1AE2A

Mutant l32r of gene v protein (single-stranded dna binding protein)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
86
structure length
86
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQRCYVDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE V PROTEIN
publication title Analyses of the stability and function of three surface mutants (R82C, K69H, and L32R) of the gene V protein from Ff phage by X-ray crystallography.
pubmed rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 10
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ae2A00
4IJLA 5C3EH 1PA6A 3UDXA 4DAYB 1N34Q 2UUBL 4IOAA 2XGTA 5M3MH 4DR6L 1VQBA 1SN8A 4X62L 4DK3C 1JJGA 2EXDA 1JB7A 4KHZA 4GLXA 1IBML 1N32L 3PO2H 1SR3A 1X3FA 2PI2A 3UE0A 2R7DA 4A3IH 2OQKA 2IX0A 2B63H 3KF8B 3BJUA 3GD7A 2YTVA 5IYBG 2JJQA 4A76A 1A63A 1R9TH 3CW2C 3JAMi 4DR4L 3S2DH 3A5UA 3ER0A 1VQAA 1Q12A 2ID0A 3H15A 1C9OA 5BR8L 2R93G 1UE1A 4JI7Q 3PF4A 3J81j 5GAHC 2MFIA 3JAMc 1JT8A 1Q86C 1YJNA 3GTMH 2K4KA 4YY3Q 1YITA 1QZHA 2NVQH 1EQQA 4L5SA 3J81c 1EYGA 5IE8A 1YNXA 3I4MG 2UUCL 3E9IA 4BBRG 5GAEC 1SFOH 2GVAA 1IZ6A 4KI0A 1VQIA 1CKNA 3S1QH 4POFA 5FLMH 2AMCB 2R92H 3HOUG 1YVCA 5M5YH 5LMUQ 2HT1A 1IXRA 1Y14B 2NN6G 1ASYA 4EQ5A 3J7ZC 3CCJA 4J15A 3CCQA 3KFUA 1PYBA 2MQHA 2RHQB 3K7UC 3AEVA 1HNZL 4O0AA 3I7FA 5IYCG 2N78A 3I4OA 4FDBA 2QGQA 4JI2L 4C3HH 1V43A 1P16A 4LF7Q 1V9PA 1KXLA 3NBHB 5M5WH 1JJCB 4A3BH 3UE1A 4GLAC 1PH2A 4GOPA 3H3VH 1YHAA 3ULLA 2LSSA 1YJ9A 4A3GH 2CWAA 2ZTDA 1U0LA 4QGUA 1LTLA 1PFSA 4GNXA 4NXMQ 2NN6I 4DUZQ 2VL6A 5H1SE 2R6GA 1J5EL 5JJIA 3GO5A 1XJVA 1YBYA 1VQ8A 3KF6B 2KHIA 4LFCQ 1EWIA 4GKJL 1P8LA 1N33Q 4DK6C 3NELA 5GROA 2A8VA 3RR5A 2PQAB 3KLWA 1B70B 4JI4Q 2BH2A 3S24A 4LW1A 1A0IA 2WB1G 4YWLA 1PH1A 2I0QA 3TS2A 5C4JH 2E5LQ 2F52A 4PZ8A 3K80C 4B3TL 4LF5L 5C44G 1TWGH 4JI8Q 4BA2I 5GQOA 2KENA 4L5RC 5EAYA 4JI5Q 2ATWA 3JC66 3L7ZC 5FJ8H 3I55A 5LMNW 2QEXA 1X6OA 3PO3H 4BXXG 5ELOA 1VS0A 4DV2L 1IL2A 2I5MX 4BY1G 3G6EA 1I50H 2VQEL 4DV6L 4DR1L 3HOWH 1XNQQ 2UU9L 1Q1EA 3BZCA 1K8AC 1NJIC 4DV5Q 1XNRL 2Q2TA 3PUYA 3FKIH 5E7NA 4DV1Q 1OXTA 2OTLA 3F8TA 4HIOA 4X6AH 3IRBA 2BA0A 3RN5A 1E22A 3M3YH 3CCLA 3H0GH 3UDFA 4YCVA 3STBD 2H5XA 3CPWA 3A74A 2EIFA 3U4VA 4LFCL 1NE3A 5IWAL 3T1HQ 2Q2HA 3L0OA 4DUYL 4JOIC 1N33L 3CCVA 4PG3A 3D0FA 1W2BA 4JV5Q 5LMNL 4LFBQ 5IYDG 2OWOA 4L5QA 2JA7H 2Y0SE 3PUZA 2UXBQ 1FVIA 3S14H 1HR0W 2IT1A 3OTOL 2E5LL 3I4NG 1A62A 1TWCH 3GTQH 4LUZA 4A93G 4JI8L 1HNXL 2ZJQA 4NXNL 1Y1WG 4A3FG 2JA8H 1VQHA 1SLJA 5HGQA 4OO1G 2JA9A 1N8RC 4OXPA 4DR5Q 2BA1A 4LF4L 3J80i 4B3RQ 4R4QA 5JJLA 4A75A 2OTJA 4X64Q 1KIXA 1NMGA 2ZM6Q 1XNQL 2KBNA 3CP0A 1HH2P 2ZTCA 2IHEA 1QZGA 2K5HA 1UE5A 3CQZH 1K9MC 3CC4A 4GN5A 3M4OH 3KF6A 4QIWE 3ULJA 3GTGH 4DR3L 4JI1L 4A3LG 3E0EA 4XIGS 3J80c 4A3JG 1OXSC 1PVOA 4TVAB 1Q8KA 1S3OA 4GOPC 2PQAA 1TWAH 4DR2L 1U5KA 4IPGA 4DV4L 1E3PA 1HNWQ 2A19A 4GKKQ 3CCSA 3CMAA 4X66L 4GNXC 1S72A 3K8AA 1HR0L 4JI3Q 4JI6Q 1HZ9A 4LFAL 4OO1I 3KJOA 3T1HL 1RL2A 4OWXB 1SROA 5M3FG 3GDEA 1VQPA 3HOZG 1EIYB 3J7A5 5IY0A 1KL9A 4OWWB 4PZ7A 2UUAL 3S15H 1GO3E 1I94L 4A3KG 4HJ9A 1PH5A 1UEBA 4NPSA 5C3EG 3GTJH 2F4VQ 4Y52H 1WJJA 2C35B 5M3MG 4YHHL 1X56A 2JEAI 3DM3A 1UWVA 1VQ4A 2F3IA 2KCMA 4AYBG 3ICEA 2K52A 4LF8Q 2ES2A 1EIFA 4Y7NH 2R93H 1VQMA 2JQOA 4BY7G 1VCIA 3CPFA 4YCWA 4APVA 2ZM6L 3HOXG 4A3EG 4A3CG 2N49A 1AH9A 4KHPQ 1QVGA 3U58A 1XPOA 4YCUA 3G4SA 4LF6Q 1C0AA 1O7IA 1K0RA 3I4MH 2L15A 3B6YA 1YZ6A 4GLVB 5HY6A 1N34L 4HJ7A 2YTYA 3RLOA 1LYLA 3GTPH 1N36Q 1X65A 3CMEA 1D8LA 2WB1E 4AIMA 4GKKL 3G71A 4JI3L 5IP9H 3HOUH 4IFDG 1NTGA 1GKHA 4DV7Q 1EOVA 1NBWA 1PH3A 4JBJA 2NZHA 3HFZB 2ZJRA 3PIPA 3CCRA 2CQOA 1MJCA 2R7ZH 4GN4B 5IYCH 4BA1I 1WCMG 1T9HA 4IO9A 4DR7Q 2ALYB 4JG2A 4R4CA 2UXCQ 1EFWA 3PSIA 4ME3A 4DV3Q 3KYHC 4JI7L 4DPGA 4RMFA 1KRSA 1Q82C 3CC7A 1FJGQ 2JE6I 3EBEA 1FGUA 4YY3L 3AFPA 1FL0A 1VQ5A 2ASBA 1G51A 4K0KQ 5M5XH 2JA5G 3U4ZA 1VQJA 3E9HA 4IFDI 4HIDA 1VQEA 3KOJA 4UP8A 3S16H 3S17H 3HOVH 1K3RA 2Q2UA 1Q1BA 1QUQB 5GAGC 3CCMA 1K73C 1LM0A 2Z6KA 2VW9A 1IBKQ 3HOYG 3M85A 1X9NA 1JMCA 2IX1A 4NB3A 3I56A 5LMUL 1QVCA 1NY4A 2NZOA 3A5ZB 3TREA 5IP7G 2QA4A 1J6QA 1XMOQ 1I3QH 2VY3A 2WP8J 4R1JA 1Y1VG 2RCNA 4A4IA 4DV7L 5C44H 4B3SQ 2JA6G 1AE2A 2PI2E 3G48A 2ZJPA 2E2IH 4IPCA 2HHHQ 1PH8A 5JEAG 4WJ4A 2B29A 1OTCA 4BXXH 5IT9c 2LXJA 3T1YQ 4LF7L 4DR7L 4P75A 3PV0A 3PIOA 3CCEA 1SE8A 1VQ7A 2PNHA 4LF9Q 3GTLH 1VQ9A 1YEZA 4POGA 5FJ8G 2CCZA 4NXML 4DUZL 3RLNA 2UXDQ 3PUWA 2VS1A 1KAWA 3PUVA 4JI0Q 2K14A 3MXNB 5FLXc 4DKAC 4IJHA 2PMZE 1L1OB 3UDIA 2HQLA 2FXQA 4MTNA 3W5OA 1BBUA 3FKIG 4AQYQ 1PHJA 1KD1C 4JI4L 3HKZG 2DGYA 1VQOA 5C4XG 4MZ9A 1YHQA 1XMQQ 5IYDH 1A8VA 4LNQA 2CFMA 3AQQA 1IBLQ 4JI5L 1JJ2A 3F1ZA 2NVTH 4DR6Q 4AYBE 4A93H 4A3DG 4X62Q 1M90C 3BU2A 4PZ6A 1X3EA 4UP7A 1Y1WH 1SMXA 3EIVA 4A3FH 1X54A 1N32Q 4GS3A 2HIVA 2BH8A 4RG1A 1VQLA 4DV5L 1GVPA 4GN3B 4KLKA 1KHIA 2AWOA 4DV1L 1PH9A 4X65Q 3S1NH 4A3MG 2K5NA 1UE6A 1V1QA 4DR4Q 2JEBI 3ERSX 1YI2A 4JBWA 4BBSG 4UP9A 4DV0Q 4IFDJ 1QUQA 2MO0A 3CXCA 3OYYA 4A3LH 5BR8Q 4A3JH 4QQBX 3CAMA 4WJ3M 2VUMG 4AH6A 2WAQG 1CUKA 5JJKA 1PYSB 1G6PA 2NVXH 1VQ6A 3PCOB 2AWNA 1EQRA 1RIPA 2D0OA 2K5VA 4JBMA 4JV5L 3BZKA 2GVBA 4LFBL 5M3FH 3M4QA 3HOZH 2N8NA 2UXBL 4P71A 1N9WA 2UUCQ 5IYBH 1BBWA 1E1OA 2LXKA 2Z6KC 1IYJB 3EN2A 4HIKA 3KDFA 4A3KH 1Q46A 2E2JH 2N3SA 3S2HH 1YJWA 1GM5A 3M7NA 4IOCA 3PO2G 5DLQE 3HKSA 1G291 4OONA 2Q2IA 1B7YB 4LUVA 4DR5L 4A3IG 1H95A 4B3RL 1Q81C 2B63G 3ZJYC 4X64L 1L0WA 4JCVE 2B3GA 3WWVA 4HJ5A 1HNZQ 3ULPA 1WFQA 3PF5A 2Y0SG 4BY7H 4JYAQ 3Q8DA 1KRTA 1E1TA 3K7AH 4X65L 5AJ3Q 2IHFA 3HOXH 4A3EH 4BBRH 1VQKA 2YU9H 4A3CH 4JI2Q 1L1OA 4B3MQ 1SRUA 4XTCS 3K81C 4DV0L 1XPRA 1Q7YC 1I6HH 3J81i 1HNWL 4QY7A 3FP9A 3S1MH 4JI6L 2K50A 4L5TA 1WOCA 4OX9Q 2RF4A 1BKBA 1PV4A 1VQNA 5JEAJ 4YWMA 3L2PA 3DLLA 1KC8C 1Z47A 1J5EQ 4JOIA 3CD6A 4GKJQ 1CKOA 4HJAA 1CSQA 5C0XG 2F4VL 3RNUA 2HIXA 4DAMA 3I2ZA 1UE7A 3PGZA 1XPUA 5FLMG 1OXVA 2R92G 1IBLL 1WCMH 1EUJA 2V1CC 4LF8L 4QJFA 5IP9G 2JK8A 4JC0A 4DNIA 4B3TQ 4O2DA 4LF5Q 2NVYH 1D7QA 1LUZA 3RN2A 5ELNA 3VDYA 4QL5A 2VQFQ 2I5LX 2R7ZG 3OW2A 4KHPL 1OXXK 2JA5H 4DV2Q 4JYAL 5AJ3L 4LF6L 1MJEA 2D62A 2VQEQ 4DV6Q 4DR1Q 4C2MH 2UU9Q 2CKZB 1QVFA 4A3BG 5C0XI 4B3ML 1YIJA 1XNRQ 3HKZE 1N36L 3HOYH 2D0PA 3F2CA 3S1RH 4A3GG 1VQCA 4R4OA 4R4TA 1VQDA 3FHWA 1NMFA 4OX9L 4H02A 5K36G 1E7ZA 4HJ8A 2E2HH 5IP7H 1OXUA 1AE3A 3HOVG 2CWPA 1Y1VH 3KDFB 1XTDA 2JA6H 5IWAQ 4DUYQ 1BVSA 4BY1H 1I5FA 5LMNQ 2UXCL 3RZDH 4DV3L 1L2FA 3AYHB 2ZTEA 1CKMA 1HZCA 3D31A 1ASZA 4TQUS 4C3JH 3H3VI 1Z9FA 2MO1A 3MEFA 1FJGL 4P73A 4P74A 3OTOQ 1MKHA 1VQFA 1HNXQ 2MNAA 3PO3G 4NXNQ 4K0KL 1HJPA 2EQSA 2VQFL 1K83H 3CF5A 3HOWG 4LUOA 3CC2A 4LF4Q 1JE5A 2WAQE 3STBC 1TXYA 3TS0A 4UY8C 2IY5B 3GTOH 3TRZA 1IBKL 4LWCA 3KJPA 3RLFA 1K8GA 3A0JA 2WFWA 1MIUA 3H0GG 4EX5A 1PH6A 1L1OC 2K75A 2VNUD 4IPDA 1W3SA 4DR3Q 5C4XH 4JI1Q 3F2DA 2AHOB 3M9BA 1M1KC 1XMOL 4P72A 1VQGA 1HZBA 2YTXA 4IPHA 2UUBQ 4B3SL 3I4NH 4DR2Q 3RZOH 4DV4Q 1YHBA 4UPAA 2GN5A 3W1GA 3CCUA 4LFAQ 2R7FA 1WYDA 4X66Q 1HZAA 1HR0Q 1IBMQ 1PH7A 2HHHL 5J3BA 4A3DH 1E24A 2KHJA 4C3IH 1TWHH 2JA7G 1CKNB 1WI5A 3M4PA 3T1YL 2Z0SA 4HIMA 2UUAQ 2OQ0A 3U50C 1B8AA 2AKWB 4MNOA 3TEHB 3W1BA 1I94Q 4LF9L 4BBSH 3AFQA 4YWKA 2JA8G 3NENA 1GD7A 1TWFH 4A3MH 1X55A 3LGJA 1C7YA 3TQYA 3SGIA 4YHHQ 2UXDL 2E8GA 2OCEA 3K0XA 2DUDA 2A1AA 4JBKA 2I5HA 2YYZA 2YV5A 3NEMA 2KCTA 4PMWA 4JI0L 2XTIA 3GTKH 1DGSA 4OWTB 5C0XJ 2RHSB 2VUMH 1CSPA 4AQYL 5GADC 4R4IA 4GOPB 4ALPA 3PUXA 1XMQL 2VZAA 1KQSA 1X3GA 3UDGA 3F2BA 1PH4A 4GNXB 1S40A
chains in the Genus database with same CATH superfamily
5T1IA 2LMCB 3UDXA 4DAYB 1HRJA 1HTLD 2XGTA 5M3MH 4X62L 1JWSD 5CV4A 4DK3C 5E4XA 1IBML 1X3FA 1H9KA 4KK7A 3UE0A 1HQRD 2F0NA 2J7ZA 2OQKA 4K5VA 3RMHA 2B63H 1PTOD 3BJUA 5J1ZA 3JAMi 3HP3A 4IUUA 1TY0A 1BO0A 1HA5A 5M5XB 1B9NA 1C9OA 2R93G 4JI7Q 3S17B 1QB5D 1EY7A 2MFIA 2VB3X 3NPPA 3GTMH 4YY3Q 4WJWA 1QZHA 1CFMA 1EQQA 4V190 3J81c 1EYGA 4IFDH 1SSOA 4G57A 2F0QA 5GAEC 1SFOH 2MP1A 1OO9B 1S4ZA 2WV6D 1AEXA 5C44B 1CKNA 2K05A 1LT3D 2PZUA 1F9QA 1A15A 2E2IB 1ASYA 2NN6G 3J7ZC 4J15A 1PLFA 2XIWA 1HNZL 5JOBA 2N78A 1WD0A 5KYIA 3U9SA 1V43A 4CDFC 4XYOA 1YJ9A 1U0LA 4QGUA 1LTLA 3NHHA 4NXMQ 3Q23A 4DUZQ 5H1SE 3GO5A 1YBYA 1L0XB 4GKJL 4ULLA 2B2TC 3RR5A 3KLWA 2L55A 5EKLA 1PZJD 2WB1G 4YWLA 1PH1A 3F2UA 2I0QA 4PZ8A 4ZYSA 4B3TL 4K8IA 4BA2I 5GQOA 2KENA 4L5RC 5EAYA 2I07B 5LMNW 5FJ8H 3I55A 1X6OA 3NTKA 1VS0A 1IHZA 2I5MX 4BY1G 1I50H 2VQEL 3WDNA 2UU9L 2KCCA 1K8AC 5EGTA 4DV5Q 3C46A 1XNRL 1KNEA 3PUYA 4DV1Q 3J7YW 2H1EA 1MSGA 3H0GH 2NZ1D 1GXDC 3SEBA 3T56B 4CBVA 2PW5A 2FMCA 4KJOA 4LFCL 3BDOA 4A3KB 2OXPA 2DJGC 3TBIB 3OWFA 5LMNL 4LFBQ 4L5QA 2JA7H 2UXBQ 1SNQA 1H9JA 1FVIA 3I90A 4IN3A 3S14H 3OTOL 3ZYYX 2E5LL 3JAML 2M9VA 1Y1WG 2JA8H 1I4PA 3NBHA 3K7AB 2EY5A 2R3ZA 2BA1A 1K8MA 2D9UA 4LF4L 4R4QA 2V4DA 4A75A 1CM9A 1KNAA 3TZDA 1NMGA 1XNQL 1PFNA 4K8JA 3CP0A 2IHEA 2K5HA 3CQZH 1K9MC 4GN5A 3M4OH 1TS5A 4QIWE 1Q90A 2B2UC 5IGEA 3J80c 1D2BA 1LABA 4TVAB 1B1ZA 1EQVA 5I9OA 2DNCA 1E3PA 2TSSA 4GKKQ 4ZQ3A 4JI6Q 4GNXC 4JI3Q 4LFAL 3OW7A 1I4GA 1RL2A 5EPLA 3R93A 2ZXRA 5IY0A 1KL9A 4OWWB 2WKDA 4N8FA 1PTOB 4XDXA 3S15H 1DCZA 4HJ9A 1PH5A 3ONAB 4Y52H 2RQXA 2Z9HA 3DM3A 3ICEA 4DAPA 3VYTA 3T4AC 2JXMB 4CDDC 1VQMA 1PFMA 3CPFA 1TVXA 4YCWA 5JPNC 2SEBD 3CRLC 1MD2D 2I46A 2NB0A 1C0AA 1O7IA 3MXNA 1YZ6A 4LMQD 1I4HA 3RLOA 1X65A 3CMEA 4AIMA 2WB1E 1WTQA 1B50A 4DNRB 3HOUH 3RZDB 1GKHA 2F0EA 2Z8LA 3DEOA 3PIPA 1LTBD 5JVH3 5IYCH 