1AE3A

Mutant r82c of gene v protein (single-stranded dna binding protein)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
86
structure length
86
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLCLVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE V PROTEIN
publication title Analyses of the stability and function of three surface mutants (R82C, K69H, and L32R) of the gene V protein from Ff phage by X-ray crystallography.
pubmed rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 11
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ae3A00
2JA5H 1HNZQ 1VS0A 3CAMA 2RHSB 3CF5A 1VQMA 1IBLL 1I50H 1KIXA 4DR4L 4A3JH 3HOVH 3F8TA 2NVYH 5JEAJ 1B7YB 3I56A 4LF4Q 1AE3A 1HZ9A 1CSQA 3PO2G 4R1JA 5IY0A 1Q7YC 3NELA 1CKMA 1Q82C 1G51A 4UP9A 4HJ5A 1S40A 1TWFH 3KOJA 2NVTH 4DR1L 3PIOA 2D0OA 2ZJPA 3T1YQ 3KLWA 3M4QA 2JEAI 2PQAB 5C3EG 3VDYA 4A3IG 1X56A 3RN5A 1YNXA 1JB7A 1YJNA 2UUBQ 4EX5A 5JJKA 2YTVA 1EYGA 1OXXK 2I0QA 4DR6L 4KI0A 1YBYA 2OQ0A 1XMOQ 2UXDQ 2Y0SE 3RN2A 2IHEA 4JI2L 4DR3L 4KHPL 2JA9A 5M3MH 4K0KL 4LF7L 4LFAL 5M5YH 1E7ZA 3B6YA 3RLFA 4A3FG 4LF5Q 4LF8Q 3HOWH 1GKHA 4DUYQ 1N36L 3CCLA 3GTLH 3M7NA 1V43A 2BA0A 1BBUA 5EAYA 1IYJB 3MXNB 4A3MG 3L2PA 3HOVG 1MJCA 2OQKA 2XTIA 2ZTEA 4DPGA 1MJEA 1MIUA 3PUXA 4WJ3M 4LFBL 3CCJA 4LF6Q 1UE7A 3KF6B 1Y1VG 2OTLA 4GKKL 4IPGA 4DR2Q 2R7ZG 4FDBA 1I3QH 4DR5L 3D0FA 4DV7Q 4IJHA 2HT1A 2HIXA 2RF4A 4UPAA 1GM5A 4BBRG 1NTGA 5C4JH 3CMAA 1N33L 4Y52H 1H95A 5C0XI 4JI3Q 4LW1A 4POFA 4JI6L 4GKJL 3OW2A 5IYCH 3K7UC 2ZTCA 4DK3C 1OXTA 3EN2A 1U0LA 1LYLA 2E8GA 3S1RH 4A3GG 3AYHB 3U58A 2ID0A 4HIKA 1VQ6A 4A3KG 3AEVA 1DGSA 2K4KA 4IFDJ 2IHFA 2LSSA 1R9TH 5K36G 4OO1I 4XTCS 2L15A 1KC8C 5JJIA 2D0PA 2WB1E 1U5KA 4YY3Q 1YIJA 3GTOH 1Q12A 2PI2E 2KHIA 3AFQA 4RMFA 3J80c 1B8AA 2LXKA 1N34Q 3CCMA 3S2HH 2IY5B 3UDIA 2MO0A 5JEAG 4OWXB 2VW9A 2QA4A 1VQ7A 1Q8KA 2HIVA 2BH2A 3M4OH 4XIGS 4GS3A 3ERSX 4B3ML 5FLXc 2VQFQ 2VQEQ 4C3HH 4DV2Q 2YU9H 1UE1A 3WWVA 1EWIA 3BZCA 3ULLA 1JJCB 4MTNA 2F4VL 1ASYA 3HKZE 3GTPH 3PF4A 3TS0A 2GN5A 4X62L 1PH4A 3CPWA 1BVSA 2UUAL 3BZKA 4P73A 1TWHH 4LUOA 3M4PA 4P75A 5IYDH 2R92G 3K0XA 2A1AA 4QIWE 4DV6Q 2CWPA 4R4OA 4AYBG 2CCZA 1Q46A 3NBHB 4BA1I 4DUZL 2ZM6L 4DV0L 5IP9H 3G4SA 1CKOA 3CCSA 4PZ8A 1PHJA 1HZBA 3LGJA 1AH9A 1N8RC 4NXNQ 5GAEC 3TREA 1KRSA 1X9NA 2UUCQ 3J81j 4A93H 2E2HH 4A3DH 3F2CA 3EBEA 3K7AH 4O0AA 3PIPA 4JV5L 3J80i 4OONA 2CKZB 3F1ZA 3I4OA 1J5EQ 2WAQE 1PA6A 1QVCA 1HR0Q 1N9WA 1KRTA 1A8VA 2AMCB 1PVOA 3HOZH 3A5ZB 3RZOH 4L5TA 4GOPA 3UDFA 4GOPB 2Z6KC 4A3EG 4DV1Q 1VQHA 2YTYA 2EQSA 2N8NA 4LFCQ 1VQNA 2UXCQ 4GN3B 5C4XG 3MEFA 3CMEA 3F2BA 3GD7A 3CC2A 1E22A 1KAWA 2JE6I 4YWMA 2KBNA 5LMNQ 1L1OB 2OWOA 5FJ8G 5IWAQ 1O7IA 1TWGH 2N3SA 2VS1A 1HNZL 4QQBX 3S1NH 2IX0A 3PUWA 4NXMQ 1X65A 1K3RA 1PFSA 1VQBA 3FHWA 4APVA 1XPUA 1HH2P 4BY1G 2E2JH 1S3OA 4IFDG 4RG1A 4LF4L 1FGUA 1KD1C 3GDEA 3S15H 2KCMA 3T1HQ 1KQSA 2ZJRA 1X3EA 4B3RQ 2JQOA 3HKSA 2AWNA 1NMFA 2K5VA 4QJFA 5IE8A 3I55A 2ASBA 4GNXA 2HHHQ 4GNXB 5M3FG 3GTQH 2VY3A 5GAHC 1YVCA 1JT8A 1IXRA 3HOZG 4GLVB 1D7QA 1MKHA 2Q2TA 1UEBA 3OTOQ 3G48A 2ES2A 2GVBA 3HOXH 4JI5L 1XMOL 4PZ7A 4C3JH 2BA1A 2OCEA 2VL6A 4R4CA 4C2MH 4UY8C 2K14A 1VQKA 3J81c 4ME3A 4A3CH 4IJLA 4GN5A 4B3TL 3I4MG 4JI4L 5J3BA 2R6GA 1XMQQ 5ELNA 1WCMG 4A3LH 4X66L 1CKNA 4LF5L 4LF8L 4BBSH 3H0GG 3AFPA 5DLQE 4DUYL 4HJ7A 1VQLA 2JA5G 1NJIC 1VQCA 3Q8DA 1CSPA 2CWAA 2R7FA 2PNHA 3K81C 2B3GA 4LUVA 1SE8A 3STBD 4OX9L 4WJ4A 3L7ZC 2V1CC 3TEHB 3J7ZC 3F2DA 4DR1Q 4A3JG 1PH5A 2JA7H 1IBKQ 4TQUS 4LF6L 1E1TA 3ULJA 1YI2A 4AQYQ 2YTXA 1XNRQ 4DR2L 1XPRA 1FJGL 1Z47A 5H1SE 4DV7L 2PI2A 2CQOA 2NN6G 3ZJYC 1XNQQ 3A74A 5LMNW 1SFOH 4BY7H 3G71A 4LWCA 1EOVA 4QL5A 4TVAB 5IT9c 4JI8Q 1GVPA 2VUMH 4JI3L 5M5XH 4JI0Q 4YHHL 4BXXH 5JJLA 4R4IA 3KDFA 1A62A 3KDFB 4KHPQ 4AIMA 1SR3A 2K50A 3A0JA 3CQZH 4OWTB 3J81i 3PF5A 5FLMH 1LM0A 3HOYH 3J7A5 2H5XA 2K75A 2Z0SA 4DV4L 1OXUA 1WYDA 3I2ZA 1P16A 2Y0SG 5M3MG 1E3PA 2R7DA 2OTJA 1IBMQ 5BR8L 2I5HA 4YY3L 4HJ8A 3HOWG 1Y1WH 2B63H 1QUQA 1QUQB 1I5FA 1WJJA 1HJPA 3UE1A 4DV3Q 2E5LL 4MNOA 2UXBL 2ZTDA 1N34L 1I94L 4HIOA 2Q2UA 3RLNA 1OTCA 2JA8H 3TRZA 2A8VA 3I4NH 1UE5A 2VQFL 4GN4B 2K5HA 4IPDA 2VQEL 4A4IA 3U4VA 4JI6Q 4IO9A 1UWVA 1K73C 4HJ9A 1TXYA 3HOUH 4HJAA 4LF9Q 4NPSA 4JOIC 3D31A 1QZHA 1PH1A 3GO5A 1W2BA 1G291 4X64Q 2AHOB 2JEBI 5LMUL 4DV6L 1VQGA 4DV5Q 5IYCG 5IYBH 2R93H 3S2DH 1YEZA 1PYSB 3AQQA 3PGZA 2DUDA 3G6EA 1ASZA 1GD7A 4NB3A 4DR7Q 1YZ6A 2RHQB 1VQAA 4NXNL 4B3SL 2UUCL 1L1OC 1EQQA 4HIMA 3PO3H 1YJWA 4A3BH 4X65Q 1W3SA 2FXQA 2A19A 5C44H 2UU9L 2GVAA 1S72A 4B3MQ 1NY4A 5GROA 3KYHC 2WB1G 1K83H 4KLKA 3BJUA 4PG3A 3PSIA 1HR0L 1KHIA 1I6HH 3CP0A 2EIFA 4BA2I 3CCRA 4EQ5A 2N78A 4DNIA 1VQ4A 3RNUA 2IX1A 1YHBA 3E9IA 5E7NA 5ELOA 1GO3E 1N32Q 1Q86C 1FVIA 2NZHA 3HKZG 3RLOA 4A75A 1SROA 5LMNL 4YWKA 2JJQA 5IWAL 3M9BA 3H15A 4JBKA 4JYAQ 1VQEA 2LXJA 5IYBG 5IYDG 4JI7Q 4JCVE 4DAMA 5HY6A 3H3VI 5C0XJ 4NXML 3PO2H 4JI1Q 2K5NA 2MO1A 4YCVA 4JG2A 1IZ6A 1L0WA 5IP9G 5AJ3Q 3UDGA 5GAGC 2ALYB 1M1KC 3T1HL 1SMXA 1VQ5A 4A3BG 4B3RL 2E2IH 3DM3A 2Q2IA 4A93G 1PH6A 5C3EH 5C44G 1SLJA 4A3IH 3S1QH 4A3DG 1IL2A 4LNQA 2KCTA 3PUYA 1J6QA 3HFZB 3CCEA 4IFDI 3K80C 3PUVA 4Y7NH 4HIDA 4R4TA 3T1YL 1X55A 2C35B 1P8LA 4L5QA 1HNXQ 4C3IH 3OTOL 2UUBL 1KXLA 1QZGA 3CXCA 3UE0A 1Q81C 2WAQG 1JJGA 1HNWQ 4QY7A 5M5WH 2D62A 3UDXA 4MZ9A 2ZJQA 1VQJA 1C0AA 2HQLA 1L2FA 2UXDL 4A3FH 2KENA 4OXPA 1JMCA 1XMQL 4A3MH 4GLAC 1IBLQ 1EQRA 3OYYA 2NVXH 4DR4Q 4YCWA 5IP7H 1OXSC 1YHQA 4IOCA 1CKNB 4IOAA 1A63A 1XTDA 3CC4A 1V1QA 1Y1VH 2RCNA 1X54A 1HR0W 2R7ZH 1PYBA 2Z6KA 1WI5A 1IBKL 2PQAA 4ALPA 4AQYL 2VNUD 1XNRL 4BBRH 1FL0A 3A5UA 1JE5A 4JBWA 1WOCA 1QVGA 1BBWA 1XNQL 2JK8A 1OXVA 1VQ9A 2BH8A 1EIYB 1K0RA 4JI8L 4IPCA 2CFMA 4JI5Q 4YCUA 4DR6Q 4JI0L 1PH8A 4O2DA 2F3IA 4A3GH 2B29A 2YV5A 1B70B 3E9HA 1RIPA 3NEMA 3L0OA 4H02A 4JI2Q 3W1GA 4A3KH 3KJPA 4B3TQ 4JI4Q 4DR3Q 3HOXG 2I5LX 2NN6I 3M85A 2ATWA 4A76A 3S1MH 4YWLA 4X66Q 3DLLA 4K0KQ 4LF7Q 1XPOA 4J15A 4LFAQ 4DAYB 4A3CG 3PCOB 2MQHA 4LUZA 3ICEA 1N36Q 4AH6A 4OX9Q 3STBC 4P74A 1YITA 4PZ6A 1IBML 5IP7G 4A3LG 3IRBA 3FP9A 4BBSG 3KF6A 2MNAA 4GLXA 4L5RC 4R4QA 1HZAA 3KFUA 3CW2C 3BU2A 1SN8A 3K8AA 5C0XG 4QGUA 4DV3L 1FJGQ 4LFBQ 4GKKQ 2XGTA 3RR5A 1PH2A 1RL2A 1VCIA 3CCQA 2JA7G 2JA6H 4DR5Q 3SGIA 1K9MC 1X3GA 3CC7A 4IPHA 2YYZA 1XJVA 1VQFA 1CUKA 1Q1BA 1V9PA 1N33Q 4YHHQ 4DV2L 2IT1A 3ER0A 4AYBE 3GTKH 4BY7G 1Z9FA 3S14H 2NZOA 4OO1G 4GKJQ 2R92H 1PH7A 4LF9L 1VQ8A 3CCVA 4L5SA 2WP8J 2VUMG 2K52A 1TWCH 3EIVA 4DV4Q 4BXXG 4X64L 3W1BA 4DV5L 3JAMc 2VZAA 2WFWA 3KJOA 2DGYA 1NMGA 2Q2HA 4GOPC 1JJ2A 5BR8Q 4JBJA 1K8GA 5FLMG 3U50C 3CD6A 3HOYG 3PUZA 3GTGH 4DR7L 1SRUA 3I7FA 1HZCA 2PMZE 2E5LQ 2UXBQ 1VQIA 1Y14B 1EIFA 2AKWB 2NVQH 3M3YH 4X65L 1PV4A 1Q1EA 2N49A 1C9OA 1I94Q 3S24A 1A0IA 1Y1WG 2B63G 1EUJA 1M90C 1YHAA 4KHZA 2JA6G 3FKIH 4B3SQ 3H3VH 4A3EH 1J5EL 1TWAH 3S16H 2F4VQ 2JA8G 5C4XH 5GQOA 3I4NG 4X62Q 1K8AC 4JC0A 4DKAC 2UUAQ 2KHJA 1AE2A 4GNXC 1BKBA 3ULPA 1UE6A 4P72A 5FJ8H 2QEXA 5LMUQ 4DV1L 3TS2A 1N32L 1KL9A 4LFCL 3W5OA 1VQOA 4PMWA 3HOUG 2UXCL 4X6AH 3GTJH 4POGA 3E0EA 4DUZQ 4BY1H 4DV0Q 4JYAL 2ZM6Q 1WFQA 3KF8B 5HGQA 4JI7L 3JAMi 1VQDA 4OWWB 1PH3A 1PH9A 3RZDH 4JI1L 1E1OA 5GADC 2R93G 3TQYA 4P71A 5AJ3L 2UU9Q 3JC66 2AWOA 5M3FH 1LUZA 3GTMH 4JV5Q 1YJ9A 3NENA 1EFWA 4JBMA 3CPFA 3PO3G 1X6OA 3U4ZA 2MFIA 4JOIA 1LTLA 2HHHL 3CCUA 3FKIG 1VQPA 1QVFA 1NBWA 2F52A 2I5MX 4UP8A 1X3FA 4DK6C 1HNXL 1NE3A 2EXDA 3S17H 1D8LA 1T9HA 1C7YA 3PV0A 1HNWL 1G6PA 3I4MH 1E24A 1L1OA 4UP7A 1WCMH 2QGQA 3H0GH
chains in the Genus database with same CATH superfamily
4IURA 1II3A 3CAMA 3J80L 1PZID 4A3JH 4WORA 1JWSD 2BDNA 5JEAJ 1AN8A 3I56A 5COYA 1W6JA 3PO2G 2B2UC 3T53B 4UP9A 1S40A 1TWFH 3KOJA 4KJNA 2QKIC 2D0OA 4UAIA 5NUCA 4B9XA 3SK8A 2JEAI 1CQFA 2A69D 4A3IG 1LTRD 1F9PA 1YJNA 4G4KA 1QE6A 1QB5D 1ICFB 1VF7A 4EX5A 5JJKA 2OT2A 5KEEA 2JA8B 4DR6L 1SYDA 4LAAA 2K04A 2IHEA 4FXKC 3I70A 2JA9A 5M3MH 1PRTF 1I4RA 1EWCA 2QDLA 3RLFA 4LF5Q 3HOWH 1GKHA 2B39A 1LT5D 3L2PA 3MTSA 2XTIA 4DPGA 2EY6A 4LF6Q 4JPBW 4IPGA 3VR5A 2R7ZG 2HIXA 2RF4A 5C4JH 3ONAB 4WJWA 1JWMD 1TR5A 3SK5A 4POFA 2VB3X 4FNFA 1K8MA 1I6HB 1GJXA 3W3AA 5IYCH 3K7UC 2ZTCA 1U0LA 1LYLA 2KVMA 4ULLA 1VQ6A 4L63B 4A3KG 2LS01 2JXMB 1O78A 2L0CA 1GUWA 5LL6S 3GTJB 2Z8LA 2HDLA 1EY9A 5EGTA 2WKCA 5JJIA 5BN3A 5KNCA 3QWNA 2KCCA 3AFQA 3PO2B 2IY5B 2QA4A 1Q8KA 1NUCA 5FLXc 2VQFQ 2E2IB 2RCFA 1UE1A 3WWVA 4ZRZA 4A3IB 1DOMA 2SNSA 2GN5A 2ZXRA 4P73A 3M4PA 1EZ6A 3K0XA 5JPNC 3DEOA 3I4MB 2MHVA 1S5ED 4AYBG 3X3MA 3G4SA 1CKOA 1HZBA 3BZDB 1N8RC 1RF2D 3TREA 3J81j 4A93H 2E2HH 3EFXD 4A3JB 3K7AH 3PIPA 3J80i 1TY2A 1LT4D 1LTBD 4KKSA 1PA6A 1QVCA 2B2WC 1HR0Q 2R7ZB 3HG9A 3A5ZB 3RZOH 2EYFA 4A3EG 2CH4W 2YTYA 5IGEA 5C4XG 1A2TA 1LV9A 3CMEA 2LMCB 2K03A 4YWMA 5LMNQ 2OWOA 5HURA 1TWGH 1HNZL 1NAPA 4A3KB 4U68A 3QIAA 3S1MB 1Q90A 4I65A 3K5NA 4K14A 2J0TD 2KCMA 2QCPX 3T1HQ 4DAVA 3DWAA 2H4OA 1X3EA 2M9VA 3E0JA 4B3RQ 5IE8A 1SAPA 2AWNA 4XQNA 4GNXA 4KHVA 3PQIA 2VY3A 3H6MA 1YVCA 2Z4HA 1IXRA 1UNSA 2GVBA 1G8ZD 3L3OC 3HOXH 1XMOL 3GV6A 1S4ZA 2K01A 1PFBA 5JVG3 4UY8C 3KLSX 4WRDA 1VQKA 4A3CH 3Q23A 2CH4A 4GN5A 2FFKB 1D5XC 4IJLA 3NTKA 2E76C 3OMCA 5ELNA 3MAQA 1WCMG 4AYBB 1ZYRC 2N88A 1VQLA 1NJIC 1B50A 1CSPA 5C5LA 2PNHA 3K81C 1GUNA 1X32A 4LUVA 4WJ4A 2DJGC 2F0UA 4DR1Q 2JA7H 3KUPA 1IBKQ 2F0NA 2XRSD 1FJGL 2B2VC 2EVBA 5DM73 4DV7L 3ZJYC 2PMZB 5LMNW 1JQYD 4BY7H 3G71A 3OHXC 4FYDA 2XWJB 4YHHL 3NSWA 4R4IA 4A3EB 1ILQA 2K05A 1SNCA 