1AEPA

Molecular structure of an apolipoprotein determined at 2.5-angstroms resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
153
structure length
153
Chain Sequence
b'NIAEAVQQLNHTIVNAAHELHETLGLPTPDEALNLLTEQANAFKTKIAEVTTSLKQEAEKHQGSVAEQLNAFARNLNNSIHDAATSLNLQDQLNSLQSALTNVGHQWQDIATKTQASAQEAWAPVQSALQEAAEKTKEAAANLQNSIQSAVQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOLIPOPHORIN III
publication title Molecular structure of an apolipoprotein determined at 2.5-A resolution.
pubmed doi rcsb
source organism Locusta migratoria
molecule tags Lipoprotein
total genus 63
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 1992-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1aepA00
1AEPA 3S84A 1H7IA 2KC3A 1GS9A 1EQ1A 1EA8A 1LE2A 1B68A 3R2PA 1BZ4A 1LE4A 1OR2A 1NFNA 1YA9A 1OR3A 1LPEA 1NFOA 1LS4A
chains in the Genus database with same CATH superfamily
4EKWA 1D0ZA 2IOQA 1DOWA 1OXBA 1OCRC 3K6BA 3QVZA 4O6YA 4D4XA 1MMNA 2XL4A 1LS1A 2XLEA 1M6TA 3DD7A 4O6MA 3U9MA 2EPNA 5AC4A 4FX5A 1O5HA 4QDLA 2J9UA 4BEMJ 2H7BA 3GODA 1OCCC 3NKEA 3PCVA 4LDRA 4PJMA 1T6UA 3C7JA 3W8HA 5AC5A 4CX9A 1Q0GA 5L3VA 4YN0B 4PJJA 2NUTA 1PCXA 4O6NA 2CDQA 2HKVA 1GQAA 5AGFA 5A6BA 1ORJA 1S7ZA 1MQVA 4DJ9A 2KGOA 1Z23A 1G8XA 1XZQA 4P9FA 2A6EF 2L7AA 4PJNA 5DLJA 4HE8D 256BA 3EJNA 5BQGA 2I8BA 3RVYA 1FR0A 1CPRA 1T9KA 1XZPA 1YA7O 3RH3A 2HZ8A 2VASA 2H7OA 2HUJA 3EZIA 3EHNA 2LD6A 3MYIA 3NYJA 4J7YA 4JIOA 1U0BB 2E87A 1AEPA 1FFTC 3ECSA 1BDJB 3GM1A 5T3WA 3IQCA 4F4BA 2YVKA 4EUKB 2KSFA 3W2WA 4JCZA 2ZPAA 4IAQA 4LDQA 4PFOA 5KYYB 3ZC4A 3EZHA 1Z3IX 3T6GB 2QY9A 4A4AA 1ST6A 4XTKA 2DYSC 3JT1A 5BQHA 2VH3A 3SXKA 1KU2A 2HMZA 4MVOA 4P6IC 3WHNA 4JC7A 3MBGA 4GYTA 4MTOA 3TULA 2R7VA 3AG4C 3DE8A 4KBLA 4IGGA 1K05A 4BJ6A 3IQTA 1GGQA 1OW6A 3HNLA 3LLKA 4YT8A 1YA9A 1EI7A 4E17A 3HKKA 1NU7D 4NQFA 3AOUA 4Q7CA 4RD9A 4NTAA 4LDKA 2DGJA 3G50A 2R03A 4JCHA 1HMOA 2J45A 3JTLO 3RYLA 3ZWIA 4AE4B 3U2MA 4G7HF 1BR2A 4ONSA 4OINF 2O9XA 2P61A 2Y3DA 3Q7GA 4N06A 4ER9A 4YL3A 4MS2A 1OCZC 3GWNA 4XQ1A 1MNEA 1PD1A 2KJGA 1T6QA 2J0XA 2KYHA 3K1HA 4JVSA 3JSEO 3V5YA 2Q4FA 4G7OF 2J46A 4BJ6C 2IXOA 3GWLA 1NBBA 2GAQA 2EINC 2KK1A 1U89A 3B0PA 1MNDA 3IQ6A 2Z15A 4KI2A 1D1CA 4C3DA 1C17M 1DOVA 1YARO 2G3KA 1G4US 3S9OA 4BG0A 2P0NA 2OEXA 2XL6A 2CNWD 1FMWA 1VB5A 2OQMA 1CGNA 3MLGA 3ABMC 1D1AA 4GEHA 3NYLA 4ULVA 1YZCA 1FMVA 3HLZA 1ORYA 3RQFA 1IW7F 2R9RB 3DAFA 4JKVA 5HSWA 2C04A 4MW3A 4PK4A 1NG1A 3C8ZA 4U5HA 3X2QC 5DQZA 4E18A 