CWA A;  1PA6 A;  3CCS A;  2EJG C;  2N3S A;  1EOV A;  1VQH A;  4DAM A;  3NBH A;  4HR7 B;  4A93 B;  2QCP X;  1EY4 A;  1D5X C;  5C3E B;  1SXT A;  2OTL A;  4KN7 C;  5IGG A;  1SMY C;  1KIX A;  1CSQ A;  2Q8T A;  1VQ9 A;  3MFY A;  1J6Q A;  3SHL A;  3I2Z A;  1VQI A;  1F77 A;  4L5R C;  1XNR L;  3GTG B;  3KLW A;  2I07 B;  5E3F A;  4OO1 G;  4K14 A;  2K28 A;  1DOL A;  2KHS A;  5M9O A;  2VW9 A;  2NBF A;  1K73 C;  3AQQ A;  3BDL A;  5EPJ A;  3CCL A;  2AQ2 B;  2I5M X;  2PCF B;  3TME A;  1B44 D;  1II3 A;  4A3M B;  4DV0 L;  1I3Q B;  2KCN A;  1CKO A;  1JWM D;  1VF7 A;  5JVG 3;  2RSO A;  3W3A A;  2B2V A;  4IUU A;  3CKI B;  5C4X H;  1HR0 Q;  4HMI A;  4AYB B;  2RA4 A;  5CV7 A;  4XT1 B;  1ONL A;  2MNA A;  2X6G A;  4Y52 H;  2Q8R E;  2F0W A;  1JOK A;  4X62 Q;  1S3O A;  3GTP B;  1QVG A;  3M4Q A;  2UUA Q;  1M90 C;  2F3V A;  4B08 A;  3EA6 A;  3PF5 A;  5CR3 A;  2K14 A;  5IGC A;  4CBV A;  3JAM c;  1O78 A;  2Y0S B;  4IUP A;  4YY3 Q;  2UXB Q;  1ZKO A;  1EOT A;  1YNJ C;  1VDZ A;  2QEX A;  4DV5 L;  2IX1 A;  3G48 A;  1M4V A;  4A4I A;  2KBN A;  1B1Z A;  3CW2 C;  1L1O B;  2ZJQ A;  2MJ8 A;  2RDG A;  2UUC Q;  1LAC A;  2B2U A;  5LL6 S;  2R92 B;  1EEI D;  2F0S A;  3JAM E;  2A6H C;  2ICI A;  3C46 A;  2BH2 A;  3M9B A;  3BVG A;  2A68 D;  3CCE A;  2MP1 A;  3OWF A;  1FNV A;  3PO2 H;  3I4N B;  2IW3 A;  2JEB I;  3GTO B;  4X3S A;  3W5O A;  2BDO A;  5E1F A;  1JC7 A;  3NBH B;  3S17 B;  1D1K A;  3EVQ A;  4IO9 A;  1PH6 A;  4OEL B;  4IUT A;  4A3I H;  3KF6 B;  1Y8O B;  4B3T Q;  3A54 A;  1VQL A;  5A35 A;  1HRJ A;  1AP0 A;  2BH8 A;  2ES2 A;  2JK8 A;  4GN3 B;  2L11 A;  4DXG A;  1KXL A;  1J9O A;  1LT6 D;  2E2J B;  1V1O A;  3Q22 A;  1F9Q A;  1MKH A;  2JA6 H;  4G57 A;  4CDD C;  4A3C H;  1OXT A;  5JJI A;  5JJK A;  3KLS X;  5C0X H;  4AQY Q;  2WV6 D;  4DR2 L;  3QOJ A;  1I4P A;  4G7H C;  4POF A;  1SSO A;  4OX9 Q;  3H91 A;  5CV8 A;  4A3L H;  1X56 A;  4C3H B;  1PTO B;  4A3F G;  2WB1 B;  1ICF B;  1B2T A;  3BDO A;  4H44 C;  1EWH A;  1MIU A;  2XGT A;  4PZ7 A;  2Z4H A;  2CWP A;  4BBS B;  1QG7 A;  1CHP D;  1VQE A;  5DAU A;  2K05 A;  5C4J H;  1Y8P B;  2Q2I A;  1FNW A;  3X3N A;  1L1O C;  3S15 B;  3MXN B;  3EIV A;  2HT1 A;  3HKZ G;  3VYR A;  4C3J H;  1VQF A;  3OOC A;  3AU7 A;  2AUK A;  4LFA Q;  3NEN A;  1BF4 A;  3K59 A;  4X3K A;  5LMN L;  4JI8 Q;  1TWC B;  4C1N I;  1IL8 A;  2IY5 B;  1AH9 A;  3T1Y Q;  1E7Z A;  2B3G A;  5DEH A;  3U50 C;  3D4R A;  4A3D B;  3L3O C;  2D62 A;  3PF4 A;  5M3M G;  1KNE A;  3OTO L;  1B53 A;  5JPM C;  3D8G A;  1WTQ A;  3M4Y A;  1MSG A;  1G91 A;  5BN5 A;  5KNC A;  3G71 A;  3CP0 A;  3T51 B;  4LFC Q;  1I4R A;  5ELB A;  1GKH A;  2R7F A;  2OTJ A;  4APV A;  1JT8 A;  3HRZ C;  2K33 A;  4KD4 A;  4RMF A;  5M3F G;  1MSH A;  1HXY D;  2K6A A;  4GOP A;  4ULL A;  4DV4 L;  1EY9 A;  1QUQ B;  3OPO A;  3P1H A;  1PYS B;  1AN8 A;  1SNO A;  5EKK A;  1FJG L;  3A8I E;  3GTL H;  1HA5 A;  1PTO C;  4N9T A;  1Y1V G;  1A3T A;  4DUY L;  2A1A A;  4HJ8 A;  2HQL A;  3HZX A;  1VQC A;  4XTC S;  2MPM A;  2PZW A;  4DR6 L;  1I6H B;  2NVT H;  3M4O B;  4BA1 I;  2CCZ A;  1HZA A;  3VR6 A;  2A69 D;  2F0T A;  2YTX A;  1GUN A;  4JOI C;  2VXW A;  1HQR D;  1OTC A;  2R7Z B;  3T56 B;  3KF8 A;  4ME5 A;  1HNW Q;  3PO3 G;  3CC7 A;  5LHY 1;  2LFN A;  1TXY A;  1U4L A;  1JR0 D;  2AKW B;  2AUJ D;  3V05 A;  4K5X A;  1L0W A;  1JQY D;  1F2M A;  4A3E B;  1WTP A;  2IT1 A;  3H09 A;  1TWH H;  2B8G A;  4QIW B;  3DM3 A;  5KGU A;  3UE1 A;  1IW7 D;  5IWA L;  2NUC A;  1NSN S;  1KNA A;  3KK7 A;  2E75 C;  2ZJR A;  4AIM A;  3ERS X;  3TZU A;  1ASZ A;  4DA2 A;  1W3S A;  1WOC A;  4NDX A;  3S9W A;  4BY7 B;  4HIO A;  3ERO A;  1F9P A;  4QF4 A;  3W1B A;  2NVX B;  1N33 Q;  3VA7 A;  2F0I A;  3HOV H;  4F87 A;  5EBC A;  4YCU A;  1YNX A;  2FFK B;  4JVZ A;  2VUM H;  1E2V A;  1ESF A;  1EYC A;  4CKE A;  2M00 A;  1VQP A;  3PUX A;  1VS0 A;  3Q0A A;  4LF5 Q;  1CI3 M;  1RTO A;  1X3G A;  3NUC A;  1Y14 B;  3PV0 A;  3IKJ A;  4RKB A;  2IPK D;  