1AE3A

Mutant r82c of gene v protein (single-stranded dna binding protein)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
86
structure length
86
Chain Sequence
b'MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLCLVPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE V PROTEIN
publication title Analyses of the stability and function of three surface mutants (R82C, K69H, and L32R) of the gene V protein from Ff phage by X-ray crystallography.
pubmed rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 11
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ae3A00
3HOVG 1SRUA 4KHZA 4NPSA 4DV0Q 1OTCA 1VQAA 1NJIC 2MO1A 4BBRG 2L15A 3L7ZC 1J5EQ 1A62A 2CWAA 3I4OA 3HOUH 4A3FH 3HKZG 1V43A 2K52A 4DR2L 1Q12A 2AMCB 2H5XA 4L5RC 4YY3Q 4JI7Q 2A19A 1PH1A 2R7ZG 1E1TA 4K0KQ 5IYCH 3I56A 4BXXG 2YU9H 4IOCA 3GDEA 1BBUA 1VQEA 4JI1L 3UE0A 3G6EA 3M85A 1YJNA 2B63G 2VS1A 5M5YH 3MXNB 4DR2Q 1BKBA 2VQFL 4PZ7A 2KHIA 2HHHL 2RHQB 4GLXA 3J80c 3K0XA 2BH2A 1EUJA 1KQSA 4GNXB 3ERSX 3GTJH 1GVPA 2NVXH 1KRTA 1YEZA 2JK8A 5IYBH 3NEMA 4OX9L 4DV2L 3I4MG 2OQKA 4P75A 5JEAG 3PIOA 1PH8A 2AHOB 4Y52H 4JI1Q 1OXXK 3GTQH 1P16A 4IPGA 1VQKA 3ER0A 1Y1VH 4GN5A 5EAYA 3J81j 3H0GH 1WJJA 4R4OA 2VQFQ 2OWOA 1E7ZA 1X6OA 2ZTEA 3NELA 2HHHQ 4UY8C 2HIVA 3F1ZA 4UP8A 1FVIA 3PUVA 1HR0L 1I3QH 4DV7L 4DR3L 1VQCA 4OX9Q 1HNXL 4DV2Q 1EIFA 4ALPA 4JOIA 5JJKA 1BBWA 5C4XH 1K8GA 4IFDI 1W3SA 1I6HH 4DV6L 1B70B 1X55A 1EOVA 3B6YA 4LNQA 3PSIA 1MJCA 2Z6KC 1L2FA 2CCZA 3PV0A 4OWWB 4DV3L 1VS0A 1SR3A 1GO3E 1Q86C 4A3MH 1HR0Q 4LF7L 4DV7Q 1HZCA 3W1BA 4DR3Q 3TRZA 5IT9c 1HNXQ 4C3JH 3HOZG 3STBC 2Q2UA 2JEBI 3PUYA 3RN2A 1UE7A 1XNQL 1CKNA 1EFWA 4DV6Q 2WB1E 4GOPB 4A3IG 1G291 2A1AA 3M3YH 2KCMA 4PMWA 3UE1A 4DR7L 4DV3Q 1QVGA 3KLWA 4PG3A 4BBSH 1EWIA 4OO1G 2PQAB 5M3FG 4LF7Q 1PV4A 1TWFH 5LMUL 1QZHA 3S1NH 4YWLA 1VQLA 1XNQQ 1E22A 4DV5L 4B3RL 1K9MC 5FLMH 3TQYA 1VQBA 1FGUA 2Z0SA 2E2JH 2BH8A 1OXTA 4X62L 1IBKL 4DR7Q 2MO0A 4ME3A 4A3JH 4JC0A 1WFQA 3T1HL 1HR0W 2ZJQA 2NVYH 2NVTH 4QL5A 4B3TQ 4L5QA 2ID0A 4L5SA 5LMUQ 1L0WA 3CCLA 4DV5Q 4B3RQ 3KDFB 2UUCL 1JE5A 2MQHA 3S16H 1Q82C 1KIXA 1AE2A 2VL6A 1E3PA 3NENA 4X62Q 1IBKQ 4PZ8A 4DPGA 1YNXA 4TVAB 3CPWA 1UWVA 3AFQA 4A3KG 3T1HQ 4JI4L 1Q46A 2N78A 2R7FA 2NZOA 4LFCL 2UXDL 3K81C 4R4QA 3DLLA 2E5LL 2PI2E 5IY0A 1RIPA 4JI8L 2YV5A 1HJPA 1I50H 5M5WH 2JA8H 2DGYA 2UUCQ 4A93H 1IYJB 2JQOA 2KBNA 3FKIH 3J81c 1C9OA 2ATWA 4LF4Q 3AEVA 1U5KA 1VQJA 4JI4Q 1XPOA 4A4IA 4BY7H 4LFCQ 2UXDQ 5J3BA 1PH4A 2E5LQ 4A3EG 3KFUA 4JI8Q 1NMGA 1S72A 3AQQA 3EN2A 1FJGL 2KHJA 2JEAI 2IHEA 4LUZA 1SN8A 3I7FA 4O0AA 4A3FG 2KCTA 2B3GA 1U0LA 2BA1A 2N3SA 3JAMc 4A3GG 4GLVB 1EQQA 5BR8L 4JI5L 5JEAJ 4A3DH 4GNXA 2HIXA 4DNIA 4GS3A 2EXDA 5GAHC 5C3EH 2ZJPA 2JA5G 1YJ9A 1PYSB 4L5TA 1Q1EA 1VQGA 5IYCG 3CXCA 2FXQA 1Q1BA 2K4KA 2JA6G 1A63A 2GVBA 1T9HA 2RCNA 3PF4A 5M3MH 4KHPQ 4AQYL 5IYDH 1SROA 2B29A 1X54A 2ES2A 3CC4A 1XTDA 2IT1A 4R4IA 5BR8Q 3HOYH 5GADC 1XJVA 4JI5Q 3F2BA 2OTLA 3LGJA 3S2DH 1NMFA 3K80C 2UXBL 1G51A 2KENA 4GN4B 1PHJA 3G48A 4JYAL 4P73A 3W1GA 3KJOA 4OONA 2Q2TA 1SFOH 1XPUA 4IPHA 2I5MX 3PO3G 4JI2L 3KJPA 5C44G 4AQYQ 3GTOH 2LXKA 3I4NG 1S3OA 3VDYA 2YTXA 1Y1WH 1L1OB 4JI3L 4X64L 3CCVA 2D62A 4C2MH 3EIVA 4DAYB 4POGA 1VQ6A 1SE8A 3GTLH 4R4TA 4DUZL 2UXBQ 1XPRA 3RZOH 1PH7A 4JYAQ 3S1MH 5C0XJ 3HOVH 1Z47A 4HJAA 2GN5A 3J7ZC 3CCMA 4O2DA 4BY1G 4C3HH 4JI2Q 1BVSA 4BBRH 4GOPA 4HJ8A 2BA0A 2VW9A 1X56A 1VQ8A 2VUMH 2AKWB 3A5ZB 3E9HA 3ULJA 4X64Q 4HJ7A 1YITA 4JI3Q 2PQAA 1SLJA 4C3IH 1YZ6A 3PUZA 4DUZQ 4YWMA 5HY6A 3CC2A 5AJ3L 3ICEA 1Q81C 1KL9A 4A3CG 2AWNA 2VQEL 1XNRL 1D7QA 1V1QA 1VQHA 3A0JA 1SMXA 1CUKA 3J80i 4NXML 3HOWH 5IP7G 1VQ9A 4MNOA 4EX5A 5GAGC 2YTYA 4HIDA 2AWOA 2B63H 1JB7A 5K36G 3OTOL 2QA4A 1UE1A 2YYZA 3U50C 5AJ3Q 4JV5L 1VQ7A 1CKOA 5E7NA 3KDFA 1G6PA 2VQEQ 2UUBL 1HH2P 2MFIA 1D8LA 1IL2A 1TWGH 2D0OA 2XGTA 4JBJA 3RZDH 3K7UC 1E24A 5C0XG 2F3IA 4NXMQ 2NN6I 4IPCA 4TQUS 1GM5A 1V9PA 2Q2IA 3BJUA 4X66L 3OTOQ 1VQ4A 4YCWA 3TS0A 1VQIA 4JV5Q 4LF8L 1OXUA 1A8VA 4POFA 1PVOA 3FP9A 2Y0SE 2K50A 1EQRA 1N8RC 1KD1C 2UUBQ 2F4VL 3CC7A 4HJ9A 2WB1G 3D31A 4LUVA 1N33L 2JA7H 3D0FA 4FDBA 3M7NA 3M4PA 2XTIA 3CQZH 3RLFA 1C7YA 3G4SA 2WFWA 4X66Q 1FL0A 1A0IA 2CFMA 4YWKA 3K7AH 1N9WA 2K5VA 3U4VA 3HOXH 1VQDA 4GN3B 2CWPA 4DK6C 3CCEA 3CCSA 3NBHB 4DAMA 2UUAL 4LF8Q 3M9BA 3GTKH 2Y0SG 4IFDJ 2JA8G 2F4VQ 2R92G 3HOZH 3RR5A 5GAEC 3L2PA 3FKIG 1N33Q 2EIFA 4DV1L 1LYLA 3H15A 3PUXA 2V1CC 4JBKA 2ZM6L 4RG1A 1C0AA 1HNZL 1K73C 3UDGA 4A3IH 4JOIC 1WCMH 4YHHL 3M4QA 4BY7G 2R93H 1YHQA 1JMCA 2VY3A 2E2HH 3PO2H 2E8GA 3Q8DA 5M3FH 2UUAQ 2RHSB 1JJGA 3TREA 3CPFA 4XTCS 4HIMA 3S1RH 1UE6A 1UE5A 4DV1Q 4BA2I 1TXYA 2ZM6Q 4JCVE 1HNZQ 2VNUD 1CSPA 2CKZB 1E1OA 4A3BH 4YHHQ 2JA9A 3UDFA 4A3DG 1VQMA 1GKHA 4UP7A 5C3EG 4IOAA 2LXJA 1Q7YC 1DGSA 4QIWE 3S2HH 1VCIA 1N36L 1JJCB 4IFDG 3HOUG 5ELNA 4LF5L 3OW2A 1ASZA 3J7A5 1L1OA 3CCRA 1PFSA 2K75A 3HOYG 1WI5A 4APVA 1EIYB 1Q8KA 3TEHB 5IE8A 4A3LH 1VQFA 3S17H 2N49A 4IJLA 1X9NA 1I94L 1FJGQ 4LFBL 3PO3H 1PH6A 2UU9L 1IXRA 2WAQE 1N36Q 1N34L 4LF5Q 1VQPA 4BA1I 3H3VH 2NN6G 1HZAA 4WJ3M 2IX1A 2ZTDA 5H1SE 4X65L 5FJ8H 1Z9FA 1TWAH 1LTLA 4DR4L 4PZ6A 2K5NA 1LM0A 1TWCH 1PH5A 4JI0L 5JJLA 1NBWA 5IP9H 1PH2A 5IYBG 4OO1I 4JI6L 3DM3A 1I94Q 1VQ5A 4KI0A 1M1KC 2Z6KA 3JAMi 4LFBQ 2UU9Q 2WAQG 2CQOA 4A3EH 3A74A 3BZKA 3OYYA 4HIOA 3T1YL 1N34Q 1CSQA 3F2CA 1K8AC 1VQNA 1Y1VG 2IX0A 3H0GG 4MZ9A 3CAMA 1WYDA 2R7DA 5FLXc 2VUMG 4X65Q 4QJFA 3PF5A 1R9TH 1CKMA 4A3GH 4DR4Q 3ZJYC 4GKKL 5DLQE 1HNWL 1QUQB 2VZAA 4AH6A 4JI0Q 5C4JH 1YHAA 4JI6Q 4DV4L 4A75A 2IY5B 1NY4A 2NZHA 2JA5H 5C4XG 3AYHB 4B3ML 2F52A 3CCQA 3UDIA 1JT8A 3T1YQ 2EQSA 2MNAA 2JE6I 2JA6H 1AH9A 3JC66 3HOWG 3IRBA 4RMFA 2HQLA 1X3GA 3E9IA 3KF6B 2ASBA 3CMEA 1K0RA 1IBML 1HNWQ 3KF8B 3RN5A 4GKKQ 4DK3C 4JBWA 3EBEA 4A3MG 3GTGH 3GTPH 2R7ZH 4AYBE 5GROA 4DV4Q 4HJ5A 4DR6L 3PGZA 4BXXH 4B3MQ 4IJHA 1L1OC 4NB3A 4GNXC 3H3VI 1Y14B 2RF4A 4DR1L 1MJEA 4OWTB 2E2IH 1K83H 5IWAL 1W2BA 5C44H 4DUYL 1TWHH 3F2DA 3CCJA 1IBMQ 1PA6A 3HKSA 3I4NH 4BBSG 1MIUA 4A76A 3TS2A 1LUZA 1I5FA 2PNHA 1J6QA 3GO5A 4AYBG 4DR6Q 1XNRQ 3FHWA 3L0OA 2QEXA 3CW2C 2Q2HA 2QGQA 4P72A 5FLMG 2GVAA 3I4MH 1VQOA 4NXNL 4OXPA 4DR1Q 1XMQL 2JA7G 4BY1H 1X3FA 5IWAQ 2JJQA 3PCOB 4DUYQ 4A3JG 2K14A 1YIJA 3HFZB 4OWXB 1ASYA 1UEBA 4EQ5A 3I2ZA 3HOXG 4B3SL 1PH9A 3UDXA 4IO9A 4LF9L 2OQ0A 2OCEA 4H02A 1B7YB 1B8AA 1YJWA 4IPDA 4A3CH 3PUWA 3BU2A 4KLKA 4NXNQ 2HT1A 3KYHC 1N32L 1XMQQ 3RLNA 5HGQA 1X3EA 5LMNL 4JG2A 3F8TA 5IP7H 4DR5L 1XMOL 2NVQH 1WCMG 3W5OA 1AE3A 3U58A 4B3SQ 3PO2G 2ALYB 5ELOA 2LSSA 4GOPC 2R93G 1NE3A 4LF9Q 4QY7A 1OXVA 4YCUA 2R6GA 3M4OH 4GKJL 3STBD 4A93G 4B3TL 2YTVA 4DKAC 4MTNA 5GQOA 1KRSA 3CF5A 2DUDA 1N32Q 3MEFA 4UP9A 3RNUA 2PMZE 5LMNQ 3E0EA 4XIGS 4DR5Q 1XMOQ 4A3BG 4JBMA 1EYGA 1QVCA 1IBLL 1WOCA 4P71A 1NTGA 1KHIA 3U4ZA 1PH3A 4GKJQ 1K3RA 3G71A 2C35B 2K5HA 1H95A 1P8LA 4X6AH 1CKNB 1QZGA 4LWCA 1KXLA 4QGUA 1MKHA 1JJ2A 4LF6L 1PYBA 2D0PA 4LF4L 4LUOA 1YI2A 4YCVA 1M90C 3AFPA 4HIKA 1IBLQ 4LFAL 4A3LG 3GD7A 4AIMA 4GLAC 2N8NA 1QVFA 2I0QA 5M3MG 2PI2A 3KOJA 4UPAA 3CMAA 4LW1A 5IYDG 2R92H 1IZ6A 3GTMH 3ULLA 3BZCA 1YBYA 2WP8J 5LMNW 2I5HA 1KAWA 4LF6Q 2UXCL 4R1JA 2IHFA 1S40A 1GD7A 3RLOA 5FJ8G 4Y7NH 3I55A 4A3KH 3S15H 1QUQA 1YHBA 4QQBX 3CCUA 1OXSC 3J81i 4WJ4A 4LFAQ 1YVCA 4J15A 2I5LX 5IP9G 3S24A 3K8AA 4DV0L 3CD6A 1X65A 3S1QH 5M5XH 4R4CA 3WWVA 3SGIA 5JJIA 2ZJRA 3CP0A 1J5EL 3KF6A 2OTJA 1RL2A 5C0XI 1Y1WG 2UXCQ 3HKZE 4KHPL 3S14H 1HZBA 2ZTCA 3PIPA 1HZ9A 4P74A 1KC8C 2A8VA 4YY3L 4JI7L 3ULPA 1O7IA 3A5UA 4K0KL
chains in the Genus database with same CATH superfamily
1BXTA 2F0MA 4C3HG 5C3EB 2MO1A 2B2VC 3DXJC 2DY8A 2RBMA 3HOUH 1V43A 1A15A 4XT1B 2AMCB 4C3IG 3KLRA 4YY3Q 4U673 4RGTA 1PMRA 3H3VC 2YU9H 4IOCA 1RTOA 2J4XA 2NUCA 5A2QL 4QIWB 3GDEA 3G6EA 2B63G 1YJNA 4DR2Q 5DM73 1JOKA 3D4WA 4GLXA 3BVGA 4ZKCB 2BH2A 1EQTA 3K5OA 1KQSA 2NVXH 1BBXC 3QO2A 1BUVT 2J7ZA 4IN3A 3PIOA 2N55A 1PH8A 4JI1Q 3J7AV 1VQKA 4KN4C 1HA5A 2WAQB 1Y1VH 2VQFQ 1E7ZA 1X6OA 2ZTEA 3NELA 1L0YB 5D65A 4DR3L 3OWEB 3LX0A 1EY4A 1I3QB 1EIFA 1PRTF 1MHWC 2D2CC 2LS01 2NZ1D 4OGQC 4ZCKA 4IFDI 2XRSD 5JVG3 4DV6L 1X55A 4I7AA 1I6HB 1FNUA 2CCZA 1E0BA 3QOJA 3STBC 2F3VA 1XNQL 2PZUA 3OW7A 1QJOA 2F0JA 5LL6S 4PMWA 1JB3A 4DR7L 4DV3Q 2QCPX 3KLWA 4PG3A 5DAUA 1EWIA 4LF7Q 3OSOA 1TWFH 2EYLA 5LMUL 5IGEA 1QZHA 2EXZA 3RMHA 1E22A 5FLMH 1VQBA 1FGUA 1EWHA 1RHPA 3HRZC 1VMCA 5CORA 2Q8TA 1WTWA 1HR0W 2H1EA 3FPUB 4B3TQ 1L0WA 3C1FA 3CCLA 5ELCA 1QE6A 1Q82C 4KTAA 1GUGA 2VL6A 3NENA 3S16B 1LTTD 4JI4L 2FHTA 3QWNA 2UXDL 1MGSA 1HCZA 4CDCC 3DLLA 1X3QA 2R93B 3PO2B 4KKSA 2UUCQ 1IYJB 2KBNA 3A55A 3OWFA 1TY2A 4BY7H 3WDNA 2A74C 4PMCA 5BN5A 1SYEA 3I4LA 2K1BA 3RD4A 4A3EG 3ITPA 1FGBD 2HDMA 3I7FA 4O0AA 3SVMA 4A3FG 5IODA 5E1FA 2B3GA 3CHBD 1Q8IA 1V8QA 4GLVB 1EWCA 4JI5L 5JEAJ 4GNXA 5C3EH 2IW3A 2Z4HA 2Z9HA 5GAHC 3K5NA 2EJMA 2CW0D 3I3CA 3SHLA 2KEDA 2A6HC 5DEHA 3CKIB 5M3MH 4KHPQ 5IGCA 3NBIA 5IYDH 2HD3A 3IAYA 1Y8OB 1X54A 5BR8Q 1B53A 1XJVA 3F2BA 2NBFA 3K80C 3KBXA 2PW7A 1PHJA 3G48A 4JYAL 1H9SB 2A6HD 3QOLA 3KJOA 2WACA 1YNNC 1JWSD 2KHSA 1EY0A 1JWMD 3TZDA 1SFOB 3IFDA 1L1OB 1HTLD 2D62A 3EIVA 3M4YA 5DNFA 1Y1WB 4R4TA 1X3PA 1XPRA 5EPLA 1HTPA 1YNND 3HOVH 3GTLB 2GN5A 1PTOB 2EVBA 2O5JC 4HJ8A 1DJRD 4C3HB 1X56A 3NTKA 1VQ8A 1D5ZC 1ESRA 3P7JA 4HJ7A 1I4HA 1YZ6A 4DUZQ 3CC2A 4C3IB 1Q81C 2AWNA 1XNRL 1STGA 4OL7A 2X69A 5GAGC 2YTYA 2RDFA 1SE2A 4DAPA 5K36G 4TSSA 2CH4A 4CKEA 2QA4A 2B63B 5AJ3Q 1WTHA 2VQEQ 