4DR7Q 2F0IA 2UXCQ 1EFWA 5C4HA 1J9OA 4JI7L 1KRSA 3P75A 1EZ6A 4TKOB 3CC7A 2JE6I 1FJGQ 4YY3L 2PO4A 3AFPA 1VQ5A 5K36H 5M5XH 3CHBD 1SMYC 3HKZB 1WTRA 3S17H 2KOLA 2EY6A 2Q2UA 5G3LD 3RZOB 2VW9A 1IW7C 3OIPA 1JMCA 2IX1A 4NB3A 4A3DB 4C3IB 3TREA 5IP7G 1GUNA 4R1JA 1Y1VG 5C44H 1AE2A 2E2IH 4IPCA 5KYLA 4A3MB 4BXXH 3T13A 2CW0C 4HN7A 3GTKB 1F77A 4P75A 3CCEA 2PNHA 1CA6A 4NXML 1MSHA 4DUZL 1KAWA 2LY7A 5BN4A 3MXNB 5FLXc 4IJHA 5KEEA 1L1OB 2SOBA 3EROA 4ODGA 3UDIA 1CTMA 5C3EB 1ZEQX 4AQYQ 3C2PA 5C4XG 4MZ9A 3TMEA 3J7AF 4ZKCB 4RGOS 1TKWB 4B08A 4LNQA 4A3IB 1JB3A 3AQQA 1IBLQ 3VR4A 4J6HA 4XXEA 2MHVA 1O80A 3F1ZA 1JJ2A 1M90C 3EIVA 2BH8A 4DV5L 1PZKD 4KLKA 4DV1L 2G9DA 4R9WA 4KN4C 3VR6A 4DR4Q 2NUCA 2X69A 2NVQB 2A74C 4UP9A 2KVMA 1QUQA 2KEDA 3AMUA 3CRKC 2VUMG 1PYSB 2F0TA 1VQ6A 3PMFA 1RIPA 2F3VA 5C5MA 3MVVA 3ERQA 3BZKA 4IZ8A 3S1QB 4LFBL 2XWBB 5M5YB 2QCPX 1SAPA 4WFN3 2UXBL 5IYBH 5D14A 3KDFA 4A3KH 1Y8OB 1WVLA 3M7NA 3G7LA 4IOCA 4K6LA 3HKSA 5DLQE 3Q0AA 2IL8A 1E0BA 1L0WA 4JCVE 4A3BB 1G2SA 1RHPA 4HJ5A 3PF5A 1KDAA 5JVG3 3K7AH 1ZYRC 2B2YA 1UAPA 3K81C 3J81i 3FP9A 1SNMA 4JI6L 1BNZA 2EJGC 1Z47A 5JPMC 1J5EQ 2A6EC 1TQOA 3I70A 5C4JB 1PRTF 3RNUA 2HIXA 1UE7A 1SYBA 5FLMG 2DNEA 5IGFA 1EUJA 2V1CC 2H4OA 1PTOH 4QJFA 5IP9G 3HOWB 2BOSA 1QJOA 4LF5Q 2QEJC 2I5LX 4C3HG 1ENAA 4JYAL 1EZ8A 2J0TD 5AJ3L 1GUWA 2D62A 1FGBD 5IT9E 5C0XI 2B2UA 4R4OA 1SMYD 3AB9A 4OX9L 4H02A 2EYHA 5KNCA 4HJ8A 3SK4A 1IW7D 2C5CA 3KDFB 4FVMA 1BVSA 1RD9D 4KHVA 5KNDA 1ESRA 2UXCL 3RZDH 1O7YA 3D31A 1TT2A 2N55A 4F7XA 2RDFA 3K57A 1BR9A 2MO1A 1FJGL 5IGGA 1HNXQ 1HJPA 2CW0D 4UY8C 3VA7A 3DWPA 4MN3A 4LWCA 1EY5A 1MIUA 3NK9A 2DN8A 1A2TA 4XQNA 1LT6D 4DR3Q 1WD1A 1I4RA 3P7JA 2F0HA 2ICIA 4IPHA 3RZOH 1AZQA 1VF5C 4PQXA 3S9WA 3W1GA 5CR3A 1XWEA 1IBMQ 1HR0Q 1PH7A 4A3DH 1E24A 1STEA 3CKIB 4C3IH 4X3TA 3U50C 2AKWB 3TEHB 2ICEC 3BDCA 1SYCA 3AFQA 3SDZA 2R93B 4YWKA 3NENA 1GD7A 4A3MH 1C7YA 4YHHQ 3X3NA 3GTKH 2YYZA 2YV5A 1SE2A 4QUCA 3J81L 3A56A 4OWTB 4QIWB 4EGVA 4EQNA 2F03A 1KDBA 4AQYL 4HCSA 4R4IA 1B53A 4N8X1 1GHJA 2VZAA 2EDGA 4GNXB 1IBLL 5C3EH 1N34Q 2L4NA 3U9OA 2DJFC 1VQBA 2R7ZB 2K03A 2RBMA 1DOMA 4A3IH 1FD7D 1ZXTA 3KF8B 2YTVA 2JJQA 1A63A 3R2TA 3CW2C 4LAAA 4DR4L 3A5UA 1JICA 3KLRA 3ER0A 1Q12A 4KV6A 5G3LF 3H3VC 1GUTA 3WOFA 2ZT9C 1X32A 3J81j 2SDFA 1LTSD 1DJRD 5GAHC 2K4KA 2NVQH 1ZYRD 1MGSA 4OHJA 4RHRA 1IYUA 4BBRG 2GA4B 2WB1B 1SE3A 1DXMA 4HSVA 5C0XH 1JORA 5DM73 3S1QH 4YIJA 4POFA 1QILA 2HCCA 1JJGA 5M5YH 2HT1A 2A6ED 1IXRA 1Y14B 3HZXA 4IUVA 4P2CB 2MQHA 1U9RA 3K7UC 4O0AA 2XRSD 3GTLB 1JWUD 2RCFA 3I4OA 4FDBA 4HSPA 4CKCA 3J7AV 1BCPC 1Z6HA 1CT1D 4XQQA 4CDEC 5FK9C 1G8ZD 1KXLA 4A3BH 1JJCB 3UE1A 3T51B 4OL7A 1YHAA 4C56C 2N88A 2SNMA 1B2TA 4EVOA 3HS0C 3MXUA 4MIUA 2NN6I 2VL6A 4M8AA 2R6GA 1J5EL 5JJIA 1XJVA 3KF6B 4JW0A 5CMDA 4LFCQ 4HR7B 4DK6C 1QCBD 5GROA 1WTOA 1O7LA 4UHVA 1B70B 3T16A 4JI4Q 1Y1WB 5C4JH 2E5LQ 4LF5L 3FEWX 1IKMA 3L7ZC 2EYLA 3MEHA 2F0SA 4FO2A 3S1NB 2QEXA 1U4RA 3WOEA 5LL6X 3G6EA 3HOWH 1XNQQ 5LL6S 5DNFA 1XYIA 4HMJA 1L0YB 2Q2TA 4ZKBB 3RN5A 2NVXB 1TR5A 5BN5A 2H5XA 3QR8A 3GQBA 3A74A 2EIFA 3U4VA 1XTCD 4V0BA 1M4VA 3L0OA 3CCVA 3D0FA 2E76C 2AUJD 2FINB 2K33A 3I73A 4B9WA 2OWOA 2F0KA 2Y0SE 5CV9A 1HR0W 2Q8RE 3I4NG 4Z9CB 4LUZA 4JI8L 3QWNA 2NWGA 1HNXL 2F0JA 2EE1A 4A3FG 4OO1G 5EBDA 1II3A 3SE0A 4DGZA 4DR5Q 1H9MA 3CU7A 1BDOA 2O2LD 1HH2P 3CC4A 4HMIA 4DR3L 5IIFA 4A3LG 4XIGS 4XQJA 1UEAB 4A3JG 1PVOA 1Q8KA 4GOPC 1BF4A 1A2UA 4IPGA 4JVZA 1HNWQ 2A19A 2CVRA 3CCSA 4IUPA 1HR0L 3JAME 3T1HL 1VQPA 5M3FG 2B39A 3HOZG 3QG1A 1EIYB 1F9SA 2EY2A 3J7A5 4QMGA 1GO3E 5ELFA 1LTTD 2F4VQ 4NPSA 2EYMA 2C35B 2K5DA 5M3MG 4YHHL 2JEAI 2TMPA 1UWVA 2KCMA 4AYBG 4LF8Q 2ZXPA 2D5DA 2R93H 4C2MB 3PIP3 2F0WA 4BY7G 1EY4A 2ZM6L 3HOXG 4A3EG 4KHPQ 1QVGA 1PZID 1XPOA 2M00A 2E2HB 4EQOA 1N34L 1N36Q 1Y1VB 2HD3A 1F2LA 2X6GA 3NE5B 4TRDA 4IFDG 2NN6H 1LTGD 1EOVA 1NBWA 1XXGA 2NZHA 4KY5A 3HFZB 2ZJRA 1ZKOA 1MHWC 2R7ZH 5FOBB 3MFGA 4GN4B 2K28A 4BA1I 1SNOA 4IO9A 2ALYB 1GUSA 1K83B 2MUYA 3PSIA 4KY6A 5C3XA 3KYHC 2B2WA 3GTOB 1V1OA 2ASBA 1BCPD 3X3MA 1G51A 4Q5VA 2JA5G 3R2IA 3SK6A 3U4ZA 2KECA 1VQJA 5C4XB 1VQEA 1S5CD 3KOJA 4UP8A 1R4PB 2WINB 4FF2A 3I56A 2RSOA 2Q8TA 4IQZA 2PYKA 2K1BA 1J6QA 3OSOA 2VY3A 2WP8J 4ID6A 4A4IA 4DV7L 3BVMA 4DXFA 2HHHQ 3V2TA 5JEAG 4WJ4A 2Q8IB 5IT9c 4C3JG 3T1YQ 5E4WC 3PV0A 3GV6A 1WTWA 1VQ7A 4IALA 1STGA 2E74C 5A2QL 3GTLH 1Q8IA 2VUMB 2QW7A 4POGA 5FJ8G 3PUWA 2VS1A 4JI0Q 4DKAC 1DONA 4MTNA 1SJHD 2J4XA 1PHJA 4JI4L 3D6WA 1VQOA 1U4LA 3D6CA 1GUGA 1A8VA 1UNSA 3GV3A 5HURA 3NBIA 2KUMA 4AYBE 1ET9A 3BU2A 4UP7A 1Y1WH 2NYZD 1X54A 4J8QA 1N32Q 2KA7A 1STAA 1K0SA 2EYPA 1AW7A 2AWOA 4DK1A 4IUTA 1PH9A 3S1NH 3DM1A 4JBWA 4IFDJ 4TSSA 3CXCA 1VMPA 5BR8Q 1I6VC 1RF2D 5C4ZA 4CGYB 5JJKA 1B3AA 2NVXH 2K5VA 3EFXD 2GVBA 3FPUB 5I4DA 4G7OC 2Z6KC 1STHA 3VR2A 2B2VC 3PO2G 1EWCA 4OONA 4LUVA 1B7YB 3SXHA 4DR5L 4C3HB 3V96A 5J39A 5M5WB 1B9MA 3WWVA 2M2LA 4JYAQ 1KRTA 5AJ3Q 1E1TA 1VQKA 4JI2Q 1L1OA 2XSCA 2AQ1B 1CHQD 1SRUA 2ENBA 4XTCS 3M7GA 3BG3A 4RHSA 1HNWL 2K50A 4OX9Q 2RF4A 3NUCA 1DOLA 5JEAJ 4YWMA 3CD6A 1CZGA 1CKOA 4HJAA 5CBEE 5CV5A 3TDQA 1TWGB 2F4VL 3MXGA 5JJZA 3PGZA 1XPUA 1OXVA 2R92G 1NNXA 4LF8L 3VYSA 1DYQA 1BCPB 3FKIB 1HUNA 3OW2A 4KHPL 1OXXK 1D5XC 4DV2Q 2JP1A 4DR1Q 4DV6Q 1HQMC 4C2MH 2CKZB 4B3ML 2FJ2A 1N36L 1O7ZA 4A3GG 1VQCA 3FHWA 3ND9A 5K36G 3BS1A 1C48A 4DFAA 5COYA 4B9XA 4F87A 2E2HH 5IP7H 1Y1VH 1TWCB 3GTQB 2XWJB 1NR4A 1JWMD 3QB3A 2EVBA 4DN4M 3MZ5A 1HZCA 3H3VI 4HAEA 1MKHA 3PO3G 2O5JC 4NXNQ 2EQSA 1TU2B 2VQFL 1K83H 1G91A 3STBC 1TXYA 4OEMB 3GTOH 3TRZA 1TWAB 1LLRD 2O5IC 1PTOF 3A0JA 4EX5A 5I2YA 5I6WA 4IPDA 1W3SA 5M9OA 2WKCA 4DF7A 5C4XH 3H09A 2AHOB 4G7ZC 1M1KC 4H0LC 1VQGA 5FKAC 2F0VA 2Y0SB 3KBXA 5HGTA 4X66Q 3GTJB 2HHHL 3W3AA 1HPCA 3M4PA 3T1YL 2KHSA 2BE5C 2UUAQ 2OQ0A 4H13C 1I94Q 1GJXA 3NQIA 3K0XA 3IFTA 1EFID 2DUDA 4JBKA 2L0CA 3TP7A 4CKBA 4JI0L 1EL0A 3C1FA 1LTID 2VUMH 1CSPA 2E75C 2F3WA 2WACA 1AP0A 2B2TA 4GOPB 1ML0D 1AZPA 1LT4D 2XVSA 4QUFA 2PZTA 1BBXC 1HFNA 1A3VA 1S40A 2LFNA 4LJZC 4RFBA 2UUBL 4IOAA 1K28A 5CC4A 2EXDA 1JB7A 4KHZA 3URYA 4GLXA 1N32L 1BCPF 5IYBG 4A76A 4HTHA 3J81E 3OMGA 2Z6BA 1EU4A 4MTKA 4BWGB 5CGKA 3A7LA 3N52A 5BR8L 3DWAA 1UE1A 3PF4A 2QF7A 3HOVB 1JT8A 3JAMc 1Q86C 1YITA 2E2DC 4X3KA 4L5SA 1STBA 5IE8A 3I4MG 3E9IA 2BCOA 1K3BC 1VQIA 5FO7B 4XYQA 1V1PB 5I6YA 2AQ3B 5FLMH 2AMCB 1YVCA 5LMUQ 4I7ZC 3FPPA 3ND8A 4EQ5A 3CCQA 2RHQB 4RCNA 1EY0A 5FO8B 4JI2L 4C3HH 4X3UA 1V9PA 5M5WH 1PH2A 5NUCA 3H3VH 2LSSA 3RUZA 2CWAA 2G5DA 4R8NA 4GNXA 2A69C 1VQ8A 1EWIA 1E2WA 3NELA 2A8VA 2NVTB 2PQAB 1JC7A 2CH4A 1LTRD 4S3SA 3S24A 1A0IA 3KF8A 4A3FB 4G4KA 3I3CA 2F52A 3K80C 1JR0D 1TWGH 1SE4A 2CHBD 4KD4A 4JI8Q 2ATWA 4JI5Q 3QOJA 4DV2L 3TSSA 1IL2A 3KUPA 1SNCA 4DV6L 4DR1L 4RGTA 1UUPA 1NJIC 4A3JB 2IX3A 2A68D 5D3DA 3TP5A 2OTLA 3FKIH 3F8TA 2L9HA 2BA0A 1E22A 1X3PA 4EQPA 3UDFA 2PCFB 4YCVA 3STBD 1VDZA 5M3FB 3HOZB 5CYUA 5KRUA 3CPWA 4K6DA 3T1HQ 1N33L 2E2JB 3P20A 5IGCA 4PG3A 1W2BA 4JV5Q 2ZXOA 1PFBA 5IYDG 3IL8A 3PUZA 1DD2A 4AYBB 4KN7C 1JOKA 3LX0A 2IT1A 4XT3B 4CJ1B 1Q3LA 1TWCH 3GTQH 4A93G 3J80E 4NXNL 2PNRC 3VYUA 4BY7B 3HOXB 2BE5D 4A3EB 3I8ZA 3DXJC 3J80i 4B3RQ 5JJLA 3HGBA 5ISRA 4X64Q 1KIXA 1FYCA 2ZM6Q 3VR5A 2OTJA 1I6HB 2KBNA 4ZAIA 4KJNA 4ZCKA 1QZGA 3S1MB 3KF6A 3BYTB 2NTSA 3H6MA 5EKKA 3E0EA 1GUOA 1TWAH 1U5KA 1Z7TA 5CV8A 2EY1A 1S72A 4X66L 2F1MA 4OO1I 3KJOA 4OWXB 4ZUIA 5C5LA 3Q6SA 4PZ7A 2UUAL 2B8FA 1SNPA 4UDUC 1I94L 4NKLA 2K5QA 3GTJH 5C3EG 3NXWA 1R4QB 1WJJA 2SNSA 1X56A 2KJXA 3I91A 1VQ4A 1F2MA 2K52A 2JA5B 5A35A 2JQOA 3NQTA 3K5OA 3S1RB 4A3CG 1U4MA 3G4SA 1VMCA 5IGBA 3B6YA 4GLVB 2X6LA 1EYCA 4HJ7A 2YTYA 1LYLA 3SR1A 1EWHA 1H9SB 2QILA 4BY1B 1HHVA 4XT1B 1CQFA 1V8QA 4DV7Q 1DM0B 1CQVA 4C3JB 3KBGA 3MFYA 4DAVA 3CCRA 1MJCA 2K7VA 4DK0A 4L8JA 1WCMG 1T9HA 1RODA 4JG2A 4R4CA 2C9OA 4CKEA 4DV3Q 3NSWA 4ME3A 4DPGA 2QDBA 3HG9A 3FDTA 1Q82C 1FL0A 2RA4A 1EY8A 4IFDI 4HIDA 5FO9B 3HOVH 1K3RA 1K73C 3HOYG 4RCOA 1F2YA 3CCMA 1DOKA 2A69D 5LMUL 1B44D 1CZWA 1YNJC 1NY4A 3A5ZB 2JA6G 4B3SQ 2RCNA 2RSNA 1XX8A 2PI2E 4F8MA 2ZJPA 1TWFB 5FLXE 1OTCA 3J80L 2LXJA 5E3FA 3PIOA 3IKJA 1SE8A 1PRTC 3FVQA 1VQ9A 2MJ8A 4ZK9B 2CCZA 4RGMA 3RLNA 3Q22A 2F4IA 4NW2A 5L37A 1S5DD 5EPJA 4KKSA 2PMZE 4DXGA 2HQLA 1E2ZA 3TZUA 4FXGC 1BBUA 2KCNA 1YHQA 1XMQQ 3PO2B 2CFMA 2HUGA 4Q0FA 4JI5L 2NVTH 1R9TB 4DR6Q 1ILPA 4FF3A 5A2QE 3S2DB 2JN4A 1SMXA 4A3FH 4OO1H 4C1NI 4GS3A 2RKSA 2OEOA 4CJ0B 3D4WA 1KHIA 3K5LA 2K5NA 1UE6A 1V1QA 2JEBI 3ERSX 3OPOA 4BBSG 5K5PA 1O78A 2MO0A 4QB4A 4A3LH 3A8JE 4A3JH 3CAMA 4WJ3M 4AH6A 2WAQG 3PCOB 2AWNA 1QG7A 2D0OA 2AUKA 4JV5L 2R92B 5M3FH 3HOZH 2UUCQ 4C1NK 1DZ1A 1BBWA 1E1OA 2LXKA 1IYJB 3EN2A 3DHQA 5DAUA 1Q46A 3HRZC 4FP5D 2E2JH 5ELEA 3W2DA 1TY2A 1SJED 1G291 1D6EC 1B4OA 4B3RL 2B63G 4NDXA 3ZJYC 4X64L 2B3GA 5C3WA 4BY7H 4A3GB 1FR3A 4X65L 4G7HC 3HOXH 4A3EH 1D1IA 1S5FD 4B3MQ 4DV0L 1I6HH 1VF7A 4JK1C 2MPMA 3S1MH 3NWTA 1WOCA 1PV4A 1TS2A 1EOTA 3L9AX 3O13A 1CSQA 1WTHA 2RDHA 1CK1A 4DAMA 3I2ZA 5CV7A 3K59A 2K01A 4RKLA 3PO3B 4JC0A 4DNIA 5FLXL 1D7QA 4QL5A 1BUVT 1F9RA 5CV6A 2VQFQ 2R7ZG 3M3YB 4F88A 2JA5H 4MHEA 2EPBA 1QVFA 1U4PA 5AFWA 2K5WA 3D4DA 3F2CA 3S1RH 3E0JA 4R4TA 4FNFA 1E7ZA 5F2DA 4ZLTF 1AE3A 2CWPA 1NSNS 1XTDA 5IWAQ 5KGUA 4DUYQ 4DU9A 4BY1H 1I5FA 1YNJD 5JEAH 4DV3L 1L2FA 3RD4A 3C3LA 1RDPD 3D4RA 1ASZA 4C3JH 3KK7A 1WTVA 5C6AA 1HFGA 4P73A 1VQFA 3D8GA 2NTTA 3EVQA 1X3QA 2F0LA 4ZRZA 3GTGB 4LUOA 3L3OC 3NTIA 1PRTD 2WAQE 3DMUA 1D5ZC 2IY5B 1SXTA 3NTHA 3RLFA 1K8OA 