1PH1 A;  5IP7 H;  2EY6 A;  3I7F A;  4XQJ A;  4TRD A;  1LTL A;  4A3B G;  3TN2 A;  5K36 G;  3CME A;  1S5D D;  3HKZ B;  3WDN A;  2KHJ A;  4C1N K;  4HSV A;  1HPC A;  1A2T A;  2E2H B;  2B2T C;  1WCM G;  3FHW A;  1DM0 B;  5C0X I;  4DV3 Q;  1KDC A;  1S4Z A;  3X3M A;  5CBA E;  4K0K Q;  2K01 A;  3FKI G;  3GTQ B;  2F0L A;  2F0D A;  3KLR A;  1FR3 A;  1SFO B;  3KBG A;  2D9U A;  1V8Q A;  2L1B A;  4KKU A;  2XVS A;  2QIL A;  4R8N A;  1Y1W H;  4IJL A;  5C6A A;  2KOL A;  4UPA A;  4DV6 Q;  1B9M A;  3CHB D;  4V19 0;  1H9R A;  1R9T B;  1JOQ A;  3VYT A;  1VQD A;  4H0L C;  5LMN W;  3O13 A;  2A6E C;  3NWS A;  3VA5 A;  1B50 A;  4JCV E;  1QZH A;  3J81 c;  1CHQ D;  1N32 Q;  1KRS A;  4IUV A;  5M3F B;  4DAY B;  2MUY A;  2SNS A;  3RZD B;  1UE5 A;  1STH A;  3SGI A;  2CW0 C;  1UE6 A;  4BBR G;  2JA5 H;  4IAL A;  2B2W A;  3J81 E;  4CDC C;  1Y1V B;  1EIF A;  4RA8 A;  2GN5 A;  1X3Q A;  2PQA B;  5FKA C;  1NCV A;  4TKO B;  3VYS A;  2B2Y A;  4KY6 A;  3GTM B;  1H9S A;  3U4Z A;  3FPU B;  1EZ8 A;  2WAQ B;  2HCC A;  3SXH A;  3NQI A;  3PGZ A;  3RN5 A;  1EFI D;  2F0O A;  2VZA A;  2F0U A;  3J80 L;  4A3J G;  3D6C A;  3D31 A;  3PO3 B;  4KHV A;  5J22 A;  1ILQ A;  3FDT A;  4X62 L;  4B3S Q;  2UUA L;  3MWY W;  2EY2 A;  4K2K A;  2EYL A;  3CF5 A;  5C3E H;  5LMU Q;  1TS4 A;  1U9R A;  4A3K H;  1YI2 A;  2VNU D;  1G8Z D;  4YY3 L;  2UXB L;  1ASY A;  3GTG H;  5A2Q E;  2R93 G;  2EOT A;  1JCK B;  2F0M A;  4ZKC B;  1SE8 A;  1EU3 A;  4JI3 Q;  1DGS A;  2UUC L;  2HCI A;  5J3B A;  1SYB A;  4KY5 A;  4A3M H;  3I4L A;  1I3Q H;  3M3Y B;  2PPB C;  3KLS A;  2QW7 A;  1RTN A;  3N6R A;  1M8A A;  1Q82 C;  1GHK A;  1LTR D;  4QY7 A;  1RKN A;  2NYZ D;  4X66 L;  1YJN A;  3KOJ A;  1XXG A;  1VQ6 A;  3GTP H;  3T53 B;  1R4P B;  1EY8 A;  1DOM A;  4LJZ C;  4U68 A;  1ICW A;  3G6J B;  3E3X A;  4DR1 Q;  1Y8N B;  5D3D A;  2L5T A;  3BS1 A;  1PRT D;  3KFU A;  2B8F A;  2IX0 A;  2PMZ E;  2K03 A;  3STB C;  1LT3 D;  3CCU A;  3H0G H;  2AWO A;  1D1I A;  2F0K A;  3TS0 A;  4KK7 A;  4OXP A;  4ABN A;  4B3T L;  1BQQ T;  2K32 A;  3K0Y A;  4HAE A;  2K5H A;  2R7D A;  1Z47 A;  3RLF A;  1WTW A;  4CJ1 B;  1Q81 C;  4A3B B;  1QE6 A;  4DV1 L;  1C4Q A;  2R92 H;  5FOB B;  4IOC A;  1GD7 A;  1WCM B;  3DEO A;  4EQN A;  2JA7 G;  4FP5 D;  4AQY L;  5JPN C;  5C44 G;  1HFG A;  3QR8 A;  2VQF Q;  2NB0 A;  4OX9 L;  2O2L D;  2E8G A;  1ENF A;  3FKI B;  3GTO H;  5C4H A;  1PTO F;  3E9I A;  4WJ3 M;  3QJY A;  2QKI C;  3S17 H;  3D0F A;  1A63 A;  2HQE A;  2LMC B;  3DWP A;  3NTI A;  1K3R A;  1EYD A;  4A93 G;  3A7A B;  3TP8 A;  4KN4 C;  1E2Z A;  3F1Z A;  3QB3 A;  1NMG A;  5D65 A;  2EYP A;  4CDF C;  3J7Z C;  4EQO A;  5IP9 H;  1NJI C;  1X32 A;  1TR5 A;  4BY1 G;  1GUT A;  5M5X B;  2EZV A;  2E2J H;  1STB A;  3U58 A;  2BOS A;  3DWA A;  5M5Y H;  4DNR B;  2MO1 A;  3G6E A;  2FMM A;  4P73 A;  4JI8 L;  5FO8 B;  3CCR A;  2EYJ A;  1CKN A;  1YNN D;  3T1Y L;  1KDB A;  4DV2 Q;  1UE7 A;  2RCF A;  3UDX A;  2JQO A;  4BBR B;  1UWV A;  2HIV A;  3HOY B;  1G2T A;  1PTO H;  1U4P A;  1NNX A;  1RCV D;  4WOR A;  3VR3 A;  3GD7 A;  4AYB G;  4BBS H;  1ZEQ X;  4H13 C;  2I0Q A;  1QZG A;  4J1M A;  1NUC A;  2G9D A;  1LTG D;  2R3Z A;  3CCQ A;  4GN4 B;  4K8J A;  4XIG S;  5IYC G;  3S1R H;  1OO9 B;  4J15 A;  1D5Z C;  3L7Z C;  5COR A;  4LFC L;  1WTR A;  1EIY B;  3IFT A;  3D6W A;  3TSS A;  1QCB D;  2G9H D;  2KEE A;  4A3J B;  4HSP A;  2EPB A;  1PMR A;  1FGB D;  1HH2 P;  3SDZ A;  3K0X A;  3E0E A;  3AMU A;  2ZTD A;  4RHR A;  1LUZ A;  1QOH A;  4DV7 Q;  2R93 B;  1IL2 A;  2ALY B;  4OO1 H;  5M5W B;  4O0A A;  1SMX A;  2JE6 I;  1FGU A;  1SJE D;  4RFB A;  4IFD G;  1PYW D;  3E6Z X;  3CRL C;  1HZ9 A;  1EY6 A;  3I4N G;  3TBI B;  1HNW L;  3MXG A;  3SR1 A;  2A5H A;  3DLL A;  2KJX A;  1Z6H A;  1HZB A;  3K57 A;  1L0Y B;  2N55 A;  1HHV A;  2I5L X;  3DM1 A;  1I94 Q;  3P20 A;  1K8M A;  4WRD A;  2QDB A;  3OWE B;  2XSC A;  2PZU A;  5C5L A;  2Z8L A;  4X65 Q;  1XX8 A;  1UEA B;  3J80 i;  1K9M