4R8NA 5C4XB 1KNEA 3CQZH 4KTAA 4OWTB 5FLMH 3HOYH 4DA2A 4DV4L 1M4VA 1P16A 2Y0SG 1E3PA 2B2YA 4X3KA 3NWSA 2C9OA 4ZLTF 1QUQA 5EBCA 1HJPA 3RZDB 4MNOA 1SXTA 1STHA 1TS5A 2RA4A 1OTCA 1A2UA 3I4NH 3FPPA 3GTMB 2XN9C 4GN4B 4IPDA 1B2TA 1EY5A 4A4IA 1PZKD 5CV7A 1DONA 1B9MA 1UWVA 2MGSA 4HJ9A 3HOUH 1BF4A 1H9RA 1PH1A 3GO5A 4X64Q 4EQPA 2R93H 3S2DH 1LTGD 3AQQA 3PGZA 1HUNA 1TWGB 1VQAA 2WIIB 1L1OC 5BN4A 4CKEA 2FXQA 5C44H 1S72A 1NY4A 3PMFA 1EY8A 2PPBC 3SR1A 2WB1G 4PG3A 3PSIA 1KHIA 2JP1A 3CP0A 2EIFA 4CKCA 2NVTB 1ET6A 4S3SA 4DNIA 1BR9A 3K5MA 2HD3A 4RKLA 5E7NA 3T4AC 1GO3E 1FVIA 2NZHA 4A75A 1G2SA 2JJQA 1KTKA 4RHSA 4JBKA 1VQEA 2LXJA 3H3VI 4NXML 4JI1Q 2K5NA 3FPUB 2MO1A 2Y0SB 4E6IA 1WTXA 1IZ6A 1L0WA 3HGBA 2JSOA 3GTLB 1NSNS 5C44G 1SLJA 3S1QH 1LABA 1SYFA 3PUYA 1J6QA 4K5WA 1SYCA 3FDTA 4R4TA 1P8LA 4L5QA 4HEDA 3OTOL 3UE0A 2A73B 2OF1A 2WAQG 1HNWQ 2A6HC 5M5WH 2D62A 5I2XA 1QJOA 1PDQA 1BOSA 1ZXTA 1GXDC 2L1BA 1XMQL 4A3MH 5CMDA 3OYYA 2NVXH 4R9WA 2LFNA 1B53A 2H1EA 1YHQA 2F0VA 1Y1VH 1X54A 2CQAA 1R9TB 1PYBA 4R8IA 5EKKA 2DY7A 5FOBB 4AQYL 3A5UA 2NTTA 2WB1B 4K5XA 4YCUA 4DR6Q 4JI0L 4KN4C 3L0OA 4JI4Q 4FXGC 2I5LX 3E5SA 4A76A 5K36H 1STAA 3PCOB 1TWHB 3ICEA 1WD0A 1IBML 2X6GA 4P2CB 3IRBA 3EJIA 3FP9A 4BBSG 3KF6A 4L5RC 5JEAH 4R4QA 3CW2C 5IODA 1SN8A 2EY2A 4QGUA 1VCIA 4Q5VA 1FNUA 1HCZA 1U4PA 1DM0B 1JWUD 3SGIA 5C44B 2KEEA 3N52A 1VQFA 1V9PA 1KAAA 1SEBD 1Y8PB 1SE3A 2X6LA 4CBVA 4AYBE 1EY6A 1Z9FA 3S14H 2NZOA 4OO1G 5JJZA 4IZ8A 2WP8J 2VUMG 1PZJD 2K52A 2WAQB 4ZKBB 1EL0A 1TWCH 3CRKC 1EU4A 1JOQA 4PQXA 3W1BA 1QILA 2VZAA 2WFWA 5CBEE 3FMCA 3I73A 1GHKA 1BDOA 1WTVA 3J81E 3I7FA 2PMZE 4KY6A 2E5LQ 1STNA 1EIFA 1IKMA 4X65L 1PV4A 2R3ZA 1A0IA 1IKLA 4B08A 3RD4A 1B44D 3NP8A 5J22A 2J7ZA 1ESRA 1TWAH 3M7GA 1PTOC 5C3WA 3M4YA 3FEWX 2F1MA 1CI3M 5EPJA 3ULPA 1UE6A 4O42A 4P72A 5I9PA 4FF1A 2K7VA 4IUNA 1F77A 1I4QA 3K6OA 4BY1H 4JYAL 1WFQA 5DAUA 1KDBA 1SJED 4X3TA 2B2TC 5AJ3L 2NVXB 3OW7A 4CJ0B 2UU9Q 5F2DA 3IL8A 3JC66 4BBSB 1RDPD 1SNDA 5IGCA 3PO3G 3CPFA 1DD2A 3DM1A 2MFIA 4ODGA 5EQ0A 2A6EC 2HDMA 4UP8A 4DK6C 2Q8IB 3SK6A 3TP5A 4DN4M 2WINB 3PV0A 1X3PA 2VUMB 1SBBB 2JA5H 1HNZQ 1GOZA 4KJOA 1I50H 1I6VC 4R1JA 1Q7YC 3NELA 1JB3A 1JOOA 2QDBA 2OEOA 2NN6H 4DR1L 3PIOA 3EROA 1F2MA 1LACA 3LWUA 1YNXA 2UUBQ 2HQEA 2JYOA 2G9HD 4BS9A 1EYGA 4XT3B 4KI0A 2ZXPA 1YBYA 2OQ0A 1XMOQ 2UXDQ 2Y0SE 4C3IG 2X69A 1LT6D 1BQQT 4LF7L 3DEPA 5M5YH 3MZ5A 1Z6HA 3A7AB 1N36L 1BBUA 1IYJB 1ENFA 1MJEA 1BBXC 1MIUA 4KV6A 4V190 4CJ2C 4LFBL 3KF6B 5ELBA 5CV6A 4DK0A 4OELB 4DR5L 3PO3B 2IWHA 5IGGA 4DV7Q 4TKOB 4MHEA 1NTGA 1ZEQX 3CMAA 1N33L 1K83B 1TWAB 4CJ1B 4LW1A 2B8GA 3TP8A 4GKJL 3OW2A 1EU3A 1BCPC 3S1RH 4A3GG 3AYHB 3AEVA 1DGSA 1J9OA 3HZXA 2EJMA 3I8ZA 4OHJA 1ONLA 4H44C 2L15A 4K6LA 4RHRA 3K5LA 2K5WA 5ELFA 1KC8C 4KKTA 2D0PA 2WB1E 1U5KA 4K8IA 2F0PA 1Q12A 1TKWB 2KHIA 2AUKA 1G91A 3S2HH 1A6XA 1AZPA 2EY5A 1SNMA 3HEJA 1KLUD 4XIGS 1NR2A 4GS3A 4RAUC 1HA5A 1RTOA 3GTPH 3BZCA 4MTNA 3OIPA 3CPWA 4NP5A 2UUAL 4Y7NB 1D2BA 4P75A 4C3IB 4PMCA 4JVZA 2CWPA 2KOLA 2CCZA 4DV0L 2ZM6L 1D1KA 5IP9H 4UHVA 1PHJA 3LGJA 4LMQD 1V1PB 4A3DH 3DHQA 2EPBA 4ILWA 4JV5L 2G9DA 3I4OA 3F1ZA 1SMYD 1ENCA 2WAQE 1IW7D 1KRTA 4RCOA 2AMCB 3HOZH 1CTMA 4RA8A 4GOPB 4LFCQ 2UXCQ 3MEFA 3F2BA 1EY0A 5CORA 4IN3A 1JICA 1KAWA 5KYLA 5FK9C 5FJ8G 1O7IA 4A3GB 1CA5A 2IX0A 4NXMQ 1ML0D 4APVA 1VQBA 3C46A 4IFDG 4QF4A 1KD1C 3S15H 2FJ2A 4KD4A 3GP7A 3JAME 1B1ZA 3DUZA 3K59A 3HKSA 2ASBA 1V1OA 5M3FG 4X3SA 1D5ZC 1STYA 2A5HA 2KHSA 1JT8A 3HOZG 1YNJD 3OTOQ 3VR3A 5CV9A 2OCEA 4OEMB 4R4CA 4ZUJA 2E74C 4ME3A 3GTKB 2E75C 4JI4L 3I4MG 2R6GA 1XMQQ 2EYPA 3S1RB 4A3LH 4LF8L 3H0GG 1KABA 5DLQE 5A2QE 4DUYL 4HJ7A 3Q8DA 3BDLA 5EJWA 5FKAC 2R7FA 5C3XA 2V1CC 3TEHB 4A3JG 1FR3A 3HS0C 3GTGB 3ULJA 4AQYQ 2YTXA 3D4DA 1Z47A 2NVQB 5H1SE 3M3YB 4ZK9B 2Z9HA 1HQRD 2PI2A 5IOCA 4FF2A 5JPMC 4LWCA 1EOVA 4QL5A 4TVAB 2AUJD 2SDFA 4JI3L 4JI0Q 1MI2A 4BXXH 1CA6A 5JJLA 4KHPQ 2MPMA 1GUSA 3KDFB 4AIMA 2K50A 3HP3A 3A0JA 3J7A5 2H5XA 2PW7A 3I2ZA 5M3MG 2FMCA 2OTJA 1IBMQ 4XXEA 5G3LF 2P5ZX 3HOWG 1Y1WH 2B63H 1WJJA 2E5LL 3URYA 3UE1A 3VR6A 5J39A 1H9SA 5C6AA 4HIOA 3MEHA 4KD3A 3LWEA 5M3FB 4U673 2VQEL 4JI6Q 1XWEA 3HOZB 1WTRA 4RH6A 2DNEA 4PNYA 1STGA 3QR8A 1HRJA 1W2BA 2AHOB 1VQGA 2O5IC 2R61A 5IYBH 5IYCG 4PV1C 1YEZA 2EXZA 1KDAA 5KNBA 4DGZA 3TBIB 4NXNL 3H0GB 3ERQA 2XVSA 1YJWA 4X65Q 2WV6D 3OWEB 2UU9L 3MXGA 2GVAA 5GROA 3I90A 3A8IE 2F3VA 3KYHC 3R2TA 4KLKA 1TY0A 3SK4A 4F7XA 1TWFB 3AMUA 1H9KA 1VQ4A 5I6WA 3MWYW 5ELOA 3V96A 1CQVA 2D5DA 4ZCKA 1Q86C 5CBAE 3HKZG 3KF8A 3RLOA 4DNTB 5JVH3 2JN4A 3BVGA 5IWAL 3M9BA 3H15A 4JYAQ 2DJFC 5IYBG 4DAMA 4YCVA 5M3MB 1ILPA 5IIFA 5AJ3Q 4YIJA 4RFBA 1LTID 3P75A 3NE5B 1VQ5A 3HOWB 1YNNC 3DM3A 4A93G 1PH6A 5C3EH 4I7AA 4LNQA 1EWHA 1A3VA 3CCEA 3Q6SA 4H7BA 4HMJA 3J80E 1L0XB 2AQ3B 2UUBL 1Q3LA 4B9WA 1K8OA 1HTPA 4IUTA 4QY7A 1K3BC 4MZ9A 5C4JB 5E4WC 1C0AA 1L2FA 2UXDL 4A3FH 4G57A 1JMCA 1CHQD 3IKJA 4GLAC 3P20A 3NWTA 4IQZA 3Q24A 4IOCA 1A63A 1XTDA 3SVMA 1HR0W 5C0XH 2SOBA 2PCFB 4JW0A 2Z6KA 2FMMA 2PQAA 4DNRB 2RDHA 4N8FA 4BBRH 1FL0A 2RSOA 1XNQL 2JK8A 2MP1A 1RHPA 5M5XB 5JOBA 5J1ZA 2BH8A 1EIYB 4JI8L 2CFMA 3RUZA 1LTTD 1MSHA 2B29A 2I46A 1RIPA 4B3TQ 3ITPA 2K32A 2Q8RE 2ATWA 4H0LC 3HOXG 1NNXA 4ZKCB 5EPLA 1WTHA 1WTOA 2F0GA 3HKZB 3WOEA 4LF7Q 4J15A 4A3CG 5I4DA 4LUZA 1N36Q 4K8JA 3STBC 2QW7A 4PZ6A 4ZQ3A 1O7LA 4QIWB 1CZGA 3BU2A 5C0XG 4LFBQ 5FO7B 3MVVA 3RR5A 1PH2A 3IAYA 2JA7G 4A93B 2E2HB 4DR5Q 2TSSA 3K7AB 4RGMA 3TN2A 1CM9A 3T56B 1H9SB 2YYZA 1CUKA 1N33Q 5DEHA 3ER0A 4BY7G 2XSCA 2R92H 4GKJQ 1PH7A 4LF9L 4L5SA 1HTLD 3RZOB 2HCCA 3EIVA 1DJRD 2L12A 2DGYA 3BDOA 4JBJA 5FLMG 3U50C 3CD6A 3HOYG 3PUZA 2KEDA 3TSSA 2EYMA 1B3AA 2LKVA 1C9OA 5KIXA 2B8FA 5CYUA 1M90C 1YHAA 1HFGA 2F0KA 3H3VH 3S16H 3NHHA 2F4IA 3I4NG 2KUMA 1K8AC 4JC0A 2L4NA 4DKAC 2UUAQ 2KHJA 4GNXC 1I4XA 5FO9B 4X3UA 1DYQA 1KL9A 3NQTA 3NTHA 4LFCL 2RSNA 4PMWA 3W5OA 1VQOA 1SE4A 3HOUG 1I4HA 1CZWA 3BG3A 3HOXB 4RGOS 4DV0Q 2ZM6Q 2SNMA 3KF8B 3MHBA 1VQDA 4OWWB 1PH3A 1E1OA 3C2PA 2R93G 2NUCA 4KKUA 1LUZA 4KK7A 3TP7A 2KQ3A 1YNND 4JV5Q 2BCOA 1XX8A 5LHY1 3U4ZA 4JOIA 2JA7B 4MIUA 1VQPA 4H13C 1QVFA 2IX3A 4BY7B 1PRTC 4PMBA 1G6PA 3K0YA 4UP7A 1K0SA 4M1UB 1GUOA 3Q22A 1WTPA 3CF5A 1IBLL 1CHPD 3H3VC 3CQZB 2NVYH 3HOYB 2CVRA 1AE3A 1HZ9A 1ZYRD 5E3FA 4HSPA 2DY8A 5IY0A 1QNKA 2MUYA 2WKDA 1Q82C 4I7ZC 3NBIA 2ZJPA 3T1YQ 3KLWA 3M4QA 2IW3A 2PQAB 3VDYA 3RN5A 1JB7A 3WOFA 1OXXK 1Z7TA 2B2TA 2I0QA 3I4NB 4JI2L 1KNAA 4DR3L 4KHPL 1QOHA 4K0KL 3HOUB 3B6YA 1JOKA 4LF8Q 4DUYQ 2RDGA 4HMIA 5C4ZA 3CCLA 1MD2D 1PTOH 3VR4A 4A3MG 4V0BA 4IALA 2R93B 3S2DB 2ZTEA 4Z9CB 3PUXA 1UE7A 1J8IA 1Y1VG 2OTLA 2NYZD 4EQNA 3D0FA 1T5EA 2EZVA 3QG1A 4IJHA 2F0WA 3SEBA 2HT1A 1MSGA 4NKLA 4Y52H 2EOTA 4JI3Q 4JI6L 2WACA 2EYHA 5EKLA 4DK3C 3EN2A 2E8GA 1ICWA 3U58A 1KDCA 1D6EC 2K4KA 1XTCD 2F0OA 2L5TA 2LSSA 1RTNA 5K36G 4OO1I 4XTCS 2PZTA 3G6JB 2O2LD 3A8JE 1YIJA 2PYKA 1O80A 2PI2E 4M8AA 5JEAG 2MO0A 2VW9A 3ZYYX 2EDGA 2HIVA 2BH2A 3M4OH 1L0YB 4DV2Q 1Y8OB 5KGUA 2VQEQ 2YU9H 4B3SL 1EWIA 3ULLA 1JJCB 4G7HC 3PF4A 1TQOA 3HKZE 4Q0FA 3S1QB 4X62L 3BYTB 1PMRA 1PH4A 1BVSA 3BZKA 1AZQA 3NK9A 4LUOA 3MXPA 5IYDH 2A1AA 4QIWE 2TMPA 1Q46A 3NBHB 4HCEA 4BA1I 4IUPA 4DUZL 5M5WB 4QUFA 5IT9E 4PZ8A 4NXNQ 1U4LA 1GUTA 1V1PA 3BDCA 1B9NA 4A3MB 1ENAA 4MTKA 2ICEC 3EBEA 4O0AA 4CDDC 1Y1VB 1J5EQ 2IJ0A 1N9WA 3A7LA 1TS2A 1HPCA 1PVOA 3BYYB 2KECA 4L5TA 4KMUC 4CKBA 4GOPA 4IUVA 4DV1Q 1VQHA 1QNUA 2EQSA 2N8NA 1CK1A 1VQNA 1PRTD 3VYRA 3GD7A 2JE6I 2A6HD 2XWBB 1DZ1A 3D6CA 2RDFA 5IWAQ 2N3SA 1HFNA 3KBGA 4HN7A 3S1NH 3PUWA 3QOJA 3C3LA 1K3RA 1XPUA 2HUGA 5DNFA 2PZUA 4BY1G 2E2JH 1EYAA 1JC7A 1S3OA 4LF4L 1FGUA 3GDEA 1PTOB 1FYCA 4QJFA 2K5VA 5FLXL 2HHHQ 3GTQH 3PIP3 1TS3A 5GAHC 2Z4IA 1MKHA 3SE0A 2F0LA 2Q2TA 1UEBA 3VA5A 4PZ7A 4C3JH 1F2ZA 2BA1A 4C2MH 2K14A 3J81c 4B3TL 4OIKA 2EE1A 3S14B 5J3BA 5CV5A 3AFPA 1TWCB 1E2WA 3NXWA 1EY4A 1WD1A 1NCVA 2JA5G 4J1MA 1TT2A 3G7LA 3F2DA 2KCNA 1E1TA 2A69C 4DR2L 1XNQQ 2EYOA 2NN6G 1SFOH 1EZ8A 5IT9c 4JI8Q 2YU9B 5M5XH 1EIHA 1FNVA 1RJTA 3KDFA 1A62A 1SR3A 3KK7A 2B2UA 4K2KA 1LM0A 5EBDA 2K75A 2Z0SA 1RD9D 1WYDA 2F0JA 3TP6A 1VMCA 2R7DA 4OGQC 3I72A 4J8QA 4YY3L 4BY1B 3ND9A 2G5DA 4HCSA 1I5FA 4KY7A 1N34L 2JA8H 1BUVT 1UE5A 2K5HA 4WFN3 1UEAB 2ICIA 4F88A 1JORA 1PTOD 1AP0A 1K73C 4RKBA 1RCVD 4HJAA 4LF9Q 1G2TA 4NPSA 4OIJA 2OXPA 1QZHA 3BVZA 1FD7D 3KLSA 4DV6L 3J7YW 3R8BA 1H9JA 3BS1A 3OSOA 3G6EA 3MFYA 1ASZA 2F3WA 2PZWA 3I4LA 5D14A 4QUCA 2UUCL 2CHBD 2JA5B 1VF5C 4A3BH 3Q0AA 1TS4A 1I50B 1W3SA 2A19A 4B3MQ 3BJUA 3SDZA 1BCPB 1JE4A 1R4QB 1I6HH 3CCRA 2N55A 2A6ED 4XQJA 2VB2X 1O7ZA 5AFWA 4YWKA 2RVLA 3IFDA 3AB9A 4F87A 4JCVE 1EYCA 5C5MA 1SJHD 3PO2H 5IP9G 1TU2B 2NZ1D 1M1KC 2ALYB 4X6AH 3LX0A 5M5YB 4A3BG 2E2IH 2Q2IA 4A3DG 4A3IH 2A68C 4DU9A 1SYGA 1E2VA 4IFDI 4HIDA 3K58A 3KLRA 3T1YL 1X55A 3VYSA 4RCNA 3LNNA 4HSVA 1PLFA 1E2ZA 3CXCA 1WVLA 1NR4A 2F0QA 3OMGA 3UDXA 2ZJQA 3J7AF 1VQJA 4DF7A 2DNCA 3QO2A 1F2LA 1IBLQ 3T13A 3X3NA 1AW7A 2B2WA 3F2UA 1IYVA 4L8JA 1V1QA 2RCNA 5ISRA 2HCIA 2R7ZH 1S5FD 3D6WA 4K5VA 1WI5A 4ALPA 2VNUD 1XNRL 1WTWA 1ZKOA 4JBWA 3A54A 2E2DC 1VQ9A 3S2HB 4EQOA 3VYUA 2BE5C 4JI5Q 4TRDA 3ND8A 1D7QA 3E9HA 2YV5A 1QG7A 4H02A 2EJGC 2J4XA 4JI2Q 3W1GA 4A3KH 3GTPB 3KJPA 3S1MH 4DR3Q 3M85A 3CKIB 4ABNA 4YWLA 2L55A 4X66Q 3DLLA 4K0KQ 1BCPD 1XPOA 4FO2A 2F0DA 2MQHA 3MXNA 4K2LA 4OX9Q 1YITA 3NUCA 4A3LG 4GLXA 4C1NI 1HZAA 4DV3L 3K8AA 3A56A 1AFPA 4A3BB 4GZYC 3EVQA 2JA6H 4A3DB 4C1NK 5D3IB 3CC7A 1XJVA 1SDFA 5K5PA 4DV2L 