3JYYA 4EBJA 1M2VA 2GWWA 1PV3A 1M2VB 2D4UA 3KMIA 4YL0A 3V7OA 2YLGA 1GM5A 4KNVA 3EGXB 4U5BE 4U9EA 2JX0A 3RW0A 1JMWA 3ZTMA 5DQTA 2HS5A 2J8WA 3MX3A 3GM3A 3GORA 3DKAA 5JVEA 5KYWB 2D5RB 4JEAA 1HW2A 1ZHTA 5DS5A 4G0HA 4WGZA 4PACA 4N6HA 1KTMA 4DBQA 3A11A 3OWTA 2YL3A 3NRHA 2GDCA 3SXMA 2CGEA 5CIVA 2YL0A 1PD0A 4O79A 1YVIA 2YWAA 2Y3HA 5FCLA 1G5ZA 5K0IA 5A6KA 2ETSA 4RDAA 3FAPB 5BUOA 4WJ0A 3NMJA 2CNWA 2XLOA 1G4WR 3ZQYA 5KYXA 2YLIA 3T6JA 3J06A 1FFHA 4Q5SF 4XPXA 5COGA 2LCHA 3X1OA 4EBKA 1ZHZA 2R7QA 3B9QA 1L3PA 3TK0A 2OJED 3K66A 3AGUA 1NSGB 2QTVA 1MMGA 2XSEA 3EH2A 4MVUA 3FOPA 4JRZA 4DRIB 5A6BD 2EPLX 1LE2A 3WG7C 1M57C 3TD7A 4N4WA 4Z9HA 1BR4A 3DWWA 2HV6A 4JEBA 5L3QA 3AG3C 1V74B 2IBFA 2LSEA 3LESA 2HV7A 3NG1A 2NSGA 5A6JA 1H9GA 3B0VC 3UGPA 5KYNA 2MYSA 4PR9A 5D92A 1TFKB 3VRCA 1FNTc 2BL2A 5A69A 1WOLA 2P7VA 3GEHA 2Q9BA 3RF3A 4D4NA 5JUAA 3AG2C 3EPVA 1Z5ZA 4JURI 3S84A 2EPMX 2OCCC 5DVWA 4XLNF 5IY5C 4C7OA 1T6IA 2XRHA 5JP7A 2KC3A 2TMVP 4I3MA 1E83A 4C7OB 2R7UA 3DI5A 2PX3A 3EFOA 1Q0KA 2L6FA 3FOOA 3NMKA 1RKCA 4X0RA 5B1AC 3ZDLA 2FAPB 2LK4A 4AK9A 2L9JA 4YL1A 2FGYA 2V3CC 2YL7A 1RXQA 3F47A 3S0XA 3T6BA 2P6VA 4BJ1A 2OG2A 2UUHA 1B68A 1CGOA 3U8PA 5CI9A 3UMKA 2V26A 2NUTB 2Q9CA 4HEAJ 4I44A 4K7BA 3UGOA 1LI5A 3M4BA 2VCAA 3DAGA 2EPKX 3BRJA 2C03A 5E3AA 2AWCA 1E2XA 1OR3A 3U8VA 3O10A 1RCPA 3SXZA 5L0HA 3BEHA 1NFOA 3TOLA 2IXMA 3VF0A 4DRHB 2HJ3A 3FDQA 3AGTA 4G78A 2XM4A 3S90A 2WL8A 1H7IA 1HMDA 1ZYRF 3JYHA 5L0JA 3UNGC 1A7DA 2G3VA 5D91A 1VMAA 3W2VA 4A2NB 3L1MA 2XXAA 4U5EE 2GA0A 2F22A 3DM5A 2R7OA 4FESA 3GEEA 1QLEC 3DJNB 5A6AA 1ORSC 2ZXOA 3DMDA 2LQGA 1T5OA 4LLCA 2J9BA 3N24A 1VTMP 4JZAA 2DI3A 2GFHA 1I4YA 1JPNA 1U6HA 2WVQA 2XLHA 3R7CA 4YT4A 5BQIA 4E7ZA 3O6XA 4YWQA 3CEXA 4YJWA 2XS8A 2BE5F 2YKZA 1FTSA 1NU9C 1ZHWA 2VCBA 3LJBA 1TFOB 2XM0A 1QPUA 1Y6DA 3IHUA 2M4EA 1Y4CA 2EILC 4QI0A 4Z9IA 1TWCA 3G4ZA 1WN0A 2RSEB 1R4TA 3EH1A 3WODF 4MVMA 3QVYA 5JS5A 2L6HA 2L6GA 3DJUB 4EHPA 5L0FA 1OW8A 4DVYP 4CS7A 1FAPB 1SMYF 4CS8A 4JTAB 2LIGA 1C02A 3T4RA 2ZD9A 1Z6AA 4CS9C 1NZEA 3NDBB 3IQ5A 3DE9A 2KQ9A 4IARA 1JOGA 4MVZA 3EGDA 3TQOA 3U0CA 1YLMA 3I5PA 3MFNA 4JJFA 2H8AA 1TQGA 2RD9A 1ZHYA 1VLTA 1R5ID 2YRFA 3HJCA 3WAQA 3LS1A 1TWGA 1RKEA 3LS0A 4Q4ZF 1E84A 1EKYA 2IXNA 3U3BA 4NCQA 4CIPA 2IM8A 3E70C 3N2ZB 2PF4E 1LKXA 2XS1A 4U5GA 4EIYA 3TJ5A 2FFHA 3FVYA 4CS8C 2W45A 4NTFA 1Q0DA 5EHHA 1K04A 2W4BA 1ZU4A 2MHRA 3ASNC 1KNYA 3ABLC 3K7DA 2UUIA 3TJ6A 5F5FA 2B0JA 3PDMP 1SYQA 2R7RA 1S05A 1N1CA 4E0IA 2HFIA 