C;  5CYU A;  2DY7 A;  1CM9 A;  1B8A A;  3GP7 A;  5C3X A;  4MN3 A;  5IIF A;  1CKN B;  1YHQ A;  2C5C A;  4GLX A;  5BN4 A;  3JC6 6;  4CDE C;  1I6H H;  3E9H A;  3HOX B;  4OON A;  1EIG A;  1DOK A;  2RHS B;  5BN3 A;  2UU9 Q;  4C3H G;  4XT3 B;  3WWV A;  1DZ1 A;  3K5M A;  2K50 A;  1SNC A;  1N33 L;  2JA7 B;  5IT9 c;  1E0B A;  2ID0 A;  1LM0 A;  2DNE A;  4DR3 Q;  1W6K A;  1SR3 A;  1F9S A;  5JEA G;  3C1E A;  3S1Q B;  5F2D A;  1HNX Q;  1SDF A;  4LF5 L;  2LY7 A;  3NSW A;  5IT9 E;  1PH9 A;  2NN6 G;  3Q6S A;  4HTH A;  1STY A;  4NXM Q;  1XYI A;  2NZO A;  1EL0 A;  2VB2 X;  4QB4 A;  3I72 A;  1X3E A;  4PNY A;  1XPU A;  3E5S A;  4RWS C;  1TY0 A;  4B3M Q;  4BY1 B;  1SMY D;  1TS2 A;  4A3D G;  3R3O A;  2O4X A;  2ZM6 Q;  3NEM A;  3WOF A;  4IFD I;  4DAV A;  1EWI A;  4IPC A;  3RNU A;  3VR2 A;  4DV3 L;  1ESR A;  1YIJ A;  2NVX H;  4K0K L;  5ELO A;  1SE4 A;  5KYL A;  2VY3 A;  3HOZ G;  2F0F A;  4NP5 A;  5HUR A;  3CPF A;  1TWF B;  4A3F H;  1A15 A;  3NTH A;  5E7N A;  2XWJ B;  1JE5 A;  2IJ0 A;  1Y69 U;  1TWG B;  1XNQ Q;  1EWC A;  3D4D A;  1SND A;  3BYT B;  3DEP A;  1QIL A;  1N32 L;  3JAM L;  3LWE A;  1NTG A;  2DJF C;  2Z4I A;  2EE1 A;  3OHX C;  4X3T A;  2HDM A;  2E2H H;  2E2I B;  1TS5 A;  2N88 A;  2ZXP A;  1A0I A;  3T16 A;  3CCJ A;  4JI5 Q;  1YNJ D;  4I7A A;  4LF8 Q;  1IKL A;  1CSP A;  5JOB A;  1N8R C;  4KJN A;  1SFO H;  4UP9 A;  4JBK A;  1VQA A;  2R7Z G;  1JB3 A;  3PUW A;  4FXD A;  3K5N A;  3SK8 A;  5IGF A;  2A6H D;  5M3M H;  1IBL Q;  1RDP D;  3TDQ A;  1FD7 D;  4EX5 A;  4DK6 C;  1STN A;  1FL0 A;  2XRS D;  1HZC A;  1ZXT A;  1K8G A;  4A3E G;  3PQI A;  3CQZ B;  4G4K A;  3HOW G;  2Z1C A;  5C0X J;  1PLF A;  2IL8 A;  1KTK A;  4B3S L;  2XIW A;  1NR4 A;  3A8J E;  5LMU L;  4FYD A;  1Q46 A;  3GTK B;  5M3F H;  1KAW A;  2F3W A;  5HGT A;  2F0V A;  1S5B D;  2Z6B A;  4E6I A;  5GAH C;  4HJA A;  1QVF A;  3S2H B;  2K5D A;  2VQE Q;  4A75 A;  2H1E A;  4L63 B;  3PIO 3;  4N8X 1;  4OO1 I;  1Y1V H;  2OEO A;  1F9R A;  4BY7 G;  4JI3 L;  1X3P A;  2ZT9 C;  2E74 C;  3OW7 A;  2F3I A;  2N49 A;  1RL2 A;  2DJG C;  4I7Z C;  1YZ6 A;  5BR8 Q;  2WKC A;  3PO3 H;  4BXX G;  2OQ0 A;  2KCM A;  4UP7 A;  4HCE A;  2L4N A;  1YEZ A;  4JBW A;  2ATW A;  1XWE A;  4ZAI A;  4DR1 L;  3TQY A;  2K5W A;  4WJ4 A;  3UDG A;  4JG2 A;  4HIM A;  4IQZ A;  4HCS A;  2O5J C;  1PFB A;  3K7A H;  4DNI A;  2P5Z X;  3DUZ A;  1U4M A;  1K83 B;  1I4Q A;  2F1M A;  2JN4 A;  3WOE A;  4ZK9 B;  1DJR D;  3A8K E;  1AW7 A;  1CK1 A;  3SK6 A;  4EQP A;  3AYH B;  5DM7 3;  1T9H A;  3C2P A;  1OXS C;  2EXD A;  2VQF L;  4KJO A;  2YYZ A;  3CAM A;  3PUZ A;  1RHP A;  1JOR A;  1EY0 A;  3HOZ B;  3M7N A;  1F2L A;  5GRO A;  1PVO A;  1PFN A;  2EYH A;  3R8B A;  3HKS A;  4KHP Q;  2QF7 A;  3BVM A;  2NTT A;  1TKW B;  3RD4 A;  1VQG A;  1SE3 A;  1LAB A;  2J7Z A;  2B2V C;  4A3B H;  2J4X A;  3TP7 A;  2C35 B;  5K36 H;  2K04 A;  1UNS A;  3MC0 B;  1PTO D;  1WCM H;  5T1I A;  4FNF A;  1PYB A;  4ZKB B;  2HDL A;  1ROD A;  4DV2 L;  2OF1 A;  5FK9 C;  1E22 A;  3BG3 A;  3PIP 3;  3RZO B;  4NMZ A;  1I4G A;  3FKI H;  4JI2 Q;  1LYL A;  4HJ9 A;  2WAQ G;  3DMU A;  5CV6 A;  1H95 A;  5HGQ A;  3QO2 A;  5I9O A;  1SLJ A;  3M85 A;  3UDI A;  1HA6 A;  2OT2 A;  3ULP A;  3W2D A;  3F2C A;  3OYY A;  2NVQ B;  2EIF A;  4PG3 A;  1AFP A;  4JI7 Q;  3ER0 A;  2B2U C;  3M4P A;  5D3I B;  3RMH A;  1BXT A;  3BZK A;  2HHH Q;  2L15 A;  2R61 A;  3HOW B;  5M5X H;  3QG1 A;  4L6T B;  1C9O A;  4KTA A;  3ITP A;  4KMU C;  4OIK A;  2C9O A;  4PV1 C;  3SEB A;  3VYU A;  3HP3 A;  3HOU G;  2BE5 C;  4X3U A;  1CKM A;  1OXV A;  5DLQ E;  1KLU D;  5L37 A;  1GUW A;  4DV7 L;  4BBR H;  1PH5 A;  1KAA A;  1I50 B;  3NXW A;  2Z6K A;  1A2U A;  3K7U C;  2XN9 C;  4JYA L;  1IXR A;  1NMF A;  1OXU A;  4GN5 A;  2QA4 A;  1WTO A;  5HY6 A;  4R9W A;  4DR4 Q;  4RCN A;  2EY5 A;  4FO2 A;  4A76 A;  1I94 L;  1IYJ B;  4OL7 A;  4G7Z C;  4A3J H;  2CQO A;  4GOP B;  1VQM A;  4LMQ D;  4MHE A;  5TSS A;  3E0J A;  4X65 L;  