4G7HC 2XGTA 1E24A 1BDOA 2F3IA 2NN6I 1TWGB 3T53B 2Q2IA 3BJUA 1JR0D 1OXUA 1PVOA 3BG3A 4H44C 2B2YA 5KIXA 4OIJA 5EKKA 2P5ZX 3RLFA 1C7YA 2NB0A 1STEA 4YWKA 5COYA 4LF8Q 3DUZA 5CV6A 5KYLA 3I73A 2F4VQ 2PNRC 1EU3A 2L1BA 3A7LA 3L2PA 1N33Q 2PQEA 4DV1L 1HNZL 1K73C 3DEOA 4A3IH 2R93H 1HQRD 3PO2H 4UHVA 4OO1H 2UUAQ 4G4KA 1LTGD 4HIMA 1SYFA 1D5MC 1TKWB 4JCVE 2OXPA 2M9VA 2Z1CA 4F87A 1IYUA 4K14A 3U9SA 1E1OA 2JA9A 3UDFA 1ZYRC 1VQMA 1GKHA 4UP7A 1SE4A 5BN4A 1DGSA 3S2HB 1WD1A 3HOUG 5ELNA 5E3FA 1DD2A 1ZYRD 3HEJA 3QG1A 1JQYD 1PFSA 3S17H 2N49A 1PZKD 1X9NA 1SMYC 2L11A 3VA7A 5E4XA 2HCIA 4LF5Q 4CGYB 1GUNA 1SNQA 5FO9B 2K5NA 1UAPA 1LM0A 1TWCH 1ZEQX 1SSOA 4JI0L 1NBWA 1TWAB 1SMYD 4JI6L 1I94Q 4KI0A 2RKSA 3E6ZX 2UU9Q 2K03A 1N34Q 1VQNA 3AB9A 1K8AC 3F2CA 1Y1VG 2IX0A 4A3EB 4MZ9A 1VF5C 5FLXc 1HNWL 5EPJA 3ZJYC 3E3XA 4DR4Q 1AN8A 4A3FB 2VZAA 1U9RA 1PTOH 1YHAA 2IY5B 1NY4A 2JA5H 3UDIA 4OIKA 2JE6I 2JA6H 3OOCA 1EFID 3SE0A 1ENAA 2QKIC 1X3GA 3E9IA 4CDEC 2ASBA 3CMEA 4K2LA 1IBML 1U4PA 4GKKQ 4DK3C 4IUNA 3GTGH 5FLXE 4AYBE 2VB2X 4DV4Q 4DR6L 3PGZA 4IJHA 1L1OC 4K8IA 2RF4A 5IWAL 4DUYL 3I4NH 2F0WA 2E2IB 2B8FA 2C5CA 3CU7A 4AYBG 3A8IE 4CDFC 1XNRQ 2SOBA 1RJTA 4P72A 1A6XA 1MSHA 2QGQA 5CV8A 5FLMG 1T5EA 4NXNL 4J1MA 4OXPA 3TZUA 4EQNA 5KRUA 4O1NA 2JA7G 1YIJA 1PTOD 1D1IA 1CTMA 2KVMA 3BVZA 4OWXB 4EQ5A 4TKOB 3UDXA 4KHVA 5ELFA 4ZRZA 2OQ0A 2Z4IA 4H02A 1HQMC 1YJWA 3BU2A 1N32L 4JG2A 1XMOL 4DXGA 1AE3A 4PQXA 1CHPD 2EY5A 4LF9Q 1IKMA 3I72A 2PZTA 1BF4A 2FMCA 2BDNA 2HQEA 4CHTB 5C0XH 3RNUA 2PMZE 4XIGS 4A3BG 1PH3A 1LTSD 5KNCA 4XDXA 2RQXA 2C35B 2NVTB 4M1UB 4X6AH 1CKNB 1QZGA 4WORA 1YNJD 4ZKBB 1O7YA 4DNRB 4LUOA 4HIKA 1DM0B 1EEID 1A2TA 4A3LG 1V1PA 4K2KA 2F3WA 2WIIB 4X3TA 5M3MG 2PI2A 4CJ0B 5IYDG 4KD4A 2R92H 1IZ6A 1YBYA 5LMNW 4ODGA 5M5WB 1GD7A 3S15H 5FJ8G 1PRTC 1OXSC 3A7AB 3J81i 4WJ4A 5FKAC 5EGTA 2EYPA 3S24A 2PZWA 1WTOA 3SGIA 2O2LD 3CP0A 2IX3A 5M5XB 4ZYSA 2UXCQ 3OPOA 3C46A 1HZBA 1RCVD 1RODA 2ZTCA 3PIPA 4YY3L 3S14B 1O7IA 3HOVG 5I2YA 1VQAA 3ZYYX 5C5MA 3L7ZC 4DK1A 2ENBA 4A3FH 3MA2B 4DR2L 1NSNS 1FYCA 2H5XA 3HOUB 3NQTA 4JI7Q 1PH1A 1LO5D 2R7ZG 1E1TA 2SNSA 1TQOA 1STHA 4JI1L 1VQEA 2YU9B 1B9NA 3N6RA 1MD2D 2KOLA 2VQFL 4PZ7A 3SDZA 1AZPA 2RHQB 3K0XA 1YEZA 5IYBH 3NEMA 2C9OA 3I4MG 4K5WA 1BO0A 4MIUA 4P75A 5JEAG 2AHOB 4UDUC 4CBVA 4IPGA 4KK7A 2RDHA 3J81j 1Y1VB 4UY8C 1ENFA 1I4PA 2MGSA 4OX9Q 1ICWA 1CQVA 3TP7A 1BBWA 1K8GA 4LK1C 1MJCA 4DV3L 1VS0A 4A3MH 4ZK9B 1LABA 4LF7L 3W1BA 1TT2A 5FK9C 1B3AA 4C3JH 2Q2UA 2LY7A 2RDGA 3PUYA 1UE7A 1G91A 1S5FD 1EFWA 1STNA 4GOPB 4A3IG 2TMPA 4V190 2KCMA 4OO1G 4PNYA 1IKLA 3DWQA 3NHHA 4AYBB 4P2CB 2E2JH 3MAQA 4X3UA 1OXTA 1WFQA 2JA7B 3MTSA 1TIID 2ZJQA 2NVYH 2NVTH 4IZ8A 4L5SA 2ID0A 4Z9CB 2UUCL 1CK1A 3TP6A 3GTKB 1KAAA 3MEHA 2F0FA 2DN8A 2QEJC 4DPGA 4TVAB 3CPWA 4A3KG 3AFQA 2NZOA 1A3UA 4HSPA 1C8CA 4R4QA 1EOTA 5IY0A 1PTOF 2KUMA 2YV5A 1HJPA 5M5WH 4A93H 5I2XA 2ATWA 5G3LD 2XWJB 3AEVA 1DOLA 4B9WA 4XQNA 1XPOA 1SYDA 4A4IA 4LFCQ 5J3BA 2E5LQ 1I4GA 4JI8Q 1CHQD 1S72A 3EN2A 1FR3A 1TS3A 5I6YA 4FF4A 3MFYA 1E2ZA 3MXNA 1EYCA 2N3SA 4ZAIA 4FF2A 1EQQA 5BR8L 5CMDA 5I6WA 2HIXA 2PMZB 4DNIA 2IWHA 3CRKC 2JA5G 1PYSB 1Q1EA 1DOMA 5IYCG 2XWBB 1Q1BA 2JA6G 1A63A 1T9HA 2CVRA 2AQ2B 1SNMA 2B29A 1F9PA 5M3MB 2L9HA 2NWGA 4R4IA 1AP0A 2XNAC 3LGJA 2QDLA 3A56A 2KENA 4GN4B 2F0UA 4RAUC 3W1GA 2Q2TA 2RVLA 4HN7A 3KJPA 4AQYQ 3I4NG 4RKLA 5KGUA 3QIAA 5FLXL 3CCVA 4C2MH 2SEBD 4DUZL 2FFKB 5JVH3 1Q90A 2WV6D 5D3IB 3CCMA 4G57A 3HOVB 4JI2Q 1BVSA 4YIJA 5CV5A 4BBRH 1EYAA 2AKWB 3A5ZB 4X64Q 4JI3Q 1YITA 2PQAA 4RCOA 2BDOA 3LNNA 3TN2A 3J7YW 4YWMA 5HY6A 3ICEA 5AJ3L 1EQVA 3DMUA 2VQEL 1D7QA 2R7ZB 1VQHA 3A0JA 1SMXA 2R61A 1F9SA 1GHJA 4EX5A 3HS0C 3KUPA 5CBEE 5DM63 1GHKA 5K5PA 3GP7A 2B2WC 3P75A 1TU2B 2X6LA 2YYZA 4QMGA 3U50C 2LKVA 3KDFA 5I9PA 1HH2P 2MFIA 1IL2A 4JBJA 3RUZA 3U9OA 5C4ZA 5C0XG 1VDZA 1W6KA 4HTHA 1LV9A 3NPPA 4IUTA 4TQUS 1GM5A 3I4MB 1I4RA 2EOTA 1J8IA 3OTOQ 1VQ4A 3TS0A 2OEOA 4LF8L 4POFA 2K50A 2UUBQ 2F4VL 4HJ9A 3BZDB 1N33L 1EZ6A 3WOEA 2JA7H 4FDBA 4R8IA 3G4SA 4X66Q 5C3XA 3K7AH 1N9WA 4RHSA 4DK6C 4GN3B 2CWPA 3CCSA 3NBHB 4IFDJ 2CQAA 2UUAL 3M9BA 3GTKH 4IUUA 2R92G 3HOZH 3NE5B 2AQ1B 3FKIG 2EIFA 4JPBW 4EQOA 5CV7A 3TBIB 3H15A 3PUXA 2G9HD 4NW2A 2KEEA 4JOIC 3ND9A 4A3IB 3D4RA 2RHSB 3TREA 4K5VA 3CPFA 3S1RH 1UE6A 4BA2I 4RH6A 2ZM6Q 1A3TA 4A3BH 4YHHQ 4A3DG 1ML0D 1VCIA 2CW0C 4XQQA 3V2TA 4NMZA 4LF5L 3OW2A 1LTBD 4DAYA 3HOYG 4QUCA 1WI5A 1WD0A 5ELBA 1ILQA 4A3LH 1VF7A 4A3KB 1I94L 2JSOA 2WINB 3MXUA 2UU9L 3S17B 4ILWA 1N34L 1HZAA 4EVOA 1KDCA 5FJ8H 4XYQA 1Z6HA 1EEFD 1Z9FA 4DR4L 4PZ6A 2O5IC 1PH2A 1B44D 3P20A 4RGMA 5IYBG 1NR4A 4OO1I 1TWCB 2R3ZA 3DM3A 4MN3A 4DA2A 2L0CA 3BZKA 1O7ZA 4HIOA 4B9XA 2BCOA 1LACA 1WYDA 1R9TH 4F8MA 1WVLA 3W2DA 4GKKL 4OELB 1B1ZA 3HP3A 3K0YA 3VA5A 4AH6A 5G3LF 4DV4L 2NZHA 1EU4A 4DNTB 3AYHB 3BYTB 3CCQA 1PZJD 5F2DA 1JT8A 2MNAA 2JA5B 3JC66 2NYZD 3HOWG 1O78A 2HQLA 3KF6B 4NP5A 2JA6B 1K0RA 3H91A 4A3MG 3TSSA 2R7ZH 1F2MA 4C3JG 1BQQT 1H9MA 5GROA 3GTGB 4Q0FA 5I9OA 4B3MQ 2PW5A 5ELDA 4FF3A 1MJEA 3PO3H 2XIWA 3PQIA 3TP8A 5C44H 3CCJA 3ERQA 2VXWA 4RFBA 3I4NB 3FDTA 5T1IA 2PNHA 1J6QA 2QEXA 1DZ1A 3I4MH 4RGOS 4NDXA 5JEAH 3J80E 1FNWA 4BY1H 2JJQA 3PCOB 5LHY1 3HFZB 4DAVA 2K32A 1SE3A 2B2TA 2OF1A 3D8GA 1S5ED 4LF9L 2RSOA 1B7YB 4A3CH 4KLKA 2EDGA 2HT1A 1M8AA 1SNCA 3KYHC 2I07B 1X3EA 5EKIA 5IP7H 3F8TA 2O4XA 5IIFA 3W5OA 1STYA 4Q5VA 3U58A 4B3SQ 2ALYB 2LSSA 5IGFA 4QY7A 4A93G 3SK8A 3T13A 3K59A 3CF5A 3MEFA 5EPKA 2QF7A 1VMPA 5IT9E 3S1NB 4UP9A 2B2VA 3KK7A 1EYGA 4JBMA 3J7AF 4KMUC 1KHIA 4GKJQ 2PPBC 1H95A 3R8BA 1LT3D 1BCPB 1PFBA 1B3QA 1BR9A 4LF4L 1YI2A 1M90C 3T4AC 3VYRA 4X3SA 3X3MA 4AIMA 2N8NA 3R93A 4L63B 3CMAA 3KOJA 2J0TD 3BZCA 2WP8J 2UXCL 4R1JA 2R92B 2EY2A 3RLOA 3I55A 3FKIB 1HUMA 2F0PA 1QUQA 4A3KH 3S15B 4LFAQ 1J9OA 2I5LX 2NTTA 1BNZA 3CD6A 1D6EC 4R8NA 3WOFA 2ZJRA 2X6GA 5C0XI 1ONLA 1PFNA 3KF8A 2WKCA 1KC8C 4JI7L 1SYCA 3ULPA 4GZYC 3A5UA 4EGVA 4DV0Q 1OTCA 3DEPA 5TSSA 4A3DB 4BBRG 2B2WA 2L15A 1SXTA 1EY9A 3I4OA 3MWYW 3X3NA 2K04A 4L5RC 1W6JA 2A19A 4DGZA 2CHBD 3HOYB 5IYCH 4BXXG 1QOHA 2OT2A 2AUJD 3S2DB 1QWYA 2F0TA 1LT4D 3UE0A 1GUTA 2F4IA 3NK9A 1CI3M 5M5YH 1EL0A 1BKBA 3GV3A 5JAVA 3VR5A 1WTPA 1EUJA 4GNXB 1GVPA 1KRTA 4OX9L 2JK8A 4HMIA 1OXXK 3GTQH 1P16A 2JYOA 3ND8A 4MHEA 3K57A 5EAYA 3H0GH 1WJJA 4R4OA 1PTOC 3C1EA 3I8ZA 2HHHQ 2HIVA 3F1ZA 4DK0A 1FVIA 3W3AA 3PUVA 4FVMA 1VQCA 2HUGA 4KD3A 4DV2Q 3EROA 4ALPA 4JOIA 2F0VA 5C4XH 3OMCA 1B70B 1UUPA 3H6MA 1EOVA 4LNQA 3BDCA 4OWWB 3PV0A 3HOWB 1Q86C 1HR0Q 4DV7Q 1HZCA 1EY7A 3TRZA 2IJ0A 4A3MB 1HNXQ 3HOZG 3RN2A 1K8OA 4C3JB 4H7BA 2WB1E 4KJOA 4WFN3 3F2UA 4HSVA 3K58A 2A1AA 4FF1A 1TVXA 3T56B 2WKDA 4BBSH 2EE1A 3IL8A 1PV4A 1D2BA 1AZQA 3S1NH 4YWLA 2A6ED 1K9MC 1KDBA 2D5DA 1YNJC 3ONAB 5JJZA 2CH4W 2EY1A 5J1ZA 4ME3A 4A3JH 2E2JB 1RKNA 4JC0A 3QJYA 1K8MA 4G7ZC 2F0DA 4L5QA 2NVYB 1SBBB 1E2VA 4DV5Q 1D1KA 4B3RQ 3R2TA 3A8KE 2Z6BA 1JE5A 2DNCA 2MQHA 1KIXA 1AE2A 5JPNC 1E3PA 1NCVA 4X62Q 1IBKQ 4PZ8A 1YNXA 3T1HQ 1Q46A 4PV1C 4LFCL 1NNXA 3K81C 4KJNA 2PI2E 1I4XA 2E5LL 4JI8L 1I50H 4DU9A 3PIO3 2JQOA 3FKIH 2KA7A 3FEWX 1C9OA 5NUCA 4LF4Q 4A93B 1U5KA 1VQJA 5FO8B 1T5XD 5EBCA 4HR7B 1OO9B 2SDFA 3QR8A 3NWTA 3KFUA 2E2DC 1NMGA 2XN9C 2Z8LA 3AU7A 1FJGL 2KHJA 1SN8A 2F0LA 2KCTA 1U0LA 4HMJA 2F1MA 1B50A 4RKBA 1EZ8A 1BCPD 1I4QA 4A3DH 4IURA 4GS3A 1SJHD 3VR2A 4L5TA 3CXCA 2K4KA 1SYGA 1QILA 2ICIA 2RCNA 4AQYL 2FJ2A 1SROA 4CKBA 2EPBA 2ES2A 2FMMA 3HOYH 2OTLA 1ILPA 4O42A 3S2DH 1NMFA 1G51A 1RF2D 5A35A 4KKTA 2JP1A 4P73A 1HUNA 1XPUA 3PO3G 4JI2L 2K5DA 5C44G 3GTOH 1F9QA 1A3VA 1GUOA 1U4LA 2MP1A 4JI3L 4X64L 1LT6D 4POGA 1DONA 1RTNA 1VQ6A 1SE8A 2EYHA 1R4QB 1S5BD 1SYBA 2UXBQ 4C2MB 3RZOH 1PH7A 1O7LA 1Z47A 2L5TA 4HJAA 2K33A 3J7ZC 5C4JB 4O2DA 4BY1G 3P1HA 5IGDA 2VW9A 4BBRB 3E9HA 1SLJA 3PUZA 3J80L 4A3CG 2KCNA 1R4PB 1V1QA 1CUKA 3HOWH 5T1GA 5IP7G 1U4RA 3EVQA 1MI2A 1JB7A 3N52A 3OTOL 1KNEA 5C3WA 3SK6A 1UE1A 1VQ7A 5E7NA 2UUBL 2D0OA 3RZDH 4NXMQ 1V9PA 3NUCA 1B9MA 4UAIA 1S5DD 4X66L 2K01A 1VQIA 4JV5Q 5IGGA 1K28A 2Y0SE 1EQRA 2HDLA 5IT9L 2PO4A 4K8JA 4LUVA 1O80A 1EY8A 3M7NA 3CQZH 1F2ZA 3NXWA 3EFXD 3U4VA 3L9AX 2N88A 4FXKC 3CCEA 3K7AB 2DJFC 2Y0SG 2IL8A 2JA8G 4N9PA 2DNEA 5GAEC 3VYTA 3D4DA 3HOZB 3EJIA 2ZM6L 4RG1A 3MHBA 4YHHL 3M4QA 2VY3A 2E8GA 3Q8DA 5M3FH 2EJFC 1JJGA 3Q6SA 4XTCS 4QUFA 4K5XA 3S1RB 1F9RA 2ZXOA 2CKZB 1HFNA 3OIQA 3NWSA 4A3BB 1H9SA 4R9WA 4J6HA 1KTKA 3OIPA 1ASZA 3J7A5 1L1OA 3A54A 1STAA 3CCRA 2K28A 3FVQA 3TEHB 2B2YC 1S5CD 1FJGQ 1PH6A 5CV4A 1IXRA 1N36Q 4QCLA 1VQPA 4BA1I 3H3VH 1PXUA 2NN6G 2A69C 1JWUD 4NKLA 1Z7TA 2DJGC 3HZXA 4FO2A 1HFGA 2M2LA 2VB3X 4LFBQ 1V1PB 2CQOA 2E76C 3DM1A 2A69D 2ZXPA 3A74A 3OYYA 1CSQA 4DXFA 3H0GG 3CAMA 3TDQA 3PMFA 2VUMG 4X65Q 3PF5A 4A3GH 4N9TA 1R9TB 2V4DA 1QG7A 5C4JH 4FP5D 4A75A 1DXMA 2ICEC 3BVMA 1MSGA 3MZ5A 4B3ML 2F52A 5C4XG 3T1YQ 2EQSA 1AH9A 1GUWA 4K6LA 4WRDA 5CC4A 3I91A 3RN5A 3VR3A 1D5XC 2AQ3B 2QW7A 3GTPH 4I7ZC 4BXXH 5J22A 1BCPF 4NB3A 3GTJB 1ET6A 1Y14B 4OWTB 1K83H 3D3RA 1W2BA 1TWHH 3F2DA 3D6CA 4BBSG 1PDQA 2KJXA 1MIUA 2JN4A 3PO3B 5C44B 4RWSC 4A76A 1ZKOA 5KYIA 3TS2A 1LUZA 1I5FA 1PLFA 3TMEA 4FXDA 3L0OA 3SR1A 2XVSA 2Q2HA 4ME5A 1STBA 4DR1Q 4XQJA 4A3JG 4HEDA 2MUYA 4BY1B 1ASYA 4RHRA 1C4QA 4K6DA 4V0BA 3HOXG 1CA5A 1PFMA 4B3SL 1WTQA 1PH9A 2OCEA 5BN3A 1B8AA 4IPDA 5CV9A 4JK1C 3PUWA 1UNSA 2H4OA 4ID6A 1XMQQ 3RLNA 4ABNA 5HGQA 1IW7C 3OMGA 2NVQH 4RA8A 1DYQA 4JVZA 1WCMG 2F0NA 4GOPC 4LJZC 1NE3A 3D6WA 3M3YB 4GKJL 3M4OH 3STBD 