3SXYA 4HFFB 2Y3BA 2QLAA 3R2PA 2JPUA 3ZTZA 4JTDB 4I1OB 1VK5A 4ZLCA 2Q7RA 4LLEA 4AX2A 3U9JA 3JZ0A 3U5SA 1F1MA 1WATA 2Y3GA 1UFBA 1LVKA 3OEOA 4ZLDA 1L7CA 3JRTA 5JT4A 2R7XA 2L81A 3EG9A 4MQ9F 4CDAA 2R05A 3EG9B 3HNIA 3ZG1A 4J30B 2KNHA 3T9OA 1YZAA 3KKBA 2YZSA 2WVNA 3L8JA 4EWCA 5KYXB 3VYWA 4XEKA 4DBRA 5L0DA 5JSLA 3US6A 3W4YA 2I15A 1YYXA 1ZW2A 2WB7A 3GANA 2XL8A 3JSZA 4JW1A 3V5ZA 2OJQA 1T01A 2EIMC 3N0TA 4OD4A 1EQ1A 2DYRC 2IYLD 2EIKC 4FWVA 2IXPA 3HNJA 4IB4A 2AU5A 1HE9A 1OQCA 1QZXA 1ZU5A 2WZLA 3C63A 5HV9A 1BR1A 1IZMA 2XLDA 1M56C 3QTHA 4ULWA 3L0IA 2LP4A 1OCOC 3LEVA 3M1CB 2J0WA 3M79A 3ZIBA 1NLXA 3C8GD 2YL1A 1H6GA 4BJ5A 1ZZPA 4PFPA 3M15A 4CJGA 5B3IA 1V4AA 4QI2A 2X51A 3UR3C 2ZXRA 4IJJA 4XWJA 5KYUA 4P9TA 2AP3A 5KYUB 2ASRA 1ZW3A 4RBNA 4WABA 5JLIA 4E0HA 4OIPF 3U2LA 1GS9A 3RQGA 3KL4A 3EFOB 4MVRA 2AWYA 4CDYA 3NMIA 2A1DD 4OD5A 1SR2A 2HJMA 3AQCA 4DRJB 4NY3A 3PHF2 4YT2A 2XLVA 4H54A 2Q3TA 1JRAA 1VYKA 3S29A 3SEOA 3AJMA 1K40A 5B1BC 1VLSA 1TWHA 3ASOC 4BJ5C 3C62A 3CSKA 4IRUA 3EQLF 3SZRA 4UDVA 2NUPA 1HE1A 4M63A 2Q9AA 1O3UA 4Z9JA 3O39A 2HSBA 4W8PA 2R7TA 2QUPA 2PNOA 3FAJA 5COFA 3RQEA 3ABKC 2P1AA 3C8GA 1QKRA 3F46A 3UMHA 3C8GB 1YAUO 4G7ZF 2EIJC 2CW0F 5CI8A 3IEEA 2NG1A 4JE9A 4AE4A 4B6IA 2A0UA 1JPJA 2R25A 2YLDA 3O55A 2XXAB 4PJLA 4YT5A 3B29A 3LUTB 1YYJA 1ZVZA 3H2UA 3QZCA 1Z7Qc 3UMIA 3ZSUA 3LNRA 4ANJA 4CS9A 1WASA 3KYJA 5E33A 1H9TA 2CYDA 2NPUA 3VAYA 1SZIA 5F5HA 3H2VA 1Q0FA 1MMAA 3LAYA 1RJ9A 3QW0A 4K1OA 1RJ9B 4NC3A 3QW1A 1TWAA 3VM6A 1RMVA 2VCCA 3I4UA 2J9WA 2YHSA 4MTFA 4LACB 4AL0A 2G62A 3PMRA 2QE9A 3LNMB 1OW7A 1WTYA 5F28E 4CIHA 3E9VA 4MVQA 4XPYA 5B3SC 1I4ZA 4LERA 1D0YA 2R02A 3SYNA 2CCYA 3Q6NA 1WWPA 5EGYA 3OA1A 1A41A 4IWBA 1AUEA 2YEVA 5KYYA 1W2WA 2VB6A 3ZVRA 4DVZA 2ZXWC 4XEFA 2XLWA 1UG7A 2WZFA 3EGDB 4YK5A 2MWQA 1OR2A 5GPGB 1O87A 3TOMA 2KW3C 2Q00A 4JTCB 3FMSA 4MNDA 3EHMA 4U5DE 1Q0MA 2PX0A 4WGYA 1RKEB 3JRMO 4H4KC 3JCUQ 3HTKC 1VOMA 2HSQA 3GEIA 5TJ5E 1YDIA 4E7SA 3AG1C 4CSAA 2QNLA 3RVZA 4MVSA 1TKNA 4AL1A 4J7TA 2VC9A 3LLIA 1SF8A 4HFKB 3SP1A 4CJOA 2A68F 2B0HA 4DOZA 5L0GA 2J7PD 3RKOF 4BPMA 1I5NA 1OKKD 1VYIA 3S27A 3KH2A 3HNKA 3ZQVA 3M4CA 4DXWA 1D1BA 2DB4A 3B71A 2X0CA 5JRAA 4C3EA 4BEJA 4MW8A 3C18A 2XLMA 3S28A 1OXKA 4W8KA 1BZ4A 1TR2A 2AVKA 3NKDA 4K0DA 1V55C 2EPOA 3K33A 3POVA 5EK0A 2M64A 2OKUA 3QMKA 4U9DA 2HMQA 2R7WA 4CSAC 1D0XA 2A6HF 4BJTA 1QQ3A 2ICWG 1A0BA 5DS6A 1APCA 5E3CA 1LI7A 1YJGA 3L8IA 2PBEA 1QVXA 3A9CA 4U5FE 5COMA 2Y39A 3CZ6A 3ITFA 3DM9B 2LFDA 4EBBA 