1EY9A 2XN9C 2WFWA 1F9PA 3DEPA 3H0GG 2B2YC 2VNUD 1LO5D 4JI1Q 3F2DA 1C4QA 2UUBQ 4P72A 2YTXA 4KD3A 4B3SL 5J22A 1ILQA 2LKVA 4DR2Q 4DV4Q 1YHBA 2EYOA 4UPAA 2GN5A 2R7FA 4PMBA 4K5WA 1EYDA 3BVZA 2JA7G 1CKNB 1AN8A 4HIMA 1B8AA 4Y7NB 3W1BA 1QOHA 2RVLA 3MAQA 5ELCA 2JA8G 1SEBD 1TWFH 4IUQA 1X55A 2K32A 3LGJA 3MHBA 2I5HA 1DGSA 4OIJA 3I4MB 1TIID 4U68A 4U673 2RHSB 3Q24A 3GTPB 4ILWA 5GADC 4ALPA 1XMQL 5EKIA 1KQSA 1EY6A 1FNVA 1X3GA 3BYYB 3F2BA 2MGSA 2JSOA 1JCKB 4IJLA 3VR3A 1PA6A 1GOZA 3MA2B 4DR6L 5IOCA 1SN8A 4QF4A 4QCLA 1BQQT 1QE6A 3PO2H 1SR3A 2PI2A 2R7DA 1RTOA 1ENFA 2IX0A 2CQAA 1LV9A 3GD7A 2KQ3A 1R9TH 1KAAA 3S2DH 3C1EA 4OGQC 1VQAA 1SYEA 3H15A 2ID0A 2F0DA 1HXYD 2L12A 2IW3A 2PZWA 3S16B 4L63B 3R8BA 1YJNA 5LHY1 1CHPD 1B3QA 3BZDB 1YNXA 4OIKA 2UUCL 2DY7A 1E2VA 2GVAA 3IAYA 5D65A 1HUMA 1I3QB 1IZ6A 1W6JA 4KI0A 2R92H 3HOUG 4OELB 4X3SA 3K58A 3CCJA 1EEFD 3KFUA 1PYBA 1SYFA 2FMMA 5I9PA 3AEVA 3I7FA 1SYDA 5IYCG 2A73B 2QGQA 1P16A 4PNYA 4LF7Q 3A54A 3NBHB 5I2XA 1AFPA 4GLAC 3I4LA 4GOPA 3ULLA 3SHLA 4A3GH 2ZTDA 1FNWA 1PFSA 2F0FA 2KHIA 1P8LA 4WORA 1N33Q 1CA5A 3KLSA 3H94A 4FYDA 2EJMA 1Y69U 2BH2A 4A93B 1GHKA 2XNAC 1D1KA 3TS2A 4LW1A 3N6RA 5EPKA 3QIAA 2FHTA 5EBCA 1PYWD 4RA8A 2A68C 5C44G 4R8IA 1EEID 4FXKC 3MTSA 1QNUA 3JC66 3PO3H 4BXXG 5ELOA 3UI2A 1A6XA 1PRTB 1Q1EA 3BZCA 4K5XA 4M1UB 2EXZA 1OXTA 2QDLA 5E7NA 4HIOA 3GP7A 3IRBA 4X6AH 3M3YH 2EOTA 3OOCA 3CCLA 3LNNA 2PMZB 1ET6A 2CH4W 1V1PA 1NE3A 4KKUA 4HEDA 5IWAL 2Q2HA 2WIIB 4DUYL 4JOIC 3S2HB 3T53B 2F0PA 1ICWA 3HEJA 3OMCA 3SVMA 3I72A 4H44C 1ENCA 5JAVA 4O1NA 1A62A 4NMZA 1JOQA 2ZJQA 5EQ0A 1VQHA 1SLJA 5HGQA 2JA9A 1N8RC 1F2ZA 4OXPA 4BBRB 2YU9B 1TS3A 5ELDA 4JPBW 2ZTCA 1UE5A 2Z4IA 1CI3M 3GTGH 3ULJA 5CBAE 4JI1L 3VA5A 1OXSC 1A3UA 1S3OA 2PQAA 4DR2L 4DV4L 4H7BA 4IURA 3CMAA 3K8AA 2F0UA 1HZ9A 1W6KA 3K6OA 1SROA 3GDEA 1FNUA 3K0YA 1TS4A 1WCMB 1HCZA 1I4QA 3BDLA 4A3KG 1BXTA 2NVYB 3K5MA 4LK1C 1UEBA 2L11A 4KTAA 1Y8NB 2KEEA 1STNA 2F3IA 4IUNA 2ES2A 1LT5D 1EIFA 4Y7NH 1PDQA 4RGNA 1BOSA 1VCIA 3HOYB 4APVA 4FXDA 1RCVD 5DM63 2AQ2B 2QKIC 2N49A 1AH9A 5IODA 2Z1CA 3ITPA 3U58A 4YCUA 1QWYA 4LF6Q 1K0RA 3I4MH 1STYA 2L15A 2OF1A 5HY6A 5KIXA 3GTPH 2JA6B 1D8LA 4RKBA 4GKKL 3G71A 2DY8A 4JI3L 5IP9H 4KKTA 4GZYC 1WTPA 4J1MA 4BS9A 4KY7A 1NTGA 2XRQD 4CJ2C 3OHXC 2K6AA 1PH3A 4JBJA 3FMCA 2OT2A 2A6HC 2CQOA 3LWUA 1MI2A 3FRPB 4RMFA 3MWYW 4N9TA 3TP6A 2G9HD 1NAPA 3EBEA 1FGUA 4E6IA 4K0KQ 3H91A 3LWEA 3QOLA 1ONLA 3NP8A 3E9HA 1JE4A 3S16H 3E6ZX 3PIO3 1Q1BA 1QUQB 5GAGC 1IBKQ 3I4NB 1LM0A 2Z6KA 3M85A 1X9NA 5ELBA 2BDOA 1H9RA 2B8GA 1QVCA 2O4XA 2B2VA 3AU7A 1TWHB 2NZOA 2QA4A 2K04A 3BVGA 1NR2A 1XMOQ 1I3QH 1KLUD 2PQEA 1NUCA 1KABA 3G48A 2L5TA 1IYVA 3KLSX 4PV1C 1PH8A 2B29A 3A8IE 1LACA 4ME5A 4BBSB 4LF7L 4DR7L 2F0GA 3SK5A 4LF9Q 2HDMA 2WAQB 1YEZA 2UXDQ 5CORA 1RJTA 3PUVA 1NCVA 4K2LA 2K14A 3DWQA 1H9SA 2FXQA 3W5OA 5M3MB 3FKIG 4DA2A 1KD1C 3HKZG 2DGYA 1SNDA 3MC0B 5IYDH 4N9PA 2B63B 3G6JB 4A3DG 4A93H 4X62Q 2EYJA 4PZ6A 1X3EA 4C3IG 1HA6A 4ABNA 3EQLC 4WRDA 2HIVA 4RG1A 1VQLA 1GVPA 4GN3B 4X65Q 3GTMB 4A3MG 1EIGA 2L1BA 1YNNC 1YI2A 2B2WC 4DV0Q 3OYYA 1SFOB 4QQBX 1CUKA 1G6PA 1ESFA 1EQRA 4I7AA 2F0MA 4JBMA 4FF4A 1QNKA 2LS01 3M4QA 2N8NA 2HDLA 4CHTB 4P71A 1N9WA 1A3TA 4PMCA 4HIKA 1EU3A 1PTOC 2N3SA 3S2HH 1I4XA 2VXWA 4O42A 1YJWA 1GM5A 4CDCC 3DUZA 1J8IA 2Q2IA 2IJ0A 4A3IG 1H95A 1Q81C 3QO2A 1S5BD 4L6TB 3OWEB 2R61A 1SDFA 1SYGA 1HNZQ 3ULPA 1WFQA 2Y0SG 3Q8DA 2IHFA 4KMUC 4BBRH 2YU9H 4A3CH 4HCEA 3TP8A 3E5SA 4RH6A 1XPRA 1Q7YC 4QY7A 1SBBB 5EJWA 4L5TA 5KNBA 1BKBA 5TSSA 1VQNA 3A8KE 2HQEA 3L2PA 3DLLA 4ZUJA 5IT9L 1KC8C 4JOIA 4GKJQ 1EYAA 2HCIA 2BDNA 2JYOA 5C0XG 3A55A 2EZVA 5BN3A 1WCMH 1JQYD 4FF1A 3OIQA 3A7AB 1I50B 2JK8A 2A6HD 1RKNA 4B3TQ 4O2DA 3V05A 1PXUA 2NVYH 1LUZA 1ICFB 3RN2A 5ELNA 3VDYA 2VB2X 1KTKA 2NBFA 1JOOA 2IWHA 2F0OA 3H0GB 3M4YA 2FFKB 4I65A 4LF6L 2P5ZX 1MJEA 1KLGD 2VQEQ 4A3BG 2UU9Q 1YIJA 1XNRQ 3HKZE 3HOYH 2D0PA 3EA6A 1VQDA 3EJIA 3R3OA 1NMFA 3PQIA 2JA7B 2Z4HA 2EJFC 5T1GA 1OXUA 3K5NA 1T5XD 4DAYA 2A5HA 3HOVG 3S14B 2JA6H 3P1HA 3D3RA 1MBYA 1PMRA 2JA8B 5LMNQ 3AYHB 2ZTEA 1CKMA 4TQUS 3NWSA 1Z9FA 3MEFA 4UAIA 4P74A 3OTOQ 1HTPA 3E3XA 3SK8A 1G6ZA 2MNAA 4K0KL 1T5EA 3CQZB 3M4OB 3CF5A 1IL8A 3HOWG 3CC2A 4LF4Q 1JE5A 3TS0A 1EQTA 1IBKL 1LTAD 3KJPA 5E1FA 1K8GA 2RDGA 1PH6A 1L1OC 2K75A 1KDCA 4RAUC 2D2CC 1EIHA 3MXPA 3M9BA 1XMOL 1HZBA 3I4NH 3S15B 4NP5A 1Y8PB 3CCUA 4LFAQ 1WYDA 1HZAA 5J3BA 2KHJA 1WTXA 1TWHH 1WI5A 5IGDA 1G2TA 2Z0SA 2PPBC 4K14A 1D5MC 4MNOA 4LF9L 3TN2A 1S5ED 1RTNA 2PW7A 1C8CA 4DNTB 3TQYA 3SGIA 2UXDL 2E8GA 2OCEA 2EYFA 4BBSH 2A1AA 3NEMA 1M8AA 2KCTA 4PMWA 2XTIA 4K2KA 5DEHA 5C0XJ 3IFDA 1IKLA 2IPKD 1YNND 4RWSC 5D3IB 3VYRA 3QJYA 3PUXA 3HOUB 3UDGA 1PH4A
chains in the Genus database with same CATH topology
4IJLA 5C3EH 1PA6A 3UDXA 4DAYB 1N34Q 2UUBL 4IOAA 2XGTA 5M3MH 4DR6L 1VQBA 1SN8A 4X62L 4DK3C 1JJGA 2EXDA 1JB7A 4KHZA 4GLXA 1IBML 1N32L 3PO2H 1SR3A 1X3FA 2PI2A 3UE0A 2R7DA 4A3IH 2OQKA 2IX0A 2B63H 3KF8B 3BJUA 3GD7A 2YTVA 5IYBG 2JJQA 4A76A 1A63A 1R9TH 3CW2C 3JAMi 4DR4L 3S2DH 3A5UA 3ER0A 1VQAA 1Q12A 2ID0A 3H15A 1C9OA 5BR8L 2R93G 1UE1A 4JI7Q 3PF4A 3J81j 5GAHC 2MFIA 3JAMc 1JT8A 1Q86C 1YJNA 3GTMH 2K4KA 4YY3Q 1YITA 1QZHA 2NVQH 1EQQA 4L5SA 3J81c 1EYGA 5IE8A 1YNXA 3I4MG 2UUCL 3E9IA 4BBRG 5GAEC 1SFOH 2GVAA 1IZ6A 4KI0A 1VQIA 1CKNA 3S1QH 4POFA 5FLMH 2AMCB 2R92H 3HOUG 1YVCA 5M5YH 5LMUQ 2HT1A 1IXRA 1Y14B 2NN6G 1ASYA 4EQ5A 3J7ZC 3CCJA 4J15A 3CCQA 3KFUA 1PYBA 2MQHA 2RHQB 3K7UC 3AEVA 1HNZL 4O0AA 3I7FA 5IYCG 2N78A 3I4OA 4FDBA 2QGQA 4JI2L 4C3HH 1V43A 1P16A 4LF7Q 1V9PA 1KXLA 3NBHB 5M5WH 1JJCB 4A3BH 3UE1A 4GLAC 1PH2A 4GOPA 3H3VH 1YHAA 3ULLA 2LSSA 1YJ9A 4A3GH 2CWAA 2ZTDA 1U0LA 4QGUA 1LTLA 1PFSA 4GNXA 4NXMQ 2NN6I 4DUZQ 2VL6A 5H1SE 2R6GA 1J5EL 5JJIA 3GO5A 1XJVA 1YBYA 1VQ8A 3KF6B 2KHIA 4LFCQ 1EWIA 4GKJL 1P8LA 1N33Q 4DK6C 3NELA 5GROA 2A8VA 3RR5A 2PQAB 3KLWA 1B70B 4JI4Q 2BH2A 3S24A 4LW1A 1A0IA 2WB1G 4YWLA 1PH1A 2I0QA 3TS2A 5C4JH 2E5LQ 2F52A 4PZ8A 3K80C 4B3TL 4LF5L 5C44G 1TWGH 4JI8Q 4BA2I 5GQOA 2KENA 4L5RC 5EAYA 4JI5Q 2ATWA 3JC66 3L7ZC 5FJ8H 3I55A 5LMNW 2QEXA 1X6OA 3PO3H 4BXXG 5ELOA 1VS0A 4DV2L 1IL2A 2I5MX 4BY1G 3G6EA 1I50H 2VQEL 4DV6L 4DR1L 3HOWH 1XNQQ 2UU9L 1Q1EA 3BZCA 1K8AC 1NJIC 4DV5Q 1XNRL 2Q2TA 3PUYA 3FKIH 5E7NA 4DV1Q 1OXTA 2OTLA 3F8TA 4HIOA 4X6AH 3IRBA 2BA0A 3RN5A 1E22A 3M3YH 3CCLA 3H0GH 3UDFA 4YCVA 3STBD 2H5XA 3CPWA 3A74A 2EIFA 3U4VA 4LFCL 1NE3A 5IWAL 3T1HQ 2Q2HA 3L0OA 4DUYL 4JOIC 1N33L 3CCVA 4PG3A 3D0FA 1W2BA 4JV5Q 5LMNL 4LFBQ 5IYDG 2OWOA 4L5QA 2JA7H 2Y0SE 3PUZA 2UXBQ 1FVIA 3S14H 1HR0W 2IT1A 3OTOL 2E5LL 3I4NG 1A62A 1TWCH 3GTQH 4LUZA 4A93G 4JI8L 1HNXL 2ZJQA 4NXNL 1Y1WG 4A3FG 2JA8H 1VQHA 1SLJA 5HGQA 4OO1G 2JA9A 1N8RC 4OXPA 4DR5Q 2BA1A 4LF4L 3J80i 4B3RQ 4R4QA 5JJLA 4A75A 2OTJA 4X64Q 1KIXA 1NMGA 2ZM6Q 1XNQL 2KBNA 3CP0A 1HH2P 2ZTCA 2IHEA 1QZGA 2K5HA 1UE5A 3CQZH 1K9MC 3CC4A 4GN5A 3M4OH 3KF6A 4QIWE 3ULJA 3GTGH 4DR3L 4JI1L 4A3LG 3E0EA 4XIGS 3J80c 4A3JG 1OXSC 1PVOA 4TVAB 1Q8KA 1S3OA 4GOPC 2PQAA 1TWAH 4DR2L 1U5KA 4IPGA 4DV4L 1E3PA 1HNWQ 2A19A 4GKKQ 3CCSA 3CMAA 4X66L 4GNXC 1S72A 3K8AA 1HR0L 4JI3Q 4JI6Q 1HZ9A 4LFAL 4OO1I 3KJOA 3T1HL 1RL2A 4OWXB 1SROA 5M3FG 3GDEA 1VQPA 3HOZG 1EIYB 3J7A5 5IY0A 1KL9A 4OWWB 4PZ7A 2UUAL 3S15H 1GO3E 1I94L 4A3KG 4HJ9A 1PH5A 1UEBA 4NPSA 5C3EG 3GTJH 2F4VQ 4Y52H 1WJJA 2C35B 5M3MG 4YHHL 1X56A 2JEAI 3DM3A 1UWVA 1VQ4A 2F3IA 2KCMA 4AYBG 3ICEA 2K52A 4LF8Q 2ES2A 1EIFA 4Y7NH 2R93H 1VQMA 2JQOA 4BY7G 1VCIA 3CPFA 4YCWA 4APVA 2ZM6L 3HOXG 4A3EG 4A3CG 2N49A 1AH9A 4KHPQ 1QVGA 3U58A 1XPOA 4YCUA 3G4SA 4LF6Q 1C0AA 1O7IA 1K0RA 3I4MH 2L15A 3B6YA 1YZ6A 4GLVB 5HY6A 1N34L 4HJ7A 2YTYA 3RLOA 1LYLA 3GTPH 1N36Q 1X65A 3CMEA 1D8LA 2WB1E 4AIMA 4GKKL 3G71A 4JI3L 5IP9H 3HOUH 4IFDG 1NTGA 1GKHA 4DV7Q 1EOVA 1NBWA 1PH3A 4JBJA 2NZHA 3HFZB 2ZJRA 3PIPA 3CCRA 2CQOA 1MJCA 2R7ZH 4GN4B 5IYCH 4BA1I 1WCMG 1T9HA 4IO9A 4DR7Q 2ALYB 4JG2A 4R4CA 2UXCQ 1EFWA 3PSIA 4ME3A 4DV3Q 3KYHC 4JI7L 4DPGA 4RMFA 1KRSA 1Q82C 3CC7A 1FJGQ 2JE6I 3EBEA 1FGUA 4YY3L 3AFPA 1FL0A 1VQ5A 2ASBA 1G51A 4K0KQ 5M5XH 2JA5G 3U4ZA 1VQJA 3E9HA 4IFDI 4HIDA 1VQEA 3KOJA 4UP8A 3S16H 3S17H 3HOVH 1K3RA 2Q2UA 1Q1BA 1QUQB 5GAGC 3CCMA 1K73C 1LM0A 2Z6KA 2VW9A 1IBKQ 3HOYG 3M85A 1X9NA 1JMCA 2IX1A 4NB3A 3I56A 5LMUL 1QVCA 1NY4A 2NZOA 3A5ZB 3TREA 5IP7G 2QA4A 1J6QA 1XMOQ 1I3QH 2VY3A 2WP8J 4R1JA 1Y1VG 2RCNA 4A4IA 4DV7L 5C44H 4B3SQ 2JA6G 1AE2A 2PI2E 3G48A 2ZJPA 2E2IH 4IPCA 2HHHQ 1PH8A 5JEAG 4WJ4A 2B29A 1OTCA 4BXXH 5IT9c 2LXJA 3T1YQ 4LF7L 4DR7L 4P75A 3PV0A 3PIOA 3CCEA 1SE8A 1VQ7A 2PNHA 4LF9Q 3GTLH 1VQ9A 1YEZA 4POGA 5FJ8G 2CCZA 4NXML 4DUZL 3RLNA 2UXDQ 3PUWA 2VS1A 1KAWA 3PUVA 4JI0Q 2K14A 3MXNB 5FLXc 4DKAC 4IJHA 2PMZE 1L1OB 3UDIA 2HQLA 2FXQA 4MTNA 3W5OA 1BBUA 3FKIG 4AQYQ 1PHJA 1KD1C 4JI4L 3HKZG 2DGYA 1VQOA 5C4XG 4MZ9A 1YHQA 1XMQQ 5IYDH 1A8VA 4LNQA 2CFMA 3AQQA 1IBLQ 4JI5L 1JJ2A 3F1ZA 2NVTH 4DR6Q 4AYBE 4A93H 4A3DG 4X62Q 1M90C 3BU2A 4PZ6A 1X3EA 4UP7A 1Y1WH 1SMXA 3EIVA 4A3FH 1X54A 1N32Q 4GS3A 2HIVA 2BH8A 4RG1A 1VQLA 4DV5L 1GVPA 4GN3B 4KLKA 1KHIA 2AWOA 4DV1L 1PH9A 4X65Q 3S1NH 4A3MG 2K5NA 1UE6A 1V1QA 4DR4Q 2JEBI 3ERSX 1YI2A 4JBWA 4BBSG 4UP9A 4DV0Q 4IFDJ 1QUQA 2MO0A 3CXCA 3OYYA 4A3LH 5BR8Q 4A3JH 4QQBX 3CAMA 4WJ3M 2VUMG 4AH6A 2WAQG 1CUKA 5JJKA 1PYSB 1G6PA 2NVXH 1VQ6A 3PCOB 2AWNA 1EQRA 1RIPA 2D0OA 2K5VA 4JBMA 4JV5L 3BZKA 2GVBA 4LFBL 5M3FH 3M4QA 3HOZH 2N8NA 2UXBL 4P71A 1N9WA 2UUCQ 5IYBH 1BBWA 1E1OA 2LXKA 2Z6KC 1IYJB 3EN2A 