1ET9A 4DKAC 1K0SA 4MTNA 2K5QA 1KRSA 2DUDA 1IW7D 1Q3LA 3URYA 1CA6A 4IALA 5LMNQ 2A73B 3E0EA 1PYWD 1GOZA 4DR5Q 1H9JA 1WOCA 3U4ZA 3T16A 1K3RA 2XSCA 1P8LA 2TSSA 1JORA 1KXLA 4QGUA 1MKHA 1JE4A 1PYBA 4KKUA 2A68C 4L6TB 1IBLQ 1TS5A 4LFAL 2K5WA 1DCZA 1IYVA 3V96A 1QVFA 1TR5A 1AFPA 3GTMH 2Y0SB 2KECA 2I5HA 2JA8B 4LF6Q 2KCCA 2A68D 2IHFA 3G6JB 3SK4A 1EY5A 4QQBX 4Y7NH 3CCUA 1YVCA 4J15A 2BOSA 5IP9G 4TRDA 4DV0L 3S1QH 1B2TA 1CT1D 1SEBD 4R4CA 1H9RA 1ZXTA 1B4OA 3QB3A 3A8JE 3FMCA 1SNPA 1RL2A 3FRPB 1EYDA 3HKZE 5C5LA 1HZ9A 4P74A 2F0QA 3GQBA 5CGKA 1SRUA 4KHZA 4NPSA 1JOQA 3E0JA 1NJIC 1AEXA 1J5EQ 1A62A 2CWAA 4IFDH 3HKZG 2K52A 1L0XB 1Q12A 2RSNA 4BS9A 2LMCB 1F2LA 1HXYD 4K0KQ 2FINB 4KY5A 2F0IA 3I56A 4IUQA 2JXMB 1HPCA 2GA4B 1BBUA 3MC0B 3M85A 2VS1A 3MXNB 3VR6A 2KHIA 2HHHL 5JPMC 5M5YB 3J80c 3ERSX 3GTJH 1XWEA 4DV2L 2OQKA 4KN7C 4Y52H 1SNDA 3MFGA 3S1MB 1CM9A 5KNBA 3ER0A 4GN5A 3GTQB 3HG9A 2F0OA 2OWOA 1I6VC 2EYJA 2LFNA 3H0GB 1JC7A 4UP8A 2RA4A 1HR0L 1I3QH 4DV7L 2VUMB 1HNXL 5JJKA 2EYOA 5J39A 1W3SA 1I6HH 5C4XB 4HAEA 3B6YA 3PSIA 4BWGB 1CFMA 2Z6KC 1L2FA 1LTAD 1SR3A 1GO3E 4DR3Q 1MBYA 5IT9c 4MTKA 2JEBI 4U68A 2DY7A 1CKNA 1G6ZA 1WTVA 1IHZA 1TS2A 5C6AA 3DHQA 2F0EA 1JICA 3BS1A 4DV6Q 3AMUA 1G291 3O13A 4X3KA 3PIP3 3M3YH 3UE1A 1QVGA 3Q22A 2PQAB 5M3FG 4KY6A 4BBSB 3GV6A 2I46A 5LL6X 1VQLA 1XNQQ 2EY6A 4DV5L 4B3RL 1GJXA 3TQYA 4B08A 2Z0SA 1CQFA 1UEAB 2E75C 5FO7B 2BH8A 4X62L 1IBKL 4DR7Q 2IPKD 2MO0A 3VR4A 1G8ZD 3T1HL 4A3JB 4QL5A 3Q23A 5LMUQ 3HOXB 3KDFB 1Y69U 3S16H 2NTSA 5E4WC 1SAPA 2XRQD 2G5DA 1UWVA 2N78A 2R7FA 1U4MA 1WCMB 1RDPD 1RIPA 2JA8H 2E2HB 2DGYA 2KQ3A 4IQZA 1I50B 1PRTB 3S9WA 3J81c 4IUPA 4ULLA 4PMBA 1NAPA 4CJ2C 4JI4Q 4S3SA 4E6IA 1RD9D 2UXDQ 2B2UC 1PH4A 1KLGD 4M8AA 1ENCA 3AQQA 2JEAI 1LTRD 2IHEA 3I90A 3KLSX 4LUZA 3MXPA 2F0KA 4A3GG 3JAMc 2BA1A 4CDDC 5FOBB 3J81E 4DFAA 2EXDA 2ZJPA 1QNKA 1YJ9A 1VQGA 2FXQA 3EQLC 2GVBA 1LTID 1NR2A 3PF4A 5KEEA 4LMQD 1CZGA 3CC4A 1XTDA 2IT1A 3BDOA 5GADC 4JI5Q 3JAME 2UXBL 4J8QA 1H9KA 4FYDA 4OONA 4HCEA 1SFOH 4IPHA 2I5MX 1KDAA 2NN6H 2LXKA 4OHJA 1S3OA 3VDYA 2B8GA 2YTXA 3GTOB 4I65A 1Y1WH 2EZVA 4DAYB 2BE5C 3GTLH 1Y8NB 5AFWA 4JYAQ 3S1MH 1EIGA 5C0XJ 3RZOB 3T51B 2L12A 2PCFB 4C3HH 5A2QE 4GOPA 3K6OA 2BA0A 2ZXRA 2VUMH 2BE5D 3ULJA 4KY7A 3NQIA 3HKZB 5EQ0A 4C3IH 4XT3B 1KL9A 1SDFA 3EA6A 2EYFA 2F03A 1QCBD 4ZQ3A 3J80i 4NXML 1VQ9A 4MNOA 1QNUA 4HIDA 2AWOA 2B63H 3VYUA 5ELEA 2ZT9C 2F0SA 1SNOA 1F77A 4C1NI 4JV5L 3C3LA 1CKOA 5C4HA 1G6PA 3G7LA 1D8LA 2A6EC 1TWGH 4XYOA 4L8JA 3K7UC 4IPCA 3RZDB 4YCWA 1V1OA 2K7VA 3H09A 1A8VA 1AW7A 3FP9A 1JOOA 1KD1C 1N8RC 1LLRD 3CC7A 1XYIA 1G2TA 2WB1G 3D31A 1E2WA 3MVVA 2K6AA 3D0FA 3I70A 3M4PA 2XTIA 3SEBA 4C1NK 2WFWA 1FL0A 1A0IA 2CFMA 3CQZB 3HOXH 2K5VA 4XXEA 1VQDA 3Q24A 4DAMA 3IFTA 3TP5A 3RR5A 1HA6A 1IL8A 1LYLA 4JBKA 2V1CC 1C0AA 4ZLTF 1FD7D 2G9DA 4CJ1B 3UDGA 1FNVA 1WCMH 4BY7G 2A5HA 1YHQA 1JMCA 2E2HH 1SJED 1HHVA 5EJWA 4F88A 1LT5D 4KV6A 5M3FB 5D3DA 4C56C 3V05A 1UE5A 4DV1Q 1TXYA 1HNZQ 2VNUD 1CSPA 1K3BC 4CKCA 5I4DA 1WTRA 1BCPC 5KNDA 2HCCA 5C3EG 4IOAA 2LXJA 1Q7YC 4DN4M 4QIWE 3S2HH 1EY6A 1N36L 1JJCB 4IFDG 2Q8RE 3Q0AA 3E5SA 2K75A 1KABA 4APVA 1EIYB 1XTCD 1Q8KA 1XX8A 5IE8A 1VQFA 4FNFA 2SNMA 4IJLA 4LFBL 2WAQE 4WJ3M 4OEMB 2IX1A 2ZTDA 1NUCA 3UI2A 5H1SE 4X65L 1ICFB 3BYYB 1TWAH 1LTLA 1PRTD 5HGTA 3NP8A 1PH5A 3CRLC 5JJLA 2B39A 5IP9H 1KNAA 1VQ5A 1M1KC 2Z6KA 3JAMi 2WAQG 4A3EH 3T1YL 2L4NA 3K5MA 3OHXC 2F0GA 2R7DA 2MHVA 4QJFA 1CKMA 5DLQE 3SK5A 5CBAE 1QUQB 4JI0Q 4A3GB 4JI6Q 1GUSA 3H94A 4RGNA 2K05A 3IRBA 4RMFA 4ZUJA 1HNWQ 3KF8B 4JBWA 3EBEA 5EKLA 1DOKA 4ZUIA 4EQPA 5CYUA 2D9UA 3GTPB 4HJ5A 4G7OC 4QF4A 4FXGC 1GXDC 3IKJA 4GNXC 3H3VI 2NVXB 1ESFA 4DR1L 2E2IH 1IBMQ 1PA6A 3HKSA 1K83B 3M7GA 1M4VA 1TWHB 3NBHA 2AUKA 3FPPA 3GO5A 3L3OC 4DR6Q 3FHWA 3CW2C 1CZWA 2Q8IB 2GVAA 1VQOA 3HGBA 1JCKB 2QILA 3R3OA 1XMQL 1X3FA 5IWAQ 4DUYQ 3NTIA 2M00A 2K14A 5D14A 5JOBA 3C2PA 1UEBA 3I2ZA 2QDBA 2EJGC 1F2YA 3NTHA 5IOCA 4IO9A 1WTXA 5HURA 2F0HA 4NXNQ 4JW0A 3DWPA 2B2UA 4HCSA 4N8X1 5LMNL 1HRJA 4IUVA 5ISRA 4DR5L 2R93G 3PO2G 5ELOA 2NVQB 5K36H 1OXVA 4YCUA 1A2UA 2R6GA 3K5LA 4WJWA 4B3TL 2YTVA 3R2IA 3NSWA 5GQOA 3M4OB 1N32Q 3DWAA 5CR3A 1TWFB 5EBDA 3KLSA 1TS4A 4N8FA 4QB4A 2L55A 4F7XA 1XMOQ 2E74C 1QVCA 1IBLL 4H0LC 4P71A 1NTGA 3G71A 1XXGA 2K5HA 2MPMA 1C48A 4LWCA 1JJ2A 4LAAA 4LF6L 2D0PA 2WB1B 4YCVA 2PYKA 3AFPA 1II3A 1QB5D 1S4ZA 5L37A 3GD7A 4GLAC 1Y8PB 2I0QA 1X32A 4UPAA 4LW1A 3ULLA 3LWEA 4RCNA 1KAWA 3J81L 2B2TC 1S40A 3GTMB 3SXHA 1YHBA 1EIHA 3LWUA 4Y7NB 3K8AA 1KLUD 1PZID 2EYMA 1X65A 4BY7B 1BOSA 5M5XH 3WWVA 5JJIA 4DF7A 1J5EL 3KF6A 4H13C 3S1QB 2OTJA 3MXGA 2MJ8A 2RCFA 1Y1WG 3KBGA 4KHPL 3S14H 1G2SA 5IGBA 3VYSA 3JAML 5M9OA 3BDLA 2A8VA 1TY0A 4K0KL
chains in the Genus database with same CATH topology
3HOVG 1SRUA 4KHZA 4NPSA 4DV0Q 1OTCA 1VQAA 1NJIC 2MO1A 4BBRG 2L15A 3L7ZC 1J5EQ 1A62A 2CWAA 3I4OA 3HOUH 4A3FH 3HKZG 1V43A 2K52A 4DR2L 1Q12A 2AMCB 2H5XA 4L5RC 4YY3Q 4JI7Q 2A19A 1PH1A 2R7ZG 1E1TA 4K0KQ 5IYCH 3I56A 4BXXG 2YU9H 4IOCA 3GDEA 1BBUA 1VQEA 4JI1L 3UE0A 3G6EA 3M85A 1YJNA 2B63G 2VS1A 5M5YH 3MXNB 4DR2Q 1BKBA 2VQFL 4PZ7A 2KHIA 2HHHL 2RHQB 4GLXA 3J80c 3K0XA 2BH2A 1EUJA 1KQSA 4GNXB 3ERSX 3GTJH 1GVPA 2NVXH 1KRTA 1YEZA 2JK8A 5IYBH 3NEMA 4OX9L 4DV2L 3I4MG 2OQKA 4P75A 5JEAG 3PIOA 1PH8A 2AHOB 4Y52H 4JI1Q 1OXXK 3GTQH 1P16A 4IPGA 1VQKA 3ER0A 1Y1VH 4GN5A 5EAYA 3J81j 3H0GH 1WJJA 4R4OA 2VQFQ 2OWOA 1E7ZA 1X6OA 2ZTEA 3NELA 2HHHQ 4UY8C 2HIVA 3F1ZA 4UP8A 1FVIA 3PUVA 1HR0L 1I3QH 4DV7L 4DR3L 1VQCA 4OX9Q 1HNXL 4DV2Q 1EIFA 4ALPA 4JOIA 5JJKA 1BBWA 5C4XH 1K8GA 4IFDI 1W3SA 1I6HH 4DV6L 1B70B 1X55A 1EOVA 3B6YA 4LNQA 3PSIA 1MJCA 2Z6KC 1L2FA 2CCZA 3PV0A 4OWWB 4DV3L 1VS0A 1SR3A 1GO3E 1Q86C 4A3MH 1HR0Q 4LF7L 4DV7Q 1HZCA 3W1BA 4DR3Q 3TRZA 5IT9c 1HNXQ 4C3JH 3HOZG 3STBC 2Q2UA 2JEBI 3PUYA 3RN2A 1UE7A 1XNQL 1CKNA 1EFWA 4DV6Q 2WB1E 4GOPB 4A3IG 1G291 2A1AA 3M3YH 2KCMA 4PMWA 3UE1A 4DR7L 4DV3Q 1QVGA 3KLWA 4PG3A 4BBSH 1EWIA 4OO1G 2PQAB 5M3FG 4LF7Q 1PV4A 1TWFH 5LMUL 1QZHA 3S1NH 4YWLA 1VQLA 1XNQQ 1E22A 4DV5L 4B3RL 1K9MC 5FLMH 3TQYA 1VQBA 1FGUA 2Z0SA 2E2JH 2BH8A 1OXTA 4X62L 1IBKL 4DR7Q 2MO0A 4ME3A 4A3JH 4JC0A 1WFQA 3T1HL 1HR0W 2ZJQA 2NVYH 2NVTH 4QL5A 4B3TQ 4L5QA 2ID0A 4L5SA 5LMUQ 1L0WA 3CCLA 4DV5Q 4B3RQ 3KDFB 2UUCL 1JE5A 2MQHA 3S16H 1Q82C 1KIXA 1AE2A 2VL6A 1E3PA 3NENA 4X62Q 1IBKQ 4PZ8A 4DPGA 1YNXA 4TVAB 3CPWA 1UWVA 3AFQA 4A3KG 3T1HQ 4JI4L 1Q46A 2N78A 2R7FA 2NZOA 4LFCL 2UXDL 3K81C 4R4QA 3DLLA 2E5LL 2PI2E 5IY0A 1RIPA 4JI8L 2YV5A 1HJPA 1I50H 5M5WH 2JA8H 2DGYA 2UUCQ 4A93H 1IYJB 2JQOA 2KBNA 3FKIH 3J81c 1C9OA 2ATWA 4LF4Q 3AEVA 1U5KA 1VQJA 4JI4Q 1XPOA 4A4IA 4BY7H 4LFCQ 2UXDQ 5J3BA 1PH4A 2E5LQ 4A3EG 3KFUA 4JI8Q 1NMGA 1S72A 3AQQA 3EN2A 1FJGL 2KHJA 2JEAI 2IHEA 4LUZA 1SN8A 3I7FA 4O0AA 4A3FG 2KCTA 2B3GA 1U0LA 2BA1A 2N3SA 3JAMc 4A3GG 4GLVB 1EQQA 5BR8L 4JI5L 5JEAJ 4A3DH 4GNXA 2HIXA 4DNIA 4GS3A 2EXDA 5GAHC 5C3EH 2ZJPA 2JA5G 1YJ9A 1PYSB 4L5TA 1Q1EA 1VQGA 5IYCG 3CXCA 2FXQA 1Q1BA 2K4KA 2JA6G 1A63A 2GVBA 1T9HA 2RCNA 3PF4A 5M3MH 4KHPQ 4AQYL 5IYDH 1SROA 2B29A 1X54A 2ES2A 3CC4A 1XTDA 2IT1A 4R4IA 5BR8Q 3HOYH 5GADC 1XJVA 4JI5Q 3F2BA 2OTLA 3LGJA 3S2DH 1NMFA 3K80C 2UXBL 1G51A 2KENA 4GN4B 1PHJA 3G48A 4JYAL 4P73A 3W1GA 3KJOA 4OONA 2Q2TA 1SFOH 1XPUA 4IPHA 2I5MX 3PO3G 4JI2L 3KJPA 5C44G 4AQYQ 3GTOH 2LXKA 3I4NG 1S3OA 3VDYA 2YTXA 1Y1WH 1L1OB 4JI3L 4X64L 3CCVA 2D62A 4C2MH 3EIVA 4DAYB 4POGA 1VQ6A 1SE8A 3GTLH 4R4TA 4DUZL 2UXBQ 1XPRA 3RZOH 1PH7A 4JYAQ 3S1MH 5C0XJ 3HOVH 1Z47A 4HJAA 2GN5A 3J7ZC 3CCMA 4O2DA 4BY1G 4C3HH 4JI2Q 1BVSA 4BBRH 4GOPA 4HJ8A 2BA0A 2VW9A 1X56A 1VQ8A 2VUMH 2AKWB 3A5ZB 3E9HA 3ULJA 4X64Q 4HJ7A 1YITA 4JI3Q 2PQAA 1SLJA 4C3IH 1YZ6A 3PUZA 4DUZQ 4YWMA 5HY6A 3CC2A 5AJ3L 3ICEA 1Q81C 1KL9A 4A3CG 2AWNA 2VQEL 1XNRL 1D7QA 1V1QA 1VQHA 3A0JA 1SMXA 1CUKA 3J80i 4NXML 3HOWH 5IP7G 1VQ9A 4MNOA 4EX5A 5GAGC 2YTYA 4HIDA 2AWOA 2B63H 1JB7A 5K36G 3OTOL 2QA4A 1UE1A 2YYZA 3U50C 5AJ3Q 4JV5L 1VQ7A 1CKOA 5E7NA 3KDFA 1G6PA 2VQEQ 2UUBL 1HH2P 2MFIA 1D8LA 1IL2A 1TWGH 2D0OA 2XGTA 4JBJA 3RZDH 3K7UC 1E24A 5C0XG 2F3IA 4NXMQ 2NN6I 4IPCA 4TQUS 1GM5A 1V9PA 2Q2IA 3BJUA 4X66L 3OTOQ 1VQ4A 4YCWA 3TS0A 1VQIA 4JV5Q 4LF8L 1OXUA 1A8VA 4POFA 1PVOA 3FP9A 2Y0SE 2K50A 1EQRA 1N8RC 1KD1C 2UUBQ 2F4VL 3CC7A 4HJ9A 2WB1G 3D31A 4LUVA 1N33L 2JA7H 3D0FA 4FDBA 3M7NA 3M4PA 2XTIA 3CQZH 3RLFA 1C7YA 3G4SA 2WFWA 4X66Q 1FL0A 1A0IA 2CFMA 4YWKA 3K7AH 1N9WA 2K5VA 3U4VA 3HOXH 1VQDA 4GN3B 2CWPA 4DK6C 3CCEA 3CCSA 3NBHB 4DAMA 2UUAL 4LF8Q 3M9BA 3GTKH 2Y0SG 4IFDJ 2JA8G 2F4VQ 2R92G 3HOZH 3RR5A 5GAEC 3L2PA 3FKIG 1N33Q 2EIFA 4DV1L 1LYLA 3H15A 3PUXA 2V1CC 4JBKA 2ZM6L 4RG1A 1C0AA 1HNZL 1K73C 3UDGA 4A3IH 4JOIC 1WCMH 4YHHL 3M4QA 4BY7G 2R93H 1YHQA 1JMCA 2VY3A 2E2HH 3PO2H 2E8GA 3Q8DA 5M3FH 2UUAQ 2RHSB 1JJGA 3TREA 3CPFA 4XTCS 4HIMA 3S1RH 1UE6A 1UE5A 4DV1Q 4BA2I 1TXYA 2ZM6Q 4JCVE 1HNZQ 2VNUD 1CSPA 2CKZB 1E1OA 4A3BH 4YHHQ 2JA9A 3UDFA 4A3DG 1VQMA 1GKHA 4UP7A 5C3EG 4IOAA 2LXJA 1Q7YC 1DGSA 4QIWE 3S2HH 1VCIA 1N36L 1JJCB 4IFDG 3HOUG 5ELNA 4LF5L 3OW2A 1ASZA 3J7A5 1L1OA 3CCRA 1PFSA 2K75A 3HOYG 1WI5A 4APVA 1EIYB 1Q8KA 3TEHB 5IE8A 4A3LH 1VQFA 3S17H 2N49A 4IJLA 1X9NA 1I94L 1FJGQ 4LFBL 3PO3H 1PH6A 2UU9L 1IXRA 2WAQE 1N36Q 1N34L 4LF5Q 1VQPA 4BA1I 3H3VH 2NN6G 1HZAA 4WJ3M 2IX1A 2ZTDA 5H1SE 4X65L 5FJ8H 1Z9FA 1TWAH 1LTLA 4DR4L 4PZ6A 2K5NA 1LM0A 1TWCH 1PH5A 4JI0L 5JJLA 1NBWA 5IP9H 1PH2A 5IYBG 4OO1I 4JI6L 3DM3A 1I94Q 1VQ5A 4KI0A 1M1KC 2Z6KA 3JAMi 4LFBQ 