4JJGA 1C03A 2OEVA 3EGXA 3CQZA 3K1IA 4KNWA 5T1DB 3B0UX 4CBEA 2J7PA 3NYMA 4N6CA 1MMDA 1WGWA 4L6RA 1EA8A 3RFYA 5KYWA 3Q7LA 1OKKA 1HW1A 2OOCA 3AQBA 1QSPA 1LM3B 4FAPB 1J8MF 3RIPA 4C3BA 1JR8A 3SNHA 2H7VC 5L0CA 3KPHA 3Q6MA 1CGME 2OU6A 4OIRF 1M2OA 1A7EA 4GQHA 1E86A 2BC5A 5DS4A 4NTBA 1J8YF 4IAOA 2NSFA 2WZGA 3I5QA 1ZHXA 4J32B 2A69F 1V54C 2J9VA 3V5XA 1LS4A 3L34A 3LEOA 1LIHA 1A7VA 3K1IC 1E85A 2W9YA 2R7SA 2A0BA 1CPQA 2ZXPA 3IPMO 2JD3A 3G4XA 3DZAA 4I1MA 1Z63A 3FHDA 1AVOB 4CDVA 2PFDA 1JAFA 2W4MA 4O7GA 3U3FA 5T3TA 3FXHA 1XWJA 5E2QA 4OIOF 1LE4A 4R32A 3W8IA 3H65A 4OIQF 5L0IA 1NFNA 3ATPA 2YQYA 2PP4A 3MYFA 5FZTA 1HY5A 1LPEA 3KYIA 4MTGA 2NUPB 4U5CE 3DXJF 2Y69C 4XEVA 4KC9A 4XPWA 4XLPF 3CAXA 3GM2A 2WVOA 2LFFA 1BBHA
chains in the Genus database with same CATH topology
1AEPA 3S84A 1H7IA 2KC3A 1GS9A 1EQ1A 1EA8A 1LE2A 1B68A 3R2PA 1BZ4A 1LE4A 1OR2A 1NFNA 1YA9A 1OR3A 1LPEA 1NFOA 1LS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AEP A;  3S84 A;  1H7I A;  2KC3 A;  1GS9 A;  1EQ1 A;  1EA8 A;  1LE2 A;  1B68 A;  3R2P A;  1BZ4 A;  1LE4 A;  1OR2 A;  1NFN A;  1YA9 A;  1OR3 A;  1LPE A;  1NFO A;  1LS4 A; 
#chains in the Genus database with same CATH topology
 4EKW A;  1D0Z A;  2IOQ A;  1DOW A;  1OXB A;  1OCR C;  3K6B A;  3QVZ A;  4O6Y A;  4D4X A;  1MMN A;  2XL4 A;  1LS1 A;  2XLE A;  1M6T A;  3DD7 A;  4O6M A;  3U9M A;  2EPN A;  5AC4 A;  4FX5 A;  1O5H A;  4QDL A;  2J9U A;  4BEM J;  2H7B A;  3GOD A;  1OCC C;  3NKE A;  3PCV A;  4LDR A;  4PJM A;  1T6U A;  3C7J A;  3W8H A;  5AC5 A;  4CX9 A;  1Q0G A;  5L3V A;  4YN0 B;  4PJJ A;  2NUT A;  1PCX A;  4O6N A;  2CDQ A;  2HKV A;  1GQA A;  5AGF A;  5A6B A;  1ORJ A;  1S7Z A;  1MQV A;  4DJ9 A;  2KGO A;  1Z23 A;  1G8X A;  1XZQ A;  4P9F A;  2A6E F;  2L7A A;  4PJN A;  5DLJ A;  4HE8 D;  256B A;  3EJN A;  5BQG A;  2I8B A;  3RVY A;  1FR0 A;  1CPR A;  1T9K A;  1XZP A;  1YA7 O;  3RH3 A;  2HZ8 A;  2VAS A;  2H7O A;  2HUJ A;  3EZI A;  3EHN A;  2LD6 A;  3MYI A;  3NYJ A;  4J7Y A;  4JIO A;  1U0B B;  2E87 A;  1AEP A;  1FFT C;  3ECS A;  1BDJ B;  3GM1 A;  5T3W A;  3IQC A;  4F4B A;  2YVK A;  4EUK B;  2KSF A;  3W2W A;  4JCZ A;  2ZPA A;  4IAQ A;  4LDQ A;  4PFO A;  5KYY B;  3ZC4 A;  3EZH A;  1Z3I X;  3T6G B;  2QY9 A;  4A4A A;  1ST6 A;  4XTK A;  2DYS C;  3JT1 A;  5BQH A;  2VH3 A;  3SXK A;  1KU2 A;  2HMZ A;  4MVO A;  4P6I C;  3WHN A;  4JC7 A;  3MBG A;  4GYT A;  4MTO A;  3TUL A;  2R7V A;  3AG4 C;  3DE8 A;  4KBL A;  4IGG A;  