3RN2 A;  4GLV B;  1Z9F A;  2L55 A;  3TRZ A;  3CC4 A;  1H9K A;  1PHJ A;  5FLX c;  4Y7N B;  3DWQ A;  4LK1 C;  1CZW A;  2HD3 A;  4PZ6 A;  2R93 H;  1EQT A;  2KCT A;  4FXK C;  5AJ3 Q;  5C4X B;  4LF9 Q;  1SNQ A;  5KEE A;  2UU9 L;  3EFX D;  3KF8 B;  2KHI A;  5FLX E;  1VQ7 A;  1KAB A;  1GUS A;  2YV5 A;  4B3R L;  2KQ3 A;  3TZD A;  4DR3 L;  2K5V A;  4O1N A;  3SK5 A;  2L12 A;  4HN7 A;  4L5S A;  3D3R A;  4Q0F A;  2CH4 A;  1HNX L;  2GVB A;  4CHT B;  1J8I A;  3A55 A;  5CGK A;  3J81 L;  2CQA A;  2A6E D;  1DYQ A;  3MVV A;  2Q2T A;  4NXM L;  1EFW A;  1NAP A;  2I46 A;  1QB5 D;  3S2D B;  5GAE C;  3CD6 A;  4B3M L;  1XMO Q;  1HTL D;  3PO2 B;  3HOY G;  2CW0 D;  2K52 A;  3KDF A;  1DD2 A;  2F0P A;  1NE3 A;  2JA7 H;  4GOP C;  5IYB G;  1CTM A;  4DGZ A;  3CU7 A;  1ZYR C;  5C44 H;  3PUY A;  4OEM B;  3KUP A;  3K5O A;  4UHV A;  1HR0 L;  3S1Q H;  1ILP A;  3NK9 A;  5GAD C;  1NY4 A;  1PRT B;  3IRB A;  4F88 A;  5A2Q L;  4DFA A;  4QUC A;  4GKK Q;  4OHJ A;  3I4M G;  4A93 H;  2Z9H A;  4B9W A;  2B39 A;  3M7G A;  3OIP A;  2JA6 B;  3DHQ A;  5ELE A;  1SYD A;  2EJF C;  1Q1B A;  4C3I G;  3UI2 A;  3HOV G;  2JP1 A;  1MD2 D;  1MJE A;  4BY1 H;  3BVZ A;  4UP8 A;  1G6P A;  4EGV A;  4L8J A;  3PUV A;  3V96 A;  5LL6 X;  4YWL A;  4NXN Q;  4JI5 L;  4LF7 Q;  4LF4 Q;  1C8C A;  3HOU B;  4LF8 L;  3EQL C;  1VQK A;  2RDF A;  4TSS A;  2K5N A;  1TWF H;  4FF2 A;  1D7Q A;  4PZ8 A;  1IBL L;  3A74 A;  3C3L A;  1TWG H;  1OXX K;  1UE1 A;  4JI0 Q;  3I3C A;  3D4W A;  2IWH A;  2RHQ B;  2JA8 G;  2ZTC A;  2UXD Q;  1CQV A;  1V1Q A;  4PMB A;  4NW2 A;  2E76 C;  4U67 3;  4GNX A;  4B9X A;  1KC8 C;  1ET9 A;  4DAP A;  3GDE A;  5KND A;  3STB D;  1SRO A;  4DR5 Q;  2E2I H;  1RD9 D;  4DPG A;  2JSO A;  4LUZ A;  1Q8K A;  3I70 A;  1YIT A;  3HOX G;  2VQE L;  2HIX A;  1BR9 A;  4ODG A;  2OWO A;  3KDF B;  1MHW C;  1KHI A;  2MQH A;  1N9W A;  2L0C A;  1E2W A;  1IYV A;  1BCP B;  1SYG A;  2XWB B;  1N34 Q;  4MIU A;  4CKC A;  1XPO A;  1NBW A;  2H4O A;  3R93 A;  3K6O A;  4IFD H;  4DK0 A;  5H1S E;  1H9S B;  1BBU A;  3J7A F;  1PZI D;  3ND8 A;  3I4N H;  1E1O A;  4K6D A;  5BR8 L;  4DNT B;  1G6Z A;  1X55 A;  3CQZ H;  2KEC A;  2YU9 B;  1CA5 A;  1EEF D;  2V4D A;  3S14 B;  5GQO A;  5CV5 A;  4G7O C;  2E2D C;  3A56 A;  5G3L F;  3AB9 A;  3S2H H;  5ELC A;  1SYC A;  2CH4 W;  4JBM A;  4LFA L;  3KJP A;  5I2X A;  2NZH A;  2SDF A;  2SNM A;  5IY0 A;  2Q2H A;  1PZK D;  2BA0 A;  1K0S A;  1S5F D;  3I8Z A;  2RKS A;  1PV4 A;  3PSI A;  4C3H H;  1Q90 A;  1STA A;  1SEB D;  3FPP A;  5EJW A;  1WTV A;  2EY1 A;  4DV4 Q;  1TWH B;  2X6L A;  1V9P A;  1LTI D;  3MEF A;  3ND9 A;  2NTS A;  4MNO A;  2PQE A;  4F8M A;  4EVO A;  4H7B A;  2B2W C;  4WFN 3;  5JEA H;  2PMZ B;  3S15 H;  2RVL A;  1B3Q A;  4KHP L;  4DR6 Q;  1BCP C;  1AZQ A;  1RF2 D;  1JJ2 A;  1PFS A;  1DON A;  2NN6 H;  3I4M B;  1K83 H;  2B2Y C;  4R4Q A;  4KI0 A;  4LNQ A;  4JPB W;  4OWX B;  1A3U A;  1TWC H;  3NPP A;  3SK4 A;  3ZJY C;  4GS3 A;  4C3I B;  3HOV B;  4FDB A;  1Q8I A;  3K58 A;  1SJH D;  4A3D H;  4QUF A;  1HR0 W;  2PYK A;  4P75 A;  4ZUJ A;  2X69 A;  3KBX A;  4ALP A;  4UDU C;  3J7Y W;  2BCO A;  3KYH C;  1U5K A;  4LWC A;  3LX0 A;  4A3G G;  3HOZ H;  1JWS D;  1CZG A;  4ILW A;  1R4Q B;  4FVM A;  1K8A C;  2R6G A;  3RLN A;  4YCW A;  1M1K C;  1GJX A;  2E5L Q;  1EZ6 A;  5FJ8 G;  4JI7 L;  2FMC A;  3RR5 A;  3NE5 B;  1GUO A;  1YHA A;  1XMQ Q;  2HHH L;  2KCC A;  2JA8 B;  5JAV A;  5CV9 A;  4IOA A;  3K8A A;  2CKZ B;  1X54 A;  4O2D A;  4CJ0 B;  2G5D A;  4DF7 A;  1K3B C;  4LF6 Q;  2NZ1 D;  3HFZ B;  2NVY B;  3LWU A;  3GQB A;  5FO9 B;  1EIH A;  1D5M C;  4YCV A;  3M4O H;  1STE A;  4AYB E;  4HJ5 A;  3IFD A;  2VL6 A;  1O7Z A;  1P16 A;  1PZJ D;  3HEJ A;  1B3A A;  5E4W C;  5ELF A;  4YWM A;  2R7Z H;  3FEW X;  4I65 A;  3GTJ B;  4K5W A;  5IT9 L;  2N8N A;  3TRE A;  2RSN A;  2F0J A;  2Y0S E;  4DR4 L;  1LV9 A;  2DUD A;  1QWY A;  2VS1 A;  3NP8 A;  1N36 Q;  1TII D;  4A3E H;  3HOW H;  4IN3 A;  1JJG A;  