4HIKA 3KDFA 4A3KH 1Q46A 2E2JH 2N3SA 3S2HH 1YJWA 1GM5A 3M7NA 4IOCA 3PO2G 5DLQE 3HKSA 1G291 4OONA 2Q2IA 1B7YB 4LUVA 4DR5L 4A3IG 1H95A 4B3RL 1Q81C 2B63G 3ZJYC 4X64L 1L0WA 4JCVE 2B3GA 3WWVA 4HJ5A 1HNZQ 3ULPA 1WFQA 3PF5A 2Y0SG 4BY7H 4JYAQ 3Q8DA 1KRTA 1E1TA 3K7AH 4X65L 5AJ3Q 2IHFA 3HOXH 4A3EH 4BBRH 1VQKA 2YU9H 4A3CH 4JI2Q 1L1OA 4B3MQ 1SRUA 4XTCS 3K81C 4DV0L 1XPRA 1Q7YC 1I6HH 3J81i 1HNWL 4QY7A 3FP9A 3S1MH 4JI6L 2K50A 4L5TA 1WOCA 4OX9Q 2RF4A 1BKBA 1PV4A 1VQNA 5JEAJ 4YWMA 3L2PA 3DLLA 1KC8C 1Z47A 1J5EQ 4JOIA 3CD6A 4GKJQ 1CKOA 4HJAA 1CSQA 5C0XG 2F4VL 3RNUA 2HIXA 4DAMA 3I2ZA 1UE7A 3PGZA 1XPUA 5FLMG 1OXVA 2R92G 1IBLL 1WCMH 1EUJA 2V1CC 4LF8L 4QJFA 5IP9G 2JK8A 4JC0A 4DNIA 4B3TQ 4O2DA 4LF5Q 2NVYH 1D7QA 1LUZA 3RN2A 5ELNA 3VDYA 4QL5A 2VQFQ 2I5LX 2R7ZG 3OW2A 4KHPL 1OXXK 2JA5H 4DV2Q 4JYAL 5AJ3L 4LF6L 1MJEA 2D62A 2VQEQ 4DV6Q 4DR1Q 4C2MH 2UU9Q 2CKZB 1QVFA 4A3BG 5C0XI 4B3ML 1YIJA 1XNRQ 3HKZE 1N36L 3HOYH 2D0PA 3F2CA 3S1RH 4A3GG 1VQCA 4R4OA 4R4TA 1VQDA 3FHWA 1NMFA 4OX9L 4H02A 5K36G 1E7ZA 4HJ8A 2E2HH 5IP7H 1OXUA 1AE3A 3HOVG 2CWPA 1Y1VH 3KDFB 1XTDA 2JA6H 5IWAQ 4DUYQ 1BVSA 4BY1H 1I5FA 5LMNQ 2UXCL 3RZDH 4DV3L 1L2FA 3AYHB 2ZTEA 1CKMA 1HZCA 3D31A 1ASZA 4TQUS 4C3JH 3H3VI 1Z9FA 2MO1A 3MEFA 1FJGL 4P73A 4P74A 3OTOQ 1MKHA 1VQFA 1HNXQ 2MNAA 3PO3G 4NXNQ 4K0KL 1HJPA 2EQSA 2VQFL 1K83H 3CF5A 3HOWG 4LUOA 3CC2A 4LF4Q 1JE5A 2WAQE 3STBC 1TXYA 3TS0A 4UY8C 2IY5B 3GTOH 3TRZA 1IBKL 4LWCA 3KJPA 3RLFA 1K8GA 3A0JA 2WFWA 1MIUA 3H0GG 4EX5A 1PH6A 1L1OC 2K75A 2VNUD 4IPDA 1W3SA 4DR3Q 5C4XH 4JI1Q 3F2DA 2AHOB 3M9BA 1M1KC 1XMOL 4P72A 1VQGA 1HZBA 2YTXA 4IPHA 2UUBQ 4B3SL 3I4NH 4DR2Q 3RZOH 4DV4Q 1YHBA 4UPAA 2GN5A 3W1GA 3CCUA 4LFAQ 2R7FA 1WYDA 4X66Q 1HZAA 1HR0Q 1IBMQ 1PH7A 2HHHL 5J3BA 4A3DH 1E24A 2KHJA 4C3IH 1TWHH 2JA7G 1CKNB 1WI5A 3M4PA 3T1YL 2Z0SA 4HIMA 2UUAQ 2OQ0A 3U50C 1B8AA 2AKWB 4MNOA 3TEHB 3W1BA 1I94Q 4LF9L 4BBSH 3AFQA 4YWKA 2JA8G 3NENA 1GD7A 1TWFH 4A3MH 1X55A 3LGJA 1C7YA 3TQYA 3SGIA 4YHHQ 2UXDL 2E8GA 2OCEA 3K0XA 2DUDA 2A1AA 4JBKA 2I5HA 2YYZA 2YV5A 3NEMA 2KCTA 4PMWA 4JI0L 2XTIA 3GTKH 1DGSA 4OWTB 5C0XJ 2RHSB 2VUMH 1CSPA 4AQYL 5GADC 4R4IA 4GOPB 4ALPA 3PUXA 1XMQL 2VZAA 1KQSA 1X3GA 3UDGA 3F2BA 1PH4A 4GNXB 1S40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJL A;  5C3E H;  1PA6 A;  3UDX A;  4DAY B;  1N34 Q;  2UUB L;  4IOA A;  2XGT A;  5M3M H;  4DR6 L;  1VQB A;  1SN8 A;  4X62 L;  4DK3 C;  1JJG A;  2EXD A;  1JB7 A;  4KHZ A;  4GLX A;  1IBM L;  1N32 L;  3PO2 H;  1SR3 A;  1X3F A;  2PI2 A;  3UE0 A;  2R7D A;  4A3I H;  2OQK A;  2IX0 A;  2B63 H;  3KF8 B;  3BJU A;  3GD7 A;  2YTV A;  5IYB G;  2JJQ A;  4A76 A;  1A63 A;  1R9T H;  3CW2 C;  3JAM i;  4DR4 L;  3S2D H;  3A5U A;  3ER0 A;  1VQA A;  1Q12 A;  2ID0 A;  3H15 A;  1C9O A;  5BR8 L;  2R93 G;  1UE1 A;  4JI7 Q;  3PF4 A;  3J81 j;  5GAH C;  2MFI A;  3JAM c;  1JT8 A;  1Q86 C;  1YJN A;  3GTM H;  2K4K A;  4YY3 Q;  1YIT A;  1QZH A;  2NVQ H;  1EQQ A;  4L5S A;  3J81 c;  1EYG A;  5IE8 A;  1YNX A;  3I4M G;  2UUC L;  3E9I A;  4BBR G;  5GAE C;  1SFO H;  2GVA A;  1IZ6 A;  4KI0 A;  1VQI A;  1CKN A;  3S1Q H;  4POF A;  5FLM H;  2AMC B;  2R92 H;  3HOU G;  1YVC A;  5M5Y H;  5LMU Q;  2HT1 A;  1IXR A;  1Y14 B;  2NN6 G;  1ASY A;  4EQ5 A;  3J7Z C;  3CCJ A;  4J15 A;  3CCQ A;  3KFU A;  1PYB A;  2MQH A;  2RHQ B;  3K7U C;  3AEV A;  1HNZ L;  4O0A A;  3I7F A;  5IYC G;  2N78 A;  3I4O A;  4FDB A;  2QGQ A;  4JI2 L;  4C3H H;  1V43 A;  1P16 A;  4LF7 Q;  1V9P A;  1KXL A;  3NBH B;  5M5W H;  1JJC B;  4A3B H;  3UE1 A;  4GLA C;  1PH2 A;  4GOP A;  3H3V H;  1YHA A;  3ULL A;  2LSS A;  1YJ9 A;  4A3G H;  2CWA A;  2ZTD A;  1U0L A;  4QGU A;  1LTL A;  1PFS A;  4GNX A;  4NXM Q;  2NN6 I;  4DUZ Q;  2VL6 A;  5H1S E;  2R6G A;  1J5E L;  5JJI A;  3GO5 A;  1XJV A;  1YBY A;  1VQ8 A;  3KF6 B;  2KHI A;  4LFC Q;  1EWI A;  4GKJ L;  1P8L A;  1N33 Q;  4DK6 C;  3NEL A;  5GRO A;  2A8V A;  3RR5 A;  2PQA B;  3KLW A;  1B70 B;  4JI4 Q;  2BH2 A;  3S24 A;  4LW1 A;  1A0I A;  2WB1 G;  4YWL A;  1PH1 A;  2I0Q A;  3TS2 A;  5C4J H;  2E5L Q;  2F52 A;  4PZ8 A;  3K80 C;  4B3T L;  4LF5 L;  5C44 G;  1TWG H;  4JI8 Q;  4BA2 I;  5GQO A;  2KEN A;  4L5R C;  5EAY A;  4JI5 Q;  2ATW A;  3JC6 6;  3L7Z C;  5FJ8 H;  3I55 A;  5LMN W;  2QEX A;  1X6O A;  3PO3 H;  4BXX G;  5ELO A;  1VS0 A;  4DV2 L;  1IL2 A;  2I5M X;  4BY1 G;  3G6E A;  1I50 H;  2VQE L;  4DV6 L;  4DR1 L;  3HOW H;  1XNQ Q;  2UU9 L;  1Q1E A;  3BZC A;  1K8A C;  1NJI C;  4DV5 Q;  1XNR L;  2Q2T A;  3PUY A;  3FKI H;  5E7N A;  4DV1 Q;  1OXT A;  2OTL A;  3F8T A;  4HIO A;  4X6A H;  3IRB A;  2BA0 A;  3RN5 A;  1E22 A;  3M3Y H;  3CCL A;  3H0G H;  3UDF A;  4YCV A;  3STB D;  2H5X A;  3CPW A;  3A74 A;  2EIF A;  3U4V A;  4LFC L;  1NE3 A;  5IWA L;  3T1H Q;  2Q2H A;  3L0O A;  4DUY L;  4JOI C;  1N33 L;  3CCV A;  4PG3 A;  3D0F A;  1W2B A;  4JV5 Q;  5LMN L;  4LFB Q;  5IYD G;  2OWO A;  4L5Q A;  2JA7 H;  2Y0S E;  3PUZ A;  2UXB Q;  1FVI A;  3S14 H;  1HR0 W;  2IT1 A;  3OTO L;  2E5L L;  3I4N G;  1A62 A;  1TWC H;  3GTQ H;  4LUZ A;  4A93 G;  4JI8 L;  1HNX L;  2ZJQ A;  4NXN L;  1Y1W G;  4A3F G;  2JA8 H;  1VQH A;  1SLJ A;  5HGQ A;  4OO1 G;  2JA9 A;  1N8R C;  4OXP A;  4DR5 Q;  2BA1 A;  4LF4 L;  3J80 i;  4B3R Q;  4R4Q A;  5JJL A;  4A75 A;  2OTJ A;  4X64 Q;  1KIX A;  1NMG A;  2ZM6 Q;  1XNQ L;  2KBN A;  3CP0 A;  1HH2 P;  2ZTC A;  2IHE A;  1QZG A;  2K5H A;  1UE5 A;  3CQZ H;  1K9M C;  3CC4 A;  4GN5 A;  3M4O H;  3KF6 A;  4QIW E;  3ULJ A;  3GTG H;  4DR3 L;  4JI1 L;  4A3L G;  3E0E A;  4XIG S;  3J80 c;  4A3J G;  1OXS C;  1PVO A;  4TVA B;  1Q8K A;  1S3O A;  4GOP C;  2PQA A;  1TWA H;  4DR2 L;  1U5K A;  4IPG A;  4DV4 L;  1E3P A;  1HNW Q;  2A19 A;  4GKK Q;  3CCS A;  3CMA A;  4X66 L;  4GNX C;  1S72 A;  3K8A A;  1HR0 L;  4JI3 Q;  4JI6 Q;  1HZ9 A;  4LFA L;  4OO1 I;  3KJO A;  3T1H L;  1RL2 A;  4OWX B;  1SRO A;  5M3F G;  3GDE A;  1VQP A;  3HOZ G;  1EIY B;  3J7A 5;  5IY0 A;  1KL9 A;  4OWW B;  4PZ7 A;  2UUA L;  3S15 H;  1GO3 E;  1I94 L;  4A3K G;  4HJ9 A;  1PH5 A;  1UEB A;  4NPS A;  5C3E G;  3GTJ H;  2F4V Q;  4Y52 H;  1WJJ A;  2C35 B;  5M3M G;  4YHH L;  1X56 A;  2JEA I;  3DM3 A;  1UWV A;  1VQ4 A;  2F3I A;  2KCM A;  4AYB G;  3ICE A;  2K52 A;  4LF8 Q;  2ES2 A;  1EIF A;  4Y7N H;  2R93 H;  1VQM A;  2JQO A;  4BY7 G;  1VCI A;  3CPF A;  4YCW A;  4APV A;  2ZM6 L;  3HOX G;  4A3E G;  4A3C G;  2N49 A;  1AH9 A;  4KHP Q;  1QVG A;  3U58 A;  1XPO A;  4YCU A;  3G4S A;  4LF6 Q;  1C0A A;  1O7I A;  1K0R A;  3I4M H;  2L15 A;  3B6Y A;  1YZ6 A;  4GLV B;  5HY6 A;  1N34 L;  4HJ7 A;  2YTY A;  3RLO A;  1LYL A;  3GTP H;  1N36 Q;  1X65 A;  3CME A;  1D8L A;  2WB1 E;  4AIM A;  4GKK L;  3G71 A;  4JI3 L;  5IP9 H;  3HOU H;  4IFD G;  1NTG A;  1GKH A;  4DV7 Q;  1EOV A;  1NBW A;  1PH3 A;  4JBJ A;  2NZH A;  3HFZ B;  2ZJR A;  3PIP A;  3CCR A;  2CQO A;  1MJC A;  2R7Z H;  4GN4 B;  5IYC H;  4BA1 I;  1WCM G;  1T9H A;  4IO9 A;  4DR7 Q;  2ALY B;  4JG2 A;  4R4C A;  2UXC Q;  1EFW A;  3PSI A;  4ME3 A;  4DV3 Q;  3KYH C;  4JI7 L;  4DPG A;  4RMF A;  1KRS A;  1Q82 C;  3CC7 A;  1FJG Q;  2JE6 I;  3EBE A;  1FGU A;  4YY3 L;  3AFP A;  1FL0 A;  1VQ5 A;  2ASB A;  1G51 A;  4K0K Q;  5M5X H;  2JA5 G;  3U4Z A;  1VQJ A;  3E9H A;  4IFD I;  4HID A;  1VQE A;  3KOJ A;  4UP8 A;  3S16 H;  3S17 H;  3HOV H;  1K3R A;  2Q2U A;  1Q1B A;  1QUQ B;  5GAG C;  3CCM A;  1K73 C;  1LM0 A;  2Z6K A;  2VW9 A;  1IBK Q;  3HOY G;  3M85 A;  1X9N A;  1JMC A;  2IX1 A;  4NB3 A;  3I56 A;  5LMU L;  1QVC A;  1NY4 A;  2NZO A;  3A5Z B;  3TRE A;  5IP7 G;  2QA4 A;  1J6Q A;  1XMO Q;  1I3Q H;  2VY3 A;  2WP8 J;  4R1J A;  1Y1V G;  2RCN A;  4A4I A;  4DV7 L;  5C44 H;  4B3S Q;  2JA6 G;  1AE2 A;  2PI2 E;  3G48 A;  2ZJP A;  2E2I H;  4IPC A;  2HHH Q;  1PH8 A;  5JEA G;  4WJ4 A;  2B29 A;  1OTC A;  4BXX H;  5IT9 c;  2LXJ A;  3T1Y Q;  4LF7 L;  4DR7 L;  4P75 A;  3PV0 A;  3PIO A;  3CCE A;  1SE8 A;  1VQ7 A;  2PNH A;  4LF9 Q;  3GTL H;  1VQ9 A;  1YEZ A;  4POG A;  5FJ8 G;  2CCZ A;  4NXM L;  4DUZ L;  3RLN A;  2UXD Q;  3PUW A;  2VS1 A;  1KAW A;  3PUV A;  4JI0 Q;  2K14 A;  3MXN B;  5FLX c;  4DKA C;  4IJH A;  2PMZ E;  1L1O B;  3UDI A;  2HQL A;  2FXQ A;  4MTN A;  3W5O A;  1BBU A;  3FKI G;  4AQY Q;  1PHJ A;  1KD1 C;  4JI4 L;  3HKZ G;  2DGY A;  1VQO A;  5C4X G;  4MZ9 A;  1YHQ A;  1XMQ Q;  5IYD H;  1A8V A;  4LNQ A;  2CFM A;  3AQQ A;  1IBL Q;  4JI5 L;  1JJ2 A;  3F1Z A;  2NVT H;  4DR6 Q;  4AYB E;  4A93 H;  4A3D G;  4X62 Q;  1M90 C;  3BU2 A;  4PZ6 A;  1X3E A;  4UP7 A;  1Y1W H;  1SMX A;  3EIV A;  4A3F H;  1X54 A;  1N32 Q;  4GS3 A;  2HIV A;  2BH8 A;  4RG1 A;  1VQL A;  4DV5 L;  1GVP A;  4GN3 B;  4KLK A;  1KHI A;  2AWO A;  4DV1 L;  1PH9 A;  4X65 Q;  3S1N H;  4A3M G;  2K5N A;  1UE6 A;  1V1Q A;  4DR4 Q;  2JEB I;  3ERS X;  1YI2 A;  4JBW A;  4BBS G;  4UP9 A;  4DV0 Q;  4IFD J;  1QUQ A;  2MO0 A;  3CXC A;  3OYY A;  4A3L H;  5BR8 Q;  4A3J H;  4QQB X;  3CAM A;  4WJ3 M;  2VUM G;  4AH6 A;  2WAQ G;  1CUK A;  5JJK A;  1PYS B;  1G6P A;  2NVX H;  1VQ6 A;  3PCO B;  2AWN A;  1EQR A;  1RIP A;  2D0O A;  2K5V A;  4JBM A;  4JV5 L;  3BZK A;  2GVB A;  4LFB L;  5M3F H;  3M4Q A;  3HOZ H;  2N8N A;  2UXB L;  4P71 A;  1N9W A;  2UUC Q;  5IYB H;  1BBW A;  1E1O A;  2LXK A;  2Z6K C;  1IYJ B;  3EN2 A;  4HIK A;  3KDF A;  4A3K H;  1Q46 A;  2E2J H;  2N3S A;  3S2H H;  1YJW A;  1GM5 A;  3M7N A;  4IOC A;  3PO2 G;  5DLQ E;  3HKS A;  1G29 1;  