1K05 A;  4BJ6 A;  3IQT A;  1GGQ A;  1OW6 A;  3HNL A;  3LLK A;  4YT8 A;  1YA9 A;  1EI7 A;  4E17 A;  3HKK A;  1NU7 D;  4NQF A;  3AOU A;  4Q7C A;  4RD9 A;  4NTA A;  4LDK A;  2DGJ A;  3G50 A;  2R03 A;  4JCH A;  1HMO A;  2J45 A;  3JTL O;  3RYL A;  3ZWI A;  4AE4 B;  3U2M A;  4G7H F;  1BR2 A;  4ONS A;  4OIN F;  2O9X A;  2P61 A;  2Y3D A;  3Q7G A;  4N06 A;  4ER9 A;  4YL3 A;  4MS2 A;  1OCZ C;  3GWN A;  4XQ1 A;  1MNE A;  1PD1 A;  2KJG A;  1T6Q A;  2J0X A;  2KYH A;  3K1H A;  4JVS A;  3JSE O;  3V5Y A;  2Q4F A;  4G7O F;  2J46 A;  4BJ6 C;  2IXO A;  3GWL A;  1NBB A;  2GAQ A;  2EIN C;  2KK1 A;  1U89 A;  3B0P A;  1MND A;  3IQ6 A;  2Z15 A;  4KI2 A;  1D1C A;  4C3D A;  1C17 M;  1DOV A;  1YAR O;  2G3K A;  1G4U S;  3S9O A;  4BG0 A;  2P0N A;  2OEX A;  2XL6 A;  2CNW D;  1FMW A;  1VB5 A;  2OQM A;  1CGN A;  3MLG A;  3ABM C;  1D1A A;  4GEH A;  3NYL A;  4ULV A;  1YZC A;  1FMV A;  3HLZ A;  1ORY A;  3RQF A;  1IW7 F;  2R9R B;  3DAF A;  4JKV A;  5HSW A;  2C04 A;  4MW3 A;  4PK4 A;  1NG1 A;  3C8Z A;  4U5H A;  3X2Q C;  5DQZ A;  4E18 A;  3JYY A;  4EBJ A;  1M2V A;  2GWW A;  1PV3 A;  1M2V B;  2D4U A;  3KMI A;  4YL0 A;  3V7O A;  2YLG A;  1GM5 A;  4KNV A;  3EGX B;  4U5B E;  4U9E A;  2JX0 A;  3RW0 A;  1JMW A;  3ZTM A;  5DQT A;  2HS5 A;  2J8W A;  3MX3 A;  3GM3 A;  3GOR A;  3DKA A;  5JVE A;  5KYW B;  2D5R B;  4JEA A;  1HW2 A;  1ZHT A;  5DS5 A;  4G0H A;  4WGZ A;  4PAC A;  4N6H A;  1KTM A;  4DBQ A;  3A11 A;  3OWT A;  2YL3 A;  3NRH A;  2GDC A;  3SXM A;  2CGE A;  5CIV A;  2YL0 A;  1PD0 A;  4O79 A;  1YVI A;  2YWA A;  2Y3H A;  5FCL A;  1G5Z A;  5K0I A;  5A6K A;  2ETS A;  4RDA A;  3FAP B;  5BUO A;  4WJ0 A;  3NMJ A;  2CNW A;  2XLO A;  1G4W R;  3ZQY A;  5KYX A;  2YLI A;  3T6J A;  3J06 A;  1FFH A;  4Q5S F;  4XPX A;  5COG A;  2LCH A;  3X1O A;  4EBK A;  1ZHZ A;  2R7Q A;  3B9Q A;  1L3P A;  3TK0 A;  2OJE D;  3K66 A;  3AGU A;  1NSG B;  2QTV A;  1MMG A;  2XSE A;  3EH2 A;  4MVU A;  3FOP A;  4JRZ A;  4DRI B;  5A6B D;  2EPL X;  1LE2 A;  3WG7 C;  1M57 C;  3TD7 A;  4N4W A;  4Z9H A;  1BR4 A;  3DWW A;  2HV6 A;  4JEB A;  5L3Q A;  3AG3 C;  1V74 B;  2IBF A;  2LSE A;  3LES A;  2HV7 A;  3NG1 A;  2NSG A;  5A6J A;  1H9G A;  3B0V C;  3UGP A;  5KYN A;  2MYS A;  4PR9 A;  5D92 A;  1TFK B;  3VRC A;  1FNT c;  2BL2 A;  5A69 A;  1WOL A;  2P7V A;  3GEH A;  2Q9B A;  3RF3 A;  4D4N A;  5JUA A;  3AG2 C;  3EPV A;  1Z5Z A;  4JUR I;  3S84 A;  2EPM X;  2OCC C;  5DVW A;  4XLN F;  5IY5 C;  4C7O