2UU9Q 2WAQG 2CQOA 4A3EH 3A74A 3BZKA 3OYYA 4HIOA 3T1YL 1N34Q 1CSQA 3F2CA 1K8AC 1VQNA 1Y1VG 2IX0A 3H0GG 4MZ9A 3CAMA 1WYDA 2R7DA 5FLXc 2VUMG 4X65Q 4QJFA 3PF5A 1R9TH 1CKMA 4A3GH 4DR4Q 3ZJYC 4GKKL 5DLQE 1HNWL 1QUQB 2VZAA 4AH6A 4JI0Q 5C4JH 1YHAA 4JI6Q 4DV4L 4A75A 2IY5B 1NY4A 2NZHA 2JA5H 5C4XG 3AYHB 4B3ML 2F52A 3CCQA 3UDIA 1JT8A 3T1YQ 2EQSA 2MNAA 2JE6I 2JA6H 1AH9A 3JC66 3HOWG 3IRBA 4RMFA 2HQLA 1X3GA 3E9IA 3KF6B 2ASBA 3CMEA 1K0RA 1IBML 1HNWQ 3KF8B 3RN5A 4GKKQ 4DK3C 4JBWA 3EBEA 4A3MG 3GTGH 3GTPH 2R7ZH 4AYBE 5GROA 4DV4Q 4HJ5A 4DR6L 3PGZA 4BXXH 4B3MQ 4IJHA 1L1OC 4NB3A 4GNXC 3H3VI 1Y14B 2RF4A 4DR1L 1MJEA 4OWTB 2E2IH 1K83H 5IWAL 1W2BA 5C44H 4DUYL 1TWHH 3F2DA 3CCJA 1IBMQ 1PA6A 3HKSA 3I4NH 4BBSG 1MIUA 4A76A 3TS2A 1LUZA 1I5FA 2PNHA 1J6QA 3GO5A 4AYBG 4DR6Q 1XNRQ 3FHWA 3L0OA 2QEXA 3CW2C 2Q2HA 2QGQA 4P72A 5FLMG 2GVAA 3I4MH 1VQOA 4NXNL 4OXPA 4DR1Q 1XMQL 2JA7G 4BY1H 1X3FA 5IWAQ 2JJQA 3PCOB 4DUYQ 4A3JG 2K14A 1YIJA 3HFZB 4OWXB 1ASYA 1UEBA 4EQ5A 3I2ZA 3HOXG 4B3SL 1PH9A 3UDXA 4IO9A 4LF9L 2OQ0A 2OCEA 4H02A 1B7YB 1B8AA 1YJWA 4IPDA 4A3CH 3PUWA 3BU2A 4KLKA 4NXNQ 2HT1A 3KYHC 1N32L 1XMQQ 3RLNA 5HGQA 1X3EA 5LMNL 4JG2A 3F8TA 5IP7H 4DR5L 1XMOL 2NVQH 1WCMG 3W5OA 1AE3A 3U58A 4B3SQ 3PO2G 2ALYB 5ELOA 2LSSA 4GOPC 2R93G 1NE3A 4LF9Q 4QY7A 1OXVA 4YCUA 2R6GA 3M4OH 4GKJL 3STBD 4A93G 4B3TL 2YTVA 4DKAC 4MTNA 5GQOA 1KRSA 3CF5A 2DUDA 1N32Q 3MEFA 4UP9A 3RNUA 2PMZE 5LMNQ 3E0EA 4XIGS 4DR5Q 1XMOQ 4A3BG 4JBMA 1EYGA 1QVCA 1IBLL 1WOCA 4P71A 1NTGA 1KHIA 3U4ZA 1PH3A 4GKJQ 1K3RA 3G71A 2C35B 2K5HA 1H95A 1P8LA 4X6AH 1CKNB 1QZGA 4LWCA 1KXLA 4QGUA 1MKHA 1JJ2A 4LF6L 1PYBA 2D0PA 4LF4L 4LUOA 1YI2A 4YCVA 1M90C 3AFPA 4HIKA 1IBLQ 4LFAL 4A3LG 3GD7A 4AIMA 4GLAC 2N8NA 1QVFA 2I0QA 5M3MG 2PI2A 3KOJA 4UPAA 3CMAA 4LW1A 5IYDG 2R92H 1IZ6A 3GTMH 3ULLA 3BZCA 1YBYA 2WP8J 5LMNW 2I5HA 1KAWA 4LF6Q 2UXCL 4R1JA 2IHFA 1S40A 1GD7A 3RLOA 5FJ8G 4Y7NH 3I55A 4A3KH 3S15H 1QUQA 1YHBA 4QQBX 3CCUA 1OXSC 3J81i 4WJ4A 4LFAQ 1YVCA 4J15A 2I5LX 5IP9G 3S24A 3K8AA 4DV0L 3CD6A 1X65A 3S1QH 5M5XH 4R4CA 3WWVA 3SGIA 5JJIA 2ZJRA 3CP0A 1J5EL 3KF6A 2OTJA 1RL2A 5C0XI 1Y1WG 2UXCQ 3HKZE 4KHPL 3S14H 1HZBA 2ZTCA 3PIPA 1HZ9A 4P74A 1KC8C 2A8VA 4YY3L 4JI7L 3ULPA 1O7IA 3A5UA 4K0KL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOV G;  1SRU A;  4KHZ A;  4NPS A;  4DV0 Q;  1OTC A;  1VQA A;  1NJI C;  2MO1 A;  4BBR G;  2L15 A;  3L7Z C;  1J5E Q;  1A62 A;  2CWA A;  3I4O A;  3HOU H;  4A3F H;  3HKZ G;  1V43 A;  2K52 A;  4DR2 L;  1Q12 A;  2AMC B;  2H5X A;  4L5R C;  4YY3 Q;  4JI7 Q;  2A19 A;  1PH1 A;  2R7Z G;  1E1T A;  4K0K Q;  5IYC H;  3I56 A;  4BXX G;  2YU9 H;  4IOC A;  3GDE A;  1BBU A;  1VQE A;  4JI1 L;  3UE0 A;  3G6E A;  3M85 A;  1YJN A;  2B63 G;  2VS1 A;  5M5Y H;  3MXN B;  4DR2 Q;  1BKB A;  2VQF L;  4PZ7 A;  2KHI A;  2HHH L;  2RHQ B;  4GLX A;  3J80 c;  3K0X A;  2BH2 A;  1EUJ A;  1KQS A;  4GNX B;  3ERS X;  3GTJ H;  1GVP A;  2NVX H;  1KRT A;  1YEZ A;  2JK8 A;  5IYB H;  3NEM A;  4OX9 L;  4DV2 L;  3I4M G;  2OQK A;  4P75 A;  5JEA G;  3PIO A;  1PH8 A;  2AHO B;  4Y52 H;  4JI1 Q;  1OXX K;  3GTQ H;  1P16 A;  4IPG A;  1VQK A;  3ER0 A;  1Y1V H;  4GN5 A;  5EAY A;  3J81 j;  3H0G H;  1WJJ A;  4R4O A;  2VQF Q;  2OWO A;  1E7Z A;  1X6O A;  2ZTE A;  3NEL A;  2HHH Q;  4UY8 C;  2HIV A;  3F1Z A;  4UP8 A;  1FVI A;  3PUV A;  1HR0 L;  1I3Q H;  4DV7 L;  4DR3 L;  1VQC A;  4OX9 Q;  1HNX L;  4DV2 Q;  1EIF A;  4ALP A;  4JOI A;  5JJK A;  1BBW A;  5C4X H;  1K8G A;  4IFD I;  1W3S A;  1I6H H;  4DV6 L;  1B70 B;  1X55 A;  1EOV A;  3B6Y A;  4LNQ A;  3PSI A;  1MJC A;  2Z6K C;  1L2F A;  2CCZ A;  3PV0 A;  4OWW B;  4DV3 L;  1VS0 A;  1SR3 A;  1GO3 E;  1Q86 C;  4A3M H;  1HR0 Q;  4LF7 L;  4DV7 Q;  1HZC A;  3W1B A;  4DR3 Q;  3TRZ A;  5IT9 c;  1HNX Q;  4C3J H;  3HOZ G;  3STB C;  2Q2U A;  2JEB I;  3PUY A;  3RN2 A;  1UE7 A;  1XNQ L;  1CKN A;  1EFW A;  4DV6 Q;  2WB1 E;  4GOP B;  4A3I G;  1G29 1;  2A1A A;  3M3Y H;  2KCM A;  4PMW A;  3UE1 A;  4DR7 L;  4DV3 Q;  1QVG A;  3KLW A;  4PG3 A;  4BBS H;  1EWI A;  4OO1 G;  2PQA B;  5M3F G;  4LF7 Q;  1PV4 A;  1TWF H;  5LMU L;  1QZH A;  3S1N H;  4YWL A;  1VQL A;  1XNQ Q;  1E22 A;  4DV5 L;  4B3R L;  1K9M C;  5FLM H;  3TQY A;  1VQB A;  1FGU A;  2Z0S A;  2E2J H;  2BH8 A;  1OXT A;  4X62 L;  1IBK L;  4DR7 Q;  2MO0 A;  4ME3 A;  4A3J H;  4JC0 A;  1WFQ A;  3T1H L;  1HR0 W;  2ZJQ A;  2NVY H;  2NVT H;  4QL5 A;  4B3T Q;  4L5Q A;  2ID0 A;  4L5S A;  5LMU Q;  1L0W A;  3CCL A;  4DV5 Q;  4B3R Q;  3KDF B;  2UUC L;  1JE5 A;  2MQH A;  3S16 H;  1Q82 C;  1KIX A;  1AE2 A;  2VL6 A;  1E3P A;  3NEN A;  4X62 Q;  1IBK Q;  4PZ8 A;  4DPG A;  1YNX A;  4TVA B;  3CPW A;  1UWV A;  3AFQ A;  4A3K G;  3T1H Q;  4JI4 L;  1Q46 A;  2N78 A;  2R7F A;  2NZO A;  4LFC L;  2UXD L;  3K81 C;  4R4Q A;  3DLL A;  2E5L L;  2PI2 E;  5IY0 A;  1RIP A;  4JI8 L;  2YV5 A;  1HJP A;  1I50 H;  5M5W H;  2JA8 H;  2DGY A;  2UUC Q;  4A93 H;  1IYJ B;  2JQO A;  2KBN A;  3FKI H;  3J81 c;  1C9O A;  2ATW A;  4LF4 Q;  3AEV A;  1U5K A;  1VQJ A;  4JI4 Q;  1XPO A;  4A4I A;  4BY7 H;  4LFC Q;  2UXD Q;  5J3B A;  1PH4 A;  2E5L Q;  4A3E G;  3KFU A;  4JI8 Q;  1NMG A;  1S72 A;  3AQQ A;  3EN2 A;  1FJG L;  2KHJ A;  2JEA I;  2IHE A;  4LUZ A;  1SN8 A;  3I7F A;  4O0A A;  4A3F G;  2KCT A;  2B3G A;  1U0L A;  2BA1 A;  2N3S A;  3JAM c;  4A3G G;  4GLV B;  1EQQ A;  5BR8 L;  4JI5 L;  5JEA J;  4A3D H;  4GNX A;  2HIX A;  4DNI A;  4GS3 A;  2EXD A;  5GAH C;  5C3E H;  2ZJP A;  2JA5 G;  1YJ9 A;  1PYS B;  4L5T A;  1Q1E A;  1VQG A;  5IYC G;  3CXC A;  2FXQ A;  1Q1B A;  2K4K A;  2JA6 G;  1A63 A;  2GVB A;  1T9H A;  2RCN A;  3PF4 A;  5M3M H;  4KHP Q;  4AQY L;  5IYD H;  1SRO A;  2B29 A;  1X54 A;  2ES2 A;  3CC4 A;  1XTD A;  2IT1 A;  4R4I A;  5BR8 Q;  3HOY H;  5GAD C;  1XJV A;  4JI5 Q;  3F2B A;  2OTL A;  3LGJ A;  3S2D H;  1NMF A;  3K80 C;  2UXB L;  1G51 A;  2KEN A;  4GN4 B;  1PHJ A;  3G48 A;  4JYA L;  4P73 A;  3W1G A;  3KJO A;  4OON A;  2Q2T A;  1SFO H;  1XPU A;  4IPH A;  2I5M X;  3PO3 G;  4JI2 L;  3KJP A;  5C44 G;  4AQY Q;  3GTO H;  2LXK A;  3I4N G;  1S3O A;  3VDY A;  2YTX A;  1Y1W H;  1L1O B;  4JI3 L;  4X64 L;  3CCV A;  2D62 A;  4C2M H;  3EIV A;  4DAY B;  4POG A;  1VQ6 A;  1SE8 A;  3GTL H;  4R4T A;  4DUZ L;  2UXB Q;  1XPR A;  3RZO H;  1PH7 A;  4JYA Q;  3S1M H;  5C0X J;  3HOV H;  1Z47 A;  4HJA A;  2GN5 A;  3J7Z C;  3CCM A;  4O2D A;  4BY1 G;  4C3H H;  4JI2 Q;  1BVS A;  4BBR H;  4GOP A;  4HJ8 A;  2BA0 A;  2VW9 A;  1X56 A;  1VQ8 A;  2VUM H;  2AKW B;  3A5Z B;  3E9H A;  3ULJ A;  4X64 Q;  4HJ7 A;  1YIT A;  4JI3 Q;  2PQA A;  1SLJ A;  4C3I H;  1YZ6 A;  3PUZ A;  4DUZ Q;  4YWM A;  5HY6 A;  3CC2 A;  5AJ3 L;  3ICE A;  1Q81 C;  1KL9 A;  4A3C G;  2AWN A;  2VQE L;  1XNR L;  1D7Q A;  1V1Q A;  1VQH A;  3A0J A;  1SMX A;  1CUK A;  3J80 i;  4NXM L;  3HOW H;  5IP7 G;  1VQ9 A;  4MNO A;  4EX5 A;  5GAG C;  2YTY A;  4HID A;  2AWO A;  2B63 H;  1JB7 A;  5K36 G;  3OTO L;  2QA4 A;  1UE1 A;  2YYZ A;  3U50 C;  5AJ3 Q;  4JV5 L;  1VQ7 A;  1CKO A;  5E7N A;  3KDF A;  1G6P A;  2VQE Q;  2UUB L;  1HH2 P;  2MFI A;  1D8L A;  1IL2 A;  1TWG H;  2D0O A;  2XGT A;  4JBJ A;  3RZD H;  3K7U C;  1E24 A;  5C0X G;  2F3I A;  4NXM Q;  2NN6 I;  4IPC A;  4TQU S;  1GM5 A;  1V9P A;  2Q2I A;  3BJU A;  4X66 L;  3OTO Q;  1VQ4 A;  4YCW A;  3TS0 A;  1VQI A;  4JV5 Q;  4LF8 L;  1OXU A;  1A8V A;  4POF A;  1PVO A;  3FP9 A;  2Y0S E;  2K50 A;  1EQR A;  1N8R C;  1KD1 C;  2UUB Q;  2F4V L;  3CC7 A;  4HJ9 A;  2WB1 G;  3D31 A;  4LUV A;  1N33 L;  2JA7 H;  3D0F A;  4FDB A;  3M7N A;  3M4P A;  2XTI A;  3CQZ H;  3RLF A;  1C7Y A;  3G4S A;  2WFW A;  4X66 Q;  1FL0 A;  1A0I A;  2CFM A;  4YWK A;  3K7A H;  1N9W A;  2K5V A;  3U4V A;  3HOX H;  1VQD A;  4GN3 B;  2CWP A;  4DK6 C;  3CCE A;  3CCS A;  3NBH B;  4DAM A;  2UUA L;  4LF8 Q;  3M9B A;  3GTK H;  2Y0S G;  4IFD J;  2JA8 G;  2F4V Q;  2R92 G;  3HOZ H;  3RR5 A;  5GAE C;  3L2P A;  3FKI G;  1N33 Q;  2EIF A;  4DV1 L;  1LYL A;  3H15 A;  3PUX A;  2V1C C;  4JBK A;  2ZM6 L;  4RG1 A;  1C0A A;  1HNZ L;  1K73 C;  3UDG A;  4A3I H;  4JOI C;  1WCM H;  4YHH L;  3M4Q A;  4BY7 G;  2R93 H;  1YHQ A;  1JMC A;  2VY3 A;  2E2H H;  3PO2 H;  2E8G A;  3Q8D A;  5M3F H;  2UUA Q;  2RHS B;  1JJG A;  3TRE A;  3CPF A;  4XTC S;  4HIM A;  3S1R H;  1UE6 A;  1UE5 A;  4DV1 Q;  4BA2 I;  1TXY A;  2ZM6 Q;  4JCV E;  1HNZ Q;  2VNU D;  1CSP A;  2CKZ B;  1E1O A;  4A3B H;  4YHH Q;  2JA9 A;  3UDF A;  4A3D G;  1VQM A;  1GKH A;  4UP7 A;  5C3E G;  4IOA A;  2LXJ A;  1Q7Y C;  1DGS A;  4QIW E;  3S2H H;  1VCI A;  1N36 L;  1JJC B;  4IFD G;  3HOU G;  5ELN A;  4LF5 L;  3OW2 A;  1ASZ A;  3J7A 5;  1L1O A;  3CCR A;  1PFS A;  2K75 A;  3HOY G;  1WI5 A;  4APV A;  1EIY B;  1Q8K A;  3TEH B;  5IE8 A;  4A3L H;  1VQF A;  3S17 H;  2N49 A;  4IJL A;  1X9N A;  1I94 L;  1FJG Q;  4LFB L;  3PO3 H;  1PH6 A;  2UU9 L;  1IXR A;  2WAQ E;  1N36 Q;  1N34 L;  4LF5 Q;  1VQP A;  4BA1 I;  3H3V H;  2NN6 G;  1HZA A;  4WJ3 M;  2IX1 A;  2ZTD A;  5H1S E;  4X65 L;  5FJ8 H;  1Z9F A;  1TWA H;  1LTL A;  4DR4 L;  4PZ6 A;  2K5N A;  1LM0 A;  1TWC H;  1PH5 A;  4JI0 L;  5JJL A;  1NBW A;  5IP9 H;  1PH2 A;  5IYB G;  4OO1 I;  4JI6 L;  3DM3 A;  1I94 Q;  1VQ5 A;  4KI0 A;  1M1K C;  2Z6K A;  3JAM i;  4LFB Q;  2UU9 Q;  2WAQ G;  2CQO A;  4A3E H;  3A74 A;  3BZK A;  3OYY A;  4HIO A;  3T1Y L;  1N34 Q;  1CSQ A;  3F2C A;  1K8A C;  1VQN A;  1Y1V G;  2IX0 A;  