4OON A;  2Q2I A;  1B7Y B;  4LUV A;  4DR5 L;  4A3I G;  1H95 A;  4B3R L;  1Q81 C;  2B63 G;  3ZJY C;  4X64 L;  1L0W A;  4JCV E;  2B3G A;  3WWV A;  4HJ5 A;  1HNZ Q;  3ULP A;  1WFQ A;  3PF5 A;  2Y0S G;  4BY7 H;  4JYA Q;  3Q8D A;  1KRT A;  1E1T A;  3K7A H;  4X65 L;  5AJ3 Q;  2IHF A;  3HOX H;  4A3E H;  4BBR H;  1VQK A;  2YU9 H;  4A3C H;  4JI2 Q;  1L1O A;  4B3M Q;  1SRU A;  4XTC S;  3K81 C;  4DV0 L;  1XPR A;  1Q7Y C;  1I6H H;  3J81 i;  1HNW L;  4QY7 A;  3FP9 A;  3S1M H;  4JI6 L;  2K50 A;  4L5T A;  1WOC A;  4OX9 Q;  2RF4 A;  1BKB A;  1PV4 A;  1VQN A;  5JEA J;  4YWM A;  3L2P A;  3DLL A;  1KC8 C;  1Z47 A;  1J5E Q;  4JOI A;  3CD6 A;  4GKJ Q;  1CKO A;  4HJA A;  1CSQ A;  5C0X G;  2F4V L;  3RNU A;  2HIX A;  4DAM A;  3I2Z A;  1UE7 A;  3PGZ A;  1XPU A;  5FLM G;  1OXV A;  2R92 G;  1IBL L;  1WCM H;  1EUJ A;  2V1C C;  4LF8 L;  4QJF A;  5IP9 G;  2JK8 A;  4JC0 A;  4DNI A;  4B3T Q;  4O2D A;  4LF5 Q;  2NVY H;  1D7Q A;  1LUZ A;  3RN2 A;  5ELN A;  3VDY A;  4QL5 A;  2VQF Q;  2I5L X;  2R7Z G;  3OW2 A;  4KHP L;  1OXX K;  2JA5 H;  4DV2 Q;  4JYA L;  5AJ3 L;  4LF6 L;  1MJE A;  2D62 A;  2VQE Q;  4DV6 Q;  4DR1 Q;  4C2M H;  2UU9 Q;  2CKZ B;  1QVF A;  4A3B G;  5C0X I;  4B3M L;  1YIJ A;  1XNR Q;  3HKZ E;  1N36 L;  3HOY H;  2D0P A;  3F2C A;  3S1R H;  4A3G G;  1VQC A;  4R4O A;  4R4T A;  1VQD A;  3FHW A;  1NMF A;  4OX9 L;  4H02 A;  5K36 G;  1E7Z A;  4HJ8 A;  2E2H H;  5IP7 H;  1OXU A;  1AE3 A;  3HOV G;  2CWP A;  1Y1V H;  3KDF B;  1XTD A;  2JA6 H;  5IWA Q;  4DUY Q;  1BVS A;  4BY1 H;  1I5F A;  5LMN Q;  2UXC L;  3RZD H;  4DV3 L;  1L2F A;  3AYH B;  2ZTE A;  1CKM A;  1HZC A;  3D31 A;  1ASZ A;  4TQU S;  4C3J H;  3H3V I;  1Z9F A;  2MO1 A;  3MEF A;  1FJG L;  4P73 A;  4P74 A;  3OTO Q;  1MKH A;  1VQF A;  1HNX Q;  2MNA A;  3PO3 G;  4NXN Q;  4K0K L;  1HJP A;  2EQS A;  2VQF L;  1K83 H;  3CF5 A;  3HOW G;  4LUO A;  3CC2 A;  4LF4 Q;  1JE5 A;  2WAQ E;  3STB C;  1TXY A;  3TS0 A;  4UY8 C;  2IY5 B;  3GTO H;  3TRZ A;  1IBK L;  4LWC A;  3KJP A;  3RLF A;  1K8G A;  3A0J A;  2WFW A;  1MIU A;  3H0G G;  4EX5 A;  1PH6 A;  1L1O C;  2K75 A;  2VNU D;  4IPD A;  1W3S A;  4DR3 Q;  5C4X H;  4JI1 Q;  3F2D A;  2AHO B;  3M9B A;  1M1K C;  1XMO L;  4P72 A;  1VQG A;  1HZB A;  2YTX A;  4IPH A;  2UUB Q;  4B3S L;  3I4N H;  4DR2 Q;  3RZO H;  4DV4 Q;  1YHB A;  4UPA A;  2GN5 A;  3W1G A;  3CCU A;  4LFA Q;  2R7F A;  1WYD A;  4X66 Q;  1HZA A;  1HR0 Q;  1IBM Q;  1PH7 A;  2HHH L;  5J3B A;  4A3D H;  1E24 A;  2KHJ A;  4C3I H;  1TWH H;  2JA7 G;  1CKN B;  1WI5 A;  3M4P A;  3T1Y L;  2Z0S A;  4HIM A;  2UUA Q;  2OQ0 A;  3U50 C;  1B8A A;  2AKW B;  4MNO A;  3TEH B;  3W1B A;  1I94 Q;  4LF9 L;  4BBS H;  3AFQ A;  4YWK A;  2JA8 G;  3NEN A;  1GD7 A;  1TWF H;  4A3M H;  1X55 A;  3LGJ A;  1C7Y A;  3TQY A;  3SGI A;  4YHH Q;  2UXD L;  2E8G A;  2OCE A;  3K0X A;  2DUD A;  2A1A A;  4JBK A;  2I5H A;  2YYZ A;  2YV5 A;  3NEM A;  2KCT A;  4PMW A;  4JI0 L;  2XTI A;  3GTK H;  1DGS A;  4OWT B;  5C0X J;  2RHS B;  2VUM H;  1CSP A;  4AQY L;  5GAD C;  4R4I A;  4GOP B;  4ALP A;  3PUX A;  1XMQ L;  2VZA A;  1KQS A;  1X3G A;  3UDG A;  3F2B A;  1PH4 A;  4GNX B;  1S40 A; 
#chains in the Genus database with same CATH topology
 5T1I A;  2LMC B;  3UDX A;  4DAY B;  1HRJ A;  1HTL D;  2XGT A;  5M3M H;  4X62 L;  1JWS D;  5CV4 A;  4DK3 C;  5E4X A;  1IBM L;  1X3F A;  1H9K A;  4KK7 A;  3UE0 A;  1HQR D;  2F0N A;  2J7Z A;  2OQK A;  4K5V A;  3RMH A;  2B63 H;  1PTO D;  3BJU A;  5J1Z A;  3JAM i;  3HP3 A;  4IUU A;  1TY0 A;  1BO0 A;  1HA5 A;  5M5X B;  1B9N A;  1C9O A;  2R93 G;  4JI7 Q;  3S17 B;  1QB5 D;  1EY7 A;  2MFI A;  2VB3 X;  3NPP A;  3GTM H;  4YY3 Q;  4WJW A;  1QZH A;  1CFM A;  1EQQ A;  4V19 0;  3J81 c;  1EYG A;  4IFD H;  1SSO A;  4G57 A;  2F0Q A;  5GAE C;  1SFO H;  2MP1 A;  1OO9 B;  1S4Z A;  2WV6 D;  1AEX A;  5C44 B;  1CKN A;  2K05 A;  1LT3 D;  2PZU A;  1F9Q A;  1A15 A;  2E2I B;  1ASY A;  2NN6 G;  3J7Z C;  4J15 A;  1PLF A;  2XIW A;  1HNZ L;  5JOB A;  2N78 A;  1WD0 A;  5KYI A;  3U9S A;  1V43 A;  4CDF C;  4XYO A;  1YJ9 A;  1U0L A;  4QGU A;  1LTL A;  3NHH A;  4NXM Q;  3Q23 A;  4DUZ Q;  5H1S E;  3GO5 A;  1YBY A;  1L0X B;  4GKJ L;  4ULL A;  2B2T C;  3RR5 A;  3KLW A;  2L55 A;  5EKL A;  1PZJ D;  2WB1 G;  4YWL A;  1PH1 A;  3F2U A;  2I0Q A;  4PZ8 A;  4ZYS A;  4B3T L;  4K8I A;  4BA2 I;  5GQO A;  2KEN A;  4L5R C;  5EAY A;  2I07 B;  5LMN W;  5FJ8 H;  3I55 A;  1X6O A;  3NTK A;  1VS0 A;  1IHZ A;  2I5M X;  4BY1 G;  1I50 H;  2VQE L;  3WDN A;  2UU9 L;  2KCC A;  1K8A C;  5EGT A;  4DV5 Q;  3C46 A;  1XNR L;  1KNE A;  3PUY A;  4DV1 Q;  3J7Y W;  2H1E A;  1MSG A;  3H0G H;  2NZ1 D;  1GXD C;  3SEB A;  3T56 B;  4CBV A;  2PW5 A;  2FMC A;  4KJO A;  4LFC L;  3BDO A;  4A3K B;  2OXP A;  2DJG C;  3TBI B;  3OWF A;  5LMN L;  4LFB Q;  4L5Q A;  2JA7 H;  2UXB Q;  1SNQ A;  1H9J A;  1FVI A;  3I90 A;  4IN3 A;  3S14 H;  3OTO L;  3ZYY X;  2E5L L;  3JAM L;  2M9V A;  1Y1W G;  2JA8 H;  1I4P A;  3NBH A;  3K7A B;  2EY5 A;  2R3Z A;  2BA1 A;  1K8M A;  2D9U A;  4LF4 L;  4R4Q A;  2V4D A;  4A75 A;  1CM9 A;  1KNA A;  3TZD A;  1NMG A;  1XNQ L;  1PFN A;  4K8J A;  3CP0 A;  2IHE A;  2K5H A;  3CQZ H;  1K9M C;  4GN5 A;  3M4O H;  1TS5 A;  4QIW E;  1Q90 A;  2B2U C;  5IGE A;  3J80 c;  1D2B A;  1LAB A;  4TVA B;  1B1Z A;  1EQV A;  5I9O A;  2DNC A;  1E3P A;  2TSS A;  4GKK Q;  4ZQ3 A;  4JI6 Q;  4GNX C;  4JI3 Q;  4LFA L;  3OW7 A;  1I4G A;  1RL2 A;  5EPL A;  3R93 A;  2ZXR A;  5IY0 A;  1KL9 A;  4OWW B;  2WKD A;  4N8F A;  1PTO B;  4XDX A;  3S15 H;  1DCZ A;  4HJ9 A;  1PH5 A;  3ONA B;  4Y52 H;  2RQX A;  2Z9H A;  3DM3 A;  3ICE A;  4DAP A;  3VYT A;  3T4A C;  2JXM B;  4CDD C;  1VQM A;  1PFM A;  3CPF A;  1TVX A;  4YCW A;  5JPN C;  2SEB D;  3CRL C;  1MD2 D;  2I46 A;  2NB0 A;  1C0A A;  1O7I A;  3MXN A;  1YZ6 A;  4LMQ D;  1I4H A;  3RLO A;  1X65 A;  3CME A;  4AIM A;  2WB1 E;  1WTQ A;  1B50 A;  4DNR B;  3HOU H;  3RZD B;  1GKH A;  2F0E A;  2Z8L A;  3DEO A;  3PIP A;  1LTB D;  5JVH 3;  5IYC H;  4DR7 Q;  2F0I A;  2UXC Q;  1EFW A;  5C4H A;  1J9O A;  4JI7 L;  1KRS A;  3P75 A;  1EZ6 A;  4TKO B;  3CC7 A;  2JE6 I;  1FJG Q;  4YY3 L;  2PO4 A;  3AFP A;  1VQ5 A;  5K36 H;  5M5X H;  3CHB D;  1SMY C;  3HKZ B;  1WTR A;  3S17 H;  2KOL A;  2EY6 A;  2Q2U A;  5G3L D;  3RZO B;  2VW9 A;  1IW7 C;  3OIP A;  1JMC A;  2IX1 A;  4NB3 A;  4A3D B;  4C3I B;  3TRE A;  5IP7 G;  1GUN A;  4R1J A;  1Y1V G;  5C44 H;  1AE2 A;  2E2I H;  4IPC A;  5KYL A;  4A3M B;  4BXX H;  3T13 A;  2CW0 C;  4HN7 A;  3GTK B;  1F77 A;  4P75 A;  3CCE A;  2PNH A;  1CA6 A;  4NXM L;  1MSH A;  4DUZ L;  1KAW A;  2LY7 A;  5BN4 A;  3MXN B;  5FLX c;  4IJH A;  5KEE A;  1L1O B;  2SOB A;  3ERO A;  4ODG A;  3UDI A;  1CTM A;  5C3E B;  1ZEQ X;  4AQY Q;  3C2P A;  5C4X G;  4MZ9 A;  3TME A;  3J7A F;  4ZKC B;  4RGO S;  1TKW B;  4B08 A;  4LNQ A;  4A3I B;  1JB3 A;  3AQQ A;  1IBL Q;  3VR4 A;  4J6H A;  4XXE A;  2MHV A;  1O80 A;  3F1Z A;  1JJ2 A;  1M90 C;  3EIV A;  2BH8 A;  4DV5 L;  1PZK D;  4KLK A;  4DV1 L;  2G9D A;  4R9W A;  4KN4 C;  3VR6 A;  4DR4 Q;  2NUC A;  2X69 A;  2NVQ B;  2A74 C;  4UP9 A;  2KVM A;  1QUQ A;  2KED A;  3AMU A;  3CRK C;  2VUM G;  1PYS B;  2F0T A;  1VQ6 A;  3PMF A;  1RIP A;  2F3V A;  5C5M A;  3MVV A;  3ERQ A;  3BZK A;  4IZ8 A;  3S1Q B;  4LFB L;  2XWB B;  5M5Y B;  2QCP X;  1SAP A;  4WFN 3;  2UXB L;  5IYB H;  5D14 A;  3KDF A;  4A3K H;  1Y8O B;  1WVL A;  3M7N A;  3G7L A;  4IOC A;  4K6L A;  3HKS A;  5DLQ E;  3Q0A A;  2IL8 A;  1E0B A;  1L0W A;  4JCV E;  4A3B B;  1G2S A;  1RHP A;  4HJ5 A;  3PF5 A;  1KDA A;  5JVG 3;  3K7A H;  1ZYR C;  2B2Y A;  1UAP A;  3K81 C;  3J81 i;  3FP9 A;  1SNM A;  4JI6 L;  1BNZ A;  2EJG C;  1Z47 A;  5JPM C;  1J5E Q;  2A6E C;  1TQO A;  3I70 A;  5C4J B;  1PRT F;  3RNU A;  2HIX A;  1UE7 A;  1SYB A;  5FLM G;  2DNE A;  5IGF A;  1EUJ A;  2V1C C;  2H4O A;  1PTO H;  4QJF A;  5IP9 G;  3HOW B;  2BOS A;  1QJO A;  4LF5 Q;  2QEJ C;  2I5L X;  4C3H G;  1ENA A;  4JYA L;  1EZ8 A;  2J0T D;  5AJ3 L;  1GUW A;  2D62 A;  1FGB D;  5IT9 E;  5C0X I;  2B2U A;  4R4O A;  1SMY D;  3AB9 A;  4OX9 L;  4H02 A;  2EYH A;  5KNC A;  4HJ8 A;  3SK4 A;  1IW7 D;  2C5C A;  3KDF B;  4FVM A;  1BVS A;  1RD9 D;  4KHV A;  5KND A;  1ESR A;  2UXC L;  3RZD H;  1O7Y A;  3D31 A;  1TT2 A;  2N55 A;  4F7X A;  2RDF A;  3K57 A;  1BR9 A;  2MO1 A;  1FJG L;  5IGG A;  1HNX Q;  1HJP A;  2CW0 D;  4UY8 C;  3VA7 A;  3DWP A;  4MN3 A;  4LWC A;  1EY5 A;  1MIU A;  3NK9 A;  2DN8 A;  1A2T A;  4XQN A;  1LT6 D;  4DR3 Q;  1WD1 A;  1I4R A;  3P7J A;  2F0H A;  2ICI A;  4IPH A;  3RZO H;  1AZQ A;  1VF5 C;  4PQX A;  3S9W A;  3W1G A;  5CR3 A;  1XWE A;  1IBM Q;  1HR0 Q;  1PH7 A;  4A3D H;  1E24 A;  1STE A;  3CKI B;  4C3I H;  4X3T A;  3U50 C;  2AKW B;  3TEH B;  2ICE C;  3BDC A;  1SYC A;  3AFQ A;  3SDZ A;  2R93 B;  4YWK A;  3NEN A;  1GD7 A;  4A3M H;  1C7Y A;  4YHH Q;  3X3N A;  3GTK H;  2YYZ A;  2YV5 A;  1SE2 A;  4QUC A;  3J81 L;  3A56 A;  4OWT B;  4QIW B;  4EGV A;  4EQN A;  2F03 A;  1KDB A;  4AQY L;  4HCS A;  4R4I A;  1B53 A;  4N8X 1;  1GHJ A;  2VZA A;  2EDG A;  4GNX B;  1IBL L;  5C3E H;  1N34 Q;  2L4N A;  3U9O A;  2DJF C;  1VQB A;  2R7Z B;  2K03 A;  2RBM A;  1DOM A;  4A3I H;  1FD7 D;  1ZXT A;  3KF8 B;  2YTV A;  2JJQ A;  1A63 A;  3R2T A;  3CW2 C;  4LAA A;  4DR4 L;  3A5U A;  1JIC A;  3KLR A;  3ER0 A;  1Q12 A;  4KV6 A;  