1JR0D 1S5CD 3CCVA 3DMUA 2ENBA 4BXXG 3TZUA 1SYEA 1CT1D 2D9UA 4DV5L 3AU7A 3JAMc 1JJ2A 2Q2HA 5BR8Q 1K8GA 1EY7A 2B2VA 4DR7L 2UXBQ 3V2TA 1VQIA 1Y14B 2AKWB 1Q1EA 5IGDA 1I94Q 3S24A 1STEA 3W2DA 1Y1WG 2B63G 4ME5A 3S15B 2JA6G 3IFTA 1RODA 3FKIH 4B3SQ 1U4RA 4A3EH 1J5EL 2NBFA 5C4XH 5I9OA 5GQOA 4RWSC 4NDXA 4X62Q 1IL8A 4CGYB 1LO5D 3QB3A 5LMUQ 4DV1L 3TS2A 1N32L 3QOLA 1IYUA 4CDEC 2M2LA 2PW5A 4DUZQ 5HGQA 4JI7L 1PH9A 5KRUA 3RZDH 5D65A 4XDXA 5GADC 3TQYA 2AWOA 3GTMH 1V8QA 1U9RA 2I07B 3V05A 3I3CA 4JBMA 3BVMA 2A68D 2F03A 1UAPA 2HHHL 3FVQA 3FKIG 1NBWA 5E4XA 1HNXL 2EXDA 3S17H 1PTOF 1C7YA 2F0HA 2EYLA 1L1OA 2LY7A 1RKNA 1WCMH 3OOCA 2NB0A 2QGQA 2K5DA 2L11A 1R4PB 1VS0A 2RHSB 1VQMA 1KIXA 4DR4L 4QB4A 3HOVH 3F8TA 1B7YB 4LF4Q 4FF4A 1CSQA 3N6RA 2XRQD 1CKMA 4XYQA 1G51A 4HJ5A 2NVTH 1Y1WB 2B63B 5C3EG 3MA2B 1X56A 2F0TA 2JA6B 1M8AA 3E3XA 2A74C 1W6KA 1DCZA 2BE5D 2YTVA 4DAPA 4MN3A 5HGTA 3RN2A 3VA7A 5IGBA 1F9SA 2KJXA 3D8GA 2EYJA 1BO0A 4LFAL 1E7ZA 4A3FG 3GTLH 3M7NA 5JAVA 1V43A 1HXYD 2BA0A 5EAYA 3MXNB 3HOVG 1MJCA 2OQKA 1A15A 4IUUA 3NQIA 1MHWC 4WJ3M 3CCJA 1HUMA 2IL8A 4GKKL 4DR2Q 4FDBA 1I3QH 4UPAA 1GM5A 4BBRG 5CC4A 3PIO3 4ZUIA 3FKIB 3TDQA 1H95A 3OIQA 5C0XI 1I4PA 3A8KE 4ZYSA 2RBMA 4LJZC 4DK1A 2BOSA 1S5BD 2UXCL 3TZDA 1OXTA 2C5CA 2ID0A 4HIKA 4IFDJ 4RGNA 3EQLC 1SNPA 2IHFA 1R9TH 2NWGA 3NTIA 1EEFD 1ET9A 3H09A 1FGBD 3EA6A 4YY3Q 1D1IA 3GTOH 4EGVA 4RMFA 3J80c 1B8AA 2LXKA 1N34Q 3CCMA 3UDIA 4OWXB 1VQ7A 3TMEA 4B3ML 3ERSX 3RMHA 4C3HH 5I2YA 1C4QA 3J81L 5C3EB 1ASYA 2F4VL 3C1FA 3TS0A 1TWHH 4O1NA 2O5JC 3S17B 2R92G 4G7OC 4DV6Q 1EYDA 4R4OA 3NBHA 1WCMB 1GUGA 1BCPF 3CCSA 1B4OA 1AH9A 3S9WA 4A3FB 5GAEC 3CU7A 1KRSA 1X9NA 1WTQA 2UUCQ 1TIID 3F2CA 3HOVB 1C8CA 3FRPB 3SHLA 5IT9L 5CV4A 4OONA 2CKZB 1T5XD 1BNZA 1HA6A 1A8VA 1TVXA 4G7ZC 4C3HG 2BDOA 4BBRB 1A3UA 3UDFA 2Z6KC 4HR7B 1Y69U 2ZXOA 4GN3B 3CC2A 1E22A 2KBNA 3K57A 1L1OB 3DWQA 4LK1C 2VS1A 1MGSA 4QQBX 2EJFC 1LTSD 1X65A 1PFSA 3FHWA 5E1FA 1HH2P 4RG1A 4XT1B 3H94A 1C48A 1JCKB 1KQSA 2ZJRA 1HHVA 2JQOA 1NMFA 3I55A 3A55A 4GNXB 2AQ2B 1LLRD 1I3QB 2ZT9C 4GLVB 1X3QA 2B2YC 4N9PA 3G48A 2ES2A 4EVOA 5D3DA 5BN5A 2CW0C 4XQQA 4JI5L 2V4DA 2VL6A 4IUQA 4FVMA 1EIGA 3UI2A 2R92B 4N9TA 3WDNA 1XYIA 4CDCC 5FO8B 4X66L 3MFGA 1CKNA 4LF5L 4BBSH 1STBA 2PQEA 1H9MA 1VQCA 2CWAA 1A3TA 1K28A 2B3GA 4OX9L 1SE8A 4UDUC 3CRLC 3STBD 3L7ZC 3J7ZC 1PH5A 4LF6L 4TQUS 3GTOB 1YI2A 1GHJA 2KA7A 1XNRQ 1XPRA 1EEID 1PRTB 1HQMC 2QF7A 1LTAD 2CQOA 3A74A 4OO1H 2L9HA 1GVPA 4C3HB 5I6YA 2VUMH 3SXHA 3L9AX 1SNQA 5DM63 3S16B 3U9SA 2RQXA 4DAYA 3J81i 3PF5A 2MJ8A 1OXUA 2VXWA 3J7AV 4J6HA 3C1EA 5BR8L 2I5HA 2PO4A 4HJ8A 1QUQB 5CR3A 2UXBL 1I4GA 4DV3Q 1CFMA 2ZTDA 2K5QA 3H91A 1I94L 2Q2UA 3RLNA 3TRZA 3R93A 5A35A 2A8VA 3P1HA 1AEXA 2VQFL 3U4VA 4IO9A 1BXTA 1TXYA 4FP5D 4QCLA 4ZAIA 4JOIC 1Y8NB 3D31A 2RKSA 3NPPA 1G291 5LMUL 2JEBI 5CGKA 4QMGA 4DV5Q 4CDFC 1PYSB 2DUDA 1GD7A 1SNOA 4NB3A 4DR7Q 1YZ6A 2RHQB 2SEBD 2F0MA 4DXFA 5KYIA 3OWFA 4HIMA 1EQQA 3PO3H 3DXJC 1PXUA 2NVYB 2Z6BA 1FNWA 1K83H 1EFID 1HR0L 3QJYA 5L37A 4BA2I 4EQ5A 2N78A 4JK1C 2IX1A 3RNUA 1YHBA 3E9IA 4DFAA 1N32Q 5ELDA 3I91A 1SROA 5LMNL 4N8X1 5IYDG 4JI7Q 5HY6A 4FF3A 5C0XJ 4L6TB 1U4MA 4JG2A 3UDGA 5GAGC 3VR2A 3T1HL 1SMXA 1EOTA 1DOKA 4B3RL 1SMYC 2F0EA 2K33A 1IW7C 3MXUA 1IL2A 2F0SA 2KCTA 4KY5A 3HFZB 3O13A 3GQBA 3DWPA 3K80C 3PUVA 1XXGA 4Y7NH 2FINB 2C35B 1HNXQ 1KXLA 4C3IH 2QEJC 1QZGA 3JAML 1Q81C 4F8MA 1JJGA 1SE2A 2CW0D 3U9OA 3KBXA 1LT3D 2HQLA 2AQ1B 2KENA 4OXPA 1EQTA 5G3LD 1EQRA 1S5DD 1DXMA 2F0IA 2K28A 4DR4Q 4YCWA 5IP7H 1OXSC 1VMPA 1CKNB 4IOAA 3CC4A 1IBKL 1B3QA 1JE5A 2Z1CA 1EQVA 1WOCA 4HAEA 1QVGA 1YNJC 1BBWA 5A2QL 1KLGD 5T1GA 1OXVA 5ELEA 1QWYA 2K6AA 1K0RA 4IPCA 3D4RA 3M4OB 1PFMA 4HTHA 1PH8A 4O2DA 2F3IA 4A3GH 1B70B 3NEMA 1IHZA 4ID6A 1QCBD 5EKIA 3HRZC 4BWGB 1PYWD 2NN6I 3OPOA 2PNRC 5TSSA 4C3JG 4LFAQ 4DAYB 3CHBD 2Q8TA 4AH6A 4P74A 5IP7G 5EPKA 3T16A 2MNAA 4NMZA 1OO9B 3KFUA 1SSOA 1FJGQ 4OL7A 4GKKQ 2XGTA 1RL2A 3CCQA 4K6DA 5KNDA 4RGTA 2IPKD 1K9MC 1X3GA 1O7YA 4IPHA 1VDZA 1Q1BA 4YHHQ 5M9OA 2IT1A 1PFNA 3GV3A 3GTKH 2FHTA 1D5MC 4NW2A 4FXDA 2NTSA 1MBYA 1VQ8A 4CHTB 4DV4Q 4X64L 1G6ZA 5T1IA 5C4HA 2K1BA 3KJOA 4GOPC 1NMGA 2M00A 5IGFA 3GTGH 1SRUA 1HZCA 4XYOA 3VYTA 4TSSA 2NVQH 3M3YH 3S1NB 1E0BA 2N49A 3K5OA 2E2JB 2QILA 1EUJA 4C56C 4KHZA 4DXGA 2DN8A 2F4VQ 2JA8G 3GTQB 2EY1A 1F2YA 1AE2A 1BKBA 5FJ8H 2QEXA 3E6ZX 1DOLA 3GTJH 4KN7C 4POGA 3E0EA 4IFDH 3R2IA 4C3JB 1ESFA 3JAMi 2D2CC 4C2MB 4JI1L 2XNAC 3D3RA 3P7JA 5ELCA 4P71A 3T51B 5M3FH 1F9RA 2F0FA 1Q8IA 1UUPA 1YJ9A 3NENA 1EFWA 1F9QA 1SYBA 1X6OA 1LTLA 5LL6X 3CCUA 2F52A 2I5MX 3MC0B 1X3FA 1NE3A 5CV8A 1D8LA 2O4XA 1SFOB 1T9HA 1HNWL 3D4WA 3I4MH 1E24A 2GA4B 3R3OA 5FLXE 2XIWA 3H0GH
chains in the Genus database with same CATH topology
2JA5H 1HNZQ 1VS0A 3CAMA 2RHSB 3CF5A 1VQMA 1IBLL 1I50H 1KIXA 4DR4L 4A3JH 3HOVH 3F8TA 2NVYH 5JEAJ 1B7YB 3I56A 4LF4Q 1AE3A 1HZ9A 1CSQA 3PO2G 4R1JA 5IY0A 1Q7YC 3NELA 1CKMA 1Q82C 1G51A 4UP9A 4HJ5A 1S40A 1TWFH 3KOJA 2NVTH 4DR1L 3PIOA 2D0OA 2ZJPA 3T1YQ 3KLWA 3M4QA 2JEAI 2PQAB 5C3EG 3VDYA 4A3IG 1X56A 3RN5A 1YNXA 1JB7A 1YJNA 2UUBQ 4EX5A 5JJKA 2YTVA 1EYGA 1OXXK 2I0QA 4DR6L 4KI0A 1YBYA 2OQ0A 1XMOQ 2UXDQ 2Y0SE 3RN2A 2IHEA 4JI2L 4DR3L 4KHPL 2JA9A 5M3MH 4K0KL 4LF7L 4LFAL 5M5YH 1E7ZA 3B6YA 3RLFA 4A3FG 4LF5Q 4LF8Q 3HOWH 1GKHA 4DUYQ 1N36L 3CCLA 3GTLH 3M7NA 1V43A 2BA0A 1BBUA 5EAYA 1IYJB 3MXNB 4A3MG 3L2PA 3HOVG 1MJCA 2OQKA 2XTIA 2ZTEA 4DPGA 1MJEA 1MIUA 3PUXA 4WJ3M 4LFBL 3CCJA 4LF6Q 1UE7A 3KF6B 1Y1VG 2OTLA 4GKKL 4IPGA 4DR2Q 2R7ZG 4FDBA 1I3QH 4DR5L 3D0FA 4DV7Q 4IJHA 2HT1A 2HIXA 2RF4A 4UPAA 1GM5A 4BBRG 1NTGA 5C4JH 3CMAA 1N33L 4Y52H 1H95A 5C0XI 4JI3Q 4LW1A 4POFA 4JI6L 4GKJL 3OW2A 5IYCH 3K7UC 2ZTCA 4DK3C 1OXTA 3EN2A 1U0LA 1LYLA 2E8GA 3S1RH 4A3GG 3AYHB 3U58A 2ID0A 4HIKA 1VQ6A 4A3KG 3AEVA 1DGSA 2K4KA 4IFDJ 2IHFA 2LSSA 1R9TH 5K36G 4OO1I 4XTCS 2L15A 1KC8C 5JJIA 2D0PA 2WB1E 1U5KA 4YY3Q 1YIJA 3GTOH 1Q12A 2PI2E 2KHIA 3AFQA 4RMFA 3J80c 1B8AA 2LXKA 1N34Q 3CCMA 3S2HH 2IY5B 3UDIA 2MO0A 5JEAG 4OWXB 2VW9A 2QA4A 1VQ7A 1Q8KA 2HIVA 2BH2A 3M4OH 4XIGS 4GS3A 3ERSX 4B3ML 5FLXc 2VQFQ 2VQEQ 4C3HH 4DV2Q 2YU9H 1UE1A 3WWVA 1EWIA 3BZCA 3ULLA 1JJCB 4MTNA 2F4VL 1ASYA 3HKZE 3GTPH 3PF4A 3TS0A 2GN5A 4X62L 1PH4A 3CPWA 1BVSA 2UUAL 3BZKA 4P73A 1TWHH 4LUOA 3M4PA 4P75A 5IYDH 2R92G 3K0XA 2A1AA 4QIWE 4DV6Q 2CWPA 4R4OA 4AYBG 2CCZA 1Q46A 3NBHB 4BA1I 4DUZL 2ZM6L 4DV0L 5IP9H 3G4SA 1CKOA 3CCSA 4PZ8A 1PHJA 1HZBA 3LGJA 1AH9A 1N8RC 4NXNQ 5GAEC 3TREA 1KRSA 1X9NA 2UUCQ 3J81j 4A93H 2E2HH 4A3DH 3F2CA 3EBEA 3K7AH 4O0AA 3PIPA 4JV5L 3J80i 4OONA 2CKZB 3F1ZA 3I4OA 1J5EQ 2WAQE 1PA6A 1QVCA 1HR0Q 1N9WA 1KRTA 1A8VA 2AMCB 1PVOA 3HOZH 3A5ZB 3RZOH 4L5TA 4GOPA 3UDFA 4GOPB 2Z6KC 4A3EG 4DV1Q 1VQHA 2YTYA 2EQSA 2N8NA 4LFCQ 1VQNA 2UXCQ 4GN3B 5C4XG 3MEFA 3CMEA 3F2BA 3GD7A 3CC2A 1E22A 1KAWA 2JE6I 4YWMA 2KBNA 5LMNQ 1L1OB 2OWOA 5FJ8G 5IWAQ 1O7IA 1TWGH 2N3SA 2VS1A 1HNZL 4QQBX 3S1NH 2IX0A 3PUWA 4NXMQ 1X65A 1K3RA 1PFSA 1VQBA 3FHWA 4APVA 1XPUA 1HH2P 4BY1G 2E2JH 1S3OA 4IFDG 4RG1A 4LF4L 1FGUA 1KD1C 3GDEA 3S15H 2KCMA 3T1HQ 1KQSA 2ZJRA 1X3EA 4B3RQ 2JQOA 3HKSA 2AWNA 1NMFA 2K5VA 4QJFA 5IE8A 3I55A 2ASBA 4GNXA 2HHHQ 4GNXB 5M3FG 3GTQH 2VY3A 5GAHC 1YVCA 1JT8A 1IXRA 3HOZG 4GLVB 1D7QA 1MKHA 2Q2TA 1UEBA 3OTOQ 3G48A 2ES2A 2GVBA 3HOXH 4JI5L 1XMOL 4PZ7A 4C3JH 2BA1A 2OCEA 2VL6A 4R4CA 4C2MH 4UY8C 2K14A 1VQKA 3J81c 4ME3A 4A3CH 4IJLA 4GN5A 4B3TL 3I4MG 4JI4L 5J3BA 2R6GA 1XMQQ 5ELNA 1WCMG 4A3LH 4X66L 1CKNA 4LF5L 4LF8L 4BBSH 3H0GG 3AFPA 5DLQE 4DUYL 4HJ7A 1VQLA 2JA5G 1NJIC 1VQCA 3Q8DA 1CSPA 2CWAA 2R7FA 2PNHA 3K81C 2B3GA 4LUVA 1SE8A 3STBD 4OX9L 4WJ4A 3L7ZC 2V1CC 3TEHB 3J7ZC 3F2DA 4DR1Q 4A3JG 1PH5A 2JA7H 1IBKQ 4TQUS 4LF6L 1E1TA 3ULJA 1YI2A 4AQYQ 2YTXA 1XNRQ 4DR2L 1XPRA 1FJGL 1Z47A 5H1SE 4DV7L 2PI2A 2CQOA 2NN6G 3ZJYC 1XNQQ 3A74A 5LMNW 1SFOH 4BY7H 3G71A 4LWCA 1EOVA 4QL5A 4TVAB 5IT9c 4JI8Q 1GVPA 2VUMH 4JI3L 5M5XH 4JI0Q 4YHHL 4BXXH 5JJLA 4R4IA 3KDFA 1A62A 3KDFB 4KHPQ 4AIMA 1SR3A 2K50A 3A0JA 3CQZH 4OWTB 3J81i 3PF5A 5FLMH 1LM0A 3HOYH 3J7A5 2H5XA 2K75A 2Z0SA 4DV4L 1OXUA 1WYDA 3I2ZA 1P16A 2Y0SG 5M3MG 1E3PA 2R7DA 2OTJA 1IBMQ 5BR8L 2I5HA 4YY3L 4HJ8A 3HOWG 1Y1WH 2B63H 1QUQA 1QUQB 1I5FA 1WJJA 1HJPA 3UE1A 4DV3Q 2E5LL 4MNOA 2UXBL 2ZTDA 1N34L 1I94L 4HIOA 2Q2UA 3RLNA 1OTCA 2JA8H 3TRZA 2A8VA 3I4NH 1UE5A 2VQFL 4GN4B 2K5HA 4IPDA 2VQEL 4A4IA 3U4VA 4JI6Q 4IO9A 1UWVA 1K73C 4HJ9A 1TXYA 3HOUH 4HJAA 4LF9Q 4NPSA 4JOIC 3D31A 1QZHA 1PH1A 3GO5A 1W2BA 1G291 4X64Q 2AHOB 2JEBI 5LMUL 4DV6L 1VQGA 4DV5Q 5IYCG 5IYBH 2R93H 3S2DH 1YEZA 1PYSB 3AQQA 3PGZA 2DUDA 3G6EA 1ASZA 1GD7A 4NB3A 4DR7Q 1YZ6A 2RHQB 1VQAA 4NXNL 4B3SL 2UUCL 1L1OC 1EQQA 4HIMA 3PO3H 1YJWA 4A3BH 4X65Q 1W3SA 2FXQA 2A19A 5C44H 2UU9L 2GVAA 1S72A 4B3MQ 1NY4A 5GROA 3KYHC 2WB1G 1K83H 4KLKA 3BJUA 4PG3A 3PSIA 1HR0L 1KHIA 1I6HH 3CP0A 2EIFA 4BA2I 3CCRA 4EQ5A 2N78A 4DNIA 1VQ4A 3RNUA 2IX1A 1YHBA 3E9IA 5E7NA 5ELOA 1GO3E 1N32Q 1Q86C 1FVIA 2NZHA 3HKZG 3RLOA 4A75A 1SROA 5LMNL 4YWKA 2JJQA 5IWAL 3M9BA 3H15A 4JBKA 4JYAQ 1VQEA 2LXJA 5IYBG 5IYDG 4JI7Q 4JCVE 4DAMA 5HY6A 3H3VI 5C0XJ 4NXML 3PO2H 4JI1Q 2K5NA 2MO1A 4YCVA 4JG2A 1IZ6A 1L0WA 5IP9G 5AJ3Q 3UDGA 5GAGC 2ALYB 1M1KC 3T1HL 1SMXA 1VQ5A 4A3BG 4B3RL 2E2IH 3DM3A 2Q2IA 4A93G 1PH6A 5C3EH 5C44G 1SLJA 4A3IH 3S1QH 4A3DG 1IL2A 4LNQA 2KCTA 3PUYA 1J6QA 3HFZB 3CCEA 4IFDI 3K80C 3PUVA 4Y7NH 4HIDA 4R4TA 3T1YL 1X55A 2C35B 1P8LA 4L5QA 1HNXQ 4C3IH 3OTOL 2UUBL 1KXLA 1QZGA 3CXCA 3UE0A 