A;  1T6I A;  2XRH A;  5JP7 A;  2KC3 A;  2TMV P;  4I3M A;  1E83 A;  4C7O B;  2R7U A;  3DI5 A;  2PX3 A;  3EFO A;  1Q0K A;  2L6F A;  3FOO A;  3NMK A;  1RKC A;  4X0R A;  5B1A C;  3ZDL A;  2FAP B;  2LK4 A;  4AK9 A;  2L9J A;  4YL1 A;  2FGY A;  2V3C C;  2YL7 A;  1RXQ A;  3F47 A;  3S0X A;  3T6B A;  2P6V A;  4BJ1 A;  2OG2 A;  2UUH A;  1B68 A;  1CGO A;  3U8P A;  5CI9 A;  3UMK A;  2V26 A;  2NUT B;  2Q9C A;  4HEA J;  4I44 A;  4K7B A;  3UGO A;  1LI5 A;  3M4B A;  2VCA A;  3DAG A;  2EPK X;  3BRJ A;  2C03 A;  5E3A A;  2AWC A;  1E2X A;  1OR3 A;  3U8V A;  3O10 A;  1RCP A;  3SXZ A;  5L0H A;  3BEH A;  1NFO A;  3TOL A;  2IXM A;  3VF0 A;  4DRH B;  2HJ3 A;  3FDQ A;  3AGT A;  4G78 A;  2XM4 A;  3S90 A;  2WL8 A;  1H7I A;  1HMD A;  1ZYR F;  3JYH A;  5L0J A;  3UNG C;  1A7D A;  2G3V A;  5D91 A;  1VMA A;  3W2V A;  4A2N B;  3L1M A;  2XXA A;  4U5E E;  2GA0 A;  2F22 A;  3DM5 A;  2R7O A;  4FES A;  3GEE A;  1QLE C;  3DJN B;  5A6A A;  1ORS C;  2ZXO A;  3DMD A;  2LQG A;  1T5O A;  4LLC A;  2J9B A;  3N24 A;  1VTM P;  4JZA A;  2DI3 A;  2GFH A;  1I4Y A;  1JPN A;  1U6H A;  2WVQ A;  2XLH A;  3R7C A;  4YT4 A;  5BQI A;  4E7Z A;  3O6X A;  4YWQ A;  3CEX A;  4YJW A;  2XS8 A;  2BE5 F;  2YKZ A;  1FTS A;  1NU9 C;  1ZHW A;  2VCB A;  3LJB A;  1TFO B;  2XM0 A;  1QPU A;  1Y6D A;  3IHU A;  2M4E A;  1Y4C A;  2EIL C;  4QI0 A;  4Z9I A;  1TWC A;  3G4Z A;  1WN0 A;  2RSE B;  1R4T A;  3EH1 A;  3WOD F;  4MVM A;  3QVY A;  5JS5 A;  2L6H A;  2L6G A;  3DJU B;  4EHP A;  5L0F A;  1OW8 A;  4DVY P;  4CS7 A;  1FAP B;  1SMY F;  4CS8 A;  4JTA B;  2LIG A;  1C02 A;  3T4R A;  2ZD9 A;  1Z6A A;  4CS9 C;  1NZE A;  3NDB B;  3IQ5 A;  3DE9 A;  2KQ9 A;  4IAR A;  1JOG A;  4MVZ A;  3EGD A;  3TQO A;  3U0C A;  1YLM A;  3I5P A;  3MFN A;  4JJF A;  2H8A A;  1TQG A;  2RD9 A;  1ZHY A;  1VLT A;  1R5I D;  2YRF A;  3HJC A;  3WAQ A;  3LS1 A;  1TWG A;  1RKE A;  3LS0 A;  4Q4Z F;  1E84 A;  1EKY A;  2IXN A;  3U3B A;  4NCQ A;  4CIP A;  2IM8 A;  3E70 C;  3N2Z B;  2PF4 E;  1LKX A;  2XS1 A;  4U5G A;  4EIY A;  3TJ5 A;  2FFH A;  3FVY A;  4CS8 C;  2W45 A;  4NTF A;  1Q0D A;  5EHH A;  1K04 A;  2W4B A;  1ZU4 A;  2MHR A;  3ASN C;  1KNY A;  3ABL C;  3K7D A;  2UUI A;  3TJ6 A;  5F5F A;  2B0J A;  3PDM P;  1SYQ A;  2R7R A;  1S05 A;  1N1C A;  4E0I A;  2HFI A;  3SXY A;  4HFF B;  2Y3B A;  2QLA A;  3R2P A;  2JPU A;  3ZTZ A;  4JTD B;  4I1O B;  1VK5 A;  4ZLC A;  2Q7R A;  4LLE A;  4AX2 A;  3U9J A;  3JZ0 A;  3U5S A;  1F1M A;  