3F2U A;  2PW7 A;  3H6M A;  5DM6 3;  1SYF A;  2WII B;  1L1O A;  3ULJ A;  1EYA A;  4RGN A;  1C0A A;  1I5F A;  4ZQ3 A;  3A7L A;  3L0O A;  1IBM Q;  1AE2 A;  2ENB A;  2JYO A;  1BUV T;  5C4Z A;  5AJ3 L;  4GLA C;  4LF9 L;  3G4S A;  1D6E C;  1G2S A;  1I50 H;  3MA2 B;  3FMC A;  1A3V A;  4J8Q A;  3H3V C;  4BY7 H;  2K4K A;  3NHH A;  1LO5 D;  1S5C D;  4RCO A;  2F0Q A;  5KRU A;  3BJU A;  1C48 A;  3CCM A;  3KF6 A;  2H5X A;  4GKJ Q;  4A3K B;  4H02 A;  3PCO B;  2JA9 A;  2ASB A;  4BXX H;  1UUP A;  4DV6 L;  3QIA A;  5E4X A;  2MGS A;  1RIP A;  4CKB A;  3HGB A;  3MZ5 A;  1MBY A;  3F2D A;  4QJF A;  1YHB A;  2MO0 A;  4LUO A;  3CMA A;  2IHE A;  4Y7N H;  1A6X A;  1VMC A;  2B63 G;  4R4C A;  3AFQ A;  4K2L A;  1W6J A;  4LFB Q;  4OGQ C;  1QNK A;  5FLM G;  4XYO A;  3FP9 A;  2WB1 E;  1XMO L;  5EQ0 A;  2YTV A;  5JVH 3;  2A73 B;  1GO3 E;  2F03 A;  2LKV A;  3GTQ H;  1GXD C;  4EQ5 A;  1BKB A;  1E1T A;  1TQO A;  3BZD B;  1IZ6 A;  1V43 A;  4C2M B;  4CJ2 C;  5C5M A;  3H0G B;  3S1M B;  4JOI A;  3MXN A;  5K5P A;  1Q1E A;  4A3G B;  3P7J A;  5IYD G;  2D0O A;  1G51 A;  1R9T H;  3I56 A;  5EGT A;  5IE8 A;  1YJ9 A;  1QJO A;  1LTT D;  1PRT F;  4GKK L;  4V0B A;  1X9N A;  2NN6 I;  1STG A;  4RKL A;  2A68 C;  3K81 C;  2GVA A;  2RF4 A;  3S2D H;  3RZD H;  2UXC Q;  1B9N A;  3UDF A;  2F0E A;  2NWG A;  1VCI A;  3KJO A;  4X66 Q;  4RGM A;  2D5D A;  5J39 A;  1Q12 A;  4NXN L;  4BS9 A;  4LF7 L;  4LF4 L;  1B4O A;  4IPH A;  1EYG A;  1ET6 A;  3V2T A;  1AE3 A;  2JXM B;  2Q8I B;  4M1U B;  4HMJ A;  1TWA B;  1EY5 A;  4ZUI A;  2O5I C;  3GTM H;  3LGJ A;  2PNH A;  1O7I A;  2A19 A;  4XDX A;  3HG9 A;  2RBM A;  4JI0 L;  4X6A H;  1O7L A;  3AEV A;  2OCE A;  1QUQ A;  1W2B A;  2PW5 A;  4DV1 Q;  5M5Y B;  2UXD L;  3NBI A;  1PDQ A;  4Q5V A;  2KUM A;  1DCZ A;  1D2B A;  3U9S A;  4YHH Q;  1YBY A;  1Z7T A;  4NPS A;  5I6Y A;  2K1B A;  3NEL A;  4DR5 L;  3MHB A;  1DXM A;  2K75 A;  3S24 A;  4ZRZ A;  1IYU A;  1EU4 A;  1S72 A;  1UEB A;  4JI1 Q;  2HUG A;  4K6L A;  5C4X G;  1LTA D;  3J7A 5;  5EAY A;  3HOU H;  1P8L A;  2LXJ A;  4KLK A;  1X65 A;  2B2T A;  3BYY B;  1F2Y A;  1SBB B;  3M3Y H;  4BA2 I;  3S1R B;  1N34 L;  1XPR A;  2F52 A;  1BCP F;  3F8T A;  3A5Z B;  4PQX A;  2LXK A;  1PH3 A;  1H9J A;  3S1N B;  2ZXR A;  4CGY B;  4QIW E;  1SE2 A;  3S16 B;  1JE4 A;  3R2T A;  3NQT A;  1YVC A;  1J5E Q;  5CBE E;  3IAY A;  5NUC A;  1WI5 A;  1LT4 D;  3GO5 A;  4K5V A;  5ELN A;  1SRU A;  3CRK C;  3TS2 A;  2F0N A;  1TVX A;  4ME3 A;  1JB7 A;  3PO2 G;  3U4V A;  4K8I A;  1K0R A;  1ML0 D;  2B63 B;  2EXZ A;  2UUB Q;  1PH8 A;  4X64 Q;  3A5U A;  2FIN B;  1S5E D;  1TS3 A;  2K5Q A;  1CFM A;  1PH2 A;  3VR5 A;  4A3I G;  2D2C C;  3VR4 A;  3ULL A;  2EDG A;  4KV6 A;  5G3L D;  2FHT A;  3GV3 A;  4MTN A;  2YU9 H;  1IBK Q;  1BO0 A;  3T1H Q;  1VQO A;  3NWT A;  1WVL A;  1PXU A;  4ZCK A;  5FO7 B;  3HKZ E;  3S14 H;  3R2I A;  4IUR A;  4UAI A;  2JA6 G;  3J7A V;  4JV5 Q;  4A3C G;  2DNC A;  5C0X G;  4DR7 Q;  2M9V A;  4IUN A;  2A69 C;  4QMG A;  3FVQ A;  4S3S A;  5JJL A;  2ZXO A;  4DUZ Q;  4A3L G;  1LTB D;  4XXE A;  1BDO A;  2AWN A;  3G7L A;  1WD1 A;  4IUQ A;  1RJT A;  3MFG A;  4IZ8 A;  2TSS A;  1VQJ A;  3JAM i;  2BE5 D;  3NTK A;  2CVR A;  3TP6 A;  3HOY H;  2F4V Q;  1HNZ Q;  2N78 A;  1IW7 C;  4C3J G;  5IYB H;  3UE0 A;  2GA4 B;  5I9P A;  4RGO S;  4DAY A;  2PNR C;  2IHF A;  1HUM A;  3OIQ A;  2E5L L;  5T1G A;  2MHV A;  3I4M H;  1XMQ L;  5EPK A;  4F7X A;  5J1Z A;  1SNP A;  2MFI A;  1EQQ A;  5ELD A;  3OSO A;  4OWW B;  3N52 A;  3P75 A;  3Q23 A;  4C3I H;  4LF6 L;  5FLX L;  2PQA A;  1LTS D;  3GV6 A;  4L5T A;  1Q7Y C;  1HCZ A;  5M5W H;  4JI4 Q;  4A3F B;  4FXG C;  1HJP A;  3BU2 A;  3URY A;  4NB3 A;  4XQQ A;  2FJ2 A;  2WAQ E;  4JI6 Q;  2RCN A;  4RG1 A;  2PI2 E;  4Z9C B;  1KD1 C;  1EY7 A;  4L5Q A;  2OXP A;  2PI2 A;  3B6Y A;  1EQV A;  3PIO A;  5C3W A;  5GAG C;  4P71 A;  4HID A;  1PH4 A;  4RGT A;  2RDH A;  3H3V H;  3VDY A;  4HED A;  2QDL A;  3I55 