1Q81C 2WAQG 1JJGA 1HNWQ 4QY7A 5M5WH 2D62A 3UDXA 4MZ9A 2ZJQA 1VQJA 1C0AA 2HQLA 1L2FA 2UXDL 4A3FH 2KENA 4OXPA 1JMCA 1XMQL 4A3MH 4GLAC 1IBLQ 1EQRA 3OYYA 2NVXH 4DR4Q 4YCWA 5IP7H 1OXSC 1YHQA 4IOCA 1CKNB 4IOAA 1A63A 1XTDA 3CC4A 1V1QA 1Y1VH 2RCNA 1X54A 1HR0W 2R7ZH 1PYBA 2Z6KA 1WI5A 1IBKL 2PQAA 4ALPA 4AQYL 2VNUD 1XNRL 4BBRH 1FL0A 3A5UA 1JE5A 4JBWA 1WOCA 1QVGA 1BBWA 1XNQL 2JK8A 1OXVA 1VQ9A 2BH8A 1EIYB 1K0RA 4JI8L 4IPCA 2CFMA 4JI5Q 4YCUA 4DR6Q 4JI0L 1PH8A 4O2DA 2F3IA 4A3GH 2B29A 2YV5A 1B70B 3E9HA 1RIPA 3NEMA 3L0OA 4H02A 4JI2Q 3W1GA 4A3KH 3KJPA 4B3TQ 4JI4Q 4DR3Q 3HOXG 2I5LX 2NN6I 3M85A 2ATWA 4A76A 3S1MH 4YWLA 4X66Q 3DLLA 4K0KQ 4LF7Q 1XPOA 4J15A 4LFAQ 4DAYB 4A3CG 3PCOB 2MQHA 4LUZA 3ICEA 1N36Q 4AH6A 4OX9Q 3STBC 4P74A 1YITA 4PZ6A 1IBML 5IP7G 4A3LG 3IRBA 3FP9A 4BBSG 3KF6A 2MNAA 4GLXA 4L5RC 4R4QA 1HZAA 3KFUA 3CW2C 3BU2A 1SN8A 3K8AA 5C0XG 4QGUA 4DV3L 1FJGQ 4LFBQ 4GKKQ 2XGTA 3RR5A 1PH2A 1RL2A 1VCIA 3CCQA 2JA7G 2JA6H 4DR5Q 3SGIA 1K9MC 1X3GA 3CC7A 4IPHA 2YYZA 1XJVA 1VQFA 1CUKA 1Q1BA 1V9PA 1N33Q 4YHHQ 4DV2L 2IT1A 3ER0A 4AYBE 3GTKH 4BY7G 1Z9FA 3S14H 2NZOA 4OO1G 4GKJQ 2R92H 1PH7A 4LF9L 1VQ8A 3CCVA 4L5SA 2WP8J 2VUMG 2K52A 1TWCH 3EIVA 4DV4Q 4BXXG 4X64L 3W1BA 4DV5L 3JAMc 2VZAA 2WFWA 3KJOA 2DGYA 1NMGA 2Q2HA 4GOPC 1JJ2A 5BR8Q 4JBJA 1K8GA 5FLMG 3U50C 3CD6A 3HOYG 3PUZA 3GTGH 4DR7L 1SRUA 3I7FA 1HZCA 2PMZE 2E5LQ 2UXBQ 1VQIA 1Y14B 1EIFA 2AKWB 2NVQH 3M3YH 4X65L 1PV4A 1Q1EA 2N49A 1C9OA 1I94Q 3S24A 1A0IA 1Y1WG 2B63G 1EUJA 1M90C 1YHAA 4KHZA 2JA6G 3FKIH 4B3SQ 3H3VH 4A3EH 1J5EL 1TWAH 3S16H 2F4VQ 2JA8G 5C4XH 5GQOA 3I4NG 4X62Q 1K8AC 4JC0A 4DKAC 2UUAQ 2KHJA 1AE2A 4GNXC 1BKBA 3ULPA 1UE6A 4P72A 5FJ8H 2QEXA 5LMUQ 4DV1L 3TS2A 1N32L 1KL9A 4LFCL 3W5OA 1VQOA 4PMWA 3HOUG 2UXCL 4X6AH 3GTJH 4POGA 3E0EA 4DUZQ 4BY1H 4DV0Q 4JYAL 2ZM6Q 1WFQA 3KF8B 5HGQA 4JI7L 3JAMi 1VQDA 4OWWB 1PH3A 1PH9A 3RZDH 4JI1L 1E1OA 5GADC 2R93G 3TQYA 4P71A 5AJ3L 2UU9Q 3JC66 2AWOA 5M3FH 1LUZA 3GTMH 4JV5Q 1YJ9A 3NENA 1EFWA 4JBMA 3CPFA 3PO3G 1X6OA 3U4ZA 2MFIA 4JOIA 1LTLA 2HHHL 3CCUA 3FKIG 1VQPA 1QVFA 1NBWA 2F52A 2I5MX 4UP8A 1X3FA 4DK6C 1HNXL 1NE3A 2EXDA 3S17H 1D8LA 1T9HA 1C7YA 3PV0A 1HNWL 1G6PA 3I4MH 1E24A 1L1OA 4UP7A 1WCMH 2QGQA 3H0GH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA5 H;  1HNZ Q;  1VS0 A;  3CAM A;  2RHS B;  3CF5 A;  1VQM A;  1IBL L;  1I50 H;  1KIX A;  4DR4 L;  4A3J H;  3HOV H;  3F8T A;  2NVY H;  5JEA J;  1B7Y B;  3I56 A;  4LF4 Q;  1AE3 A;  1HZ9 A;  1CSQ A;  3PO2 G;  4R1J A;  5IY0 A;  1Q7Y C;  3NEL A;  1CKM A;  1Q82 C;  1G51 A;  4UP9 A;  4HJ5 A;  1S40 A;  1TWF H;  3KOJ A;  2NVT H;  4DR1 L;  3PIO A;  2D0O A;  2ZJP A;  3T1Y Q;  3KLW A;  3M4Q A;  2JEA I;  2PQA B;  5C3E G;  3VDY A;  4A3I G;  1X56 A;  3RN5 A;  1YNX A;  1JB7 A;  1YJN A;  2UUB Q;  4EX5 A;  5JJK A;  2YTV A;  1EYG A;  1OXX K;  2I0Q A;  4DR6 L;  4KI0 A;  1YBY A;  2OQ0 A;  1XMO Q;  2UXD Q;  2Y0S E;  3RN2 A;  2IHE A;  4JI2 L;  4DR3 L;  4KHP L;  2JA9 A;  5M3M H;  4K0K L;  4LF7 L;  4LFA L;  5M5Y H;  1E7Z A;  3B6Y A;  3RLF A;  4A3F G;  4LF5 Q;  4LF8 Q;  3HOW H;  1GKH A;  4DUY Q;  1N36 L;  3CCL A;  3GTL H;  3M7N A;  1V43 A;  2BA0 A;  1BBU A;  5EAY A;  1IYJ B;  3MXN B;  4A3M G;  3L2P A;  3HOV G;  1MJC A;  2OQK A;  2XTI A;  2ZTE A;  4DPG A;  1MJE A;  1MIU A;  3PUX A;  4WJ3 M;  4LFB L;  3CCJ A;  4LF6 Q;  1UE7 A;  3KF6 B;  1Y1V G;  2OTL A;  4GKK L;  4IPG A;  4DR2 Q;  2R7Z G;  4FDB A;  1I3Q H;  4DR5 L;  3D0F A;  4DV7 Q;  4IJH A;  2HT1 A;  2HIX A;  2RF4 A;  4UPA A;  1GM5 A;  4BBR G;  1NTG A;  5C4J H;  3CMA A;  1N33 L;  4Y52 H;  1H95 A;  5C0X I;  4JI3 Q;  4LW1 A;  4POF A;  4JI6 L;  4GKJ L;  3OW2 A;  5IYC H;  3K7U C;  2ZTC A;  4DK3 C;  1OXT A;  3EN2 A;  1U0L A;  1LYL A;  2E8G A;  3S1R H;  4A3G G;  3AYH B;  3U58 A;  2ID0 A;  4HIK A;  1VQ6 A;  4A3K G;  3AEV A;  1DGS A;  2K4K A;  4IFD J;  2IHF A;  2LSS A;  1R9T H;  5K36 G;  4OO1 I;  4XTC S;  2L15 A;  1KC8 C;  5JJI A;  2D0P A;  2WB1 E;  1U5K A;  4YY3 Q;  1YIJ A;  3GTO H;  1Q12 A;  2PI2 E;  2KHI A;  3AFQ A;  4RMF A;  3J80 c;  1B8A A;  2LXK A;  1N34 Q;  3CCM A;  3S2H H;  2IY5 B;  3UDI A;  2MO0 A;  5JEA G;  4OWX B;  2VW9 A;  2QA4 A;  1VQ7 A;  1Q8K A;  2HIV A;  2BH2 A;  3M4O H;  4XIG S;  4GS3 A;  3ERS X;  4B3M L;  5FLX c;  2VQF Q;  2VQE Q;  4C3H H;  4DV2 Q;  2YU9 H;  1UE1 A;  3WWV A;  1EWI A;  3BZC A;  3ULL A;  1JJC B;  4MTN A;  2F4V L;  1ASY A;  3HKZ E;  3GTP H;  3PF4 A;  3TS0 A;  2GN5 A;  4X62 L;  1PH4 A;  3CPW A;  1BVS A;  2UUA L;  3BZK A;  4P73 A;  1TWH H;  4LUO A;  3M4P A;  4P75 A;  5IYD H;  2R92 G;  3K0X A;  2A1A A;  4QIW E;  4DV6 Q;  2CWP A;  4R4O A;  4AYB G;  2CCZ A;  1Q46 A;  3NBH B;  4BA1 I;  4DUZ L;  2ZM6 L;  4DV0 L;  5IP9 H;  3G4S A;  1CKO A;  3CCS A;  4PZ8 A;  1PHJ A;  1HZB A;  3LGJ A;  1AH9 A;  1N8R C;  4NXN Q;  5GAE C;  3TRE A;  1KRS A;  1X9N A;  2UUC Q;  3J81 j;  4A93 H;  2E2H H;  4A3D H;  3F2C A;  3EBE A;  3K7A H;  4O0A A;  3PIP A;  4JV5 L;  3J80 i;  4OON A;  2CKZ B;  3F1Z A;  3I4O A;  1J5E Q;  2WAQ E;  1PA6 A;  1QVC A;  1HR0 Q;  1N9W A;  1KRT A;  1A8V A;  2AMC B;  1PVO A;  3HOZ H;  3A5Z B;  3RZO H;  4L5T A;  4GOP A;  3UDF A;  4GOP B;  2Z6K C;  4A3E G;  4DV1 Q;  1VQH A;  2YTY A;  2EQS A;  2N8N A;  4LFC Q;  1VQN A;  2UXC Q;  4GN3 B;  5C4X G;  3MEF A;  3CME A;  3F2B A;  3GD7 A;  3CC2 A;  1E22 A;  1KAW A;  2JE6 I;  4YWM A;  2KBN A;  5LMN Q;  1L1O B;  2OWO A;  5FJ8 G;  5IWA Q;  1O7I A;  1TWG H;  2N3S A;  2VS1 A;  1HNZ L;  4QQB X;  3S1N H;  2IX0 A;  3PUW A;  4NXM Q;  1X65 A;  1K3R A;  1PFS A;  1VQB A;  3FHW A;  4APV A;  1XPU A;  1HH2 P;  4BY1 G;  2E2J H;  1S3O A;  4IFD G;  4RG1 A;  4LF4 L;  1FGU A;  1KD1 C;  3GDE A;  3S15 H;  2KCM A;  3T1H Q;  1KQS A;  2ZJR A;  1X3E A;  4B3R Q;  2JQO A;  3HKS A;  2AWN A;  1NMF A;  2K5V A;  4QJF A;  5IE8 A;  3I55 A;  2ASB A;  4GNX A;  2HHH Q;  4GNX B;  5M3F G;  3GTQ H;  2VY3 A;  5GAH C;  1YVC A;  1JT8 A;  1IXR A;  3HOZ G;  4GLV B;  1D7Q A;  1MKH A;  2Q2T A;  1UEB A;  3OTO Q;  3G48 A;  2ES2 A;  2GVB A;  3HOX H;  4JI5 L;  1XMO L;  4PZ7 A;  4C3J H;  2BA1 A;  2OCE A;  2VL6 A;  4R4C A;  4C2M H;  4UY8 C;  2K14 A;  1VQK A;  3J81 c;  4ME3 A;  4A3C H;  4IJL A;  4GN5 A;  4B3T L;  3I4M G;  4JI4 L;  5J3B A;  2R6G A;  1XMQ Q;  5ELN A;  1WCM G;  4A3L H;  4X66 L;  1CKN A;  4LF5 L;  4LF8 L;  4BBS H;  3H0G G;  3AFP A;  5DLQ E;  4DUY L;  4HJ7 A;  1VQL A;  2JA5 G;  1NJI C;  1VQC A;  3Q8D A;  1CSP A;  2CWA A;  2R7F A;  2PNH A;  3K81 C;  2B3G A;  4LUV A;  1SE8 A;  3STB D;  4OX9 L;  4WJ4 A;  3L7Z C;  2V1C C;  3TEH B;  3J7Z C;  3F2D A;  4DR1 Q;  4A3J G;  1PH5 A;  2JA7 H;  1IBK Q;  4TQU S;  4LF6 L;  1E1T A;  3ULJ A;  1YI2 A;  4AQY Q;  2YTX A;  1XNR Q;  4DR2 L;  1XPR A;  1FJG L;  1Z47 A;  5H1S E;  4DV7 L;  2PI2 A;  2CQO A;  2NN6 G;  3ZJY C;  1XNQ Q;  3A74 A;  5LMN W;  1SFO H;  4BY7 H;  3G71 A;  4LWC A;  1EOV A;  4QL5 A;  4TVA B;  5IT9 c;  4JI8 Q;  1GVP A;  2VUM H;  4JI3 L;  5M5X H;  4JI0 Q;  4YHH L;  4BXX H;  5JJL A;  4R4I A;  3KDF A;  1A62 A;  3KDF B;  4KHP Q;  4AIM A;  1SR3 A;  2K50 A;  3A0J A;  3CQZ H;  4OWT B;  3J81 i;  3PF5 A;  5FLM H;  1LM0 A;  3HOY H;  3J7A 5;  2H5X A;  2K75 A;  2Z0S A;  4DV4 L;  1OXU A;  1WYD A;  3I2Z A;  1P16 A;  2Y0S G;  5M3M G;  1E3P A;  2R7D A;  2OTJ A;  1IBM Q;  5BR8 L;  2I5H A;  4YY3 L;  4HJ8 A;  3HOW G;  1Y1W H;  2B63 H;  1QUQ A;  1QUQ B;  1I5F A;  1WJJ A;  1HJP A;  3UE1 A;  4DV3 Q;  2E5L L;  4MNO A;  2UXB L;  2ZTD A;  1N34 L;  1I94 L;  4HIO A;  2Q2U A;  3RLN A;  1OTC A;  2JA8 H;  3TRZ A;  2A8V A;  3I4N H;  1UE5 A;  2VQF L;  4GN4 B;  2K5H A;  4IPD A;  2VQE L;  4A4I A;  3U4V A;  4JI6 Q;  4IO9 A;  1UWV A;  1K73 C;  4HJ9 A;  1TXY A;  3HOU H;  4HJA A;  4LF9 Q;  4NPS A;  4JOI C;  3D31 A;  1QZH A;  1PH1 A;  3GO5 A;  1W2B A;  1G29 1;  4X64 Q;  2AHO B;  2JEB I;  5LMU L;  4DV6 L;  1VQG A;  4DV5 Q;  5IYC G;  5IYB H;  2R93 H;  3S2D H;  1YEZ A;  1PYS B;  3AQQ A;  3PGZ A;  2DUD A;  3G6E A;  1ASZ A;  1GD7 A;  4NB3 A;  4DR7 Q;  1YZ6 A;  2RHQ B;  1VQA A;  4NXN L;  4B3S L;  2UUC L;  1L1O C;  1EQQ A;  4HIM A;  3PO3 H;  1YJW A;  4A3B H;  4X65 Q;  1W3S A;  2FXQ A;  2A19 A;  5C44 H;  2UU9 L;  2GVA A;  1S72 A;  4B3M Q;  1NY4 A;  5GRO A;  3KYH C;  2WB1 G;  1K83 H;  4KLK A;  3BJU A;  4PG3 A;  3PSI A;  1HR0 L;  1KHI A;  1I6H H;  3CP0 A;  2EIF A;  4BA2 I;  3CCR A;  4EQ5 A;  2N78 A;  4DNI A;  1VQ4 A;  3RNU A;  2IX1 A;  1YHB A;  3E9I A;  5E7N A;  5ELO A;  1GO3 E;  1N32 Q;  1Q86 C;  1FVI A;  2NZH A;  3HKZ G;  3RLO A;  4A75 A;  1SRO A;  5LMN L;  4YWK A;  2JJQ A;  5IWA L;  3M9B A;  3H15 A;  4JBK A;  4JYA Q;  1VQE A;  2LXJ A;  5IYB G;  5IYD G;  4JI7 Q;  4JCV E;  4DAM A;  5HY6 A;  3H3V I;  5C0X J;  4NXM L;  3PO2 H;  4JI1 Q;  2K5N A;  2MO1 A;  4YCV A;  4JG2 A;  1IZ6 A;  1L0W A;  5IP9 G;  5AJ3 Q;  3UDG A;  5GAG C;  2ALY B;  1M1K C;  3T1H L;  1SMX A;  1VQ5 A;  4A3B G;  4B3R L;  2E2I H;  3DM3 A;  2Q2I A;  4A93 G;  1PH6 A;  5C3E H;  5C44 G;  1SLJ A;  4A3I H;  3S1Q H;  4A3D G;  1IL2 A;  4LNQ A;  2KCT A;  3PUY A;  1J6Q A;  3HFZ B;  3CCE A;  4IFD I;  3K80 C;  3PUV A;  4Y7N H;  4HID A;  4R4T A;  3T1Y L;  1X55 A;  2C35 B;  1P8L A;  4L5Q A;  1HNX Q;  4C3I H;  3OTO L;  2UUB L;  1KXL A;  1QZG A;  3CXC A;  3UE0 A;  1Q81 C;  2WAQ G;  1JJG A;  1HNW Q;  4QY7 A;  5M5W H;  2D62 A;  3UDX A;  4MZ9 A;  2ZJQ A;  1VQJ A;  1C0A A;  2HQL A;  1L2F A;  2UXD L;  