1WAT A;  2Y3G A;  1UFB A;  1LVK A;  3OEO A;  4ZLD A;  1L7C A;  3JRT A;  5JT4 A;  2R7X A;  2L81 A;  3EG9 A;  4MQ9 F;  4CDA A;  2R05 A;  3EG9 B;  3HNI A;  3ZG1 A;  4J30 B;  2KNH A;  3T9O A;  1YZA A;  3KKB A;  2YZS A;  2WVN A;  3L8J A;  4EWC A;  5KYX B;  3VYW A;  4XEK A;  4DBR A;  5L0D A;  5JSL A;  3US6 A;  3W4Y A;  2I15 A;  1YYX A;  1ZW2 A;  2WB7 A;  3GAN A;  2XL8 A;  3JSZ A;  4JW1 A;  3V5Z A;  2OJQ A;  1T01 A;  2EIM C;  3N0T A;  4OD4 A;  1EQ1 A;  2DYR C;  2IYL D;  2EIK C;  4FWV A;  2IXP A;  3HNJ A;  4IB4 A;  2AU5 A;  1HE9 A;  1OQC A;  1QZX A;  1ZU5 A;  2WZL A;  3C63 A;  5HV9 A;  1BR1 A;  1IZM A;  2XLD A;  1M56 C;  3QTH A;  4ULW A;  3L0I A;  2LP4 A;  1OCO C;  3LEV A;  3M1C B;  2J0W A;  3M79 A;  3ZIB A;  1NLX A;  3C8G D;  2YL1 A;  1H6G A;  4BJ5 A;  1ZZP A;  4PFP A;  3M15 A;  4CJG A;  5B3I A;  1V4A A;  4QI2 A;  2X51 A;  3UR3 C;  2ZXR A;  4IJJ A;  4XWJ A;  5KYU A;  4P9T A;  2AP3 A;  5KYU B;  2ASR A;  1ZW3 A;  4RBN A;  4WAB A;  5JLI A;  4E0H A;  4OIP F;  3U2L A;  1GS9 A;  3RQG A;  3KL4 A;  3EFO B;  4MVR A;  2AWY A;  4CDY A;  3NMI A;  2A1D D;  4OD5 A;  1SR2 A;  2HJM A;  3AQC A;  4DRJ B;  4NY3 A;  3PHF 2;  4YT2 A;  2XLV A;  4H54 A;  2Q3T A;  1JRA A;  1VYK A;  3S29 A;  3SEO A;  3AJM A;  1K40 A;  5B1B C;  1VLS A;  1TWH A;  3ASO C;  4BJ5 C;  3C62 A;  3CSK A;  4IRU A;  3EQL F;  3SZR A;  4UDV A;  2NUP A;  1HE1 A;  4M63 A;  2Q9A A;  1O3U A;  4Z9J A;  3O39 A;  2HSB A;  4W8P A;  2R7T A;  2QUP A;  2PNO A;  3FAJ A;  5COF A;  3RQE A;  3ABK C;  2P1A A;  3C8G A;  1QKR A;  3F46 A;  3UMH A;  3C8G B;  1YAU O;  4G7Z F;  2EIJ C;  2CW0 F;  5CI8 A;  3IEE A;  2NG1 A;  4JE9 A;  4AE4 A;  4B6I A;  2A0U A;  1JPJ A;  2R25 A;  2YLD A;  3O55 A;  2XXA B;  4PJL A;  4YT5 A;  3B29 A;  3LUT B;  1YYJ A;  1ZVZ A;  3H2U A;  3QZC A;  1Z7Q c;  3UMI A;  3ZSU A;  3LNR A;  4ANJ A;  4CS9 A;  1WAS A;  3KYJ A;  5E33 A;  1H9T A;  2CYD A;  2NPU A;  3VAY A;  1SZI A;  5F5H A;  3H2V A;  1Q0F A;  1MMA A;  3LAY A;  1RJ9 A;  3QW0 A;  4K1O A;  1RJ9 B;  4NC3 A;  3QW1 A;  1TWA A;  3VM6 A;  1RMV A;  2VCC A;  3I4U A;  2J9W A;  2YHS A;  4MTF A;  4LAC B;  4AL0 A;  2G62 A;  3PMR A;  2QE9 A;  3LNM B;  1OW7 A;  1WTY A;  5F28 E;  4CIH A;  3E9V A;  4MVQ A;  4XPY A;  5B3S C;  1I4Z A;  4LER A;  1D0Y A;  2R02 A;  3SYN A;  2CCY A;  3Q6N A;  1WWP A;  5EGY A;  3OA1 A;  1A41 A;  4IWB A;  1AUE A;  2YEV A;  5KYY A;  1W2W A;  2VB6 A;  3ZVR A;  4DVZ A;  2ZXW C;  4XEF A;  2XLW A;  1UG7 