5G3L F;  3H3V C;  1GUT A;  3WOF A;  2ZT9 C;  1X32 A;  3J81 j;  2SDF A;  1LTS D;  1DJR D;  5GAH C;  2K4K A;  2NVQ H;  1ZYR D;  1MGS A;  4OHJ A;  4RHR A;  1IYU A;  4BBR G;  2GA4 B;  2WB1 B;  1SE3 A;  1DXM A;  4HSV A;  5C0X H;  1JOR A;  5DM7 3;  3S1Q H;  4YIJ A;  4POF A;  1QIL A;  2HCC A;  1JJG A;  5M5Y H;  2HT1 A;  2A6E D;  1IXR A;  1Y14 B;  3HZX A;  4IUV A;  4P2C B;  2MQH A;  1U9R A;  3K7U C;  4O0A A;  2XRS D;  3GTL B;  1JWU D;  2RCF A;  3I4O A;  4FDB A;  4HSP A;  4CKC A;  3J7A V;  1BCP C;  1Z6H A;  1CT1 D;  4XQQ A;  4CDE C;  5FK9 C;  1G8Z D;  1KXL A;  4A3B H;  1JJC B;  3UE1 A;  3T51 B;  4OL7 A;  1YHA A;  4C56 C;  2N88 A;  2SNM A;  1B2T A;  4EVO A;  3HS0 C;  3MXU A;  4MIU A;  2NN6 I;  2VL6 A;  4M8A A;  2R6G A;  1J5E L;  5JJI A;  1XJV A;  3KF6 B;  4JW0 A;  5CMD A;  4LFC Q;  4HR7 B;  4DK6 C;  1QCB D;  5GRO A;  1WTO A;  1O7L A;  4UHV A;  1B70 B;  3T16 A;  4JI4 Q;  1Y1W B;  5C4J H;  2E5L Q;  4LF5 L;  3FEW X;  1IKM A;  3L7Z C;  2EYL A;  3MEH A;  2F0S A;  4FO2 A;  3S1N B;  2QEX A;  1U4R A;  3WOE A;  5LL6 X;  3G6E A;  3HOW H;  1XNQ Q;  5LL6 S;  5DNF A;  1XYI A;  4HMJ A;  1L0Y B;  2Q2T A;  4ZKB B;  3RN5 A;  2NVX B;  1TR5 A;  5BN5 A;  2H5X A;  3QR8 A;  3GQB A;  3A74 A;  2EIF A;  3U4V A;  1XTC D;  4V0B A;  1M4V A;  3L0O A;  3CCV A;  3D0F A;  2E76 C;  2AUJ D;  2FIN B;  2K33 A;  3I73 A;  4B9W A;  2OWO A;  2F0K A;  2Y0S E;  5CV9 A;  1HR0 W;  2Q8R E;  3I4N G;  4Z9C B;  4LUZ A;  4JI8 L;  3QWN A;  2NWG A;  1HNX L;  2F0J A;  2EE1 A;  4A3F G;  4OO1 G;  5EBD A;  1II3 A;  3SE0 A;  4DGZ A;  4DR5 Q;  1H9M A;  3CU7 A;  1BDO A;  2O2L D;  1HH2 P;  3CC4 A;  4HMI A;  4DR3 L;  5IIF A;  4A3L G;  4XIG S;  4XQJ A;  1UEA B;  4A3J G;  1PVO A;  1Q8K A;  4GOP C;  1BF4 A;  1A2U A;  4IPG A;  4JVZ A;  1HNW Q;  2A19 A;  2CVR A;  3CCS A;  4IUP A;  1HR0 L;  3JAM E;  3T1H L;  1VQP A;  5M3F G;  2B39 A;  3HOZ G;  3QG1 A;  1EIY B;  1F9S A;  2EY2 A;  3J7A 5;  4QMG A;  1GO3 E;  5ELF A;  1LTT D;  2F4V Q;  4NPS A;  2EYM A;  2C35 B;  2K5D A;  5M3M G;  4YHH L;  2JEA I;  2TMP A;  1UWV A;  2KCM A;  4AYB G;  4LF8 Q;  2ZXP A;  2D5D A;  2R93 H;  4C2M B;  3PIP 3;  2F0W A;  4BY7 G;  1EY4 A;  2ZM6 L;  3HOX G;  4A3E G;  4KHP Q;  1QVG A;  1PZI D;  1XPO A;  2M00 A;  2E2H B;  4EQO A;  1N34 L;  1N36 Q;  1Y1V B;  2HD3 A;  1F2L A;  2X6G A;  3NE5 B;  4TRD A;  4IFD G;  2NN6 H;  1LTG D;  1EOV A;  1NBW A;  1XXG A;  2NZH A;  4KY5 A;  3HFZ B;  2ZJR A;  1ZKO A;  1MHW C;  2R7Z H;  5FOB B;  3MFG A;  4GN4 B;  2K28 A;  4BA1 I;  1SNO A;  4IO9 A;  2ALY B;  1GUS A;  1K83 B;  2MUY A;  3PSI A;  4KY6 A;  5C3X A;  3KYH C;  2B2W A;  3GTO B;  1V1O A;  2ASB A;  1BCP D;  3X3M A;  1G51 A;  4Q5V A;  2JA5 G;  3R2I A;  3SK6 A;  3U4Z A;  2KEC A;  1VQJ A;  5C4X B;  1VQE A;  1S5C D;  3KOJ A;  4UP8 A;  1R4P B;  2WIN B;  4FF2 A;  3I56 A;  2RSO A;  2Q8T A;  4IQZ A;  2PYK A;  2K1B A;  1J6Q A;  3OSO A;  2VY3 A;  2WP8 J;  4ID6 A;  4A4I A;  4DV7 L;  3BVM A;  4DXF A;  2HHH Q;  3V2T A;  5JEA G;  4WJ4 A;  2Q8I B;  5IT9 c;  4C3J G;  3T1Y Q;  5E4W C;  3PV0 A;  3GV6 A;  1WTW A;  1VQ7 A;  4IAL A;  1STG A;  2E74 C;  5A2Q L;  3GTL H;  1Q8I A;  2VUM B;  2QW7 A;  4POG A;  5FJ8 G;  3PUW A;  2VS1 A;  4JI0 Q;  4DKA C;  1DON A;  4MTN A;  1SJH D;  2J4X A;  1PHJ A;  4JI4 L;  3D6W A;  1VQO A;  1U4L A;  3D6C A;  1GUG A;  1A8V A;  1UNS A;  3GV3 A;  5HUR A;  3NBI A;  2KUM A;  4AYB E;  1ET9 A;  3BU2 A;  4UP7 A;  1Y1W H;  2NYZ D;  1X54 A;  4J8Q A;  1N32 Q;  2KA7 A;  1STA A;  1K0S A;  2EYP A;  1AW7 A;  2AWO A;  4DK1 A;  4IUT A;  1PH9 A;  3S1N H;  3DM1 A;  4JBW A;  4IFD J;  4TSS A;  3CXC A;  1VMP A;  5BR8 Q;  1I6V C;  1RF2 D;  5C4Z A;  4CGY B;  5JJK A;  1B3A A;  2NVX H;  2K5V A;  3EFX D;  2GVB A;  3FPU B;  5I4D A;  4G7O C;  2Z6K C;  1STH A;  3VR2 A;  2B2V C;  3PO2 G;  1EWC A;  4OON A;  4LUV A;  1B7Y B;  3SXH A;  4DR5 L;  4C3H B;  3V96 A;  5J39 A;  5M5W B;  1B9M A;  3WWV A;  2M2L A;  4JYA Q;  1KRT A;  5AJ3 Q;  1E1T A;  1VQK A;  4JI2 Q;  1L1O A;  2XSC A;  2AQ1 B;  1CHQ D;  1SRU A;  2ENB A;  4XTC S;  3M7G A;  3BG3 A;  4RHS A;  1HNW L;  2K50 A;  4OX9 Q;  2RF4 A;  3NUC A;  1DOL A;  5JEA J;  4YWM A;  3CD6 A;  1CZG A;  1CKO A;  4HJA A;  5CBE E;  5CV5 A;  3TDQ A;  1TWG B;  2F4V L;  3MXG A;  5JJZ A;  3PGZ A;  1XPU A;  1OXV A;  2R92 G;  1NNX A;  4LF8 L;  3VYS A;  1DYQ A;  1BCP B;  3FKI B;  1HUN A;  3OW2 A;  4KHP L;  1OXX K;  1D5X C;  4DV2 Q;  2JP1 A;  4DR1 Q;  4DV6 Q;  1HQM C;  4C2M H;  2CKZ B;  4B3M L;  2FJ2 A;  1N36 L;  1O7Z A;  4A3G G;  1VQC A;  3FHW A;  3ND9 A;  5K36 G;  3BS1 A;  1C48 A;  4DFA A;  5COY A;  4B9X A;  4F87 A;  2E2H H;  5IP7 H;  1Y1V H;  1TWC B;  3GTQ B;  2XWJ B;  1NR4 A;  1JWM D;  3QB3 A;  2EVB A;  4DN4 M;  3MZ5 A;  1HZC A;  3H3V I;  4HAE A;  1MKH A;  3PO3 G;  2O5J C;  4NXN Q;  2EQS A;  1TU2 B;  2VQF L;  1K83 H;  1G91 A;  3STB C;  1TXY A;  4OEM B;  3GTO H;  3TRZ A;  1TWA B;  1LLR D;  2O5I C;  1PTO F;  3A0J A;  4EX5 A;  5I2Y A;  5I6W A;  4IPD A;  1W3S A;  5M9O A;  2WKC A;  4DF7 A;  5C4X H;  3H09 A;  2AHO B;  4G7Z C;  1M1K C;  4H0L C;  1VQG A;  5FKA C;  2F0V A;  2Y0S B;  3KBX A;  5HGT A;  4X66 Q;  3GTJ B;  2HHH L;  3W3A A;  1HPC A;  3M4P A;  3T1Y L;  2KHS A;  2BE5 C;  2UUA Q;  2OQ0 A;  4H13 C;  1I94 Q;  1GJX A;  3NQI A;  3K0X A;  3IFT A;  1EFI D;  2DUD A;  4JBK A;  2L0C A;  3TP7 A;  4CKB A;  4JI0 L;  1EL0 A;  3C1F A;  1LTI D;  2VUM H;  1CSP A;  2E75 C;  2F3W A;  2WAC A;  1AP0 A;  2B2T A;  4GOP B;  1ML0 D;  1AZP A;  1LT4 D;  2XVS A;  4QUF A;  2PZT A;  1BBX C;  1HFN A;  1A3V A;  1S40 A;  2LFN A;  4LJZ C;  4RFB A;  2UUB L;  4IOA A;  1K28 A;  5CC4 A;  2EXD A;  1JB7 A;  4KHZ A;  3URY A;  4GLX A;  1N32 L;  1BCP F;  5IYB G;  4A76 A;  4HTH A;  3J81 E;  3OMG A;  2Z6B A;  1EU4 A;  4MTK A;  4BWG B;  5CGK A;  3A7L A;  3N52 A;  5BR8 L;  3DWA A;  1UE1 A;  3PF4 A;  2QF7 A;  3HOV B;  1JT8 A;  3JAM c;  1Q86 C;  1YIT A;  2E2D C;  4X3K A;  4L5S A;  1STB A;  5IE8 A;  3I4M G;  3E9I A;  2BCO A;  1K3B C;  1VQI A;  5FO7 B;  4XYQ A;  1V1P B;  5I6Y A;  2AQ3 B;  5FLM H;  2AMC B;  1YVC A;  5LMU Q;  4I7Z C;  3FPP A;  3ND8 A;  4EQ5 A;  3CCQ A;  2RHQ B;  4RCN A;  1EY0 A;  5FO8 B;  4JI2 L;  4C3H H;  4X3U A;  1V9P A;  5M5W H;  1PH2 A;  5NUC A;  3H3V H;  2LSS A;  3RUZ A;  2CWA A;  2G5D A;  4R8N A;  4GNX A;  2A69 C;  1VQ8 A;  1EWI A;  1E2W A;  3NEL A;  2A8V A;  2NVT B;  2PQA B;  1JC7 A;  2CH4 A;  1LTR D;  4S3S A;  3S24 A;  1A0I A;  3KF8 A;  4A3F B;  4G4K A;  3I3C A;  2F52 A;  3K80 C;  1JR0 D;  1TWG H;  1SE4 A;  2CHB D;  4KD4 A;  4JI8 Q;  2ATW A;  4JI5 Q;  3QOJ A;  4DV2 L;  3TSS A;  1IL2 A;  3KUP A;  1SNC A;  4DV6 L;  4DR1 L;  4RGT A;  1UUP A;  1NJI C;  4A3J B;  2IX3 A;  2A68 D;  5D3D A;  3TP5 A;  2OTL A;  3FKI H;  3F8T A;  2L9H A;  2BA0 A;  1E22 A;  1X3P A;  4EQP A;  3UDF A;  2PCF B;  4YCV A;  3STB D;  1VDZ A;  5M3F B;  3HOZ B;  5CYU A;  5KRU A;  3CPW A;  4K6D A;  3T1H Q;  1N33 L;  2E2J B;  3P20 A;  5IGC A;  4PG3 A;  1W2B A;  4JV5 Q;  2ZXO A;  1PFB A;  5IYD G;  3IL8 A;  3PUZ A;  1DD2 A;  4AYB B;  4KN7 C;  1JOK A;  3LX0 A;  2IT1 A;  4XT3 B;  4CJ1 B;  1Q3L A;  1TWC H;  3GTQ H;  4A93 G;  3J80 E;  4NXN L;  2PNR C;  3VYU A;  4BY7 B;  3HOX B;  2BE5 D;  4A3E B;  3I8Z A;  3DXJ C;  3J80 i;  4B3R Q;  5JJL A;  3HGB A;  5ISR A;  4X64 Q;  1KIX A;  1FYC A;  2ZM6 Q;  3VR5 A;  2OTJ A;  1I6H B;  2KBN A;  4ZAI A;  4KJN A;  4ZCK A;  1QZG A;  3S1M B;  3KF6 A;  3BYT B;  2NTS A;  3H6M A;  5EKK A;  3E0E A;  1GUO A;  1TWA H;  1U5K A;  1Z7T A;  5CV8 A;  2EY1 A;  1S72 A;  4X66 L;  2F1M A;  4OO1 I;  3KJO A;  4OWX B;  4ZUI A;  5C5L A;  3Q6S A;  4PZ7 A;  2UUA L;  2B8F A;  1SNP A;  4UDU C;  1I94 L;  4NKL A;  2K5Q A;  3GTJ H;  5C3E G;  3NXW A;  1R4Q B;  1WJJ A;  2SNS A;  1X56 A;  2KJX A;  3I91 A;  1VQ4 A;  1F2M A;  2K52 A;  2JA5 B;  5A35 A;  2JQO A;  3NQT A;  3K5O A;  3S1R B;  4A3C G;  1U4M A;  3G4S A;  1VMC A;  5IGB A;  3B6Y A;  4GLV B;  2X6L A;  1EYC A;  4HJ7 A;  2YTY A;  1LYL A;  3SR1 A;  1EWH A;  1H9S B;  2QIL A;  4BY1 B;  1HHV A;  4XT1 B;  1CQF A;  1V8Q A;  4DV7 Q;  1DM0 B;  1CQV A;  4C3J B;  3KBG A;  3MFY A;  4DAV A;  3CCR A;  1MJC A;  2K7V A;  4DK0 A;  4L8J A;  1WCM G;  1T9H A;  1ROD A;  4JG2 A;  4R4C A;  2C9O A;  4CKE A;  4DV3 Q;  3NSW A;  4ME3 A;  4DPG A;  2QDB A;  3HG9 A;  3FDT A;  1Q82 C;  1FL0 A;  2RA4 A;  1EY8 A;  4IFD I;  4HID A;  5FO9 B;  3HOV H;  1K3R A;  1K73 C;  3HOY G;  4RCO A;  1F2Y A;  3CCM A;  1DOK A;  2A69 D;  5LMU L;  1B44 D;  1CZW A;  1YNJ C;  1NY4 A;  3A5Z B;  2JA6 G;  4B3S Q;  2RCN A;  2RSN A;  1XX8 A;  2PI2 E;  4F8M A;  2ZJP A;  1TWF B;  5FLX E;  1OTC A;  3J80 L;  2LXJ A;  5E3F A;  3PIO A;  3IKJ A;  1SE8 A;  1PRT C;  3FVQ A;  1VQ9 A;  2MJ8 A;  4ZK9 B;  2CCZ A;  4RGM A;  3RLN A;  3Q22 A;  2F4I A;  4NW2 A;  5L37 A;  1S5D D;  5EPJ A;  4KKS A;  2PMZ E;  4DXG A;  2HQL A;  1E2Z A;  3TZU A;  4FXG C;  1BBU A;  2KCN A;  1YHQ A;  1XMQ Q;  3PO2 B;  2CFM A;  2HUG A;  4Q0F A;  4JI5 L;  2NVT H;  1R9T B;  4DR6 Q;  1ILP A;  4FF3 A;  5A2Q E;  3S2D B;  2JN4 A;  1SMX A;  4A3F H;  4OO1 H;  4C1N I;  4GS3 A;  2RKS A;  2OEO A;  4CJ0 B;  3D4W A;  1KHI A;  3K5L A;  2K5N A;  1UE6 A;  1V1Q A;  2JEB I;  3ERS X;  3OPO A;  4BBS G;  5K5P A;  1O78 A;  2MO0 A;  4QB4 A;  4A3L H;  3A8J E;  4A3J H;  3CAM A;  4WJ3 M;  4AH6 A;  2WAQ G;  3PCO B;  2AWN A;  1QG7 A;  2D0O