4A3F H;  2KEN A;  4OXP A;  1JMC A;  1XMQ L;  4A3M H;  4GLA C;  1IBL Q;  1EQR A;  3OYY A;  2NVX H;  4DR4 Q;  4YCW A;  5IP7 H;  1OXS C;  1YHQ A;  4IOC A;  1CKN B;  4IOA A;  1A63 A;  1XTD A;  3CC4 A;  1V1Q A;  1Y1V H;  2RCN A;  1X54 A;  1HR0 W;  2R7Z H;  1PYB A;  2Z6K A;  1WI5 A;  1IBK L;  2PQA A;  4ALP A;  4AQY L;  2VNU D;  1XNR L;  4BBR H;  1FL0 A;  3A5U A;  1JE5 A;  4JBW A;  1WOC A;  1QVG A;  1BBW A;  1XNQ L;  2JK8 A;  1OXV A;  1VQ9 A;  2BH8 A;  1EIY B;  1K0R A;  4JI8 L;  4IPC A;  2CFM A;  4JI5 Q;  4YCU A;  4DR6 Q;  4JI0 L;  1PH8 A;  4O2D A;  2F3I A;  4A3G H;  2B29 A;  2YV5 A;  1B70 B;  3E9H A;  1RIP A;  3NEM A;  3L0O A;  4H02 A;  4JI2 Q;  3W1G A;  4A3K H;  3KJP A;  4B3T Q;  4JI4 Q;  4DR3 Q;  3HOX G;  2I5L X;  2NN6 I;  3M85 A;  2ATW A;  4A76 A;  3S1M H;  4YWL A;  4X66 Q;  3DLL A;  4K0K Q;  4LF7 Q;  1XPO A;  4J15 A;  4LFA Q;  4DAY B;  4A3C G;  3PCO B;  2MQH A;  4LUZ A;  3ICE A;  1N36 Q;  4AH6 A;  4OX9 Q;  3STB C;  4P74 A;  1YIT A;  4PZ6 A;  1IBM L;  5IP7 G;  4A3L G;  3IRB A;  3FP9 A;  4BBS G;  3KF6 A;  2MNA A;  4GLX A;  4L5R C;  4R4Q A;  1HZA A;  3KFU A;  3CW2 C;  3BU2 A;  1SN8 A;  3K8A A;  5C0X G;  4QGU A;  4DV3 L;  1FJG Q;  4LFB Q;  4GKK Q;  2XGT A;  3RR5 A;  1PH2 A;  1RL2 A;  1VCI A;  3CCQ A;  2JA7 G;  2JA6 H;  4DR5 Q;  3SGI A;  1K9M C;  1X3G A;  3CC7 A;  4IPH A;  2YYZ A;  1XJV A;  1VQF A;  1CUK A;  1Q1B A;  1V9P A;  1N33 Q;  4YHH Q;  4DV2 L;  2IT1 A;  3ER0 A;  4AYB E;  3GTK H;  4BY7 G;  1Z9F A;  3S14 H;  2NZO A;  4OO1 G;  4GKJ Q;  2R92 H;  1PH7 A;  4LF9 L;  1VQ8 A;  3CCV A;  4L5S A;  2WP8 J;  2VUM G;  2K52 A;  1TWC H;  3EIV A;  4DV4 Q;  4BXX G;  4X64 L;  3W1B A;  4DV5 L;  3JAM c;  2VZA A;  2WFW A;  3KJO A;  2DGY A;  1NMG A;  2Q2H A;  4GOP C;  1JJ2 A;  5BR8 Q;  4JBJ A;  1K8G A;  5FLM G;  3U50 C;  3CD6 A;  3HOY G;  3PUZ A;  3GTG H;  4DR7 L;  1SRU A;  3I7F A;  1HZC A;  2PMZ E;  2E5L Q;  2UXB Q;  1VQI A;  1Y14 B;  1EIF A;  2AKW B;  2NVQ H;  3M3Y H;  4X65 L;  1PV4 A;  1Q1E A;  2N49 A;  1C9O A;  1I94 Q;  3S24 A;  1A0I A;  1Y1W G;  2B63 G;  1EUJ A;  1M90 C;  1YHA A;  4KHZ A;  2JA6 G;  3FKI H;  4B3S Q;  3H3V H;  4A3E H;  1J5E L;  1TWA H;  3S16 H;  2F4V Q;  2JA8 G;  5C4X H;  5GQO A;  3I4N G;  4X62 Q;  1K8A C;  4JC0 A;  4DKA C;  2UUA Q;  2KHJ A;  1AE2 A;  4GNX C;  1BKB A;  3ULP A;  1UE6 A;  4P72 A;  5FJ8 H;  2QEX A;  5LMU Q;  4DV1 L;  3TS2 A;  1N32 L;  1KL9 A;  4LFC L;  3W5O A;  1VQO A;  4PMW A;  3HOU G;  2UXC L;  4X6A H;  3GTJ H;  4POG A;  3E0E A;  4DUZ Q;  4BY1 H;  4DV0 Q;  4JYA L;  2ZM6 Q;  1WFQ A;  3KF8 B;  5HGQ A;  4JI7 L;  3JAM i;  1VQD A;  4OWW B;  1PH3 A;  1PH9 A;  3RZD H;  4JI1 L;  1E1O A;  5GAD C;  2R93 G;  3TQY A;  4P71 A;  5AJ3 L;  2UU9 Q;  3JC6 6;  2AWO A;  5M3F H;  1LUZ A;  3GTM H;  4JV5 Q;  1YJ9 A;  3NEN A;  1EFW A;  4JBM A;  3CPF A;  3PO3 G;  1X6O A;  3U4Z A;  2MFI A;  4JOI A;  1LTL A;  2HHH L;  3CCU A;  3FKI G;  1VQP A;  1QVF A;  1NBW A;  2F52 A;  2I5M X;  4UP8 A;  1X3F A;  4DK6 C;  1HNX L;  1NE3 A;  2EXD A;  3S17 H;  1D8L A;  1T9H A;  1C7Y A;  3PV0 A;  1HNW L;  1G6P A;  3I4M H;  1E24 A;  1L1O A;  4UP7 A;  1WCM H;  2QGQ A;  3H0G H; 
#chains in the Genus database with same CATH topology
 4IUR A;  1II3 A;  3CAM A;  3J80 L;  1PZI D;  4A3J H;  4WOR A;  1JWS D;  2BDN A;  5JEA J;  1AN8 A;  3I56 A;  5COY A;  1W6J A;  3PO2 G;  2B2U C;  3T53 B;  4UP9 A;  1S40 A;  1TWF H;  3KOJ A;  4KJN A;  2QKI C;  2D0O A;  4UAI A;  5NUC A;  4B9X A;  3SK8 A;  2JEA I;  1CQF A;  2A69 D;  4A3I G;  1LTR D;  1F9P A;  1YJN A;  4G4K A;  1QE6 A;  1QB5 D;  1ICF B;  1VF7 A;  4EX5 A;  5JJK A;  2OT2 A;  5KEE A;  2JA8 B;  4DR6 L;  1SYD A;  4LAA A;  2K04 A;  2IHE A;  4FXK C;  3I70 A;  2JA9 A;  5M3M H;  1PRT F;  1I4R A;  1EWC A;  2QDL A;  3RLF A;  4LF5 Q;  3HOW H;  1GKH A;  2B39 A;  1LT5 D;  3L2P A;  3MTS A;  2XTI A;  4DPG A;  2EY6 A;  4LF6 Q;  4JPB W;  4IPG A;  3VR5 A;  2R7Z G;  2HIX A;  2RF4 A;  5C4J H;  3ONA B;  4WJW A;  1JWM D;  1TR5 A;  3SK5 A;  4POF A;  2VB3 X;  4FNF A;  1K8M A;  1I6H B;  1GJX A;  3W3A A;  5IYC H;  3K7U C;  2ZTC A;  1U0L A;  1LYL A;  2KVM A;  4ULL A;  1VQ6 A;  4L63 B;  4A3K G;  2LS0 1;  2JXM B;  1O78 A;  2L0C A;  1GUW A;  5LL6 S;  3GTJ B;  2Z8L A;  2HDL A;  1EY9 A;  5EGT A;  2WKC A;  5JJI A;  5BN3 A;  5KNC A;  3QWN A;  2KCC A;  3AFQ A;  3PO2 B;  2IY5 B;  2QA4 A;  1Q8K A;  1NUC A;  5FLX c;  2VQF Q;  2E2I B;  2RCF A;  1UE1 A;  3WWV A;  4ZRZ A;  4A3I B;  1DOM A;  2SNS A;  2GN5 A;  2ZXR A;  4P73 A;  3M4P A;  1EZ6 A;  3K0X A;  5JPN C;  3DEO A;  3I4M B;  2MHV A;  1S5E D;  4AYB G;  3X3M A;  3G4S A;  1CKO A;  1HZB A;  3BZD B;  1N8R C;  1RF2 D;  3TRE A;  3J81 j;  4A93 H;  2E2H H;  3EFX D;  4A3J B;  3K7A H;  3PIP A;  3J80 i;  1TY2 A;  1LT4 D;  1LTB D;  4KKS A;  1PA6 A;  1QVC A;  2B2W C;  1HR0 Q;  2R7Z B;  3HG9 A;  3A5Z B;  3RZO H;  2EYF A;  4A3E G;  2CH4 W;  2YTY A;  5IGE A;  5C4X G;  1A2T A;  1LV9 A;  3CME A;  2LMC B;  2K03 A;  4YWM A;  5LMN Q;  2OWO A;  5HUR A;  1TWG H;  1HNZ L;  1NAP A;  4A3K B;  4U68 A;  3QIA A;  3S1M B;  1Q90 A;  4I65 A;  3K5N A;  4K14 A;  2J0T D;  2KCM A;  2QCP X;  3T1H Q;  4DAV A;  3DWA A;  2H4O A;  1X3E A;  2M9V A;  3E0J A;  4B3R Q;  5IE8 A;  1SAP A;  2AWN A;  4XQN A;  4GNX A;  4KHV A;  3PQI A;  2VY3 A;  3H6M A;  1YVC A;  2Z4H A;  1IXR A;  1UNS A;  2GVB A;  1G8Z D;  3L3O C;  3HOX H;  1XMO L;  3GV6 A;  1S4Z A;  2K01 A;  1PFB A;  5JVG 3;  4UY8 C;  3KLS X;  4WRD A;  1VQK A;  4A3C H;  3Q23 A;  2CH4 A;  4GN5 A;  2FFK B;  1D5X C;  4IJL A;  3NTK A;  2E76 C;  3OMC A;  5ELN A;  3MAQ A;  1WCM G;  4AYB B;  1ZYR C;  2N88 A;  1VQL A;  1NJI C;  1B50 A;  1CSP A;  5C5L A;  2PNH A;  3K81 C;  1GUN A;  1X32 A;  4LUV A;  4WJ4 A;  2DJG C;  2F0U A;  4DR1 Q;  2JA7 H;  3KUP A;  1IBK Q;  2F0N A;  2XRS D;  1FJG L;  2B2V C;  2EVB A;  5DM7 3;  4DV7 L;  3ZJY C;  2PMZ B;  5LMN W;  1JQY D;  4BY7 H;  3G71 A;  3OHX C;  4FYD A;  2XWJ B;  4YHH L;  3NSW A;  4R4I A;  4A3E B;  1ILQ A;  2K05 A;  1SNC A;  4R8N A;  5C4X B;  1KNE A;  3CQZ H;  4KTA A;  4OWT B;  5FLM H;  3HOY H;  4DA2 A;  4DV4 L;  1M4V A;  1P16 A;  2Y0S G;  1E3P A;  2B2Y A;  4X3K A;  3NWS A;  2C9O A;  4ZLT F;  1QUQ A;  5EBC A;  1HJP A;  3RZD B;  4MNO A;  1SXT A;  1STH A;  1TS5 A;  2RA4 A;  1OTC A;  1A2U A;  3I4N H;  3FPP A;  3GTM B;  2XN9 C;  4GN4 B;  4IPD A;  1B2T A;  1EY5 A;  4A4I A;  1PZK D;  5CV7 A;  1DON A;  1B9M A;  1UWV A;  2MGS A;  4HJ9 A;  3HOU H;  1BF4 A;  1H9R A;  1PH1 A;  3GO5 A;  4X64 Q;  4EQP A;  2R93 H;  3S2D H;  1LTG D;  3AQQ A;  3PGZ A;  1HUN A;  1TWG B;  1VQA A;  2WII B;  1L1O C;  5BN4 A;  4CKE A;  2FXQ A;  5C44 H;  1S72 A;  1NY4 A;  3PMF A;  1EY8 A;  2PPB C;  3SR1 A;  2WB1 G;  4PG3 A;  3PSI A;  1KHI A;  2JP1 A;  3CP0 A;  2EIF A;  4CKC A;  2NVT B;  1ET6 A;  4S3S A;  4DNI A;  1BR9 A;  3K5M A;  2HD3 A;  4RKL A;  5E7N A;  3T4A C;  1GO3 E;  1FVI A;  2NZH A;  4A75 A;  1G2S A;  2JJQ A;  1KTK A;  4RHS A;  4JBK A;  1VQE A;  2LXJ A;  3H3V I;  4NXM L;  4JI1 Q;  2K5N A;  3FPU B;  2MO1 A;  2Y0S B;  4E6I A;  1WTX A;  1IZ6 A;  1L0W A;  3HGB A;  2JSO A;  3GTL B;  1NSN S;  5C44 G;  1SLJ A;  3S1Q H;  1LAB A;  1SYF A;  3PUY A;  1J6Q A;  4K5W A;  1SYC A;  3FDT A;  4R4T A;  1P8L A;  4L5Q A;  4HED A;  3OTO L;  3UE0 A;  2A73 B;  2OF1 A;  2WAQ G;  1HNW Q;  2A6H C;  5M5W H;  2D62 A;  5I2X A;  1QJO A;  1PDQ A;  1BOS A;  1ZXT A;  1GXD C;  2L1B A;  1XMQ L;  4A3M H;  5CMD A;  3OYY A;  2NVX H;  4R9W A;  2LFN A;  1B53 A;  2H1E A;  1YHQ A;  2F0V A;  1Y1V H;  1X54 A;  2CQA A;  1R9T B;  1PYB A;  4R8I A;  5EKK A;  2DY7 A;  5FOB B;  4AQY L;  3A5U A;  2NTT A;  2WB1 B;  4K5X A;  4YCU A;  4DR6 Q;  4JI0 L;  4KN4 C;  3L0O A;  4JI4 Q;  4FXG C;  2I5L X;  3E5S A;  4A76 A;  5K36 H;  1STA A;  3PCO B;  1TWH B;  3ICE A;  1WD0 A;  1IBM L;  2X6G A;  4P2C B;  3IRB A;  3EJI A;  3FP9 A;  4BBS G;  3KF6 A;  4L5R C;  5JEA H;  4R4Q A;  3CW2 C;  5IOD A;  1SN8 A;  2EY2 A;  4QGU A;  1VCI A;  4Q5V A;  1FNU A;  1HCZ A;  1U4P A;  1DM0 B;  1JWU D;  3SGI A;  5C44 B;  2KEE A;  3N52 A;  1VQF A;  1V9P A;  1KAA A;  1SEB D;  1Y8P B;  1SE3 A;  2X6L A;  4CBV A;  4AYB E;  1EY6 A;  1Z9F A;  3S14 H;  2NZO A;  4OO1 G;  5JJZ A;  4IZ8 A;  2WP8 J;  2VUM G;  1PZJ D;  2K52 A;  2WAQ B;  4ZKB B;  1EL0 A;  1TWC H;  3CRK C;  1EU4 A;  1JOQ A;  4PQX A;  3W1B A;  1QIL A;  2VZA A;  2WFW A;  5CBE E;  3FMC A;  3I73 A;  1GHK A;  1BDO A;  1WTV A;  3J81 E;  3I7F A;  2PMZ E;  4KY6 A;  2E5L Q;  1STN A;  1EIF A;  1IKM A;  4X65 L;  1PV4 A;  2R3Z A;  1A0I A;  1IKL A;  4B08 A;  3RD4 A;  1B44 D;  3NP8 A;  5J22 A;  2J7Z A;  1ESR A;  1TWA H;  3M7G A;  1PTO C;  5C3W A;  3M4Y A;  3FEW X;  2F1M A;  1CI3 M;  5EPJ A;  3ULP A;  1UE6 A;  4O42 A;  4P72 A;  5I9P A;  4FF1 A;  2K7V A;  4IUN A;  1F77 A;  1I4Q A;  3K6O A;  4BY1 H;  4JYA L;  1WFQ A;  5DAU A;  1KDB A;  1SJE D;  4X3T A;  2B2T C;  5AJ3 L;  2NVX B;  3OW7 A;  4CJ0 B;  2UU9 Q;  5F2D A;  3IL8 A;  3JC6 6;  4BBS B;  1RDP D;  1SND A;  5IGC A;  3PO3 G;  3CPF A;  1DD2 A;  3DM1 A;  2MFI A;  4ODG A;  5EQ0 A;  2A6E C;  2HDM A;  4UP8 A;  4DK6 C;  2Q8I B;  3SK6 A;  3TP5 A;  4DN4 M;  2WIN B;  3PV0 A;  1X3P A;  2VUM B;  1SBB B;  2JA5 H;  1HNZ Q;  1GOZ A;  4KJO A;  1I50 H;  1I6V C;  4R1J A;  1Q7Y C;  3NEL A;  1JB3 A;  1JOO A;  2QDB A;  2OEO A;  2NN6 H;  4DR1 L;  3PIO A;  3ERO A;  1F2M A;  1LAC