A;  2WZF A;  3EGD B;  4YK5 A;  2MWQ A;  1OR2 A;  5GPG B;  1O87 A;  3TOM A;  2KW3 C;  2Q00 A;  4JTC B;  3FMS A;  4MND A;  3EHM A;  4U5D E;  1Q0M A;  2PX0 A;  4WGY A;  1RKE B;  3JRM O;  4H4K C;  3JCU Q;  3HTK C;  1VOM A;  2HSQ A;  3GEI A;  5TJ5 E;  1YDI A;  4E7S A;  3AG1 C;  4CSA A;  2QNL A;  3RVZ A;  4MVS A;  1TKN A;  4AL1 A;  4J7T A;  2VC9 A;  3LLI A;  1SF8 A;  4HFK B;  3SP1 A;  4CJO A;  2A68 F;  2B0H A;  4DOZ A;  5L0G A;  2J7P D;  3RKO F;  4BPM A;  1I5N A;  1OKK D;  1VYI A;  3S27 A;  3KH2 A;  3HNK A;  3ZQV A;  3M4C A;  4DXW A;  1D1B A;  2DB4 A;  3B71 A;  2X0C A;  5JRA A;  4C3E A;  4BEJ A;  4MW8 A;  3C18 A;  2XLM A;  3S28 A;  1OXK A;  4W8K A;  1BZ4 A;  1TR2 A;  2AVK A;  3NKD A;  4K0D A;  1V55 C;  2EPO A;  3K33 A;  3POV A;  5EK0 A;  2M64 A;  2OKU A;  3QMK A;  4U9D A;  2HMQ A;  2R7W A;  4CSA C;  1D0X A;  2A6H F;  4BJT A;  1QQ3 A;  2ICW G;  1A0B A;  5DS6 A;  1APC A;  5E3C A;  1LI7 A;  1YJG A;  3L8I A;  2PBE A;  1QVX A;  3A9C A;  4U5F E;  5COM A;  2Y39 A;  3CZ6 A;  3ITF A;  3DM9 B;  2LFD A;  4EBB A;  4JJG A;  1C03 A;  2OEV A;  3EGX A;  3CQZ A;  3K1I A;  4KNW A;  5T1D B;  3B0U X;  4CBE A;  2J7P A;  3NYM A;  4N6C A;  1MMD A;  1WGW A;  4L6R A;  1EA8 A;  3RFY A;  5KYW A;  3Q7L A;  1OKK A;  1HW1 A;  2OOC A;  3AQB A;  1QSP A;  1LM3 B;  4FAP B;  1J8M F;  3RIP A;  4C3B A;  1JR8 A;  3SNH A;  2H7V C;  5L0C A;  3KPH A;  3Q6M A;  1CGM E;  2OU6 A;  4OIR F;  1M2O A;  1A7E A;  4GQH A;  1E86 A;  2BC5 A;  5DS4 A;  4NTB A;  1J8Y F;  4IAO A;  2NSF A;  2WZG A;  3I5Q A;  1ZHX A;  4J32 B;  2A69 F;  1V54 C;  2J9V A;  3V5X A;  1LS4 A;  3L34 A;  3LEO A;  1LIH A;  1A7V A;  3K1I C;  1E85 A;  2W9Y A;  2R7S A;  2A0B A;  1CPQ A;  2ZXP A;  3IPM O;  2JD3 A;  3G4X A;  3DZA A;  4I1M A;  1Z63 A;  3FHD A;  1AVO B;  4CDV A;  2PFD A;  1JAF A;  2W4M A;  4O7G A;  3U3F A;  5T3T A;  3FXH A;  1XWJ A;  5E2Q A;  4OIO F;  1LE4 A;  4R32 A;  3W8I A;  3H65 A;  4OIQ F;  5L0I A;  1NFN A;  3ATP A;  2YQY A;  2PP4 A;  3MYF A;  5FZT A;  1HY5 A;  1LPE A;  3KYI A;  4MTG A;  2NUP B;  4U5C E;  3DXJ F;  2Y69 C;  4XEV A;  4KC9 A;  4XPW A;  4XLP F;  3CAX A;  3GM2 A;  2WVO A;  2LFF A;  1BBH A; 
#chains in the Genus database with same CATH homology
 1AEP A;  3S84 A;  1H7I A;  2KC3 A;  1GS9 A;  1EQ1 A;  1EA8 A;  1LE2 A;  1B68 A;  3R2P A;  1BZ4 A;  1LE4 A;  1OR2 A;  1NFN A;  1YA9 A;  1OR3 A;  1LPE A;  1NFO A;  1LS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...