A;  1A8V A;  2AHO B;  2BA1 A;  2ICE C;  4MTK A;  4PMC A;  1N36 L;  1XNR Q;  2EYO A;  1MGS A;  2JA8 H;  1BOS A;  1TT2 A;  4AH6 A;  1MJC A;  1MI2 A;  4KHZ A;  2QEJ C;  3AFP A;  2OQK A;  4R4I A;  2NVY H;  4KY7 A;  1AEX A;  2ZTE A;  1A62 A;  4DV0 Q;  1Q86 C;  2KEN A;  1JIC A;  5M3M B;  1IBM L;  1CT1 D;  1K8O A;  3HOX H;  4BWG B;  4OWT B;  5CMD A;  5I4D A;  5EPL A;  2EYF A;  2ZM6 L;  4C56 C;  2SEB D;  4TVA B;  3GTJ H;  2WAC A;  2KVM A;  3T13 A;  3CPW A;  3MTS A;  3Q24 A;  1WTX A;  5I6W A;  2EYM A;  4A3I B;  1IHZ A;  4RH6 A;  1ZYR D;  4R4O A;  1WFQ A;  4GKJ L;  4WJW A;  1XTC D;  4DV5 Q;  3ONA B;  1YJW A;  4NKL A;  1GUG A;  3C1F A;  2DY8 A;  1WD0 A;  2KA7 A;  1B7Y B;  1XNQ L;  5KIX A;  1B70 B;  4GZY C;  1VQ4 A;  4TQU S;  1PH7 A;  1L0X B;  3FRP B;  1LLR D;  2RQX A;  5ISR A;  3MEH A;  4LFB L;  4R8I A;  2VUM G;  2WP8 J;  3MXP A;  1X3F A;  1I6V C;  3J80 c;  1GOZ A;  1BBW A;  1FNU A;  2M2L A;  4P2C B;  5IGB A;  4R4T A;  5C4J B;  4QL5 A;  1GVP A;  5IP7 G;  1VQ8 A;  4JW0 A;  2AQ1 B;  3BZC A;  1C7Y A;  3QOL A;  1SN8 A;  1JWU D;  4IPD A;  3TP5 A;  4KKS A;  1HQM C;  2BDN A;  4C3J B;  2LSS A;  3J80 E;  2Q2U A;  4QGU A;  3K7A B;  3PIP A;  4P74 A;  5IYC H;  1F2Z A;  3EBE A;  4J6H A;  4MZ9 A;  4IFD J;  3K5L A;  2WIN B;  2Z6K C;  4DR2 Q;  1QNU A;  2PZT A;  2PO4 A;  1O80 A;  3LNN A;  3T4A C;  4DKA C;  2UXC L;  3SE0 A;  5KYI A;  1Y1W G;  1BNZ A;  2F4I A;  4JC0 A;  3PMF A;  1ENA A;  1EUJ A;  1PRT C;  1WTH A;  4LAA A;  1IKM A;  1WYD A;  3I73 A;  4C2M H;  1AZP A;  3S1M H;  4FF3 A;  4A3G H;  4OIJ A; 
#chains in the Genus database with same CATH homology
 4DR1 L;  2DUD A;  2VS1 A;  3I7F A;  3TQY A;  2I5H A;  1N36 Q;  4JYA Q;  1LTL A;  4WJ4 A;  4A3E H;  3OW2 A;  3UDG A;  2JJQ A;  3HOW H;  5LMN Q;  4A3B G;  1JJG A;  4JG2 A;  3H15 A;  4HIM A;  5K36 G;  3CME A;  2JA5 G;  3K7A H;  4DNI A;  2KHJ A;  5FJ8 H;  3GTK H;  1L1O A;  3ULJ A;  1WCM G;  3FHW A;  5C0X I;  1L2F A;  2EQS A;  4YHH L;  1C0A A;  1I5F A;  4DV3 Q;  3L0O A;  1IBM Q;  1AE2 A;  4K0K Q;  1FVI A;  3FKI G;  3OTO Q;  4JI1 L;  3AYH B;  5AJ3 L;  1T9H A;  1D8L A;  4GLA C;  4LF9 L;  1OXS C;  2EXD A;  5JEA J;  1I50 H;  3G4S A;  4BY7 H;  2DGY A;  2CFM A;  2K4K A;  2VQF L;  4IJL A;  1Y1W H;  2YYZ A;  3CAM A;  3PUZ A;  4UPA A;  2D0P A;  5JJI A;  4DV6 Q;  1TWA H;  2XTI A;  5C3E G;  3M7N A;  3BJU A;  3CCM A;  1S40 A;  3KF6 A;  2H5X A;  5GRO A;  1VQD A;  4DK3 C;  3I4O A;  5LMN W;  4A3K G;  4H02 A;  3H3V I;  3PCO B;  1PVO A;  4JCV E;  3HKS A;  2JA9 A;  3J81 c;  1QZH A;  1FJG Q;  2ASB A;  4BXX H;  4KHP Q;  4DV6 L;  1N32 Q;  1KRS A;  3F2B A;  2AMC B;  1RIP A;  3EN2 A;  4DAY B;  4R1J A;  4GNX B;  4DUY Q;  1J5E L;  1VQG A;  1UE5 A;  3F2D A;  4QJF A;  1YHB A;  3SGI A;  4A3B H;  2MO0 A;  4LUO A;  3L2P A;  2IHE A;  4Y7N H;  3CMA A;  2C35 B;  1UE6 A;  4A3M G;  4BBR G;  2JA5 H;  2V1C C;  2B63 G;  4R4C A;  3AFQ A;  4LFB Q;  1WCM H;  1KRT A;  1CUK A;  1EIF A;  5FLM G;  1PYB A;  3FP9 A;  1QVC A;  2GN5 A;  2WB1 E;  2PQA B;  1XMO L;  2YTV A;  4DV2 L;  1GO3 E;  3J81 i;  1E22 A;  4YWK A;  3GTQ H;  3FKI H;  4HIK A;  2UUB L;  4X64 L;  4JI2 Q;  1LYL A;  4HJ9 A;  2WAQ G;  3U4Z A;  4EQ5 A;  1H95 A;  4HJ7 A;  4JBJ A;  5HGQ A;  1BKB A;  3PGZ A;  1E1T A;  1SLJ A;  3M85 A;  4IJH A;  3RN5 A;  2VZA A;  1IZ6 A;  1V43 A;  3K80 C;  4A3J G;  3D31 A;  3W1G A;  3S1N H;  2Y0S G;  3H0G G;  3UDI A;  1E3P A;  4JOI A;  4X62 L;  3ULP A;  4B3S Q;  1Q1E A;  3F2C A;  3OYY A;  2QGQ A;  2UUA L;  4JI2 L;  3S16 H;  2EIF A;  4PG3 A;  5IYD G;  2D0O A;  5C3E H;  3CF5 A;  1G51 A;  3ER0 A;  3M4P A;  2FXQ A;  5IWA Q;  1R9T H;  3I56 A;  4JI7 Q;  5IE8 A;  1IBK L;  3T1H L;  3BZK A;  4A3K H;  1YJ9 A;  2HHH Q;  2A8V A;  2L15 A;  1YI2 A;  2VNU D;  5M5X H;  4YY3 L;  4GKK L;  2UXB L;  1X9N A;  2R92 G;  2NN6 I;  1X6O A;  1ASY A;  1C9O A;  3GTG H;  2R93 G;  1JMC A;  2B29 A;  4JV5 L;  1KQS A;  3K81 C;  2GVA A;  2RF4 A;  3ICE A;  4DR7 L;  3HOU G;  3S2D