3H0G G;  4MZ9 A;  3CAM A;  1WYD A;  2R7D A;  5FLX c;  2VUM G;  4X65 Q;  4QJF A;  3PF5 A;  1R9T H;  1CKM A;  4A3G H;  4DR4 Q;  3ZJY C;  4GKK L;  5DLQ E;  1HNW L;  1QUQ B;  2VZA A;  4AH6 A;  4JI0 Q;  5C4J H;  1YHA A;  4JI6 Q;  4DV4 L;  4A75 A;  2IY5 B;  1NY4 A;  2NZH A;  2JA5 H;  5C4X G;  3AYH B;  4B3M L;  2F52 A;  3CCQ A;  3UDI A;  1JT8 A;  3T1Y Q;  2EQS A;  2MNA A;  2JE6 I;  2JA6 H;  1AH9 A;  3JC6 6;  3HOW G;  3IRB A;  4RMF A;  2HQL A;  1X3G A;  3E9I A;  3KF6 B;  2ASB A;  3CME A;  1K0R A;  1IBM L;  1HNW Q;  3KF8 B;  3RN5 A;  4GKK Q;  4DK3 C;  4JBW A;  3EBE A;  4A3M G;  3GTG H;  3GTP H;  2R7Z H;  4AYB E;  5GRO A;  4DV4 Q;  4HJ5 A;  4DR6 L;  3PGZ A;  4BXX H;  4B3M Q;  4IJH A;  1L1O C;  4NB3 A;  4GNX C;  3H3V I;  1Y14 B;  2RF4 A;  4DR1 L;  1MJE A;  4OWT B;  2E2I H;  1K83 H;  5IWA L;  1W2B A;  5C44 H;  4DUY L;  1TWH H;  3F2D A;  3CCJ A;  1IBM Q;  1PA6 A;  3HKS A;  3I4N H;  4BBS G;  1MIU A;  4A76 A;  3TS2 A;  1LUZ A;  1I5F A;  2PNH A;  1J6Q A;  3GO5 A;  4AYB G;  4DR6 Q;  1XNR Q;  3FHW A;  3L0O A;  2QEX A;  3CW2 C;  2Q2H A;  2QGQ A;  4P72 A;  5FLM G;  2GVA A;  3I4M H;  1VQO A;  4NXN L;  4OXP A;  4DR1 Q;  1XMQ L;  2JA7 G;  4BY1 H;  1X3F A;  5IWA Q;  2JJQ A;  3PCO B;  4DUY Q;  4A3J G;  2K14 A;  1YIJ A;  3HFZ B;  4OWX B;  1ASY A;  1UEB A;  4EQ5 A;  3I2Z A;  3HOX G;  4B3S L;  1PH9 A;  3UDX A;  4IO9 A;  4LF9 L;  2OQ0 A;  2OCE A;  4H02 A;  1B7Y B;  1B8A A;  1YJW A;  4IPD A;  4A3C H;  3PUW A;  3BU2 A;  4KLK A;  4NXN Q;  2HT1 A;  3KYH C;  1N32 L;  1XMQ Q;  3RLN A;  5HGQ A;  1X3E A;  5LMN L;  4JG2 A;  3F8T A;  5IP7 H;  4DR5 L;  1XMO L;  2NVQ H;  1WCM G;  3W5O A;  1AE3 A;  3U58 A;  4B3S Q;  3PO2 G;  2ALY B;  5ELO A;  2LSS A;  4GOP C;  2R93 G;  1NE3 A;  4LF9 Q;  4QY7 A;  1OXV A;  4YCU A;  2R6G A;  3M4O H;  4GKJ L;  3STB D;  4A93 G;  4B3T L;  2YTV A;  4DKA C;  4MTN A;  5GQO A;  1KRS A;  3CF5 A;  2DUD A;  1N32 Q;  3MEF A;  4UP9 A;  3RNU A;  2PMZ E;  5LMN Q;  3E0E A;  4XIG S;  4DR5 Q;  1XMO Q;  4A3B G;  4JBM A;  1EYG A;  1QVC A;  1IBL L;  1WOC A;  4P71 A;  1NTG A;  1KHI A;  3U4Z A;  1PH3 A;  4GKJ Q;  1K3R A;  3G71 A;  2C35 B;  2K5H A;  1H95 A;  1P8L A;  4X6A H;  1CKN B;  1QZG A;  4LWC A;  1KXL A;  4QGU A;  1MKH A;  1JJ2 A;  4LF6 L;  1PYB A;  2D0P A;  4LF4 L;  4LUO A;  1YI2 A;  4YCV A;  1M90 C;  3AFP A;  4HIK A;  1IBL Q;  4LFA L;  4A3L G;  3GD7 A;  4AIM A;  4GLA C;  2N8N A;  1QVF A;  2I0Q A;  5M3M G;  2PI2 A;  3KOJ A;  4UPA A;  3CMA A;  4LW1 A;  5IYD G;  2R92 H;  1IZ6 A;  3GTM H;  3ULL A;  3BZC A;  1YBY A;  2WP8 J;  5LMN W;  2I5H A;  1KAW A;  4LF6 Q;  2UXC L;  4R1J A;  2IHF A;  1S40 A;  1GD7 A;  3RLO A;  5FJ8 G;  4Y7N H;  3I55 A;  4A3K H;  3S15 H;  1QUQ A;  1YHB A;  4QQB X;  3CCU A;  1OXS C;  3J81 i;  4WJ4 A;  4LFA Q;  1YVC A;  4J15 A;  2I5L X;  5IP9 G;  3S24 A;  3K8A A;  4DV0 L;  3CD6 A;  1X65 A;  3S1Q H;  5M5X H;  4R4C A;  3WWV A;  3SGI A;  5JJI A;  2ZJR A;  3CP0 A;  1J5E L;  3KF6 A;  2OTJ A;  1RL2 A;  5C0X I;  1Y1W G;  2UXC Q;  3HKZ E;  4KHP L;  3S14 H;  1HZB A;  2ZTC A;  3PIP A;  1HZ9 A;  4P74 A;  1KC8 C;  2A8V A;  4YY3 L;  4JI7 L;  3ULP A;  1O7I A;  3A5U A;  4K0K L; 
#chains in the Genus database with same CATH topology
 1BXT A;  2F0M A;  4C3H G;  5C3E B;  2MO1 A;  2B2V C;  3DXJ C;  2DY8 A;  2RBM A;  3HOU H;  1V43 A;  1A15 A;  4XT1 B;  2AMC B;  4C3I G;  3KLR A;  4YY3 Q;  4U67 3;  4RGT A;  1PMR A;  3H3V C;  2YU9 H;  4IOC A;  1RTO A;  2J4X A;  2NUC A;  5A2Q L;  4QIW B;  3GDE A;  3G6E A;  2B63 G;  1YJN A;  4DR2 Q;  5DM7 3;  1JOK A;  3D4W A;  4GLX A;  3BVG A;  4ZKC B;  2BH2 A;  1EQT A;  3K5O A;  1KQS A;  2NVX H;  1BBX C;  3QO2 A;  1BUV T;  2J7Z A;  4IN3 A;  3PIO A;  2N55 A;  1PH8 A;  4JI1 Q;  3J7A V;  1VQK A;  4KN4 C;  1HA5 A;  2WAQ B;  1Y1V H;  2VQF Q;  1E7Z A;  1X6O A;  2ZTE A;  3NEL A;  1L0Y B;  5D65 A;  4DR3 L;  3OWE B;  3LX0 A;  1EY4 A;  1I3Q B;  1EIF A;  1PRT F;  1MHW C;  2D2C C;  2LS0 1;  2NZ1 D;  4OGQ C;  4ZCK A;  4IFD I;  2XRS D;  5JVG 3;  4DV6 L;  1X55 A;  4I7A A;  1I6H B;  1FNU A;  2CCZ A;  1E0B A;  3QOJ A;  3STB C;  2F3V A;  1XNQ L;  2PZU A;  3OW7 A;  1QJO A;  2F0J A;  5LL6 S;  4PMW A;  1JB3 A;  4DR7 L;  4DV3 Q;  2QCP X;  3KLW A;  4PG3 A;  5DAU A;  1EWI A;  4LF7 Q;  3OSO A;  1TWF H;  2EYL A;  5LMU L;  5IGE A;  1QZH A;  2EXZ A;  3RMH A;  1E22 A;  5FLM H;  1VQB A;  1FGU A;  1EWH A;  1RHP A;  3HRZ C;  1VMC A;  5COR A;  2Q8T A;  1WTW A;  1HR0 W;  2H1E A;  3FPU B;  4B3T Q;  1L0W A;  3C1F A;  3CCL A;  5ELC A;  1QE6 A;  1Q82 C;  4KTA A;  1GUG A;  2VL6 A;  3NEN A;  3S16 B;  1LTT D;  4JI4 L;  2FHT A;  3QWN A;  2UXD L;  1MGS A;  1HCZ A;  4CDC C;  3DLL A;  1X3Q A;  2R93 B;  3PO2 B;  4KKS A;  2UUC Q;  1IYJ B;  2KBN A;  3A55 A;  3OWF A;  1TY2 A;  4BY7 H;  3WDN A;  2A74 C;  4PMC A;  5BN5 A;  1SYE A;  3I4L A;  2K1B A;  3RD4 A;  4A3E G;  3ITP A;  1FGB D;  2HDM A;  3I7F A;  4O0A A;  3SVM A;  4A3F G;  5IOD A;  5E1F A;  2B3G A;  3CHB D;  1Q8I A;  1V8Q A;  4GLV B;  1EWC A;  4JI5 L;  5JEA J;  4GNX A;  5C3E H;  2IW3 A;  2Z4H A;  2Z9H A;  5GAH C;  3K5N A;  2EJM A;  2CW0 D;  3I3C A;  3SHL A;  2KED A;  2A6H C;  5DEH A;  3CKI B;  5M3M H;  4KHP Q;  5IGC A;  3NBI A;  5IYD H;  2HD3 A;  3IAY A;  1Y8O B;  1X54 A;  5BR8 Q;  1B53 A;  1XJV A;  3F2B A;  2NBF A;  3K80 C;  3KBX A;  2PW7 A;  1PHJ A;  3G48 A;  4JYA L;  1H9S B;  2A6H D;  3QOL A;  3KJO A;  2WAC A;  1YNN C;  1JWS D;  2KHS A;  1EY0 A;  1JWM D;  3TZD A;  1SFO B;  3IFD A;  1L1O B;  1HTL D;  2D62 A;  3EIV A;  3M4Y A;  5DNF A;  1Y1W B;  4R4T A;  1X3P A;  1XPR A;  5EPL A;  1HTP A;  1YNN D;  3HOV H;  3GTL B;  2GN5 A;  1PTO B;  2EVB A;  2O5J C;  4HJ8 A;  1DJR D;  4C3H B;  1X56 A;  3NTK A;  1VQ8 A;  1D5Z C;  1ESR A;  3P7J A;  4HJ7 A;  1I4H A;  1YZ6 A;  4DUZ Q;  3CC2 A;  4C3I B;  1Q81 C;  2AWN A;  1XNR L;  1STG A;  4OL7 A;  2X69 A;  5GAG C;  2YTY A;  2RDF A;  1SE2 A;  4DAP A;  5K36 G;  4TSS A;  2CH4 A;  4CKE A;  2QA4 A;  2B63 B;  5AJ3 Q;  1WTH A;  2VQE Q;  4G7H C;  2XGT A;  1E24 A;  1BDO A;  2F3I A;  2NN6 I;  1TWG B;  3T53 B;  2Q2I A;  3BJU A;  1JR0 D;  1OXU A;  1PVO A;  3BG3 A;  4H44 C;  2B2Y A;  5KIX A;  4OIJ A;  5EKK A;  2P5Z X;  3RLF A;  1C7Y A;  2NB0 A;  1STE A;  4YWK A;  5COY A;  4LF8 Q;  3DUZ A;  5CV6 A;  5KYL A;  3I73 A;  2F4V Q;  2PNR C;  1EU3 A;  2L1B A;  3A7L A;  3L2P A;  1N33 Q;  2PQE A;  4DV1 L;  1HNZ L;  1K73 C;  3DEO A;  4A3I H;  2R93 H;  1HQR D;  3PO2 H;  4UHV A;  4OO1 H;  2UUA Q;  4G4K A;  1LTG D;  4HIM A;  1SYF A;  1D5M C;  1TKW B;  4JCV E;  2OXP A;  2M9V A;  2Z1C A;  4F87 A;  1IYU A;  4K14 A;  3U9S A;  1E1O A;  2JA9 A;  3UDF A;  1ZYR C;  1VQM A;  1GKH A;  4UP7 A;  1SE4 A;  5BN4 A;  1DGS A;  3S2H B;  1WD1 A;  3HOU G;  5ELN A;  5E3F A;  1DD2 A;  1ZYR D;  3HEJ A;  3QG1 A;  1JQY D;  1PFS A;  3S17 H;  2N49 A;  1PZK D;  1X9N A;  1SMY C;  2L11 A;  3VA7 A;  5E4X A;  2HCI A;  4LF5 Q;  4CGY B;  1GUN A;  1SNQ A;  5FO9 B;  2K5N A;  1UAP A;  1LM0 A;  1TWC H;  1ZEQ X;  1SSO A;  4JI0 L;  1NBW A;  1TWA B;  1SMY D;  4JI6 L;  1I94 Q;  4KI0 A;  2RKS A;  3E6Z X;  2UU9 Q;  2K03 A;  1N34 Q;  1VQN A;  3AB9 A;  1K8A C;  3F2C A;  1Y1V G;  2IX0 A;  4A3E B;  4MZ9 A;  1VF5 C;  5FLX c;  1HNW L;  5EPJ A;  3ZJY C;  3E3X A;  4DR4 Q;  1AN8 A;  4A3F B;  2VZA A;  1U9R A;  1PTO H;  1YHA A;  2IY5 B;  1NY4 A;  2JA5 H;  3UDI A;  4OIK A;  2JE6 I;  2JA6 H;  3OOC A;  1EFI D;  3SE0 A;  1ENA A;  2QKI C;  1X3G A;  3E9I A;  4CDE C;  2ASB A;  3CME A;  4K2L A;  1IBM L;  1U4P A;  4GKK Q;  4DK3 C;  4IUN A;  3GTG H;  5FLX E;  4AYB E;  2VB2 X;  4DV4 Q;  4DR6 L;  3PGZ A;  4IJH A;  1L1O C;  4K8I A;  2RF4 A;  5IWA L;  4DUY L;  3I4N H;  2F0W A;  2E2I B;  2B8F A;  2C5C A;  3CU7 A;  4AYB G;  3A8I E;  4CDF C;  1XNR Q;  2SOB A;  1RJT A;  4P72 A;  1A6X A;  1MSH A;  2QGQ A;  5CV8 A;  5FLM G;  1T5E A;  4NXN L;  4J1M A;  4OXP A;  3TZU A;  4EQN A;  5KRU A;  4O1N A;  2JA7 G;  1YIJ A;  1PTO D;  1D1I A;  1CTM A;  2KVM A;  3BVZ A;  4OWX B;  4EQ5 A;  4TKO B;  3UDX A;  4KHV A;  5ELF A;  4ZRZ A;  2OQ0 A;  2Z4I A;  4H02 A;  1HQM C;  1YJW A;  3BU2 A;  1N32 L;  4JG2 A;  1XMO L;  4DXG A;  1AE3 A;  4PQX A;  1CHP D;  2EY5 A;  4LF9 Q;  1IKM A;  3I72 A;  2PZT A;  1BF4 A;  2FMC A;  2BDN A;  2HQE A;  4CHT B;  5C0X H;  3RNU A;  2PMZ E;  4XIG S;  4A3B G;  1PH3 A;  1LTS D;  5KNC A;  4XDX A;  2RQX A;  2C35 B;  2NVT B;  4M1U B;  4X6A H;  1CKN B;  1QZG A;  4WOR A;  1YNJ D;  4ZKB B;  1O7Y A;  4DNR B;  4LUO A;  4HIK A;  1DM0 B;  1EEI D;  1A2T A;  4A3L G;  1V1P A;  4K2K A;  2F3W A;  2WII B;  4X3T A;  5M3M G;  2PI2 A;  4CJ0 B;  5IYD G;  4KD4 A;  2R92 H;  1IZ6 A;  1YBY A;  5LMN W;  4ODG A;  5M5W B;  1GD7 A;  3S15 H;  5FJ8 G;  1PRT C;  1OXS C;  3A7A B;  3J81 i;  4WJ4 A;  5FKA C;  5EGT A;  2EYP A;  3S24 A;  2PZW A;  1WTO A;  3SGI A;  2O2L D;  3CP0 A;  2IX3 A;  5M5X B;  4ZYS A;  2UXC Q;  3OPO A;  3C46 A;  1HZB A;  1RCV D;  1ROD A;  2ZTC A;  3PIP A;  4YY3 L;  3S14 B;  1O7I A;  3HOV G;  5I2Y A;  1VQA A;  3ZYY X;  5C5M A;  3L7Z C;  4DK1 A;  2ENB A;  4A3F H;  3MA2 B;  4DR2 L;  1NSN S;  1FYC A;  2H5X A;  3HOU B;  3NQT A;  4JI7 Q;  1PH1 A;  1LO5 D;  2R7Z G;  1E1T A;  2SNS A;  1TQO A;  1STH A;  4JI1 L;  1VQE A;  2YU9 B;  1B9N A;  3N6R A;  1MD2 D;  2KOL A;  2VQF L;  4PZ7 A;  3SDZ A;  1AZP A;  2RHQ B;  3K0X A;  1YEZ A;  5IYB H;  3NEM A;  2C9O A;  3I4M