A;  2AUK A;  4JV5 L;  2R92 B;  5M3F H;  3HOZ H;  2UUC Q;  4C1N K;  1DZ1 A;  1BBW A;  1E1O A;  2LXK A;  1IYJ B;  3EN2 A;  3DHQ A;  5DAU A;  1Q46 A;  3HRZ C;  4FP5 D;  2E2J H;  5ELE A;  3W2D A;  1TY2 A;  1SJE D;  1G29 1;  1D6E C;  1B4O A;  4B3R L;  2B63 G;  4NDX A;  3ZJY C;  4X64 L;  2B3G A;  5C3W A;  4BY7 H;  4A3G B;  1FR3 A;  4X65 L;  4G7H C;  3HOX H;  4A3E H;  1D1I A;  1S5F D;  4B3M Q;  4DV0 L;  1I6H H;  1VF7 A;  4JK1 C;  2MPM A;  3S1M H;  3NWT A;  1WOC A;  1PV4 A;  1TS2 A;  1EOT A;  3L9A X;  3O13 A;  1CSQ A;  1WTH A;  2RDH A;  1CK1 A;  4DAM A;  3I2Z A;  5CV7 A;  3K59 A;  2K01 A;  4RKL A;  3PO3 B;  4JC0 A;  4DNI A;  5FLX L;  1D7Q A;  4QL5 A;  1BUV T;  1F9R A;  5CV6 A;  2VQF Q;  2R7Z G;  3M3Y B;  4F88 A;  2JA5 H;  4MHE A;  2EPB A;  1QVF A;  1U4P A;  5AFW A;  2K5W A;  3D4D A;  3F2C A;  3S1R H;  3E0J A;  4R4T A;  4FNF A;  1E7Z A;  5F2D A;  4ZLT F;  1AE3 A;  2CWP A;  1NSN S;  1XTD A;  5IWA Q;  5KGU A;  4DUY Q;  4DU9 A;  4BY1 H;  1I5F A;  1YNJ D;  5JEA H;  4DV3 L;  1L2F A;  3RD4 A;  3C3L A;  1RDP D;  3D4R A;  1ASZ A;  4C3J H;  3KK7 A;  1WTV A;  5C6A A;  1HFG A;  4P73 A;  1VQF A;  3D8G A;  2NTT A;  3EVQ A;  1X3Q A;  2F0L A;  4ZRZ A;  3GTG B;  4LUO A;  3L3O C;  3NTI A;  1PRT D;  2WAQ E;  3DMU A;  1D5Z C;  2IY5 B;  1SXT A;  3NTH A;  3RLF A;  1K8O A;  1EY9 A;  2XN9 C;  2WFW A;  1F9P A;  3DEP A;  3H0G G;  2B2Y C;  2VNU D;  1LO5 D;  4JI1 Q;  3F2D A;  1C4Q A;  2UUB Q;  4P72 A;  2YTX A;  4KD3 A;  4B3S L;  5J22 A;  1ILQ A;  2LKV A;  4DR2 Q;  4DV4 Q;  1YHB A;  2EYO A;  4UPA A;  2GN5 A;  2R7F A;  4PMB A;  4K5W A;  1EYD A;  3BVZ A;  2JA7 G;  1CKN B;  1AN8 A;  4HIM A;  1B8A A;  4Y7N B;  3W1B A;  1QOH A;  2RVL A;  3MAQ A;  5ELC A;  2JA8 G;  1SEB D;  1TWF H;  4IUQ A;  1X55 A;  2K32 A;  3LGJ A;  3MHB A;  2I5H A;  1DGS A;  4OIJ A;  3I4M B;  1TII D;  4U68 A;  4U67 3;  2RHS B;  3Q24 A;  3GTP B;  4ILW A;  5GAD C;  4ALP A;  1XMQ L;  5EKI A;  1KQS A;  1EY6 A;  1FNV A;  1X3G A;  3BYY B;  3F2B A;  2MGS A;  2JSO A;  1JCK B;  4IJL A;  3VR3 A;  1PA6 A;  1GOZ A;  3MA2 B;  4DR6 L;  5IOC A;  1SN8 A;  4QF4 A;  4QCL A;  1BQQ T;  1QE6 A;  3PO2 H;  1SR3 A;  2PI2 A;  2R7D A;  1RTO A;  1ENF A;  2IX0 A;  2CQA A;  1LV9 A;  3GD7 A;  2KQ3 A;  1R9T H;  1KAA A;  3S2D H;  3C1E A;  4OGQ C;  1VQA A;  1SYE A;  3H15 A;  2ID0 A;  2F0D A;  1HXY D;  2L12 A;  2IW3 A;  2PZW A;  3S16 B;  4L63 B;  3R8B A;  1YJN A;  5LHY 1;  1CHP D;  1B3Q A;  3BZD B;  1YNX A;  4OIK A;  2UUC L;  2DY7 A;  1E2V A;  2GVA A;  3IAY A;  5D65 A;  1HUM A;  1I3Q B;  1IZ6 A;  1W6J A;  4KI0 A;  2R92 H;  3HOU G;  4OEL B;  4X3S A;  3K58 A;  3CCJ A;  1EEF D;  3KFU A;  1PYB A;  1SYF A;  2FMM A;  5I9P A;  3AEV A;  3I7F A;  1SYD A;  5IYC G;  2A73 B;  2QGQ A;  1P16 A;  4PNY A;  4LF7 Q;  3A54 A;  3NBH B;  5I2X A;  1AFP A;  4GLA C;  3I4L A;  4GOP A;  3ULL A;  3SHL A;  4A3G H;  2ZTD A;  1FNW A;  1PFS A;  2F0F A;  2KHI A;  1P8L A;  4WOR A;  1N33 Q;  1CA5 A;  3KLS A;  3H94 A;  4FYD A;  2EJM A;  1Y69 U;  2BH2 A;  4A93 B;  1GHK A;  2XNA C;  1D1K A;  3TS2 A;  4LW1 A;  3N6R A;  5EPK A;  3QIA A;  2FHT A;  5EBC A;  1PYW D;  4RA8 A;  2A68 C;  5C44 G;  4R8I A;  1EEI D;  4FXK C;  3MTS A;  1QNU A;  3JC6 6;  3PO3 H;  4BXX G;  5ELO A;  3UI2 A;  1A6X A;  1PRT B;  1Q1E A;  3BZC A;  4K5X A;  4M1U B;  2EXZ A;  1OXT A;  2QDL A;  5E7N A;  4HIO A;  3GP7 A;  3IRB A;  4X6A H;  3M3Y H;  2EOT A;  3OOC A;  3CCL A;  3LNN A;  2PMZ B;  1ET6 A;  2CH4 W;  1V1P A;  1NE3 A;  4KKU A;  4HED A;  5IWA L;  2Q2H A;  2WII B;  4DUY L;  4JOI C;  3S2H B;  3T53 B;  2F0P A;  1ICW A;  3HEJ A;  3OMC A;  3SVM A;  3I72 A;  4H44 C;  1ENC A;  5JAV A;  4O1N A;  1A62 A;  4NMZ A;  1JOQ A;  2ZJQ A;  5EQ0 A;  1VQH A;  1SLJ A;  5HGQ A;  2JA9 A;  1N8R C;  1F2Z A;  4OXP A;  4BBR B;  2YU9 B;  1TS3 A;  5ELD A;  4JPB W;  2ZTC A;  1UE5 A;  2Z4I A;  1CI3 M;  3GTG H;  3ULJ A;  5CBA E;  4JI1 L;  3VA5 A;  1OXS C;  1A3U A;  1S3O A;  2PQA A;  4DR2 L;  4DV4 L;  4H7B A;  4IUR A;  3CMA A;  3K8A A;  2F0U A;  1HZ9 A;  1W6K A;  3K6O A;  1SRO A;  3GDE A;  1FNU A;  3K0Y A;  1TS4 A;  1WCM B;  1HCZ A;  1I4Q A;  3BDL A;  4A3K G;  1BXT A;  2NVY B;  3K5M A;  4LK1 C;  1UEB A;  2L11 A;  4KTA A;  1Y8N B;  2KEE A;  1STN A;  2F3I A;  4IUN A;  2ES2 A;  1LT5 D;  1EIF A;  4Y7N H;  1PDQ A;  4RGN A;  1BOS A;  1VCI A;  3HOY B;  4APV A;  4FXD A;  1RCV D;  5DM6 3;  2AQ2 B;  2QKI C;  2N49 A;  1AH9 A;  5IOD A;  2Z1C A;  3ITP A;  3U58 A;  4YCU A;  1QWY A;  4LF6 Q;  1K0R A;  3I4M H;  1STY A;  2L15 A;  2OF1 A;  5HY6 A;  5KIX A;  3GTP H;  2JA6 B;  1D8L A;  4RKB A;  4GKK L;  3G71 A;  2DY8 A;  4JI3 L;  5IP9 H;  4KKT A;  4GZY C;  1WTP A;  4J1M A;  4BS9 A;  4KY7 A;  1NTG A;  2XRQ D;  4CJ2 C;  3OHX C;  2K6A A;  1PH3 A;  4JBJ A;  3FMC A;  2OT2 A;  2A6H C;  2CQO A;  3LWU A;  1MI2 A;  3FRP B;  4RMF A;  3MWY W;  4N9T A;  3TP6 A;  2G9H D;  1NAP A;  3EBE A;  1FGU A;  4E6I A;  4K0K Q;  3H91 A;  3LWE A;  3QOL A;  1ONL A;  3NP8 A;  3E9H A;  1JE4 A;  3S16 H;  3E6Z X;  3PIO 3;  1Q1B A;  1QUQ B;  5GAG C;  1IBK Q;  3I4N B;  1LM0 A;  2Z6K A;  3M85 A;  1X9N A;  5ELB A;  2BDO A;  1H9R A;  2B8G A;  1QVC A;  2O4X A;  2B2V A;  3AU7 A;  1TWH B;  2NZO A;  2QA4 A;  2K04 A;  3BVG A;  1NR2 A;  1XMO Q;  1I3Q H;  1KLU D;  2PQE A;  1NUC A;  1KAB A;  3G48 A;  2L5T A;  1IYV A;  3KLS X;  4PV1 C;  1PH8 A;  2B29 A;  3A8I E;  1LAC A;  4ME5 A;  4BBS B;  4LF7 L;  4DR7 L;  2F0G A;  3SK5 A;  4LF9 Q;  2HDM A;  2WAQ B;  1YEZ A;  2UXD Q;  5COR A;  1RJT A;  3PUV A;  1NCV A;  4K2L A;  2K14 A;  3DWQ A;  1H9S A;  2FXQ A;  3W5O A;  5M3M B;  3FKI G;  4DA2 A;  1KD1 C;  3HKZ G;  2DGY A;  1SND A;  3MC0 B;  5IYD H;  4N9P A;  2B63 B;  3G6J B;  4A3D G;  4A93 H;  4X62 Q;  2EYJ A;  4PZ6 A;  1X3E A;  4C3I G;  1HA6 A;  4ABN A;  3EQL C;  4WRD A;  2HIV A;  4RG1 A;  1VQL A;  1GVP A;  4GN3 B;  4X65 Q;  3GTM B;  4A3M G;  1EIG A;  2L1B A;  1YNN C;  1YI2 A;  2B2W C;  4DV0 Q;  3OYY A;  1SFO B;  4QQB X;  1CUK A;  1G6P A;  1ESF A;  1EQR A;  4I7A A;  2F0M A;  4JBM A;  4FF4 A;  1QNK A;  2LS0 1;  3M4Q A;  2N8N A;  2HDL A;  4CHT B;  4P71 A;  1N9W A;  1A3T A;  4PMC A;  4HIK A;  1EU3 A;  1PTO C;  2N3S A;  3S2H H;  1I4X A;  2VXW A;  4O42 A;  1YJW A;  1GM5 A;  4CDC C;  3DUZ A;  1J8I A;  2Q2I A;  2IJ0 A;  4A3I G;  1H95 A;  1Q81 C;  3QO2 A;  1S5B D;  4L6T B;  3OWE B;  2R61 A;  1SDF A;  1SYG A;  1HNZ Q;  3ULP A;  1WFQ A;  2Y0S G;  3Q8D A;  2IHF A;  4KMU C;  4BBR H;  2YU9 H;  4A3C H;  4HCE A;  3TP8 A;  3E5S A;  4RH6 A;  1XPR A;  1Q7Y C;  4QY7 A;  1SBB B;  5EJW A;  4L5T A;  5KNB A;  1BKB A;  5TSS A;  1VQN A;  3A8K E;  2HQE A;  3L2P A;  3DLL A;  4ZUJ A;  5IT9 L;  1KC8 C;  4JOI A;  4GKJ Q;  1EYA A;  2HCI A;  2BDN A;  2JYO A;  5C0X G;  3A55 A;  2EZV A;  5BN3 A;  1WCM H;  1JQY D;  4FF1 A;  3OIQ A;  3A7A B;  1I50 B;  2JK8 A;  2A6H D;  1RKN A;  4B3T Q;  4O2D A;  3V05 A;  1PXU A;  2NVY H;  1LUZ A;  1ICF B;  3RN2 A;  5ELN A;  3VDY A;  2VB2 X;  1KTK A;  2NBF A;  1JOO A;  2IWH A;  2F0O A;  3H0G B;  3M4Y A;  2FFK B;  4I65 A;  4LF6 L;  2P5Z X;  1MJE A;  1KLG D;  2VQE Q;  4A3B G;  2UU9 Q;  1YIJ A;  1XNR Q;  3HKZ E;  3HOY H;  2D0P A;  3EA6 A;  1VQD A;  3EJI A;  3R3O A;  1NMF A;  3PQI A;  2JA7 B;  2Z4H A;  2EJF C;  5T1G A;  1OXU A;  3K5N A;  1T5X D;  4DAY A;  2A5H A;  3HOV G;  3S14 B;  2JA6 H;  3P1H A;  3D3R A;  1MBY A;  1PMR A;  2JA8 B;  5LMN Q;  3AYH B;  2ZTE A;  1CKM A;  4TQU S;  3NWS A;  1Z9F A;  3MEF A;  4UAI A;  4P74 A;  3OTO Q;  1HTP A;  3E3X A;  3SK8 A;  1G6Z A;  2MNA A;  4K0K L;  1T5E A;  3CQZ B;  3M4O B;  3CF5 A;  1IL8 A;  3HOW G;  3CC2 A;  4LF4 Q;  1JE5 A;  3TS0 A;  1EQT A;  1IBK L;  1LTA D;  3KJP A;  5E1F A;  1K8G A;  2RDG A;  1PH6 A;  1L1O C;  2K75 A;  1KDC A;  4RAU C;  2D2C C;  1EIH A;  3MXP A;  3M9B A;  1XMO L;  1HZB A;  3I4N H;  3S15 B;  4NP5 A;  1Y8P B;  3CCU A;  4LFA Q;  1WYD A;  1HZA A;  5J3B A;  2KHJ A;  1WTX A;  1TWH H;  1WI5 A;  5IGD A;  1G2T A;  2Z0S A;  2PPB C;  4K14 A;  1D5M C;  4MNO A;  4LF9 L;  3TN2 A;  1S5E D;  1RTN A;  2PW7 A;  1C8C A;  4DNT B;  3TQY A;  3SGI A;  2UXD L;  2E8G A;  2OCE A;  2EYF A;  4BBS H;  2A1A A;  3NEM A;  1M8A A;  2KCT A;  4PMW A;  2XTI A;  4K2K A;  5DEH A;  5C0X J;  3IFD A;  1IKL A;  2IPK D;  1YNN D;  4RWS C;  5D3I B;  3VYR A;  3QJY A;  3PUX A;  3HOU B;  3UDG A;  1PH4 A; 
#chains in the Genus database with same CATH homology