H;  1SE8 A;  3RZD H;  3Q8D A;  4JI3 Q;  2UXC Q;  1DGS A;  3UDF A;  2UUC L;  1CKM A;  1G29 1;  1KL9 A;  1OXV A;  5DLQ E;  1VCI A;  4LW1 A;  5J3B A;  3KJO A;  4DUZ L;  4BBR H;  4X66 Q;  4DV7 L;  4A3M H;  3CC2 A;  1PH5 A;  1VQB A;  4LUV A;  1I3Q H;  2B63 H;  1Q12 A;  4NXN L;  3CXC A;  4LF7 L;  4LF4 L;  1BVS A;  1E24 A;  4IPH A;  2JEA I;  5FLM H;  2ZJP A;  1Q82 C;  1EYG A;  2Z6K A;  4QY7 A;  1AE3 A;  3K7U C;  2YTY A;  4X66 L;  1YJN A;  4GNX C;  3KOJ A;  3RZO H;  1VQ6 A;  4JYA L;  3GTP H;  2F4V L;  1IXR A;  1HNZ L;  1NMF A;  1OXU A;  4GN5 A;  3LGJ A;  2QA4 A;  3GTM H;  2PNH A;  5HY6 A;  4P72 A;  3J81 j;  4DR4 Q;  4DR1 Q;  1O7I A;  5IP9 G;  4A76 A;  2A19 A;  3KFU A;  2IX0 A;  2PMZ E;  3STB C;  1IYJ B;  1I94 L;  4A3J H;  1XJV A;  4JI0 L;  4X6A H;  2CQO A;  3H0G H;  3CCU A;  3AEV A;  2AWO A;  2OCE A;  1QUQ A;  4OXP A;  4GOP B;  1XTD A;  3TS0 A;  4DV1 Q;  1VQM A;  1W2B A;  4B3T L;  2NVQ H;  2UXD L;  2Z0S A;  4POG A;  5IYD H;  4X65 L;  3RN2 A;  2K5H A;  2R7D A;  1JJC B;  1Z47 A;  4GLV B;  3RLF A;  4YHH Q;  1Z9F A;  1YBY A;  3TRZ A;  3CC4 A;  1Q81 C;  1PHJ A;  4NPS A;  5FLX c;  4DR5 L;  3NEL A;  4DV1 L;  2R92 H;  4QQB X;  2K75 A;  3S24 A;  1S72 A;  4PZ6 A;  2R93 H;  4IOC A;  2WB1 G;  3CCV A;  1UEB A;  2KCT A;  4JI1 Q;  1VQ5 A;  5AJ3 Q;  1GD7 A;  5C4X G;  2JA7 G;  3RLO A;  4AQY L;  4LF9 Q;  3J7A 5;  3TEH B;  5EAY A;  3HOU H;  1P8L A;  4UY8 C;  4BBS G;  4B3R Q;  2LXJ A;  4KLK A;  5C44 G;  1VQN A;  1X65 A;  2VQF Q;  1WJJ A;  4OX9 L;  2UU9 L;  1EQR A;  1U0L A;  1GM5 A;  3KF8 B;  2E8G A;  4PMW A;  3GTO H;  2KHI A;  3M3Y H;  4JI4 L;  1VQ7 A;  2WFW A;  1N34 L;  1XPR A;  4BA2 I;  2F52 A;  3F8T A;  3E9I A;  4JI6 L;  2YV5 A;  4B3R L;  4WJ3 M;  3A0J A;  3A5Z B;  4IPG A;  3S17 H;  2LXK A;  1PH3 A;  3D0F A;  2CWA A;  4DR3 L;  2K5V A;  1A63 A;  1PA6 A;  3CCS A;  2N3S A;  1EOV A;  1VQH A;  4DAM A;  1K3R A;  4A93 G;  4QIW E;  3F1Z A;  1NMG A;  4L5S A;  1HNX L;  1YVC A;  2GVB A;  3J7Z C;  2OTL A;  1J5E Q;  5IP9 H;  1NJI C;  1KIX A;  1CSQ A;  1WI5 A;  4BY1 G;  1VQ9 A;  2E2J H;  3GO5 A;  1J6Q A;  3I2Z A;  1VQI A;  3U58 A;  4L5R C;  1XNR L;  3KLW A;  1SRU A;  5ELN A;  5M5Y H;  2Q2T A;  4NXM L;  3TS2 A;  2MO1 A;  1EFW A;  4OO1 G;  3G6E A;  4P73 A;  2VW9 A;  4JI8 L;  3CCR A;  1K73 C;  1CKN A;  3AQQ A;  3CCL A;  4ME3 A;  5GAE C;  3CD6 A;  1JB7 A;  4B3M L;  3T1Y L;  1XMO Q;  2I5M X;  3PO2 G;  3U4V A;  4DV2 Q;  1K0R A;  1UE7 A;  3UDX A;  3HOY G;  2JQO A;  1UWV A;  2HIV A;  4DV0 L;  2K52 A;  3KDF A;  2UUB Q;  1PH8 A;  1CKO A;  4X64 Q;  3A5U A;  1HR0 Q;  1NE3 A;  3GD7 A;  5C4X H;  4AYB G;  2JA7 H;  4BBS H;  4GOP C;  1PH2 A;  5IYB G;  1QZG A;  2I0Q A;  4A3I G;  5C44 H;  3PUY A;  2MNA A;  4Y52 H;  3CCQ A;  4GN4 B;  4XIG S;  5IYC G;  1S3O A;  4X62 Q;  1QVG A;  3ULL A;  3S1R H;  3M4Q A;  4J15 A;  2UUA Q;  3L7Z C;  1M90 C;  4LFC L;  1HR0 L;  1EIY B;  3S1Q H;  3PF5 A;  4MTN A;  2YU9 H;  5GAD C;  1NY4 A;  1IBK Q;  3IRB A;  3T1H Q;  1VQO A;  2K14 A;  3JAM c;  4YY3 Q;  4GKK Q;  2UXB Q;  3I4M G;  4A93 H;  3HKZ E;  3S14 H;  2QEX A;  4DV5 L;  2JA6 G;  1HH2 P;  2IX1 A;  4JV5 Q;  3K0X A;  3G48 A;  4A3C G;  3E0E A;  5C0X G;  4A4I A;  4DR7 Q;  2KBN A;  2ZTD A;  1Q1B A;  3HOV G;  3CW2 C;  1L1O B;  2ZJQ A;  1LUZ A;  1MJE A;  4BY1 H;  2UUC Q;  5JJL A;  4UP8 A;  1G6P A;  4A3L G;  4DUZ Q;  4DV7 Q;  3PUV A;  1IL2 A;  2ALY B;  4YWL A;  4NXN Q;  2AWN A;  1SMX A;  4O0A A;  4JI5 L;  2BH2 A;  2JE6 I;  1FGU A;  3M9B A;  4LF4 Q;  4LF7 Q;  4IFD G;  4LF8 L;  3CCE A;  1VQJ A;  1HZ9 A;  3JAM i;  1VQK A;  3I4N G;  3PO2 H;  3HOY H;  2JEB I;  2K5N A;  3W5O A;  2F4V Q;  1TWF H;  1HNZ Q;  2N78 A;  1HNW L;  1D7Q A;  3DLL A;  4PZ8 A;  1IBL L;  3NBH B;  1HZB A;  4IO9 A;  1PH6 A;  5IYB H;  3A74 A;  2I5L X;  1TWG H;  3UE0 A;  4A3I H;  1OXX K;  1UE1 A;  1I94 Q;  4JI0 Q;  3KF6 B;  4B3T Q;  2RHQ B;  2JA8 G;  2ZTC A;  2UXD Q;  1VQL A;  2BH8 A;  4X65 Q;  2ES2 A;  2JK8 A;  4GN3 B;  