G;  4K5W A;  1BO0 A;  4MIU A;  4P75 A;  5JEA G;  2AHO B;  4UDU C;  4CBV A;  4IPG A;  4KK7 A;  2RDH A;  3J81 j;  1Y1V B;  4UY8 C;  1ENF A;  1I4P A;  2MGS A;  4OX9 Q;  1ICW A;  1CQV A;  3TP7 A;  1BBW A;  1K8G A;  4LK1 C;  1MJC A;  4DV3 L;  1VS0 A;  4A3M H;  4ZK9 B;  1LAB A;  4LF7 L;  3W1B A;  1TT2 A;  5FK9 C;  1B3A A;  4C3J H;  2Q2U A;  2LY7 A;  2RDG A;  3PUY A;  1UE7 A;  1G91 A;  1S5F D;  1EFW A;  1STN A;  4GOP B;  4A3I G;  2TMP A;  4V19 0;  2KCM A;  4OO1 G;  4PNY A;  1IKL A;  3DWQ A;  3NHH A;  4AYB B;  4P2C B;  2E2J H;  3MAQ A;  4X3U A;  1OXT A;  1WFQ A;  2JA7 B;  3MTS A;  1TII D;  2ZJQ A;  2NVY H;  2NVT H;  4IZ8 A;  4L5S A;  2ID0 A;  4Z9C B;  2UUC L;  1CK1 A;  3TP6 A;  3GTK B;  1KAA A;  3MEH A;  2F0F A;  2DN8 A;  2QEJ C;  4DPG A;  4TVA B;  3CPW A;  4A3K G;  3AFQ A;  2NZO A;  1A3U A;  4HSP A;  1C8C A;  4R4Q A;  1EOT A;  5IY0 A;  1PTO F;  2KUM A;  2YV5 A;  1HJP A;  5M5W H;  4A93 H;  5I2X A;  2ATW A;  5G3L D;  2XWJ B;  3AEV A;  1DOL A;  4B9W A;  4XQN A;  1XPO A;  1SYD A;  4A4I A;  4LFC Q;  5J3B A;  2E5L Q;  1I4G A;  4JI8 Q;  1CHQ D;  1S72 A;  3EN2 A;  1FR3 A;  1TS3 A;  5I6Y A;  4FF4 A;  3MFY A;  1E2Z A;  3MXN A;  1EYC A;  2N3S A;  4ZAI A;  4FF2 A;  1EQQ A;  5BR8 L;  5CMD A;  5I6W A;  2HIX A;  2PMZ B;  4DNI A;  2IWH A;  3CRK C;  2JA5 G;  1PYS B;  1Q1E A;  1DOM A;  5IYC G;  2XWB B;  1Q1B A;  2JA6 G;  1A63 A;  1T9H A;  2CVR A;  2AQ2 B;  1SNM A;  2B29 A;  1F9P A;  5M3M B;  2L9H A;  2NWG A;  4R4I A;  1AP0 A;  2XNA C;  3LGJ A;  2QDL A;  3A56 A;  2KEN A;  4GN4 B;  2F0U A;  4RAU C;  3W1G A;  2Q2T A;  2RVL A;  4HN7 A;  3KJP A;  4AQY Q;  3I4N G;  4RKL A;  5KGU A;  3QIA A;  5FLX L;  3CCV A;  4C2M H;  2SEB D;  4DUZ L;  2FFK B;  5JVH 3;  1Q90 A;  2WV6 D;  5D3I B;  3CCM A;  4G57 A;  3HOV B;  4JI2 Q;  1BVS A;  4YIJ A;  5CV5 A;  4BBR H;  1EYA A;  2AKW B;  3A5Z B;  4X64 Q;  4JI3 Q;  1YIT A;  2PQA A;  4RCO A;  2BDO A;  3LNN A;  3TN2 A;  3J7Y W;  4YWM A;  5HY6 A;  3ICE A;  5AJ3 L;  1EQV A;  3DMU A;  2VQE L;  1D7Q A;  2R7Z B;  1VQH A;  3A0J A;  1SMX A;  2R61 A;  1F9S A;  1GHJ A;  4EX5 A;  3HS0 C;  3KUP A;  5CBE E;  5DM6 3;  1GHK A;  5K5P A;  3GP7 A;  2B2W C;  3P75 A;  1TU2 B;  2X6L A;  2YYZ A;  4QMG A;  3U50 C;  2LKV A;  3KDF A;  5I9P A;  1HH2 P;  2MFI A;  1IL2 A;  4JBJ A;  3RUZ A;  3U9O A;  5C4Z A;  5C0X G;  1VDZ A;  1W6K A;  4HTH A;  1LV9 A;  3NPP A;  4IUT A;  4TQU S;  1GM5 A;  3I4M B;  1I4R A;  2EOT A;  1J8I A;  3OTO Q;  1VQ4 A;  3TS0 A;  2OEO A;  4LF8 L;  4POF A;  2K50 A;  2UUB Q;  2F4V L;  4HJ9 A;  3BZD B;  1N33 L;  1EZ6 A;  3WOE A;  2JA7 H;  4FDB A;  4R8I A;  3G4S A;  4X66 Q;  5C3X A;  3K7A H;  1N9W A;  4RHS A;  4DK6 C;  4GN3 B;  2CWP A;  3CCS A;  3NBH B;  4IFD J;  2CQA A;  2UUA L;  3M9B A;  3GTK H;  4IUU A;  2R92 G;  3HOZ H;  3NE5 B;  2AQ1 B;  3FKI G;  2EIF A;  4JPB W;  4EQO A;  5CV7 A;  3TBI B;  3H15 A;  3PUX A;  2G9H D;  4NW2 A;  2KEE A;  4JOI C;  3ND9 A;  4A3I B;  3D4R A;  2RHS B;  3TRE A;  4K5V A;  3CPF A;  3S1R H;  1UE6 A;  4BA2 I;  4RH6 A;  2ZM6 Q;  1A3T A;  4A3B H;  4YHH Q;  4A3D G;  1ML0 D;  1VCI A;  2CW0 C;  4XQQ A;  3V2T A;  4NMZ A;  4LF5 L;  3OW2 A;  1LTB D;  4DAY A;  3HOY G;  4QUC A;  1WI5 A;  1WD0 A;  5ELB A;  1ILQ A;  4A3L H;  1VF7 A;  4A3K B;  1I94 L;  2JSO A;  2WIN B;  3MXU A;  2UU9 L;  3S17 B;  4ILW A;  1N34 L;  1HZA A;  4EVO A;  1KDC A;  5FJ8 H;  4XYQ A;  1Z6H A;  1EEF D;  1Z9F A;  4DR4 L;  4PZ6 A;  2O5I C;  1PH2 A;  1B44 D;  3P20 A;  4RGM A;  5IYB G;  1NR4 A;  4OO1 I;  1TWC B;  2R3Z A;  3DM3 A;  4MN3 A;  4DA2 A;  2L0C A;  3BZK A;  1O7Z A;  4HIO A;  4B9X A;  2BCO A;  1LAC A;  1WYD A;  1R9T H;  4F8M A;  1WVL A;  3W2D A;  4GKK L;  4OEL B;  1B1Z A;  3HP3 A;  3K0Y A;  3VA5 A;  4AH6 A;  5G3L F;  4DV4 L;  2NZH A;  1EU4 A;  4DNT B;  3AYH B;  3BYT B;  3CCQ A;  1PZJ D;  5F2D A;  1JT8 A;  2MNA A;  2JA5 B;  3JC6 6;  2NYZ D;  3HOW G;  1O78 A;  2HQL A;  3KF6 B;  4NP5 A;  2JA6 B;  1K0R A;  3H91 A;  4A3M G;  3TSS A;  2R7Z H;  1F2M A;  4C3J G;  1BQQ T;  1H9M A;  5GRO A;  3GTG B;  4Q0F A;  5I9O A;  4B3M Q;  2PW5 A;  5ELD A;  4FF3 A;  1MJE A;  3PO3 H;  2XIW A;  3PQI A;  3TP8 A;  5C44 H;  3CCJ A;  3ERQ A;  2VXW A;  4RFB A;  3I4N B;  3FDT A;  5T1I A;  2PNH A;  1J6Q A;  2QEX A;  1DZ1 A;  3I4M H;  4RGO S;  4NDX A;  5JEA H;  3J80 E;  1FNW A;  4BY1 H;  2JJQ A;  3PCO B;  5LHY 1;  3HFZ B;  4DAV A;  2K32 A;  1SE3 A;  2B2T A;  2OF1 A;  3D8G A;  1S5E D;  4LF9 L;  2RSO A;  1B7Y B;  4A3C H;  4KLK A;  2EDG A;  2HT1 A;  1M8A A;  1SNC A;  3KYH C;  2I07 B;  1X3E A;  5EKI A;  5IP7 H;  3F8T A;  2O4X A;  5IIF A;  3W5O A;  1STY A;  4Q5V A;  3U58 A;  4B3S Q;  2ALY B;  2LSS A;  5IGF A;  4QY7 A;  4A93 G;  3SK8 A;  3T13 A;  3K59 A;  3CF5 A;  3MEF A;  5EPK A;  2QF7 A;  1VMP A;  5IT9 E;  3S1N B;  4UP9 A;  2B2V A;  3KK7 A;  1EYG A;  4JBM A;  3J7A F;  4KMU C;  1KHI A;  4GKJ Q;  2PPB C;  1H95 A;  3R8B A;  1LT3 D;  1BCP B;  1PFB A;  1B3Q A;  1BR9 A;  4LF4 L;  1YI2 A;  1M90 C;  3T4A C;  3VYR A;  4X3S A;  3X3M A;  4AIM A;  2N8N A;  3R93 A;  4L63 B;  3CMA A;  3KOJ A;  2J0T D;  3BZC A;  2WP8 J;  2UXC L;  4R1J A;  2R92 B;  2EY2 A;  3RLO A;  3I55 A;  3FKI B;  1HUM A;  2F0P A;  1QUQ A;  4A3K H;  3S15 B;  4LFA Q;  1J9O A;  2I5L X;  2NTT A;  1BNZ A;  3CD6 A;  1D6E C;  4R8N A;  3WOF A;  2ZJR A;  2X6G A;  5C0X I;  1ONL A;  1PFN A;  3KF8 A;  2WKC A;  1KC8 C;  4JI7 L;  1SYC A;  3ULP A;  4GZY C;  3A5U A;  4EGV A;  4DV0 Q;  1OTC A;  3DEP A;  5TSS A;  4A3D B;  4BBR G;  2B2W A;  2L15 A;  1SXT A;  1EY9 A;  3I4O A;  3MWY W;  3X3N A;  2K04 A;  4L5R C;  1W6J A;  2A19 A;  4DGZ A;  2CHB D;  3HOY B;  5IYC H;  4BXX G;  1QOH A;  2OT2 A;  2AUJ D;  3S2D B;  1QWY A;  2F0T A;  1LT4 D;  3UE0 A;  1GUT A;  2F4I A;  3NK9 A;  1CI3 M;  5M5Y H;  1EL0 A;  1BKB A;  3GV3 A;  5JAV A;  3VR5 A;  1WTP A;  1EUJ A;  4GNX B;  1GVP A;  1KRT A;  4OX9 L;  2JK8 A;  4HMI A;  1OXX K;  3GTQ H;  1P16 A;  2JYO A;  3ND8 A;  4MHE A;  3K57 A;  5EAY A;  3H0G H;  1WJJ A;  4R4O A;  1PTO C;  3C1E A;  3I8Z A;  2HHH Q;  2HIV A;  3F1Z A;  4DK0 A;  1FVI A;  3W3A A;  3PUV A;  4FVM A;  1VQC A;  2HUG A;  4KD3 A;  4DV2 Q;  3ERO A;  4ALP A;  4JOI A;  2F0V A;  5C4X H;  3OMC A;  1B70 B;  1UUP A;  3H6M A;  1EOV A;  4LNQ A;  3BDC A;  4OWW B;  3PV0 A;  3HOW B;  1Q86 C;  1HR0 Q;  4DV7 Q;  1HZC A;  1EY7 A;  3TRZ A;  2IJ0 A;  4A3M B;  1HNX Q;  3HOZ G;  3RN2 A;  1K8O A;  4C3J B;  4H7B A;  2WB1 E;  4KJO A;  4WFN 3;  3F2U A;  4HSV A;  3K58 A;  2A1A A;  4FF1 A;  1TVX A;  3T56 B;  2WKD A;  4BBS H;  2EE1 A;  3IL8 A;  1PV4 A;  1D2B A;  1AZQ A;  3S1N H;  4YWL A;  2A6E D;  1K9M C;  1KDB A;  2D5D A;  1YNJ C;  3ONA B;  5JJZ A;  2CH4 W;  2EY1 A;  5J1Z A;  4ME3 A;  4A3J H;  2E2J B;  1RKN A;  4JC0 A;  3QJY A;  1K8M A;  4G7Z C;  2F0D A;  4L5Q A;  2NVY B;  1SBB B;  1E2V A;  4DV5 Q;  1D1K A;  4B3R Q;  3R2T A;  3A8K E;  2Z6B A;  1JE5 A;  2DNC A;  2MQH A;  1KIX A;  1AE2 A;  5JPN C;  1E3P A;  1NCV A;  4X62 Q;  1IBK Q;  4PZ8 A;  1YNX A;  3T1H Q;  1Q46 A;  4PV1 C;  4LFC L;  1NNX A;  3K81 C;  4KJN A;  2PI2 E;  1I4X A;  2E5L L;  4JI8 L;  1I50 H;  4DU9 A;  3PIO 3;  2JQO A;  3FKI H;  2KA7 A;  3FEW X;  1C9O A;  5NUC A;  4LF4 Q;  4A93 B;  1U5K A;  1VQJ A;  5FO8 B;  1T5X D;  5EBC A;  4HR7 B;  1OO9 B;  2SDF A;  3QR8 A;  3NWT A;  3KFU A;  2E2D C;  1NMG A;  2XN9 C;  2Z8L A;  3AU7 A;  1FJG L;  2KHJ A;  1SN8 A;  2F0L A;  2KCT A;  1U0L A;  4HMJ A;  2F1M A;  1B50 A;  4RKB A;  1EZ8 A;  1BCP D;  1I4Q A;  4A3D H;  4IUR A;  4GS3 A;  1SJH D;  3VR2 A;  4L5T A;  3CXC A;  2K4K A;  1SYG A;  1QIL A;  2ICI A;  2RCN A;  4AQY L;  2FJ2 A;  1SRO A;  4CKB A;  2EPB A;  2ES2 A;  2FMM A;  3HOY H;  2OTL A;  1ILP A;  4O42 A;  3S2D H;  1NMF A;  1G51 A;  1RF2 D;  5A35 A;  4KKT A;  2JP1 A;  4P73 A;  1HUN A;  1XPU A;  3PO3 G;  4JI2 L;  2K5D A;  5C44 G;  3GTO H;  1F9Q A;  1A3V A;  1GUO A;  1U4L A;  2MP1 A;  4JI3 L;  4X64 L;  1LT6 D;  4POG A;  1DON A;  1RTN A;  1VQ6 A;  1SE8 A;  2EYH A;  1R4Q B;  1S5B D;  1SYB A;  2UXB Q;  4C2M B;  3RZO H;  1PH7 A;  1O7L A;  1Z47 A;  2L5T A;  4HJA A;  2K33 A;  3J7Z C;  5C4J B;  4O2D A;  4BY1 G;  3P1H A;  5IGD A;  2VW9 A;  4BBR B;  3E9H A;  1SLJ A;  3PUZ A;  3J80 L;  4A3C G;  2KCN A;  1R4P B;  1V1Q A;  1CUK A;  3HOW H;  5T1G A;  5IP7 G;  1U4R A;  3EVQ A;  1MI2 A;  1JB7 A;  3N52 A;  3OTO L;  1KNE A;  5C3W A;  3SK6 A;  1UE1 A;  1VQ7 A;  5E7N A;  2UUB L;  2D0O A;  3RZD H;  4NXM Q;  1V9P A;  3NUC A;  1B9M A;  4UAI A;  1S5D D;  4X66 L;  2K01 A;  1VQI A;  4JV5 Q;  5IGG A;  1K28 A;  2Y0S E;  1EQR A;  2HDL A;  5IT9 L;  2PO4 A;  4K8J A;  4LUV A;  1O80 A;  1EY8 A;  3M7N A;  3CQZ H;  1F2Z A;  3NXW A;  3EFX D;  3U4V A;  3L9A X;  2N88 A;  4FXK C;  3CCE A;  3K7A B;  2DJF C;  2Y0S G;  2IL8 A;  2JA8 G;  4N9P A;  2DNE A;  5GAE C;  3VYT A;  3D4D A;  3HOZ B;  3EJI A;  2ZM6 L;  4RG1 A;  3MHB A;  4YHH L;  3M4Q A;  2VY3 A;  2E8G A;  3Q8D A;  5M3F H;  2EJF C;  1JJG A;  3Q6S A;  4XTC S;  4QUF A;  4K5X A;  3S1R B;  1F9R A;  2ZXO A;  2CKZ B;  1HFN A;  3OIQ A;  3NWS A;  4A3B B;  1H9S A;  4R9W A;  4J6H A;  1KTK A;  3OIP A;  1ASZ A;  3J7A 5;  1L1O A;  3A54 A;  1STA A;  3CCR A;  2K28 A;  3FVQ A;  3TEH B;  2B2Y C;  1S5C D;  1FJG Q;  1PH6 A;  5CV4 A;  1IXR A;  1N36 Q;  4QCL A;  1VQP A;  4BA1 I;  3H3V H;  1PXU A;  2NN6 G;  2A69 C;  1JWU D;  4NKL A;  1Z7T A;  2DJG