A;  3LWU A;  1YNX A;  2UUB Q;  2HQE A;  2JYO A;  2G9H D;  4BS9 A;  1EYG A;  4XT3 B;  4KI0 A;  2ZXP A;  1YBY A;  2OQ0 A;  1XMO Q;  2UXD Q;  2Y0S E;  4C3I G;  2X69 A;  1LT6 D;  1BQQ T;  4LF7 L;  3DEP A;  5M5Y H;  3MZ5 A;  1Z6H A;  3A7A B;  1N36 L;  1BBU A;  1IYJ B;  1ENF A;  1MJE A;  1BBX C;  1MIU A;  4KV6 A;  4V19 0;  4CJ2 C;  4LFB L;  3KF6 B;  5ELB A;  5CV6 A;  4DK0 A;  4OEL B;  4DR5 L;  3PO3 B;  2IWH A;  5IGG A;  4DV7 Q;  4TKO B;  4MHE A;  1NTG A;  1ZEQ X;  3CMA A;  1N33 L;  1K83 B;  1TWA B;  4CJ1 B;  4LW1 A;  2B8G A;  3TP8 A;  4GKJ L;  3OW2 A;  1EU3 A;  1BCP C;  3S1R H;  4A3G G;  3AYH B;  3AEV A;  1DGS A;  1J9O A;  3HZX A;  2EJM A;  3I8Z A;  4OHJ A;  1ONL A;  4H44 C;  2L15 A;  4K6L A;  4RHR A;  3K5L A;  2K5W A;  5ELF A;  1KC8 C;  4KKT A;  2D0P A;  2WB1 E;  1U5K A;  4K8I A;  2F0P A;  1Q12 A;  1TKW B;  2KHI A;  2AUK A;  1G91 A;  3S2H H;  1A6X A;  1AZP A;  2EY5 A;  1SNM A;  3HEJ A;  1KLU D;  4XIG S;  1NR2 A;  4GS3 A;  4RAU C;  1HA5 A;  1RTO A;  3GTP H;  3BZC A;  4MTN A;  3OIP A;  3CPW A;  4NP5 A;  2UUA L;  4Y7N B;  1D2B A;  4P75 A;  4C3I B;  4PMC A;  4JVZ A;  2CWP A;  2KOL A;  2CCZ A;  4DV0 L;  2ZM6 L;  1D1K A;  5IP9 H;  4UHV A;  1PHJ A;  3LGJ A;  4LMQ D;  1V1P B;  4A3D H;  3DHQ A;  2EPB A;  4ILW A;  4JV5 L;  2G9D A;  3I4O A;  3F1Z A;  1SMY D;  1ENC A;  2WAQ E;  1IW7 D;  1KRT A;  4RCO A;  2AMC B;  3HOZ H;  1CTM A;  4RA8 A;  4GOP B;  4LFC Q;  2UXC Q;  3MEF A;  3F2B A;  1EY0 A;  5COR A;  4IN3 A;  1JIC A;  1KAW A;  5KYL A;  5FK9 C;  5FJ8 G;  1O7I A;  4A3G B;  1CA5 A;  2IX0 A;  4NXM Q;  1ML0 D;  4APV A;  1VQB A;  3C46 A;  4IFD G;  4QF4 A;  1KD1 C;  3S15 H;  2FJ2 A;  4KD4 A;  3GP7 A;  3JAM E;  1B1Z A;  3DUZ A;  3K59 A;  3HKS A;  2ASB A;  1V1O A;  5M3F G;  4X3S A;  1D5Z C;  1STY A;  2A5H A;  2KHS A;  1JT8 A;  3HOZ G;  1YNJ D;  3OTO Q;  3VR3 A;  5CV9 A;  2OCE A;  4OEM B;  4R4C A;  4ZUJ A;  2E74 C;  4ME3 A;  3GTK B;  2E75 C;  4JI4 L;  3I4M G;  2R6G A;  1XMQ Q;  2EYP A;  3S1R B;  4A3L H;  4LF8 L;  3H0G G;  1KAB A;  5DLQ E;  5A2Q E;  4DUY L;  4HJ7 A;  3Q8D A;  3BDL A;  5EJW A;  5FKA C;  2R7F A;  5C3X A;  2V1C C;  3TEH B;  4A3J G;  1FR3 A;  3HS0 C;  3GTG B;  3ULJ A;  4AQY Q;  2YTX A;  3D4D A;  1Z47 A;  2NVQ B;  5H1S E;  3M3Y B;  4ZK9 B;  2Z9H A;  1HQR D;  2PI2 A;  5IOC A;  4FF2 A;  5JPM C;  4LWC A;  1EOV A;  4QL5 A;  4TVA B;  2AUJ D;  2SDF A;  4JI3 L;  4JI0 Q;  1MI2 A;  4BXX H;  1CA6 A;  5JJL A;  4KHP Q;  2MPM A;  1GUS A;  3KDF B;  4AIM A;  2K50 A;  3HP3 A;  3A0J A;  3J7A 5;  2H5X A;  2PW7 A;  3I2Z A;  5M3M G;  2FMC A;  2OTJ A;  1IBM Q;  4XXE A;  5G3L F;  2P5Z X;  3HOW G;  1Y1W H;  2B63 H;  1WJJ A;  2E5L L;  3URY A;  3UE1 A;  3VR6 A;  5J39 A;  1H9S A;  5C6A A;  4HIO A;  3MEH A;  4KD3 A;  3LWE A;  5M3F B;  4U67 3;  2VQE L;  4JI6 Q;  1XWE A;  3HOZ B;  1WTR A;  4RH6 A;  2DNE A;  4PNY A;  1STG A;  3QR8 A;  1HRJ A;  1W2B A;  2AHO B;  1VQG A;  2O5I C;  2R61 A;  5IYB H;  5IYC G;  4PV1 C;  1YEZ A;  2EXZ A;  1KDA A;  5KNB A;  4DGZ A;  3TBI B;  4NXN L;  3H0G B;  3ERQ A;  2XVS A;  1YJW A;  4X65 Q;  2WV6 D;  3OWE B;  2UU9 L;  3MXG A;  2GVA A;  5GRO A;  3I90 A;  3A8I E;  2F3V A;  3KYH C;  3R2T A;  4KLK A;  1TY0 A;  3SK4 A;  4F7X A;  1TWF B;  3AMU A;  1H9K A;  1VQ4 A;  5I6W A;  3MWY W;  5ELO A;  3V96 A;  1CQV A;  2D5D A;  4ZCK A;  1Q86 C;  5CBA E;  3HKZ G;  3KF8 A;  3RLO A;  4DNT B;  5JVH 3;  2JN4 A;  3BVG A;  5IWA L;  3M9B A;  3H15 A;  4JYA Q;  2DJF C;  5IYB G;  4DAM A;  4YCV A;  5M3M B;  1ILP A;  5IIF A;  5AJ3 Q;  4YIJ A;  4RFB A;  1LTI D;  3P75 A;  3NE5 B;  1VQ5 A;  3HOW B;  1YNN C;  3DM3 A;  4A93 G;  1PH6 A;  5C3E H;  4I7A A;  4LNQ A;  1EWH A;  1A3V A;  3CCE A;  3Q6S A;  4H7B A;  4HMJ A;  3J80 E;  1L0X B;  2AQ3 B;  2UUB L;  1Q3L A;  4B9W A;  1K8O A;  1HTP A;  4IUT A;  4QY7 A;  1K3B C;  4MZ9 A;  5C4J B;  5E4W C;  1C0A A;  1L2F A;  2UXD L;  4A3F H;  4G57 A;  1JMC A;  1CHQ D;  3IKJ A;  4GLA C;  3P20 A;  3NWT A;  4IQZ A;  3Q24 A;  4IOC A;  1A63 A;  1XTD A;  3SVM A;  1HR0 W;  5C0X H;  2SOB A;  2PCF B;  4JW0 A;  2Z6K A;  2FMM A;  2PQA A;  4DNR B;  2RDH A;  4N8F A;  4BBR H;  1FL0 A;  2RSO A;  1XNQ L;  2JK8 A;  2MP1 A;  1RHP A;  5M5X B;  5JOB A;  5J1Z A;  2BH8 A;  1EIY B;  4JI8 L;  2CFM A;  3RUZ A;  1LTT D;  1MSH A;  2B29 A;  2I46 A;  1RIP A;  4B3T Q;  3ITP A;  2K32 A;  2Q8R E;  2ATW A;  4H0L C;  3HOX G;  1NNX A;  4ZKC B;  5EPL A;  1WTH A;  1WTO A;  2F0G A;  3HKZ B;  3WOE A;  4LF7 Q;  4J15 A;  4A3C G;  5I4D A;  4LUZ A;  1N36 Q;  4K8J A;  3STB C;  2QW7 A;  4PZ6 A;  4ZQ3 A;  1O7L A;  4QIW B;  1CZG A;  3BU2 A;  5C0X G;  4LFB Q;  5FO7 B;  3MVV A;  3RR5 A;  1PH2 A;  3IAY A;  2JA7 G;  4A93 B;  2E2H B;  4DR5 Q;  2TSS A;  3K7A B;  4RGM A;  3TN2 A;  1CM9 A;  3T56 B;  1H9S B;  2YYZ A;  1CUK A;  1N33 Q;  5DEH A;  3ER0 A;  4BY7 G;  2XSC A;  2R92 H;  4GKJ Q;  1PH7 A;  4LF9 L;  4L5S A;  1HTL D;  3RZO B;  2HCC A;  3EIV A;  1DJR D;  2L12 A;  2DGY A;  3BDO A;  4JBJ A;  5FLM G;  3U50 C;  3CD6 A;  3HOY G;  3PUZ A;  2KED A;  3TSS A;  2EYM A;  1B3A A;  2LKV A;  1C9O A;  5KIX A;  2B8F A;  5CYU A;  1M90 C;  1YHA A;  1HFG A;  2F0K A;  3H3V H;  3S16 H;  3NHH A;  2F4I A;  3I4N G;  2KUM A;  1K8A C;  4JC0 A;  2L4N A;  4DKA C;  2UUA Q;  2KHJ A;  4GNX C;  1I4X A;  5FO9 B;  4X3U A;  1DYQ A;  1KL9 A;  3NQT A;  3NTH A;  4LFC L;  2RSN A;  4PMW A;  3W5O A;  1VQO A;  1SE4 A;  3HOU G;  1I4H A;  1CZW A;  3BG3 A;  3HOX B;  4RGO S;  4DV0 Q;  2ZM6 Q;  2SNM A;  3KF8 B;  3MHB A;  1VQD A;  4OWW B;  1PH3 A;  1E1O A;  3C2P A;  2R93 G;  2NUC A;  4KKU A;  1LUZ A;  4KK7 A;  3TP7 A;  2KQ3 A;  1YNN D;  4JV5 Q;  2BCO A;  1XX8 A;  5LHY 1;  3U4Z A;  4JOI A;  2JA7 B;  4MIU A;  1VQP A;  4H13 C;  1QVF A;  2IX3 A;  4BY7 B;  1PRT C;  4PMB A;  1G6P A;  3K0Y A;  4UP7 A;  1K0S A;  4M1U B;  1GUO A;  3Q22 A;  1WTP A;  3CF5 A;  1IBL L;  1CHP D;  3H3V C;  3CQZ B;  2NVY H;  3HOY B;  2CVR A;  1AE3 A;  1HZ9 A;  1ZYR D;  5E3F A;  4HSP A;  2DY8 A;  5IY0 A;  1QNK A;  2MUY A;  2WKD A;  1Q82 C;  4I7Z C;  3NBI A;  2ZJP A;  3T1Y Q;  3KLW A;  3M4Q A;  2IW3 A;  2PQA B;  3VDY A;  3RN5 A;  1JB7 A;  3WOF A;  1OXX K;  1Z7T A;  2B2T A;  2I0Q A;  3I4N B;  4JI2 L;  1KNA A;  4DR3 L;  4KHP L;  1QOH A;  4K0K L;  3HOU B;  3B6Y A;  1JOK A;  4LF8 Q;  4DUY Q;  2RDG A;  4HMI A;  5C4Z A;  3CCL A;  1MD2 D;  1PTO H;  3VR4 A;  4A3M G;  4V0B A;  4IAL A;  2R93 B;  3S2D B;  2ZTE A;  4Z9C B;  3PUX A;  1UE7 A;  1J8I A;  1Y1V G;  2OTL A;  2NYZ D;  4EQN A;  3D0F A;  1T5E A;  2EZV A;  3QG1 A;  4IJH A;  2F0W A;  3SEB A;  2HT1 A;  1MSG A;  4NKL A;  4Y52 H;  2EOT A;  4JI3 Q;  4JI6 L;  2WAC A;  2EYH A;  5EKL A;  4DK3 C;  3EN2 A;  2E8G A;  1ICW A;  3U58 A;  1KDC A;  1D6E C;  2K4K A;  1XTC D;  2F0O A;  2L5T A;  2LSS A;  1RTN A;  5K36 G;  4OO1 I;  4XTC S;  2PZT A;  3G6J B;  2O2L D;  3A8J E;  1YIJ A;  2PYK A;  1O80 A;  2PI2 E;  4M8A A;  5JEA G;  2MO0 A;  2VW9 A;  3ZYY X;  2EDG A;  2HIV A;  2BH2 A;  3M4O H;  1L0Y B;  4DV2 Q;  1Y8O B;  5KGU A;  2VQE Q;  2YU9 H;  4B3S L;  1EWI A;  3ULL A;  1JJC B;  4G7H C;  3PF4 A;  1TQO A;  3HKZ E;  4Q0F A;  3S1Q B;  4X62 L;  3BYT B;  1PMR A;  1PH4 A;  1BVS A;  3BZK A;  1AZQ A;  3NK9 A;  4LUO A;  3MXP A;  5IYD H;  2A1A A;  4QIW E;  2TMP A;  1Q46 A;  3NBH B;  4HCE A;  4BA1 I;  4IUP A;  4DUZ L;  5M5W B;  4QUF A;  5IT9 E;  4PZ8 A;  4NXN Q;  1U4L A;  1GUT A;  1V1P A;  3BDC A;  1B9N A;  4A3M B;  1ENA A;  4MTK A;  2ICE C;  3EBE A;  4O0A A;  4CDD C;  1Y1V B;  1J5E Q;  2IJ0 A;  1N9W A;  3A7L A;  1TS2 A;  1HPC A;  1PVO A;  3BYY B;  2KEC A;  4L5T A;  4KMU C;  4CKB A;  4GOP A;  4IUV A;  4DV1 Q;  1VQH A;  1QNU A;  2EQS A;  2N8N A;  1CK1 A;  1VQN A;  1PRT D;  3VYR A;  3GD7 A;  2JE6 I;  2A6H D;  2XWB B;  1DZ1 A;  3D6C A;  2RDF A;  5IWA Q;  2N3S A;  1HFN A;  3KBG A;  4HN7 A;  3S1N H;  3PUW A;  3QOJ A;  3C3L A;  1K3R A;  1XPU A;  2HUG A;  5DNF A;  2PZU A;  4BY1 G;  2E2J H;  1EYA A;  1JC7 A;  1S3O A;  4LF4 L;  1FGU A;  3GDE A;  1PTO B;  1FYC A;  4QJF A;  2K5V A;  5FLX L;  2HHH Q;  3GTQ H;  3PIP 3;  1TS3 A;  5GAH C;  2Z4I A;  1MKH A;  3SE0 A;  2F0L A;  2Q2T A;  1UEB A;  3VA5 A;  4PZ7 A;  4C3J H;  1F2Z A;  2BA1 A;  4C2M H;  2K14 A;  3J81 c;  4B3T L;  4OIK A;  2EE1 A;  3S14 B;  5J3B A;  5CV5 A;  3AFP A;  1TWC B;  1E2W A;  3NXW A;  1EY4 A;  1WD1 A;  1NCV A;  2JA5 G;  4J1M A;  1TT2 A;  3G7L A;  3F2D A;  2KCN A;  1E1T A;  2A69 C;  4DR2 L;  1XNQ Q;  2EYO A;  2NN6 G;  1SFO H;  1EZ8 A;  5IT9 c;  4JI8 Q;  2YU9 B;  5M5X H;  1EIH A;  1FNV A;  1RJT A;  3KDF A;  1A62 A;  1SR3 A;  3KK7 A;  2B2U A;  4K2K A;  1LM0 A;  5EBD A;  2K75 A;  2Z0S A;  1RD9 D;  1WYD A;  2F0J A;  3TP6 A;  1VMC A;  2R7D A;  4OGQ C;  3I72 A;  4J8Q A;  4YY3 L;  4BY1 B;  3ND9 A;  2G5D A;  4HCS A;  1I5F A;  4KY7 A;  1N34 L;  2JA8 H;  1BUV T;  1UE5 A;  2K5H A;  4WFN 3;  1UEA B;  2ICI A;  4F88 A;  1JOR A;  1PTO D;  1AP0 A;  1K73 C;  4RKB A;  1RCV D;  4HJA A;  4LF9 Q;  1G2T A;  4NPS A;  4OIJ A;  2OXP A;  1QZH A;  3BVZ A;  1FD7 D;  3KLS A;  4DV6 L;  3J7Y W;  3R8B A;  1H9J A;  3BS1 A;  3OSO A;  3G6E A;  3MFY A;  1ASZ A;  2F3W A;  2PZW A;  3I4L A;  5D14 A;  4QUC A;  2UUC L;  2CHB D;  2JA5 B;  1VF5 C;  4A3B H;  3Q0A A;  1TS4 A;  1I50 B;  1W3S A;  2A19 A;  4B3M Q;  3BJU A;  3SDZ A;  1BCP B;  1JE4 A;  1R4Q B;  1I6H H;  3CCR A;  2N55 A;  2A6E D;  4XQJ A;  