1V1Q A;  1KXL A;  3J80 i;  1K9M C;  2IHF A;  4GNX A;  1KC8 C;  1B8A A;  2E5L L;  3GDE A;  3STB D;  1SRO A;  4DR5 Q;  2E2I H;  3I4M H;  1XMQ L;  1CKN B;  1YHQ A;  4DPG A;  1MKH A;  4LUZ A;  4GLX A;  2JA6 H;  3JC6 6;  1Q8K A;  2MFI A;  4A3C H;  1YIT A;  1EQQ A;  1OXT A;  1I6H H;  3HOX G;  2VQE L;  2HIX A;  3E9H A;  5JJK A;  5LMU Q;  4AQY Q;  2OWO A;  3KDF B;  4OWW B;  4OON A;  4C3I H;  4DR2 L;  1KHI A;  4LF6 L;  2MQH A;  4POF A;  2RHS B;  1N9W A;  2PQA A;  4OX9 Q;  4L5T A;  2UU9 Q;  4A3L H;  1X56 A;  3WWV A;  1Q7Y C;  4A3F G;  5M5W H;  4JI4 Q;  2K50 A;  1N34 Q;  1HJP A;  3BU2 A;  1XPO A;  4NB3 A;  4JI6 Q;  1NBW A;  1MIU A;  2WAQ E;  5IT9 c;  1N33 L;  2RCN A;  2ID0 A;  2XGT A;  1LM0 A;  2CWP A;  4PZ7 A;  4RG1 A;  1VQE A;  2PI2 E;  4DR3 Q;  5H1S E;  1SR3 A;  1KD1 C;  1BBU A;  4L5Q A;  2PI2 A;  3I4N H;  3B6Y A;  1E1O A;  5C4J H;  5BR8 L;  3PIO A;  5GAG C;  2Q2I A;  4P71 A;  5JEA G;  1L1O C;  4HID A;  1X55 A;  3CQZ H;  3MXN B;  1PH4 A;  1HNX Q;  3EIV A;  4LF5 L;  2HT1 A;  3H3V H;  3HKZ G;  4C3J H;  3VDY A;  1VQF A;  1PH9 A;  4LFA Q;  3NEN A;  2NN6 G;  3I55 A;  1A8V A;  2AHO B;  2BA1 A;  1N36 L;  1XNR Q;  5GQO A;  4NXM Q;  2JA8 H;  2NZO A;  5LMN L;  4JI8 Q;  4AH6 A;  3S2H H;  1X3E A;  1MJC A;  4KHZ A;  1XPU A;  4JBM A;  4LFA L;  4B3M Q;  2IY5 B;  3KJP A;  1E7Z A;  2B3G A;  3AFP A;  2OQK A;  4R4I A;  3U50 C;  2NZH A;  3T1Y Q;  2NVY H;  4A3D G;  2D62 A;  2ZM6 Q;  2ZTE A;  1A62 A;  3NEM A;  5IY0 A;  4DV0 Q;  1Q86 C;  4IFD I;  2KEN A;  2Q2H A;  1EWI A;  3PF4 A;  4IPC A;  2BA0 A;  5M3M G;  3RNU A;  4DV3 L;  1YIJ A;  1IBM L;  2NVX H;  3HOX H;  4K0K L;  5ELO A;  4OWT B;  3OTO L;  2VY3 A;  3HOZ G;  1PV4 A;  3PSI A;  2ZM6 L;  4C3H H;  3G71 A;  4TVA B;  3CPF A;  3CP0 A;  3GTJ H;  4A3F H;  4LFC Q;  5E7N A;  4DV4 Q;  1GKH A;  1V9P A;  1JE5 A;  2R7F A;  2OTJ A;  3MEF A;  4APV A;  3CPW A;  1JT8 A;  4GKJ Q;  4MNO A;  4RMF A;  5M3F G;  4R4O A;  1WFQ A;  1XNQ Q;  4GKJ L;  4GOP A;  4DV5 Q;  4DV4 L;  1AH9 A;  3S15 H;  1QUQ B;  1YJW A;  1PYS B;  1FJG L;  4KHP L;  3GTL H;  4DR6 Q;  1N32 L;  1JJ2 A;  1NTG A;  1PFS A;  1B7Y B;  1Y1V G;  2E2H H;  1XNQ L;  1B70 B;  4DUY L;  1K83 H;  2A1A A;  1VQ4 A;  4HJ8 A;  4R4Q A;  4TQU S;  1PH7 A;  2HQL A;  1A0I A;  3CCJ A;  4XTC S;  1VQC A;  4JI5 Q;  4KI0 A;  4LNQ A;  4DR6 L;  4OWX B;  1TWC H;  3ZJY C;  2NVT H;  4BA1 I;  4GS3 A;  4LF8 Q;  2CCZ A;  4FDB A;  1HZA A;  1CSP A;  4LFB L;  4A3D H;  1N8R C;  2YTX A;  4JOI C;  4UP9 A;  2WP8 J;  1VQA A;  1SFO H;  1OTC A;  4JBK A;  2VUM G;  2R7Z G;  1HR0 W;  3PUW A;  1X3F A;  4P75 A;  1HNW Q;  3PO3 G;  5M3M H;  3J80 c;  3CC7 A;  4ALP A;  1IBL Q;  1BBW A;  3KYH C;  1TXY A;  1U5K A;  4LWC A;  4DK6 C;  4EX5 A;  4A3G G;  2AKW B;  3HOZ H;  1FL0 A;  4R4T A;  4QL5 A;  1GVP A;  1L0W A;  5IP7 G;  1VQ8 A;  1HZC A;  3BZC A;  1K8G A;  1C7Y A;  4A3E G;  1SN8 A;  4IPD A;  3HOW G;  5C0X J;  2IT1 A;  1TWH H;  1K8A C;  2R6G A;  3RLN A;  4B3S L;  3DM3 A;  4YCW A;  1M1K C;  2LSS A;  3UE1 A;  2Q2U A;  4QGU A;  5LMU L;  2E5L Q;  5FJ8 G;  1Q46 A;  4JI7 L;  5IWA L;  3PIP A;  3RR5 A;  1KAW A;  4P74 A;  5IYC H;  5M3F H;  1YHA A;  1XMQ Q;  3EBE A;  2HHH L;  4IOA A;  3K8A A;  2CKZ B;  4MZ9 A;  5GAH C;  4HJA A;  1QVF A;  4IFD J;  2ZJR A;  4AIM A;  1X54 A;  2VQE Q;  4O2D A;  3ERS X;  4A75 A;  2Z6K C;  4DR2 Q;  4LF6 Q;  4OO1 I;  1ASZ A;  3HFZ B;  1W3S A;  1Y1V H;  1WOC A;  4BY7 G;  4DKA C;  4JI3 L;  4HIO A;  2UXC L;  1Y1W G;  3W1B A;  4YCV A;  1N33 Q;  3M4O H;  4AYB E;  4HJ5 A;  4JC0 A;  3HOV H;  2F3I A;  2N49 A;  2VL6 A;  4YCU A;  1YNX A;  1RL2 A;  1EUJ A;  4YWM A;  1P16 A;  2VUM H;  2R7Z H;  1YZ6 A;  5BR8 Q;  1WYD A;  4C2M H;  3PO3 H;  2N8N A;  1VQP A;  4BXX G;  2OQ0 A;  2KCM A;  1VS0 A;  3PUX A;  3TRE A;  4UP7 A;  4LF5 Q;  3S1M H;  1X3G A;  3PV0 A;  1Y14 B;  4A3G H;  1YEZ A;  4JBW A;  2ATW A;  2Y0S E;  1PH1 A;  4DR4 L;  5IP7 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...