C;  3HZX A;  4FO2 A;  1HFG A;  2M2L A;  2VB3 X;  4LFB Q;  1V1P B;  2CQO A;  2E76 C;  3DM1 A;  2A69 D;  2ZXP A;  3A74 A;  3OYY A;  1CSQ A;  4DXF A;  3H0G G;  3CAM A;  3TDQ A;  3PMF A;  2VUM G;  4X65 Q;  3PF5 A;  4A3G H;  4N9T A;  1R9T B;  2V4D A;  1QG7 A;  5C4J H;  4FP5 D;  4A75 A;  1DXM A;  2ICE C;  3BVM A;  1MSG A;  3MZ5 A;  4B3M L;  2F52 A;  5C4X G;  3T1Y Q;  2EQS A;  1AH9 A;  1GUW A;  4K6L A;  4WRD A;  5CC4 A;  3I91 A;  3RN5 A;  3VR3 A;  1D5X C;  2AQ3 B;  2QW7 A;  3GTP H;  4I7Z C;  4BXX H;  5J22 A;  1BCP F;  4NB3 A;  3GTJ B;  1ET6 A;  1Y14 B;  4OWT B;  1K83 H;  3D3R A;  1W2B A;  1TWH H;  3F2D A;  3D6C A;  4BBS G;  1PDQ A;  2KJX A;  1MIU A;  2JN4 A;  3PO3 B;  5C44 B;  4RWS C;  4A76 A;  1ZKO A;  5KYI A;  3TS2 A;  1LUZ A;  1I5F A;  1PLF A;  3TME A;  4FXD A;  3L0O A;  3SR1 A;  2XVS A;  2Q2H A;  4ME5 A;  1STB A;  4DR1 Q;  4XQJ A;  4A3J G;  4HED A;  2MUY A;  4BY1 B;  1ASY A;  4RHR A;  1C4Q A;  4K6D A;  4V0B A;  3HOX G;  1CA5 A;  1PFM A;  4B3S L;  1WTQ A;  1PH9 A;  2OCE A;  5BN3 A;  1B8A A;  4IPD A;  5CV9 A;  4JK1 C;  3PUW A;  1UNS A;  2H4O A;  4ID6 A;  1XMQ Q;  3RLN A;  4ABN A;  5HGQ A;  1IW7 C;  3OMG A;  2NVQ H;  4RA8 A;  1DYQ A;  4JVZ A;  1WCM G;  2F0N A;  4GOP C;  4LJZ C;  1NE3 A;  3D6W A;  3M3Y B;  4GKJ L;  3M4O H;  3STB D;  1ET9 A;  4DKA C;  1K0S A;  4MTN A;  2K5Q A;  1KRS A;  2DUD A;  1IW7 D;  1Q3L A;  3URY A;  1CA6 A;  4IAL A;  5LMN Q;  2A73 B;  3E0E A;  1PYW D;  1GOZ A;  4DR5 Q;  1H9J A;  1WOC A;  3U4Z A;  3T16 A;  1K3R A;  2XSC A;  1P8L A;  2TSS A;  1JOR A;  1KXL A;  4QGU A;  1MKH A;  1JE4 A;  1PYB A;  4KKU A;  2A68 C;  4L6T B;  1IBL Q;  1TS5 A;  4LFA L;  2K5W A;  1DCZ A;  1IYV A;  3V96 A;  1QVF A;  1TR5 A;  1AFP A;  3GTM H;  2Y0S B;  2KEC A;  2I5H A;  2JA8 B;  4LF6 Q;  2KCC A;  2A68 D;  2IHF A;  3G6J B;  3SK4 A;  1EY5 A;  4QQB X;  4Y7N H;  3CCU A;  1YVC A;  4J15 A;  2BOS A;  5IP9 G;  4TRD A;  4DV0 L;  3S1Q H;  1B2T A;  1CT1 D;  1SEB D;  4R4C A;  1H9R A;  1ZXT A;  1B4O A;  3QB3 A;  3A8J E;  3FMC A;  1SNP A;  1RL2 A;  3FRP B;  1EYD A;  3HKZ E;  5C5L A;  1HZ9 A;  4P74 A;  2F0Q A;  3GQB A;  5CGK A;  1SRU A;  4KHZ A;  4NPS A;  1JOQ A;  3E0J A;  1NJI C;  1AEX A;  1J5E Q;  1A62 A;  2CWA A;  4IFD H;  3HKZ G;  2K52 A;  1L0X B;  1Q12 A;  2RSN A;  4BS9 A;  2LMC B;  1F2L A;  1HXY D;  4K0K Q;  2FIN B;  4KY5 A;  2F0I A;  3I56 A;  4IUQ A;  2JXM B;  1HPC A;  2GA4 B;  1BBU A;  3MC0 B;  3M85 A;  2VS1 A;  3MXN B;  3VR6 A;  2KHI A;  2HHH L;  5JPM C;  5M5Y B;  3J80 c;  3ERS X;  3GTJ H;  1XWE A;  4DV2 L;  2OQK A;  4KN7 C;  4Y52 H;  1SND A;  3MFG A;  3S1M B;  1CM9 A;  5KNB A;  3ER0 A;  4GN5 A;  3GTQ B;  3HG9 A;  2F0O A;  2OWO A;  1I6V C;  2EYJ A;  2LFN A;  3H0G B;  1JC7 A;  4UP8 A;  2RA4 A;  1HR0 L;  1I3Q H;  4DV7 L;  2VUM B;  1HNX L;  5JJK A;  2EYO A;  5J39 A;  1W3S A;  1I6H H;  5C4X B;  4HAE A;  3B6Y A;  3PSI A;  4BWG B;  1CFM A;  2Z6K C;  1L2F A;  1LTA D;  1SR3 A;  1GO3 E;  4DR3 Q;  1MBY A;  5IT9 c;  4MTK A;  2JEB I;  4U68 A;  2DY7 A;  1CKN A;  1G6Z A;  1WTV A;  1IHZ A;  1TS2 A;  5C6A A;  3DHQ A;  2F0E A;  1JIC A;  3BS1 A;  4DV6 Q;  3AMU A;  1G29 1;  3O13 A;  4X3K A;  3PIP 3;  3M3Y H;  3UE1 A;  1QVG A;  3Q22 A;  2PQA B;  5M3F G;  4KY6 A;  4BBS B;  3GV6 A;  2I46 A;  5LL6 X;  1VQL A;  1XNQ Q;  2EY6 A;  4DV5 L;  4B3R L;  1GJX A;  3TQY A;  4B08 A;  2Z0S A;  1CQF A;  1UEA B;  2E75 C;  5FO7 B;  2BH8 A;  4X62 L;  1IBK L;  4DR7 Q;  2IPK D;  2MO0 A;  3VR4 A;  1G8Z D;  3T1H L;  4A3J B;  4QL5 A;  3Q23 A;  5LMU Q;  3HOX B;  3KDF B;  1Y69 U;  3S16 H;  2NTS A;  5E4W C;  1SAP A;  2XRQ D;  2G5D A;  1UWV A;  2N78 A;  2R7F A;  1U4M A;  1WCM B;  1RDP D;  1RIP A;  2JA8 H;  2E2H B;  2DGY A;  2KQ3 A;  4IQZ A;  1I50 B;  1PRT B;  3S9W A;  3J81 c;  4IUP A;  4ULL A;  4PMB A;  1NAP A;  4CJ2 C;  4JI4 Q;  4S3S A;  4E6I A;  1RD9 D;  2UXD Q;  2B2U C;  1PH4 A;  1KLG D;  4M8A A;  1ENC A;  3AQQ A;  2JEA I;  1LTR D;  2IHE A;  3I90 A;  3KLS X;  4LUZ A;  3MXP A;  2F0K A;  4A3G G;  3JAM c;  2BA1 A;  4CDD C;  5FOB B;  3J81 E;  4DFA A;  2EXD A;  2ZJP A;  1QNK A;  1YJ9 A;  1VQG A;  2FXQ A;  3EQL C;  2GVB A;  1LTI D;  1NR2 A;  3PF4 A;  5KEE A;  4LMQ D;  1CZG A;  3CC4 A;  1XTD A;  2IT1 A;  3BDO A;  5GAD C;  4JI5 Q;  3JAM E;  2UXB L;  4J8Q A;  1H9K A;  4FYD A;  4OON A;  4HCE A;  1SFO H;  4IPH A;  2I5M X;  1KDA A;  2NN6 H;  2LXK A;  4OHJ A;  1S3O A;  3VDY A;  2B8G A;  2YTX A;  3GTO B;  4I65 A;  1Y1W H;  2EZV A;  4DAY B;  2BE5 C;  3GTL H;  1Y8N B;  5AFW A;  4JYA Q;  3S1M H;  1EIG A;  5C0X J;  3RZO B;  3T51 B;  2L12 A;  2PCF B;  4C3H H;  5A2Q E;  4GOP A;  3K6O A;  2BA0 A;  2ZXR A;  2VUM H;  2BE5 D;  3ULJ A;  4KY7 A;  3NQI A;  3HKZ B;  5EQ0 A;  4C3I H;  4XT3 B;  1KL9 A;  1SDF A;  3EA6 A;  2EYF A;  2F03 A;  1QCB D;  4ZQ3 A;  3J80 i;  4NXM L;  1VQ9 A;  4MNO A;  1QNU A;  4HID A;  2AWO A;  2B63 H;  3VYU A;  5ELE A;  2ZT9 C;  2F0S A;  1SNO A;  1F77 A;  4C1N I;  4JV5 L;  3C3L A;  1CKO A;  5C4H A;  1G6P A;  3G7L A;  1D8L A;  2A6E C;  1TWG H;  4XYO A;  4L8J A;  3K7U C;  4IPC A;  3RZD B;  4YCW A;  1V1O A;  2K7V A;  3H09 A;  1A8V A;  1AW7 A;  3FP9 A;  1JOO A;  1KD1 C;  1N8R C;  1LLR D;  3CC7 A;  1XYI A;  1G2T A;  2WB1 G;  3D31 A;  1E2W A;  3MVV A;  2K6A A;  3D0F A;  3I70 A;  3M4P A;  2XTI A;  3SEB A;  4C1N K;  2WFW A;  1FL0 A;  1A0I A;  2CFM A;  3CQZ B;  3HOX H;  2K5V A;  4XXE A;  1VQD A;  3Q24 A;  4DAM A;  3IFT A;  3TP5 A;  3RR5 A;  1HA6 A;  1IL8 A;  1LYL A;  4JBK A;  2V1C C;  1C0A A;  4ZLT F;  1FD7 D;  2G9D A;  4CJ1 B;  3UDG A;  1FNV A;  1WCM H;  4BY7 G;  2A5H A;  1YHQ A;  1JMC A;  2E2H H;  1SJE D;  1HHV A;  5EJW A;  4F88 A;  1LT5 D;  4KV6 A;  5M3F B;  5D3D A;  4C56 C;  3V05 A;  1UE5 A;  4DV1 Q;  1TXY A;  1HNZ Q;  2VNU D;  1CSP A;  1K3B C;  4CKC A;  5I4D A;  1WTR A;  1BCP C;  5KND A;  2HCC A;  5C3E G;  4IOA A;  2LXJ A;  1Q7Y C;  4DN4 M;  4QIW E;  3S2H H;  1EY6 A;  1N36 L;  1JJC B;  4IFD G;  2Q8R E;  3Q0A A;  3E5S A;  2K75 A;  1KAB A;  4APV A;  1EIY B;  1XTC D;  1Q8K A;  1XX8 A;  5IE8 A;  1VQF A;  4FNF A;  2SNM A;  4IJL A;  4LFB L;  2WAQ E;  4WJ3 M;  4OEM B;  2IX1 A;  2ZTD A;  1NUC A;  3UI2 A;  5H1S E;  4X65 L;  1ICF B;  3BYY B;  1TWA H;  1LTL A;  1PRT D;  5HGT A;  3NP8 A;  1PH5 A;  3CRL C;  5JJL A;  2B39 A;  5IP9 H;  1KNA A;  1VQ5 A;  1M1K C;  2Z6K A;  3JAM i;  2WAQ G;  4A3E H;  3T1Y L;  2L4N A;  3K5M A;  3OHX C;  2F0G A;  2R7D A;  2MHV A;  4QJF A;  1CKM A;  5DLQ E;  3SK5 A;  5CBA E;  1QUQ B;  4JI0 Q;  4A3G B;  4JI6 Q;  1GUS A;  3H94 A;  4RGN A;  2K05 A;  3IRB A;  4RMF A;  4ZUJ A;  1HNW Q;  3KF8 B;  4JBW A;  3EBE A;  5EKL A;  1DOK A;  4ZUI A;  4EQP A;  5CYU A;  2D9U A;  3GTP B;  4HJ5 A;  4G7O C;  4QF4 A;  4FXG C;  1GXD C;  3IKJ A;  4GNX C;  3H3V I;  2NVX B;  1ESF A;  4DR1 L;  2E2I H;  1IBM Q;  1PA6 A;  3HKS A;  1K83 B;  3M7G A;  1M4V A;  1TWH B;  3NBH A;  2AUK A;  3FPP A;  3GO5 A;  3L3O C;  4DR6 Q;  3FHW A;  3CW2 C;  1CZW A;  2Q8I B;  2GVA A;  1VQO A;  3HGB A;  1JCK B;  2QIL A;  3R3O A;  1XMQ L;  1X3F A;  5IWA Q;  4DUY Q;  3NTI A;  2M00 A;  2K14 A;  5D14 A;  5JOB A;  3C2P A;  1UEB A;  3I2Z A;  2QDB A;  2EJG C;  1F2Y A;  3NTH A;  5IOC A;  4IO9 A;  1WTX A;  5HUR A;  2F0H A;  4NXN Q;  4JW0 A;  3DWP A;  2B2U A;  4HCS A;  4N8X 1;  5LMN L;  1HRJ A;  4IUV A;  5ISR A;  4DR5 L;  2R93 G;  3PO2 G;  5ELO A;  2NVQ B;  5K36 H;  1OXV A;  4YCU A;  1A2U A;  2R6G A;  3K5L A;  4WJW A;  4B3T L;  2YTV A;  3R2I A;  3NSW A;  5GQO A;  3M4O B;  1N32 Q;  3DWA A;  5CR3 A;  1TWF B;  5EBD A;  3KLS A;  1TS4 A;  4N8F A;  4QB4 A;  2L55 A;  4F7X A;  1XMO Q;  2E74 C;  1QVC A;  1IBL L;  4H0L C;  4P71 A;  1NTG A;  3G71 A;  1XXG A;  2K5H A;  2MPM A;  1C48 A;  4LWC A;  1JJ2 A;  4LAA A;  4LF6 L;  2D0P A;  2WB1 B;  4YCV A;  2PYK A;  3AFP A;  1II3 A;  1QB5 D;  1S4Z A;  5L37 A;  3GD7 A;  4GLA C;  1Y8P B;  2I0Q A;  1X32 A;  4UPA A;  4LW1 A;  3ULL A;  3LWE A;  4RCN A;  1KAW A;  3J81 L;  2B2T C;  1S40 A;  3GTM B;  3SXH A;  1YHB A;  1EIH A;  3LWU A;  4Y7N B;  3K8A A;  1KLU D;  1PZI D;  2EYM A;  1X65 A;  4BY7 B;  1BOS A;  5M5X H;  3WWV A;  5JJI A;  4DF7 A;  1J5E L;  3KF6 A;  4H13 C;  3S1Q B;  2OTJ A;  3MXG A;  2MJ8 A;  2RCF A;  1Y1W G;  3KBG A;  4KHP L;  3S14 H;  1G2S A;  5IGB A;  3VYS A;  3JAM L;  5M9O A;  3BDL A;  2A8V A;  1TY0 A;  4K0K L; 
#chains in the Genus database with same CATH homology