2VB2 X;  1O7Z A;  5AFW A;  4YWK A;  2RVL A;  3IFD A;  3AB9 A;  4F87 A;  4JCV E;  1EYC A;  5C5M A;  1SJH D;  3PO2 H;  5IP9 G;  1TU2 B;  2NZ1 D;  1M1K C;  2ALY B;  4X6A H;  3LX0 A;  5M5Y B;  4A3B G;  2E2I H;  2Q2I A;  4A3D G;  4A3I H;  2A68 C;  4DU9 A;  1SYG A;  1E2V A;  4IFD I;  4HID A;  3K58 A;  3KLR A;  3T1Y L;  1X55 A;  3VYS A;  4RCN A;  3LNN A;  4HSV A;  1PLF A;  1E2Z A;  3CXC A;  1WVL A;  1NR4 A;  2F0Q A;  3OMG A;  3UDX A;  2ZJQ A;  3J7A F;  1VQJ A;  4DF7 A;  2DNC A;  3QO2 A;  1F2L A;  1IBL Q;  3T13 A;  3X3N A;  1AW7 A;  2B2W A;  3F2U A;  1IYV A;  4L8J A;  1V1Q A;  2RCN A;  5ISR A;  2HCI A;  2R7Z H;  1S5F D;  3D6W A;  4K5V A;  1WI5 A;  4ALP A;  2VNU D;  1XNR L;  1WTW A;  1ZKO A;  4JBW A;  3A54 A;  2E2D C;  1VQ9 A;  3S2H B;  4EQO A;  3VYU A;  2BE5 C;  4JI5 Q;  4TRD A;  3ND8 A;  1D7Q A;  3E9H A;  2YV5 A;  1QG7 A;  4H02 A;  2EJG C;  2J4X A;  4JI2 Q;  3W1G A;  4A3K H;  3GTP B;  3KJP A;  3S1M H;  4DR3 Q;  3M85 A;  3CKI B;  4ABN A;  4YWL A;  2L55 A;  4X66 Q;  3DLL A;  4K0K Q;  1BCP D;  1XPO A;  4FO2 A;  2F0D A;  2MQH A;  3MXN A;  4K2L A;  4OX9 Q;  1YIT A;  3NUC A;  4A3L G;  4GLX A;  4C1N I;  1HZA A;  4DV3 L;  3K8A A;  3A56 A;  1AFP A;  4A3B B;  4GZY C;  3EVQ A;  2JA6 H;  4A3D B;  4C1N K;  5D3I B;  3CC7 A;  1XJV A;  1SDF A;  5K5P A;  4DV2 L;  1JR0 D;  1S5C D;  3CCV A;  3DMU A;  2ENB A;  4BXX G;  3TZU A;  1SYE A;  1CT1 D;  2D9U A;  4DV5 L;  3AU7 A;  3JAM c;  1JJ2 A;  2Q2H A;  5BR8 Q;  1K8G A;  1EY7 A;  2B2V A;  4DR7 L;  2UXB Q;  3V2T A;  1VQI A;  1Y14 B;  2AKW B;  1Q1E A;  5IGD A;  1I94 Q;  3S24 A;  1STE A;  3W2D A;  1Y1W G;  2B63 G;  4ME5 A;  3S15 B;  2JA6 G;  3IFT A;  1ROD A;  3FKI H;  4B3S Q;  1U4R A;  4A3E H;  1J5E L;  2NBF A;  5C4X H;  5I9O A;  5GQO A;  4RWS C;  4NDX A;  4X62 Q;  1IL8 A;  4CGY B;  1LO5 D;  3QB3 A;  5LMU Q;  4DV1 L;  3TS2 A;  1N32 L;  3QOL A;  1IYU A;  4CDE C;  2M2L A;  2PW5 A;  4DUZ Q;  5HGQ A;  4JI7 L;  1PH9 A;  5KRU A;  3RZD H;  5D65 A;  4XDX A;  5GAD C;  3TQY A;  2AWO A;  3GTM H;  1V8Q A;  1U9R A;  2I07 B;  3V05 A;  3I3C A;  4JBM A;  3BVM A;  2A68 D;  2F03 A;  1UAP A;  2HHH L;  3FVQ A;  3FKI G;  1NBW A;  5E4X A;  1HNX L;  2EXD A;  3S17 H;  1PTO F;  1C7Y A;  2F0H A;  2EYL A;  1L1O A;  2LY7 A;  1RKN A;  1WCM H;  3OOC A;  2NB0 A;  2QGQ A;  2K5D A;  2L11 A;  1R4P B;  1VS0 A;  2RHS B;  1VQM A;  1KIX A;  4DR4 L;  4QB4 A;  3HOV H;  3F8T A;  1B7Y B;  4LF4 Q;  4FF4 A;  1CSQ A;  3N6R A;  2XRQ D;  1CKM A;  4XYQ A;  1G51 A;  4HJ5 A;  2NVT H;  1Y1W B;  2B63 B;  5C3E G;  3MA2 B;  1X56 A;  2F0T A;  2JA6 B;  1M8A A;  3E3X A;  2A74 C;  1W6K A;  1DCZ A;  2BE5 D;  2YTV A;  4DAP A;  4MN3 A;  5HGT A;  3RN2 A;  3VA7 A;  5IGB A;  1F9S A;  2KJX A;  3D8G A;  2EYJ A;  1BO0 A;  4LFA L;  1E7Z A;  4A3F G;  3GTL H;  3M7N A;  5JAV A;  1V43 A;  1HXY D;  2BA0 A;  5EAY A;  3MXN B;  3HOV G;  1MJC A;  2OQK A;  1A15 A;  4IUU A;  3NQI A;  1MHW C;  4WJ3 M;  3CCJ A;  1HUM A;  2IL8 A;  4GKK L;  4DR2 Q;  4FDB A;  1I3Q H;  4UPA A;  1GM5 A;  4BBR G;  5CC4 A;  3PIO 3;  4ZUI A;  3FKI B;  3TDQ A;  1H95 A;  3OIQ A;  5C0X I;  1I4P A;  3A8K E;  4ZYS A;  2RBM A;  4LJZ C;  4DK1 A;  2BOS A;  1S5B D;  2UXC L;  3TZD A;  1OXT A;  2C5C A;  2ID0 A;  4HIK A;  4IFD J;  4RGN A;  3EQL C;  1SNP A;  2IHF A;  1R9T H;  2NWG A;  3NTI A;  1EEF D;  1ET9 A;  3H09 A;  1FGB D;  3EA6 A;  4YY3 Q;  1D1I A;  3GTO H;  4EGV A;  4RMF A;  3J80 c;  1B8A A;  2LXK A;  1N34 Q;  3CCM A;  3UDI A;  4OWX B;  1VQ7 A;  3TME A;  4B3M L;  3ERS X;  3RMH A;  4C3H H;  5I2Y A;  1C4Q A;  3J81 L;  5C3E B;  1ASY A;  2F4V L;  3C1F A;  3TS0 A;  1TWH H;  4O1N A;  2O5J C;  3S17 B;  2R92 G;  4G7O C;  4DV6 Q;  1EYD A;  4R4O A;  3NBH A;  1WCM B;  1GUG A;  1BCP F;  3CCS A;  1B4O A;  1AH9 A;  3S9W A;  4A3F B;  5GAE C;  3CU7 A;  1KRS A;  1X9N A;  1WTQ A;  2UUC Q;  1TII D;  3F2C A;  3HOV B;  1C8C A;  3FRP B;  3SHL A;  5IT9 L;  5CV4 A;  4OON A;  2CKZ B;  1T5X D;  1BNZ A;  1HA6 A;  1A8V A;  1TVX A;  4G7Z C;  4C3H G;  2BDO A;  4BBR B;  1A3U A;  3UDF A;  2Z6K C;  4HR7 B;  1Y69 U;  2ZXO A;  4GN3 B;  3CC2 A;  1E22 A;  2KBN A;  3K57 A;  1L1O B;  3DWQ A;  4LK1 C;  2VS1 A;  1MGS A;  4QQB X;  2EJF C;  1LTS D;  1X65 A;  1PFS A;  3FHW A;  5E1F A;  1HH2 P;  4RG1 A;  4XT1 B;  3H94 A;  1C48 A;  1JCK B;  1KQS A;  2ZJR A;  1HHV A;  2JQO A;  1NMF A;  3I55 A;  3A55 A;  4GNX B;  2AQ2 B;  1LLR D;  1I3Q B;  2ZT9 C;  4GLV B;  1X3Q A;  2B2Y C;  4N9P A;  3G48 A;  2ES2 A;  4EVO A;  5D3D A;  5BN5 A;  2CW0 C;  4XQQ A;  4JI5 L;  2V4D A;  2VL6 A;  4IUQ A;  4FVM A;  1EIG A;  3UI2 A;  2R92 B;  4N9T A;  3WDN A;  1XYI A;  4CDC C;  5FO8 B;  4X66 L;  3MFG A;  1CKN A;  4LF5 L;  4BBS H;  1STB A;  2PQE A;  1H9M A;  1VQC A;  2CWA A;  1A3T A;  1K28 A;  2B3G A;  4OX9 L;  1SE8 A;  4UDU C;  3CRL C;  3STB D;  3L7Z C;  3J7Z C;  1PH5 A;  4LF6 L;  4TQU S;  3GTO B;  1YI2 A;  1GHJ A;  2KA7 A;  1XNR Q;  1XPR A;  1EEI D;  1PRT B;  1HQM C;  2QF7 A;  1LTA D;  2CQO A;  3A74 A;  4OO1 H;  2L9H A;  1GVP A;  4C3H B;  5I6Y A;  2VUM H;  3SXH A;  3L9A X;  1SNQ A;  5DM6 3;  3S16 B;  3U9S A;  2RQX A;  4DAY A;  3J81 i;  3PF5 A;  2MJ8 A;  1OXU A;  2VXW A;  3J7A V;  4J6H A;  3C1E A;  5BR8 L;  2I5H A;  2PO4 A;  4HJ8 A;  1QUQ B;  5CR3 A;  2UXB L;  1I4G A;  4DV3 Q;  1CFM A;  2ZTD A;  2K5Q A;  3H91 A;  1I94 L;  2Q2U A;  3RLN A;  3TRZ A;  3R93 A;  5A35 A;  2A8V A;  3P1H A;  1AEX A;  2VQF L;  3U4V A;  4IO9 A;  1BXT A;  1TXY A;  4FP5 D;  4QCL A;  4ZAI A;  4JOI C;  1Y8N B;  3D31 A;  2RKS A;  3NPP A;  1G29 1;  5LMU L;  2JEB I;  5CGK A;  4QMG A;  4DV5 Q;  4CDF C;  1PYS B;  2DUD A;  1GD7 A;  1SNO A;  4NB3 A;  4DR7 Q;  1YZ6 A;  2RHQ B;  2SEB D;  2F0M A;  4DXF A;  5KYI A;  3OWF A;  4HIM A;  1EQQ A;  3PO3 H;  3DXJ C;  1PXU A;  2NVY B;  2Z6B A;  1FNW A;  1K83 H;  1EFI D;  1HR0 L;  3QJY A;  5L37 A;  4BA2 I;  4EQ5 A;  2N78 A;  4JK1 C;  2IX1 A;  3RNU A;  1YHB A;  3E9I A;  4DFA A;  1N32 Q;  5ELD A;  3I91 A;  1SRO A;  5LMN L;  4N8X 1;  5IYD G;  4JI7 Q;  5HY6 A;  4FF3 A;  5C0X J;  4L6T B;  1U4M A;  4JG2 A;  3UDG A;  5GAG C;  3VR2 A;  3T1H L;  1SMX A;  1EOT A;  1DOK A;  4B3R L;  1SMY C;  2F0E A;  2K33 A;  1IW7 C;  3MXU A;  1IL2 A;  2F0S A;  2KCT A;  4KY5 A;  3HFZ B;  3O13 A;  3GQB A;  3DWP A;  3K80 C;  3PUV A;  1XXG A;  4Y7N H;  2FIN B;  2C35 B;  1HNX Q;  1KXL A;  4C3I H;  2QEJ C;  1QZG A;  3JAM L;  1Q81 C;  4F8M A;  1JJG A;  1SE2 A;  2CW0 D;  3U9O A;  3KBX A;  1LT3 D;  2HQL A;  2AQ1 B;  2KEN A;  4OXP A;  1EQT A;  5G3L D;  1EQR A;  1S5D D;  1DXM A;  2F0I A;  2K28 A;  4DR4 Q;  4YCW A;  5IP7 H;  1OXS C;  1VMP A;  1CKN B;  4IOA A;  3CC4 A;  1IBK L;  1B3Q A;  1JE5 A;  2Z1C A;  1EQV A;  1WOC A;  4HAE A;  1QVG A;  1YNJ C;  1BBW A;  5A2Q L;  1KLG D;  5T1G A;  1OXV A;  5ELE A;  1QWY A;  2K6A A;  1K0R A;  4IPC A;  3D4R A;  3M4O B;  1PFM A;  4HTH A;  1PH8 A;  4O2D A;  2F3I A;  4A3G H;  1B70 B;  3NEM A;  1IHZ A;  4ID6 A;  1QCB D;  5EKI A;  3HRZ C;  4BWG B;  1PYW D;  2NN6 I;  3OPO A;  2PNR C;  5TSS A;  4C3J G;  4LFA Q;  4DAY B;  3CHB D;  2Q8T A;  4AH6 A;  4P74 A;  5IP7 G;  5EPK A;  3T16 A;  2MNA A;  4NMZ A;  1OO9 B;  3KFU A;  1SSO A;  1FJG Q;  4OL7 A;  4GKK Q;  2XGT A;  1RL2 A;  3CCQ A;  4K6D A;  5KND A;  4RGT A;  2IPK D;  1K9M C;  1X3G A;  1O7Y A;  4IPH A;  1VDZ A;  1Q1B A;  4YHH Q;  5M9O A;  2IT1 A;  1PFN A;  3GV3 A;  3GTK H;  2FHT A;  1D5M C;  4NW2 A;  4FXD A;  2NTS A;  1MBY A;  1VQ8 A;  4CHT B;  4DV4 Q;  4X64 L;  1G6Z A;  5T1I A;  5C4H A;  2K1B A;  3KJO A;  4GOP C;  1NMG A;  2M00 A;  5IGF A;  3GTG H;  1SRU A;  1HZC A;  4XYO A;  3VYT A;  4TSS A;  2NVQ H;  3M3Y H;  3S1N B;  1E0B A;  2N49 A;  3K5O A;  2E2J B;  2QIL A;  1EUJ A;  4C56 C;  4KHZ A;  4DXG A;  2DN8 A;  2F4V Q;  2JA8 G;  3GTQ B;  2EY1 A;  1F2Y A;  1AE2 A;  1BKB A;  5FJ8 H;  2QEX A;  3E6Z X;  1DOL A;  3GTJ H;  4KN7 C;  4POG A;  3E0E A;  4IFD H;  3R2I A;  4C3J B;  1ESF A;  3JAM i;  2D2C C;  4C2M B;  4JI1 L;  2XNA C;  3D3R A;  3P7J A;  5ELC A;  4P71 A;  3T51 B;  5M3F H;  1F9R A;  2F0F A;  1Q8I A;  1UUP A;  1YJ9 A;  3NEN A;  1EFW A;  1F9Q A;  1SYB A;  1X6O A;  1LTL A;  5LL6 X;  3CCU A;  2F52 A;  2I5M X;  3MC0 B;  1X3F A;  1NE3 A;  5CV8 A;  1D8L A;  2O4X A;  1SFO B;  1T9H A;  1HNW L;  3D4W A;  3I4M H;  1E24 A;  2GA4 B;  3R3O A;  5FLX E;  2XIW A;  3H0G H; 
#chains in the Genus database with same CATH homology