 4IJL A;  5C3E H;  1PA6 A;  3UDX A;  4DAY B;  1N34 Q;  2UUB L;  4IOA A;  2XGT A;  5M3M H;  4DR6 L;  1VQB A;  1SN8 A;  4X62 L;  4DK3 C;  1JJG A;  2EXD A;  1JB7 A;  4KHZ A;  4GLX A;  1IBM L;  1N32 L;  3PO2 H;  1SR3 A;  1X3F A;  2PI2 A;  3UE0 A;  2R7D A;  4A3I H;  2OQK A;  2IX0 A;  2B63 H;  3KF8 B;  3BJU A;  3GD7 A;  2YTV A;  5IYB G;  2JJQ A;  4A76 A;  1A63 A;  1R9T H;  3CW2 C;  3JAM i;  4DR4 L;  3S2D H;  3A5U A;  3ER0 A;  1VQA A;  1Q12 A;  2ID0 A;  3H15 A;  1C9O A;  5BR8 L;  2R93 G;  1UE1 A;  4JI7 Q;  3PF4 A;  3J81 j;  5GAH C;  2MFI A;  3JAM c;  1JT8 A;  1Q86 C;  1YJN A;  3GTM H;  2K4K A;  4YY3 Q;  1YIT A;  1QZH A;  2NVQ H;  1EQQ A;  4L5S A;  3J81 c;  1EYG A;  5IE8 A;  1YNX A;  3I4M G;  2UUC L;  3E9I A;  4BBR G;  5GAE C;  1SFO H;  2GVA A;  1IZ6 A;  4KI0 A;  1VQI A;  1CKN A;  3S1Q H;  4POF A;  5FLM H;  2AMC B;  2R92 H;  3HOU G;  1YVC A;  5M5Y H;  5LMU Q;  2HT1 A;  1IXR A;  1Y14 B;  2NN6 G;  1ASY A;  4EQ5 A;  3J7Z C;  3CCJ A;  4J15 A;  3CCQ A;  3KFU A;  1PYB A;  2MQH A;  2RHQ B;  3K7U C;  3AEV A;  1HNZ L;  4O0A A;  3I7F A;  5IYC G;  2N78 A;  3I4O A;  4FDB A;  2QGQ A;  4JI2 L;  4C3H H;  1V43 A;  1P16 A;  4LF7 Q;  1V9P A;  1KXL A;  3NBH B;  5M5W H;  1JJC B;  4A3B H;  3UE1 A;  4GLA C;  1PH2 A;  4GOP A;  3H3V H;  1YHA A;  3ULL A;  2LSS A;  1YJ9 A;  4A3G H;  2CWA A;  2ZTD A;  1U0L A;  4QGU A;  1LTL A;  1PFS A;  4GNX A;  4NXM Q;  2NN6 I;  4DUZ Q;  2VL6 A;  5H1S E;  2R6G A;  1J5E L;  5JJI A;  3GO5 A;  1XJV A;  1YBY A;  1VQ8 A;  3KF6 B;  2KHI A;  4LFC Q;  1EWI A;  4GKJ L;  1P8L A;  1N33 Q;  4DK6 C;  3NEL A;  5GRO A;  2A8V A;  3RR5 A;  2PQA B;  3KLW A;  1B70 B;  4JI4 Q;  2BH2 A;  3S24 A;  4LW1 A;  1A0I A;  2WB1 G;  4YWL A;  1PH1 A;  2I0Q A;  3TS2 A;  5C4J H;  2E5L Q;  2F52 A;  4PZ8 A;  3K80 C;  4B3T L;  4LF5 L;  5C44 G;  1TWG H;  4JI8 Q;  4BA2 I;  5GQO A;  2KEN A;  4L5R C;  5EAY A;  4JI5 Q;  2ATW A;  3JC6 6;  3L7Z C;  5FJ8 H;  3I55 A;  5LMN W;  2QEX A;  1X6O A;  3PO3 H;  4BXX G;  5ELO A;  1VS0 A;  4DV2 L;  1IL2 A;  2I5M X;  4BY1 G;  3G6E A;  1I50 H;  2VQE L;  4DV6 L;  4DR1 L;  3HOW H;  1XNQ Q;  2UU9 L;  1Q1E A;  3BZC A;  1K8A C;  1NJI C;  4DV5 Q;  1XNR L;  2Q2T A;  3PUY A;  3FKI H;  5E7N A;  4DV1 Q;  1OXT A;  2OTL A;  3F8T A;  4HIO A;  4X6A H;  3IRB A;  2BA0 A;  3RN5 A;  1E22 A;  3M3Y H;  3CCL A;  3H0G H;  3UDF A;  4YCV A;  3STB D;  2H5X A;  3CPW A;  3A74 A;  2EIF A;  3U4V A;  4LFC L;  1NE3 A;  5IWA L;  3T1H Q;  2Q2H A;  3L0O A;  4DUY L;  4JOI C;  1N33 L;  3CCV A;  4PG3 A;  3D0F A;  1W2B A;  4JV5 Q;  5LMN L;  4LFB Q;  5IYD G;  2OWO A;  4L5Q A;  2JA7 H;  2Y0S E;  3PUZ A;  2UXB Q;  1FVI A;  3S14 H;  1HR0 W;  2IT1 A;  3OTO L;  2E5L L;  3I4N G;  1A62 A;  1TWC H;  3GTQ H;  4LUZ A;  4A93 G;  4JI8 L;  1HNX L;  2ZJQ A;  4NXN L;  1Y1W G;  4A3F G;  2JA8 H;  1VQH A;  1SLJ A;  5HGQ A;  4OO1 G;  2JA9 A;  1N8R C;  4OXP A;  4DR5 Q;  2BA1 A;  4LF4 L;  3J80 i;  4B3R Q;  4R4Q A;  5JJL A;  4A75 A;  2OTJ A;  4X64 Q;  1KIX A;  1NMG A;  2ZM6 Q;  1XNQ L;  2KBN A;  3CP0 A;  1HH2 P;  2ZTC A;  2IHE A;  1QZG A;  2K5H A;  1UE5 A;  3CQZ H;  1K9M C;  3CC4 A;  4GN5 A;  3M4O H;  3KF6 A;  4QIW E;  3ULJ A;  3GTG H;  4DR3 L;  4JI1 L;  4A3L G;  3E0E A;  4XIG S;  3J80 c;  4A3J G;  1OXS C;  1PVO A;  4TVA B;  1Q8K A;  1S3O A;  4GOP C;  2PQA A;  1TWA H;  4DR2 L;  1U5K A;  4IPG A;  4DV4 L;  1E3P A;  1HNW Q;  2A19 A;  4GKK Q;  3CCS A;  3CMA A;  4X66 L;  4GNX C;  1S72 A;  3K8A A;  1HR0 L;  4JI3 Q;  4JI6 Q;  1HZ9 A;  4LFA L;  4OO1 I;  3KJO A;  3T1H L;  1RL2 A;  4OWX B;  1SRO A;  5M3F G;  3GDE A;  1VQP A;  3HOZ G;  1EIY B;  3J7A 5;  5IY0 A;  1KL9 A;  4OWW B;  4PZ7 A;  2UUA L;  3S15 H;  1GO3 E;  1I94 L;  4A3K G;  4HJ9 A;  1PH5 A;  1UEB A;  4NPS A;  5C3E G;  3GTJ H;  2F4V Q;  4Y52 H;  1WJJ A;  2C35 B;  5M3M G;  4YHH L;  1X56 A;  2JEA I;  3DM3 A;  1UWV A;  1VQ4 A;  2F3I A;  2KCM A;  4AYB G;  3ICE A;  2K52 A;  4LF8 Q;  2ES2 A;  1EIF A;  4Y7N H;  2R93 H;  1VQM A;  2JQO A;  4BY7 G;  1VCI A;  3CPF A;  4YCW A;  4APV A;  2ZM6 L;  3HOX G;  4A3E G;  4A3C G;  2N49 A;  1AH9 A;  4KHP Q;  1QVG A;  3U58 A;  1XPO A;  4YCU A;  3G4S A;  4LF6 Q;  1C0A A;  1O7I A;  1K0R A;  3I4M H;  2L15 A;  3B6Y A;  1YZ6 A;  4GLV B;  5HY6 A;  1N34 L;  4HJ7 A;  2YTY A;  3RLO A;  1LYL A;  3GTP H;  1N36 Q;  1X65 A;  3CME A;  1D8L A;  2WB1 E;  4AIM A;  4GKK L;  3G71 A;  4JI3 L;  5IP9 H;  3HOU H;  4IFD G;  1NTG A;  1GKH A;  4DV7 Q;  1EOV A;  1NBW A;  1PH3 A;  4JBJ A;  2NZH A;  3HFZ B;  2ZJR A;  3PIP A;  3CCR A;  2CQO A;  1MJC A;  2R7Z H;  4GN4 B;  5IYC H;  4BA1 I;  1WCM G;  1T9H A;  4IO9 A;  4DR7 Q;  2ALY B;  4JG2 A;  4R4C A;  2UXC Q;  1EFW A;  3PSI A;  4ME3 A;  4DV3 Q;  3KYH C;  4JI7 L;  4DPG A;  4RMF A;  1KRS A;  1Q82 C;  3CC7 A;  1FJG Q;  2JE6 I;  3EBE A;  1FGU A;  4YY3 L;  3AFP A;  1FL0 A;  1VQ5 A;  2ASB A;  1G51 A;  4K0K Q;  5M5X H;  2JA5 G;  3U4Z A;  1VQJ A;  3E9H A;  4IFD I;  4HID A;  1VQE A;  3KOJ A;  4UP8 A;  3S16 H;  3S17 H;  3HOV H;  1K3R A;  2Q2U A;  1Q1B A;  1QUQ B;  5GAG C;  3CCM A;  1K73 C;  1LM0 A;  2Z6K A;  2VW9 A;  1IBK Q;  3HOY G;  3M85 A;  1X9N A;  1JMC A;  2IX1 A;  4NB3 A;  3I56 A;  5LMU L;  1QVC A;  1NY4 A;  2NZO A;  3A5Z B;  3TRE A;  5IP7 G;  2QA4 A;  1J6Q A;  1XMO Q;  1I3Q H;  2VY3 A;  2WP8 J;  4R1J A;  1Y1V G;  2RCN A;  4A4I A;  4DV7 L;  5C44 H;  4B3S Q;  2JA6 G;  1AE2 A;  2PI2 E;  3G48 A;  2ZJP A;  2E2I H;  4IPC A;  2HHH Q;  1PH8 A;  5JEA G;  4WJ4 A;  2B29 A;  1OTC A;  4BXX H;  5IT9 c;  2LXJ A;  3T1Y Q;  4LF7 L;  4DR7 L;  4P75 A;  3PV0 A;  3PIO A;  3CCE A;  1SE8 A;  1VQ7 A;  2PNH A;  4LF9 Q;  3GTL H;  1VQ9 A;  1YEZ A;  4POG A;  5FJ8 G;  2CCZ A;  4NXM L;  4DUZ L;  3RLN A;  2UXD Q;  3PUW A;  2VS1 A;  1KAW A;  3PUV A;  4JI0 Q;  2K14 A;  3MXN B;  5FLX c;  4DKA C;  4IJH A;  2PMZ E;  1L1O B;  3UDI A;  2HQL A;  2FXQ A;  4MTN A;  3W5O A;  1BBU A;  3FKI G;  4AQY Q;  1PHJ A;  1KD1 C;  4JI4 L;  3HKZ G;  2DGY A;  1VQO A;  5C4X G;  4MZ9 A;  1YHQ A;  1XMQ Q;  5IYD H;  1A8V A;  4LNQ A;  2CFM A;  3AQQ A;  1IBL Q;  4JI5 L;  1JJ2 A;  3F1Z A;  2NVT H;  4DR6 Q;  4AYB E;  4A93 H;  4A3D G;  4X62 Q;  1M90 C;  3BU2 A;  4PZ6 A;  1X3E A;  4UP7 A;  1Y1W H;  1SMX A;  3EIV A;  4A3F H;  1X54 A;  1N32 Q;  4GS3 A;  2HIV A;  2BH8 A;  4RG1 A;  1VQL A;  4DV5 L;  1GVP A;  4GN3 B;  4KLK A;  1KHI A;  2AWO A;  4DV1 L;  1PH9 A;  4X65 Q;  3S1N H;  4A3M G;  2K5N A;  1UE6 A;  1V1Q A;  4DR4 Q;  2JEB I;  3ERS X;  1YI2 A;  4JBW A;  4BBS G;  4UP9 A;  4DV0 Q;  4IFD J;  1QUQ A;  2MO0 A;  3CXC A;  3OYY A;  4A3L H;  5BR8 Q;  4A3J H;  4QQB X;  3CAM A;  4WJ3 M;  2VUM G;  4AH6 A;  2WAQ G;  1CUK A;  5JJK A;  1PYS B;  1G6P A;  2NVX H;  1VQ6 A;  3PCO B;  2AWN A;  1EQR A;  1RIP A;  2D0O A;  2K5V A;  4JBM A;  4JV5 L;  3BZK A;  2GVB A;  4LFB L;  5M3F H;  3M4Q A;  3HOZ H;  2N8N A;  2UXB L;  4P71 A;  1N9W A;  2UUC Q;  5IYB H;  1BBW A;  1E1O A;  2LXK A;  2Z6K C;  1IYJ B;  3EN2 A;  4HIK A;  3KDF A;  4A3K H;  1Q46 A;  2E2J H;  2N3S A;  3S2H H;  1YJW A;  1GM5 A;  3M7N A;  4IOC A;  3PO2 G;  5DLQ E;  3HKS A;  1G29 1;  4OON A;  2Q2I A;  1B7Y B;  4LUV A;  4DR5 L;  4A3I G;  1H95 A;  4B3R L;  1Q81 C;  2B63 G;  3ZJY C;  4X64 L;  1L0W A;  4JCV E;  2B3G A;  3WWV A;  4HJ5 A;  1HNZ Q;  3ULP A;  1WFQ A;  3PF5 A;  2Y0S G;  4BY7 H;  4JYA Q;  3Q8D A;  1KRT A;  1E1T A;  3K7A H;  4X65 L;  5AJ3 Q;  2IHF A;  3HOX H;  4A3E H;  4BBR H;  1VQK A;  2YU9 H;  4A3C H;  4JI2 Q;  1L1O A;  4B3M Q;  1SRU A;  4XTC S;  3K81 C;  4DV0 L;  1XPR A;  1Q7Y C;  1I6H H;  3J81 i;  1HNW L;  4QY7 A;  3FP9 A;  3S1M H;  4JI6 L;  2K50 A;  4L5T A;  1WOC A;  4OX9 Q;  2RF4 A;  1BKB A;  1PV4 A;  1VQN A;  5JEA J;  4YWM A;  3L2P A;  3DLL A;  1KC8 C;  1Z47 A;  1J5E Q;  4JOI A;  3CD6 A;  4GKJ Q;  1CKO A;  4HJA A;  1CSQ A;  5C0X G;  2F4V L;  3RNU A;  2HIX A;  4DAM A;  3I2Z A;  1UE7 A;  3PGZ A;  1XPU A;  5FLM G;  1OXV A;  2R92 G;  1IBL L;  1WCM H;  1EUJ A;  2V1C C;  4LF8 L;  4QJF A;  5IP9 G;  2JK8 A;  4JC0 A;  4DNI A;  4B3T Q;  4O2D A;  4LF5 Q;  2NVY H;  1D7Q A;  1LUZ A;  3RN2 A;  5ELN A;  3VDY A;  4QL5 A;  2VQF Q;  2I5L X;  2R7Z G;  3OW2 A;  4KHP L;  1OXX K;  2JA5 H;  4DV2 Q;  4JYA L;  5AJ3 L;  4LF6 L;  1MJE A;  2D62 A;  2VQE Q;  4DV6 Q;  4DR1 Q;  4C2M H;  2UU9 Q;  2CKZ B;  1QVF A;  4A3B G;  5C0X I;  4B3M L;  1YIJ A;  1XNR Q;  3HKZ E;  1N36 L;  3HOY H;  2D0P A;  3F2C A;  3S1R H;  4A3G G;  1VQC A;  4R4O A;  4R4T A;  1VQD A;  3FHW A;  1NMF A;  4OX9 L;  4H02 A;  5K36 G;  1E7Z A;  4HJ8 A;  2E2H H;  5IP7 H;  1OXU A;  1AE3 A;  3HOV G;  2CWP A;  1Y1V H;  3KDF B;  1XTD A;  2JA6 H;  5IWA Q;  4DUY Q;  1BVS A;  4BY1 H;  1I5F A;  5LMN Q;  2UXC L;  3RZD H;  4DV3 L;  1L2F A;  3AYH B;  2ZTE A;  1CKM A;  1HZC A;  3D31 A;  1ASZ A;  4TQU S;  4C3J H;  3H3V I;  1Z9F A;  2MO1 A;  3MEF A;  1FJG L;  4P73 A;  4P74 A;  3OTO Q;  1MKH A;  1VQF A;  1HNX Q;  2MNA A;  3PO3 G;  4NXN Q;  4K0K L;  1HJP A;  2EQS A;  2VQF L;  1K83 H;  3CF5 A;  3HOW G;  4LUO A;  3CC2 A;  4LF4 Q;  1JE5 A;  2WAQ E;  3STB C;  1TXY A;  3TS0 A;  4UY8 C;  2IY5 B;  3GTO H;  3TRZ A;  1IBK L;  4LWC A;  3KJP A;  3RLF A;  1K8G A;  3A0J A;  2WFW A;  1MIU A;  3H0G G;  4EX5 A;  1PH6 A;  1L1O C;  2K75 A;  2VNU D;  4IPD A;  1W3S A;  4DR3 Q;  5C4X H;  4JI1 Q;  3F2D A;  2AHO B;  3M9B A;  1M1K C;  1XMO L;  4P72 A;  1VQG A;  1HZB A;  2YTX A;  4IPH A;  2UUB Q;  4B3S L;  3I4N H;  4DR2 Q;  3RZO H;  4DV4 Q;  1YHB A;  4UPA A;  2GN5 A;  3W1G A;  3CCU A;  4LFA Q;  2R7F A;  1WYD A;  4X66 Q;  1HZA A;  1HR0 Q;  1IBM Q;  1PH7 A;  2HHH L;  5J3B A;  4A3D H;  1E24 A;  2KHJ A;  4C3I H;  1TWH H;  2JA7 G;  1CKN B;  1WI5 A;  3M4P A;  3T1Y L;  2Z0S A;  4HIM A;  2UUA Q;  2OQ0 A;  3U50 C;  1B8A A;  2AKW B;  4MNO A;  3TEH B;  3W1B A;  1I94 Q;  4LF9 L;  4BBS H;  3AFQ A;  4YWK A;  2JA8 G;  3NEN A;  1GD7 A;  1TWF H;  4A3M H;  1X55 A;  3LGJ A;  1C7Y A;  3TQY A;  3SGI A;  4YHH Q;  2UXD L;  2E8G A;  2OCE A;  3K0X A;  2DUD A;  2A1A A;  4JBK A;  2I5H A;  2YYZ A;  2YV5 A;  3NEM A;  2KCT A;  4PMW A;  4JI0 L;  2XTI A;  3GTK H;  1DGS A;  4OWT B;  5C0X J;  2RHS B;  2VUM H;  1CSP A;  4AQY L;  5GAD C;  4R4I A;  4GOP B;  4ALP A;  3PUX A;  1XMQ L;  2VZA A;  1KQS A;  1X3G A;  3UDG A;  3F2B A;  1PH4 A;  4GNX B;  1S40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...