 3HOV G;  1SRU A;  4KHZ A;  4NPS A;  4DV0 Q;  1OTC A;  1VQA A;  1NJI C;  2MO1 A;  4BBR G;  2L15 A;  3L7Z C;  1J5E Q;  1A62 A;  2CWA A;  3I4O A;  3HOU H;  4A3F H;  3HKZ G;  1V43 A;  2K52 A;  4DR2 L;  1Q12 A;  2AMC B;  2H5X A;  4L5R C;  4YY3 Q;  4JI7 Q;  2A19 A;  1PH1 A;  2R7Z G;  1E1T A;  4K0K Q;  5IYC H;  3I56 A;  4BXX G;  2YU9 H;  4IOC A;  3GDE A;  1BBU A;  1VQE A;  4JI1 L;  3UE0 A;  3G6E A;  3M85 A;  1YJN A;  2B63 G;  2VS1 A;  5M5Y H;  3MXN B;  4DR2 Q;  1BKB A;  2VQF L;  4PZ7 A;  2KHI A;  2HHH L;  2RHQ B;  4GLX A;  3J80 c;  3K0X A;  2BH2 A;  1EUJ A;  1KQS A;  4GNX B;  3ERS X;  3GTJ H;  1GVP A;  2NVX H;  1KRT A;  1YEZ A;  2JK8 A;  5IYB H;  3NEM A;  4OX9 L;  4DV2 L;  3I4M G;  2OQK A;  4P75 A;  5JEA G;  3PIO A;  1PH8 A;  2AHO B;  4Y52 H;  4JI1 Q;  1OXX K;  3GTQ H;  1P16 A;  4IPG A;  1VQK A;  3ER0 A;  1Y1V H;  4GN5 A;  5EAY A;  3J81 j;  3H0G H;  1WJJ A;  4R4O A;  2VQF Q;  2OWO A;  1E7Z A;  1X6O A;  2ZTE A;  3NEL A;  2HHH Q;  4UY8 C;  2HIV A;  3F1Z A;  4UP8 A;  1FVI A;  3PUV A;  1HR0 L;  1I3Q H;  4DV7 L;  4DR3 L;  1VQC A;  4OX9 Q;  1HNX L;  4DV2 Q;  1EIF A;  4ALP A;  4JOI A;  5JJK A;  1BBW A;  5C4X H;  1K8G A;  4IFD I;  1W3S A;  1I6H H;  4DV6 L;  1B70 B;  1X55 A;  1EOV A;  3B6Y A;  4LNQ A;  3PSI A;  1MJC A;  2Z6K C;  1L2F A;  2CCZ A;  3PV0 A;  4OWW B;  4DV3 L;  1VS0 A;  1SR3 A;  1GO3 E;  1Q86 C;  4A3M H;  1HR0 Q;  4LF7 L;  4DV7 Q;  1HZC A;  3W1B A;  4DR3 Q;  3TRZ A;  5IT9 c;  1HNX Q;  4C3J H;  3HOZ G;  3STB C;  2Q2U A;  2JEB I;  3PUY A;  3RN2 A;  1UE7 A;  1XNQ L;  1CKN A;  1EFW A;  4DV6 Q;  2WB1 E;  4GOP B;  4A3I G;  1G29 1;  2A1A A;  3M3Y H;  2KCM A;  4PMW A;  3UE1 A;  4DR7 L;  4DV3 Q;  1QVG A;  3KLW A;  4PG3 A;  4BBS H;  1EWI A;  4OO1 G;  2PQA B;  5M3F G;  4LF7 Q;  1PV4 A;  1TWF H;  5LMU L;  1QZH A;  3S1N H;  4YWL A;  1VQL A;  1XNQ Q;  1E22 A;  4DV5 L;  4B3R L;  1K9M C;  5FLM H;  3TQY A;  1VQB A;  1FGU A;  2Z0S A;  2E2J H;  2BH8 A;  1OXT A;  4X62 L;  1IBK L;  4DR7 Q;  2MO0 A;  4ME3 A;  4A3J H;  4JC0 A;  1WFQ A;  3T1H L;  1HR0 W;  2ZJQ A;  2NVY H;  2NVT H;  4QL5 A;  4B3T Q;  4L5Q A;  2ID0 A;  4L5S A;  5LMU Q;  1L0W A;  3CCL A;  4DV5 Q;  4B3R Q;  3KDF B;  2UUC L;  1JE5 A;  2MQH A;  3S16 H;  1Q82 C;  1KIX A;  1AE2 A;  2VL6 A;  1E3P A;  3NEN A;  4X62 Q;  1IBK Q;  4PZ8 A;  4DPG A;  1YNX A;  4TVA B;  3CPW A;  1UWV A;  3AFQ A;  4A3K G;  3T1H Q;  4JI4 L;  1Q46 A;  2N78 A;  2R7F A;  2NZO A;  4LFC L;  2UXD L;  3K81 C;  4R4Q A;  3DLL A;  2E5L L;  2PI2 E;  5IY0 A;  1RIP A;  4JI8 L;  2YV5 A;  1HJP A;  1I50 H;  5M5W H;  2JA8 H;  2DGY A;  2UUC Q;  4A93 H;  1IYJ B;  2JQO A;  2KBN A;  3FKI H;  3J81 c;  1C9O A;  2ATW A;  4LF4 Q;  3AEV A;  1U5K A;  1VQJ A;  4JI4 Q;  1XPO A;  4A4I A;  4BY7 H;  4LFC Q;  2UXD Q;  5J3B A;  1PH4 A;  2E5L Q;  4A3E G;  3KFU A;  4JI8 Q;  1NMG A;  1S72 A;  3AQQ A;  3EN2 A;  1FJG L;  2KHJ A;  2JEA I;  2IHE A;  4LUZ A;  1SN8 A;  3I7F A;  4O0A A;  4A3F G;  2KCT A;  2B3G A;  1U0L A;  2BA1 A;  2N3S A;  3JAM c;  4A3G G;  4GLV B;  1EQQ A;  5BR8 L;  4JI5 L;  5JEA J;  4A3D H;  4GNX A;  2HIX A;  4DNI A;  4GS3 A;  2EXD A;  5GAH C;  5C3E H;  2ZJP A;  2JA5 G;  1YJ9 A;  1PYS B;  4L5T A;  1Q1E A;  1VQG A;  5IYC G;  3CXC A;  2FXQ A;  1Q1B A;  2K4K A;  2JA6 G;  1A63 A;  2GVB A;  1T9H A;  2RCN A;  3PF4 A;  5M3M H;  4KHP Q;  4AQY L;  5IYD H;  1SRO A;  2B29 A;  1X54 A;  2ES2 A;  3CC4 A;  1XTD A;  2IT1 A;  4R4I A;  5BR8 Q;  3HOY H;  5GAD C;  1XJV A;  4JI5 Q;  3F2B A;  2OTL A;  3LGJ A;  3S2D H;  1NMF A;  3K80 C;  2UXB L;  1G51 A;  2KEN A;  4GN4 B;  1PHJ A;  3G48 A;  4JYA L;  4P73 A;  3W1G A;  3KJO A;  4OON A;  2Q2T A;  1SFO H;  1XPU A;  4IPH A;  2I5M X;  3PO3 G;  4JI2 L;  3KJP A;  5C44 G;  4AQY Q;  3GTO H;  2LXK A;  3I4N G;  1S3O A;  3VDY A;  2YTX A;  1Y1W H;  1L1O B;  4JI3 L;  4X64 L;  3CCV A;  2D62 A;  4C2M H;  3EIV A;  4DAY B;  4POG A;  1VQ6 A;  1SE8 A;  3GTL H;  4R4T A;  4DUZ L;  2UXB Q;  1XPR A;  3RZO H;  1PH7 A;  4JYA Q;  3S1M H;  5C0X J;  3HOV H;  1Z47 A;  4HJA A;  2GN5 A;  3J7Z C;  3CCM A;  4O2D A;  4BY1 G;  4C3H H;  4JI2 Q;  1BVS A;  4BBR H;  4GOP A;  4HJ8 A;  2BA0 A;  2VW9 A;  1X56 A;  1VQ8 A;  2VUM H;  2AKW B;  3A5Z B;  3E9H A;  3ULJ A;  4X64 Q;  4HJ7 A;  1YIT A;  4JI3 Q;  2PQA A;  1SLJ A;  4C3I H;  1YZ6 A;  3PUZ A;  4DUZ Q;  4YWM A;  5HY6 A;  3CC2 A;  5AJ3 L;  3ICE A;  1Q81 C;  1KL9 A;  4A3C G;  2AWN A;  2VQE L;  1XNR L;  1D7Q A;  1V1Q A;  1VQH A;  3A0J A;  1SMX A;  1CUK A;  3J80 i;  4NXM L;  3HOW H;  5IP7 G;  1VQ9 A;  4MNO A;  4EX5 A;  5GAG C;  2YTY A;  4HID A;  2AWO A;  2B63 H;  1JB7 A;  5K36 G;  3OTO L;  2QA4 A;  1UE1 A;  2YYZ A;  3U50 C;  5AJ3 Q;  4JV5 L;  1VQ7 A;  1CKO A;  5E7N A;  3KDF A;  1G6P A;  2VQE Q;  2UUB L;  1HH2 P;  2MFI A;  1D8L A;  1IL2 A;  1TWG H;  2D0O A;  2XGT A;  4JBJ A;  3RZD H;  3K7U C;  1E24 A;  5C0X G;  2F3I A;  4NXM Q;  2NN6 I;  4IPC A;  4TQU S;  1GM5 A;  1V9P A;  2Q2I A;  3BJU A;  4X66 L;  3OTO Q;  1VQ4 A;  4YCW A;  3TS0 A;  1VQI A;  4JV5 Q;  4LF8 L;  1OXU A;  1A8V A;  4POF A;  1PVO A;  3FP9 A;  2Y0S E;  2K50 A;  1EQR A;  1N8R C;  1KD1 C;  2UUB Q;  2F4V L;  3CC7 A;  4HJ9 A;  2WB1 G;  3D31 A;  4LUV A;  1N33 L;  2JA7 H;  3D0F A;  4FDB A;  3M7N A;  3M4P A;  2XTI A;  3CQZ H;  3RLF A;  1C7Y A;  3G4S A;  2WFW A;  4X66 Q;  1FL0 A;  1A0I A;  2CFM A;  4YWK A;  3K7A H;  1N9W A;  2K5V A;  3U4V A;  3HOX H;  1VQD A;  4GN3 B;  2CWP A;  4DK6 C;  3CCE A;  3CCS A;  3NBH B;  4DAM A;  2UUA L;  4LF8 Q;  3M9B A;  3GTK H;  2Y0S G;  4IFD J;  2JA8 G;  2F4V Q;  2R92 G;  3HOZ H;  3RR5 A;  5GAE C;  3L2P A;  3FKI G;  1N33 Q;  2EIF A;  4DV1 L;  1LYL A;  3H15 A;  3PUX A;  2V1C C;  4JBK A;  2ZM6 L;  4RG1 A;  1C0A A;  1HNZ L;  1K73 C;  3UDG A;  4A3I H;  4JOI C;  1WCM H;  4YHH L;  3M4Q A;  4BY7 G;  2R93 H;  1YHQ A;  1JMC A;  2VY3 A;  2E2H H;  3PO2 H;  2E8G A;  3Q8D A;  5M3F H;  2UUA Q;  2RHS B;  1JJG A;  3TRE A;  3CPF A;  4XTC S;  4HIM A;  3S1R H;  1UE6 A;  1UE5 A;  4DV1 Q;  4BA2 I;  1TXY A;  2ZM6 Q;  4JCV E;  1HNZ Q;  2VNU D;  1CSP A;  2CKZ B;  1E1O A;  4A3B H;  4YHH Q;  2JA9 A;  3UDF A;  4A3D G;  1VQM A;  1GKH A;  4UP7 A;  5C3E G;  4IOA A;  2LXJ A;  1Q7Y C;  1DGS A;  4QIW E;  3S2H H;  1VCI A;  1N36 L;  1JJC B;  4IFD G;  3HOU G;  5ELN A;  4LF5 L;  3OW2 A;  1ASZ A;  3J7A 5;  1L1O A;  3CCR A;  1PFS A;  2K75 A;  3HOY G;  1WI5 A;  4APV A;  1EIY B;  1Q8K A;  3TEH B;  5IE8 A;  4A3L H;  1VQF A;  3S17 H;  2N49 A;  4IJL A;  1X9N A;  1I94 L;  1FJG Q;  4LFB L;  3PO3 H;  1PH6 A;  2UU9 L;  1IXR A;  2WAQ E;  1N36 Q;  1N34 L;  4LF5 Q;  1VQP A;  4BA1 I;  3H3V H;  2NN6 G;  1HZA A;  4WJ3 M;  2IX1 A;  2ZTD A;  5H1S E;  4X65 L;  5FJ8 H;  1Z9F A;  1TWA H;  1LTL A;  4DR4 L;  4PZ6 A;  2K5N A;  1LM0 A;  1TWC H;  1PH5 A;  4JI0 L;  5JJL A;  1NBW A;  5IP9 H;  1PH2 A;  5IYB G;  4OO1 I;  4JI6 L;  3DM3 A;  1I94 Q;  1VQ5 A;  4KI0 A;  1M1K C;  2Z6K A;  3JAM i;  4LFB Q;  2UU9 Q;  2WAQ G;  2CQO A;  4A3E H;  3A74 A;  3BZK A;  3OYY A;  4HIO A;  3T1Y L;  1N34 Q;  1CSQ A;  3F2C A;  1K8A C;  1VQN A;  1Y1V G;  2IX0 A;  3H0G G;  4MZ9 A;  3CAM A;  1WYD A;  2R7D A;  5FLX c;  2VUM G;  4X65 Q;  4QJF A;  3PF5 A;  1R9T H;  1CKM A;  4A3G H;  4DR4 Q;  3ZJY C;  4GKK L;  5DLQ E;  1HNW L;  1QUQ B;  2VZA A;  4AH6 A;  4JI0 Q;  5C4J H;  1YHA A;  4JI6 Q;  4DV4 L;  4A75 A;  2IY5 B;  1NY4 A;  2NZH A;  2JA5 H;  5C4X G;  3AYH B;  4B3M L;  2F52 A;  3CCQ A;  3UDI A;  1JT8 A;  3T1Y Q;  2EQS A;  2MNA A;  2JE6 I;  2JA6 H;  1AH9 A;  3JC6 6;  3HOW G;  3IRB A;  4RMF A;  2HQL A;  1X3G A;  3E9I A;  3KF6 B;  2ASB A;  3CME A;  1K0R A;  1IBM L;  1HNW Q;  3KF8 B;  3RN5 A;  4GKK Q;  4DK3 C;  4JBW A;  3EBE A;  4A3M G;  3GTG H;  3GTP H;  2R7Z H;  4AYB E;  5GRO A;  4DV4 Q;  4HJ5 A;  4DR6 L;  3PGZ A;  4BXX H;  4B3M Q;  4IJH A;  1L1O C;  4NB3 A;  4GNX C;  3H3V I;  1Y14 B;  2RF4 A;  4DR1 L;  1MJE A;  4OWT B;  2E2I H;  1K83 H;  5IWA L;  1W2B A;  5C44 H;  4DUY L;  1TWH H;  3F2D A;  3CCJ A;  1IBM Q;  1PA6 A;  3HKS A;  3I4N H;  4BBS G;  1MIU A;  4A76 A;  3TS2 A;  1LUZ A;  1I5F A;  2PNH A;  1J6Q A;  3GO5 A;  4AYB G;  4DR6 Q;  1XNR Q;  3FHW A;  3L0O A;  2QEX A;  3CW2 C;  2Q2H A;  2QGQ A;  4P72 A;  5FLM G;  2GVA A;  3I4M H;  1VQO A;  4NXN L;  4OXP A;  4DR1 Q;  1XMQ L;  2JA7 G;  4BY1 H;  1X3F A;  5IWA Q;  2JJQ A;  3PCO B;  4DUY Q;  4A3J G;  2K14 A;  1YIJ A;  3HFZ B;  4OWX B;  1ASY A;  1UEB A;  4EQ5 A;  3I2Z A;  3HOX G;  4B3S L;  1PH9 A;  3UDX A;  4IO9 A;  4LF9 L;  2OQ0 A;  2OCE A;  4H02 A;  1B7Y B;  1B8A A;  1YJW A;  4IPD A;  4A3C H;  3PUW A;  3BU2 A;  4KLK A;  4NXN Q;  2HT1 A;  3KYH C;  1N32 L;  1XMQ Q;  3RLN A;  5HGQ A;  1X3E A;  5LMN L;  4JG2 A;  3F8T A;  5IP7 H;  4DR5 L;  1XMO L;  2NVQ H;  1WCM G;  3W5O A;  1AE3 A;  3U58 A;  4B3S Q;  3PO2 G;  2ALY B;  5ELO A;  2LSS A;  4GOP C;  2R93 G;  1NE3 A;  4LF9 Q;  4QY7 A;  1OXV A;  4YCU A;  2R6G A;  3M4O H;  4GKJ L;  3STB D;  4A93 G;  4B3T L;  2YTV A;  4DKA C;  4MTN A;  5GQO A;  1KRS A;  3CF5 A;  2DUD A;  1N32 Q;  3MEF A;  4UP9 A;  3RNU A;  2PMZ E;  5LMN Q;  3E0E A;  4XIG S;  4DR5 Q;  1XMO Q;  4A3B G;  4JBM A;  1EYG A;  1QVC A;  1IBL L;  1WOC A;  4P71 A;  1NTG A;  1KHI A;  3U4Z A;  1PH3 A;  4GKJ Q;  1K3R A;  3G71 A;  2C35 B;  2K5H A;  1H95 A;  1P8L A;  4X6A H;  1CKN B;  1QZG A;  4LWC A;  1KXL A;  4QGU A;  1MKH A;  1JJ2 A;  4LF6 L;  1PYB A;  2D0P A;  4LF4 L;  4LUO A;  1YI2 A;  4YCV A;  1M90 C;  3AFP A;  4HIK A;  1IBL Q;  4LFA L;  4A3L G;  3GD7 A;  4AIM A;  4GLA C;  2N8N A;  1QVF A;  2I0Q A;  5M3M G;  2PI2 A;  3KOJ A;  4UPA A;  3CMA A;  4LW1 A;  5IYD G;  2R92 H;  1IZ6 A;  3GTM H;  3ULL A;  3BZC A;  1YBY A;  2WP8 J;  5LMN W;  2I5H A;  1KAW A;  4LF6 Q;  2UXC L;  4R1J A;  2IHF A;  1S40 A;  1GD7 A;  3RLO A;  5FJ8 G;  4Y7N H;  3I55 A;  4A3K H;  3S15 H;  1QUQ A;  1YHB A;  4QQB X;  3CCU A;  1OXS C;  3J81 i;  4WJ4 A;  4LFA Q;  1YVC A;  4J15 A;  2I5L X;  5IP9 G;  3S24 A;  3K8A A;  4DV0 L;  3CD6 A;  1X65 A;  3S1Q H;  5M5X H;  4R4C A;  3WWV A;  3SGI A;  5JJI A;  2ZJR A;  3CP0 A;  1J5E L;  3KF6 A;  2OTJ A;  1RL2 A;  5C0X I;  1Y1W G;  2UXC Q;  3HKZ E;  4KHP L;  3S14 H;  1HZB A;  2ZTC A;  3PIP A;  1HZ9 A;  4P74 A;  1KC8 C;  2A8V A;  4YY3 L;  4JI7 L;  3ULP A;  1O7I A;  3A5U A;  4K0K L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...