 2JA5 H;  1HNZ Q;  1VS0 A;  3CAM A;  2RHS B;  3CF5 A;  1VQM A;  1IBL L;  1I50 H;  1KIX A;  4DR4 L;  4A3J H;  3HOV H;  3F8T A;  2NVY H;  5JEA J;  1B7Y B;  3I56 A;  4LF4 Q;  1AE3 A;  1HZ9 A;  1CSQ A;  3PO2 G;  4R1J A;  5IY0 A;  1Q7Y C;  3NEL A;  1CKM A;  1Q82 C;  1G51 A;  4UP9 A;  4HJ5 A;  1S40 A;  1TWF H;  3KOJ A;  2NVT H;  4DR1 L;  3PIO A;  2D0O A;  2ZJP A;  3T1Y Q;  3KLW A;  3M4Q A;  2JEA I;  2PQA B;  5C3E G;  3VDY A;  4A3I G;  1X56 A;  3RN5 A;  1YNX A;  1JB7 A;  1YJN A;  2UUB Q;  4EX5 A;  5JJK A;  2YTV A;  1EYG A;  1OXX K;  2I0Q A;  4DR6 L;  4KI0 A;  1YBY A;  2OQ0 A;  1XMO Q;  2UXD Q;  2Y0S E;  3RN2 A;  2IHE A;  4JI2 L;  4DR3 L;  4KHP L;  2JA9 A;  5M3M H;  4K0K L;  4LF7 L;  4LFA L;  5M5Y H;  1E7Z A;  3B6Y A;  3RLF A;  4A3F G;  4LF5 Q;  4LF8 Q;  3HOW H;  1GKH A;  4DUY Q;  1N36 L;  3CCL A;  3GTL H;  3M7N A;  1V43 A;  2BA0 A;  1BBU A;  5EAY A;  1IYJ B;  3MXN B;  4A3M G;  3L2P A;  3HOV G;  1MJC A;  2OQK A;  2XTI A;  2ZTE A;  4DPG A;  1MJE A;  1MIU A;  3PUX A;  4WJ3 M;  4LFB L;  3CCJ A;  4LF6 Q;  1UE7 A;  3KF6 B;  1Y1V G;  2OTL A;  4GKK L;  4IPG A;  4DR2 Q;  2R7Z G;  4FDB A;  1I3Q H;  4DR5 L;  3D0F A;  4DV7 Q;  4IJH A;  2HT1 A;  2HIX A;  2RF4 A;  4UPA A;  1GM5 A;  4BBR G;  1NTG A;  5C4J H;  3CMA A;  1N33 L;  4Y52 H;  1H95 A;  5C0X I;  4JI3 Q;  4LW1 A;  4POF A;  4JI6 L;  4GKJ L;  3OW2 A;  5IYC H;  3K7U C;  2ZTC A;  4DK3 C;  1OXT A;  3EN2 A;  1U0L A;  1LYL A;  2E8G A;  3S1R H;  4A3G G;  3AYH B;  3U58 A;  2ID0 A;  4HIK A;  1VQ6 A;  4A3K G;  3AEV A;  1DGS A;  2K4K A;  4IFD J;  2IHF A;  2LSS A;  1R9T H;  5K36 G;  4OO1 I;  4XTC S;  2L15 A;  1KC8 C;  5JJI A;  2D0P A;  2WB1 E;  1U5K A;  4YY3 Q;  1YIJ A;  3GTO H;  1Q12 A;  2PI2 E;  2KHI A;  3AFQ A;  4RMF A;  3J80 c;  1B8A A;  2LXK A;  1N34 Q;  3CCM A;  3S2H H;  2IY5 B;  3UDI A;  2MO0 A;  5JEA G;  4OWX B;  2VW9 A;  2QA4 A;  1VQ7 A;  1Q8K A;  2HIV A;  2BH2 A;  3M4O H;  4XIG S;  4GS3 A;  3ERS X;  4B3M L;  5FLX c;  2VQF Q;  2VQE Q;  4C3H H;  4DV2 Q;  2YU9 H;  1UE1 A;  3WWV A;  1EWI A;  3BZC A;  3ULL A;  1JJC B;  4MTN A;  2F4V L;  1ASY A;  3HKZ E;  3GTP H;  3PF4 A;  3TS0 A;  2GN5 A;  4X62 L;  1PH4 A;  3CPW A;  1BVS A;  2UUA L;  3BZK A;  4P73 A;  1TWH H;  4LUO A;  3M4P A;  4P75 A;  5IYD H;  2R92 G;  3K0X A;  2A1A A;  4QIW E;  4DV6 Q;  2CWP A;  4R4O A;  4AYB G;  2CCZ A;  1Q46 A;  3NBH B;  4BA1 I;  4DUZ L;  2ZM6 L;  4DV0 L;  5IP9 H;  3G4S A;  1CKO A;  3CCS A;  4PZ8 A;  1PHJ A;  1HZB A;  3LGJ A;  1AH9 A;  1N8R C;  4NXN Q;  5GAE C;  3TRE A;  1KRS A;  1X9N A;  2UUC Q;  3J81 j;  4A93 H;  2E2H H;  4A3D H;  3F2C A;  3EBE A;  3K7A H;  4O0A A;  3PIP A;  4JV5 L;  3J80 i;  4OON A;  2CKZ B;  3F1Z A;  3I4O A;  1J5E Q;  2WAQ E;  1PA6 A;  1QVC A;  1HR0 Q;  1N9W A;  1KRT A;  1A8V A;  2AMC B;  1PVO A;  3HOZ H;  3A5Z B;  3RZO H;  4L5T A;  4GOP A;  3UDF A;  4GOP B;  2Z6K C;  4A3E G;  4DV1 Q;  1VQH A;  2YTY A;  2EQS A;  2N8N A;  4LFC Q;  1VQN A;  2UXC Q;  4GN3 B;  5C4X G;  3MEF A;  3CME A;  3F2B A;  3GD7 A;  3CC2 A;  1E22 A;  1KAW A;  2JE6 I;  4YWM A;  2KBN A;  5LMN Q;  1L1O B;  2OWO A;  5FJ8 G;  5IWA Q;  1O7I A;  1TWG H;  2N3S A;  2VS1 A;  1HNZ L;  4QQB X;  3S1N H;  2IX0 A;  3PUW A;  4NXM Q;  1X65 A;  1K3R A;  1PFS A;  1VQB A;  3FHW A;  4APV A;  1XPU A;  1HH2 P;  4BY1 G;  2E2J H;  1S3O A;  4IFD G;  4RG1 A;  4LF4 L;  1FGU A;  1KD1 C;  3GDE A;  3S15 H;  2KCM A;  3T1H Q;  1KQS A;  2ZJR A;  1X3E A;  4B3R Q;  2JQO A;  3HKS A;  2AWN A;  1NMF A;  2K5V A;  4QJF A;  5IE8 A;  3I55 A;  2ASB A;  4GNX A;  2HHH Q;  4GNX B;  5M3F G;  3GTQ H;  2VY3 A;  5GAH C;  1YVC A;  1JT8 A;  1IXR A;  3HOZ G;  4GLV B;  1D7Q A;  1MKH A;  2Q2T A;  1UEB A;  3OTO Q;  3G48 A;  2ES2 A;  2GVB A;  3HOX H;  4JI5 L;  1XMO L;  4PZ7 A;  4C3J H;  2BA1 A;  2OCE A;  2VL6 A;  4R4C A;  4C2M H;  4UY8 C;  2K14 A;  1VQK A;  3J81 c;  4ME3 A;  4A3C H;  4IJL A;  4GN5 A;  4B3T L;  3I4M G;  4JI4 L;  5J3B A;  2R6G A;  1XMQ Q;  5ELN A;  1WCM G;  4A3L H;  4X66 L;  1CKN A;  4LF5 L;  4LF8 L;  4BBS H;  3H0G G;  3AFP A;  5DLQ E;  4DUY L;  4HJ7 A;  1VQL A;  2JA5 G;  1NJI C;  1VQC A;  3Q8D A;  1CSP A;  2CWA A;  2R7F A;  2PNH A;  3K81 C;  2B3G A;  4LUV A;  1SE8 A;  3STB D;  4OX9 L;  4WJ4 A;  3L7Z C;  2V1C C;  3TEH B;  3J7Z C;  3F2D A;  4DR1 Q;  4A3J G;  1PH5 A;  2JA7 H;  1IBK Q;  4TQU S;  4LF6 L;  1E1T A;  3ULJ A;  1YI2 A;  4AQY Q;  2YTX A;  1XNR Q;  4DR2 L;  1XPR A;  1FJG L;  1Z47 A;  5H1S E;  4DV7 L;  2PI2 A;  2CQO A;  2NN6 G;  3ZJY C;  1XNQ Q;  3A74 A;  5LMN W;  1SFO H;  4BY7 H;  3G71 A;  4LWC A;  1EOV A;  4QL5 A;  4TVA B;  5IT9 c;  4JI8 Q;  1GVP A;  2VUM H;  4JI3 L;  5M5X H;  4JI0 Q;  4YHH L;  4BXX H;  5JJL A;  4R4I A;  3KDF A;  1A62 A;  3KDF B;  4KHP Q;  4AIM A;  1SR3 A;  2K50 A;  3A0J A;  3CQZ H;  4OWT B;  3J81 i;  3PF5 A;  5FLM H;  1LM0 A;  3HOY H;  3J7A 5;  2H5X A;  2K75 A;  2Z0S A;  4DV4 L;  1OXU A;  1WYD A;  3I2Z A;  1P16 A;  2Y0S G;  5M3M G;  1E3P A;  2R7D A;  2OTJ A;  1IBM Q;  5BR8 L;  2I5H A;  4YY3 L;  4HJ8 A;  3HOW G;  1Y1W H;  2B63 H;  1QUQ A;  1QUQ B;  1I5F A;  1WJJ A;  1HJP A;  3UE1 A;  4DV3 Q;  2E5L L;  4MNO A;  2UXB L;  2ZTD A;  1N34 L;  1I94 L;  4HIO A;  2Q2U A;  3RLN A;  1OTC A;  2JA8 H;  3TRZ A;  2A8V A;  3I4N H;  1UE5 A;  2VQF L;  4GN4 B;  2K5H A;  4IPD A;  2VQE L;  4A4I A;  3U4V A;  4JI6 Q;  4IO9 A;  1UWV A;  1K73 C;  4HJ9 A;  1TXY A;  3HOU H;  4HJA A;  4LF9 Q;  4NPS A;  4JOI C;  3D31 A;  1QZH A;  1PH1 A;  3GO5 A;  1W2B A;  1G29 1;  4X64 Q;  2AHO B;  2JEB I;  5LMU L;  4DV6 L;  1VQG A;  4DV5 Q;  5IYC G;  5IYB H;  2R93 H;  3S2D H;  1YEZ A;  1PYS B;  3AQQ A;  3PGZ A;  2DUD A;  3G6E A;  1ASZ A;  1GD7 A;  4NB3 A;  4DR7 Q;  1YZ6 A;  2RHQ B;  1VQA A;  4NXN L;  4B3S L;  2UUC L;  1L1O C;  1EQQ A;  4HIM A;  3PO3 H;  1YJW A;  4A3B H;  4X65 Q;  1W3S A;  2FXQ A;  2A19 A;  5C44 H;  2UU9 L;  2GVA A;  1S72 A;  4B3M Q;  1NY4 A;  5GRO A;  3KYH C;  2WB1 G;  1K83 H;  4KLK A;  3BJU A;  4PG3 A;  3PSI A;  1HR0 L;  1KHI A;  1I6H H;  3CP0 A;  2EIF A;  4BA2 I;  3CCR A;  4EQ5 A;  2N78 A;  4DNI A;  1VQ4 A;  3RNU A;  2IX1 A;  1YHB A;  3E9I A;  5E7N A;  5ELO A;  1GO3 E;  1N32 Q;  1Q86 C;  1FVI A;  2NZH A;  3HKZ G;  3RLO A;  4A75 A;  1SRO A;  5LMN L;  4YWK A;  2JJQ A;  5IWA L;  3M9B A;  3H15 A;  4JBK A;  4JYA Q;  1VQE A;  2LXJ A;  5IYB G;  5IYD G;  4JI7 Q;  4JCV E;  4DAM A;  5HY6 A;  3H3V I;  5C0X J;  4NXM L;  3PO2 H;  4JI1 Q;  2K5N A;  2MO1 A;  4YCV A;  4JG2 A;  1IZ6 A;  1L0W A;  5IP9 G;  5AJ3 Q;  3UDG A;  5GAG C;  2ALY B;  1M1K C;  3T1H L;  1SMX A;  1VQ5 A;  4A3B G;  4B3R L;  2E2I H;  3DM3 A;  2Q2I A;  4A93 G;  1PH6 A;  5C3E H;  5C44 G;  1SLJ A;  4A3I H;  3S1Q H;  4A3D G;  1IL2 A;  4LNQ A;  2KCT A;  3PUY A;  1J6Q A;  3HFZ B;  3CCE A;  4IFD I;  3K80 C;  3PUV A;  4Y7N H;  4HID A;  4R4T A;  3T1Y L;  1X55 A;  2C35 B;  1P8L A;  4L5Q A;  1HNX Q;  4C3I H;  3OTO L;  2UUB L;  1KXL A;  1QZG A;  3CXC A;  3UE0 A;  1Q81 C;  2WAQ G;  1JJG A;  1HNW Q;  4QY7 A;  5M5W H;  2D62 A;  3UDX A;  4MZ9 A;  2ZJQ A;  1VQJ A;  1C0A A;  2HQL A;  1L2F A;  2UXD L;  4A3F H;  2KEN A;  4OXP A;  1JMC A;  1XMQ L;  4A3M H;  4GLA C;  1IBL Q;  1EQR A;  3OYY A;  2NVX H;  4DR4 Q;  4YCW A;  5IP7 H;  1OXS C;  1YHQ A;  4IOC A;  1CKN B;  4IOA A;  1A63 A;  1XTD A;  3CC4 A;  1V1Q A;  1Y1V H;  2RCN A;  1X54 A;  1HR0 W;  2R7Z H;  1PYB A;  2Z6K A;  1WI5 A;  1IBK L;  2PQA A;  4ALP A;  4AQY L;  2VNU D;  1XNR L;  4BBR H;  1FL0 A;  3A5U A;  1JE5 A;  4JBW A;  1WOC A;  1QVG A;  1BBW A;  1XNQ L;  2JK8 A;  1OXV A;  1VQ9 A;  2BH8 A;  1EIY B;  1K0R A;  4JI8 L;  4IPC A;  2CFM A;  4JI5 Q;  4YCU A;  4DR6 Q;  4JI0 L;  1PH8 A;  4O2D A;  2F3I A;  4A3G H;  2B29 A;  2YV5 A;  1B70 B;  3E9H A;  1RIP A;  3NEM A;  3L0O A;  4H02 A;  4JI2 Q;  3W1G A;  4A3K H;  3KJP A;  4B3T Q;  4JI4 Q;  4DR3 Q;  3HOX G;  2I5L X;  2NN6 I;  3M85 A;  2ATW A;  4A76 A;  3S1M H;  4YWL A;  4X66 Q;  3DLL A;  4K0K Q;  4LF7 Q;  1XPO A;  4J15 A;  4LFA Q;  4DAY B;  4A3C G;  3PCO B;  2MQH A;  4LUZ A;  3ICE A;  1N36 Q;  4AH6 A;  4OX9 Q;  3STB C;  4P74 A;  1YIT A;  4PZ6 A;  1IBM L;  5IP7 G;  4A3L G;  3IRB A;  3FP9 A;  4BBS G;  3KF6 A;  2MNA A;  4GLX A;  4L5R C;  4R4Q A;  1HZA A;  3KFU A;  3CW2 C;  3BU2 A;  1SN8 A;  3K8A A;  5C0X G;  4QGU A;  4DV3 L;  1FJG Q;  4LFB Q;  4GKK Q;  2XGT A;  3RR5 A;  1PH2 A;  1RL2 A;  1VCI A;  3CCQ A;  2JA7 G;  2JA6 H;  4DR5 Q;  3SGI A;  1K9M C;  1X3G A;  3CC7 A;  4IPH A;  2YYZ A;  1XJV A;  1VQF A;  1CUK A;  1Q1B A;  1V9P A;  1N33 Q;  4YHH Q;  4DV2 L;  2IT1 A;  3ER0 A;  4AYB E;  3GTK H;  4BY7 G;  1Z9F A;  3S14 H;  2NZO A;  4OO1 G;  4GKJ Q;  2R92 H;  1PH7 A;  4LF9 L;  1VQ8 A;  3CCV A;  4L5S A;  2WP8 J;  2VUM G;  2K52 A;  1TWC H;  3EIV A;  4DV4 Q;  4BXX G;  4X64 L;  3W1B A;  4DV5 L;  3JAM c;  2VZA A;  2WFW A;  3KJO A;  2DGY A;  1NMG A;  2Q2H A;  4GOP C;  1JJ2 A;  5BR8 Q;  4JBJ A;  1K8G A;  5FLM G;  3U50 C;  3CD6 A;  3HOY G;  3PUZ A;  3GTG H;  4DR7 L;  1SRU A;  3I7F A;  1HZC A;  2PMZ E;  2E5L Q;  2UXB Q;  1VQI A;  1Y14 B;  1EIF A;  2AKW B;  2NVQ H;  3M3Y H;  4X65 L;  1PV4 A;  1Q1E A;  2N49 A;  1C9O A;  1I94 Q;  3S24 A;  1A0I A;  1Y1W G;  2B63 G;  1EUJ A;  1M90 C;  1YHA A;  4KHZ A;  2JA6 G;  3FKI H;  4B3S Q;  3H3V H;  4A3E H;  1J5E L;  1TWA H;  3S16 H;  2F4V Q;  2JA8 G;  5C4X H;  5GQO A;  3I4N G;  4X62 Q;  1K8A C;  4JC0 A;  4DKA C;  2UUA Q;  2KHJ A;  1AE2 A;  4GNX C;  1BKB A;  3ULP A;  1UE6 A;  4P72 A;  5FJ8 H;  2QEX A;  5LMU Q;  4DV1 L;  3TS2 A;  1N32 L;  1KL9 A;  4LFC L;  3W5O A;  1VQO A;  4PMW A;  3HOU G;  2UXC L;  4X6A H;  3GTJ H;  4POG A;  3E0E A;  4DUZ Q;  4BY1 H;  4DV0 Q;  4JYA L;  2ZM6 Q;  1WFQ A;  3KF8 B;  5HGQ A;  4JI7 L;  3JAM i;  1VQD A;  4OWW B;  1PH3 A;  1PH9 A;  3RZD H;  4JI1 L;  1E1O A;  5GAD C;  2R93 G;  3TQY A;  4P71 A;  5AJ3 L;  2UU9 Q;  3JC6 6;  2AWO A;  5M3F H;  1LUZ A;  3GTM H;  4JV5 Q;  1YJ9 A;  3NEN A;  1EFW A;  4JBM A;  3CPF A;  3PO3 G;  1X6O A;  3U4Z A;  2MFI A;  4JOI A;  1LTL A;  2HHH L;  3CCU A;  3FKI G;  1VQP A;  1QVF A;  1NBW A;  2F52 A;  2I5M X;  4UP8 A;  1X3F A;  4DK6 C;  1HNX L;  1NE3 A;  2EXD A;  3S17 H;  1D8L A;  1T9H A;  1C7Y A;  3PV0 A;  1HNW L;  1G6P A;  3I4M H;  1E24 A;  1L1O A;  4UP7 A;  1WCM H;  2QGQ A;  3H0G H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...