1AEPA

Molecular structure of an apolipoprotein determined at 2.5-angstroms resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
153
structure length
153
Chain Sequence
NIAEAVQQLNHTIVNAAHELHETLGLPTPDEALNLLTEQANAFKTKIAEVTTSLKQEAEKHQGSVAEQLNAFARNLNNSIHDAATSLNLQDQLNSLQSALTNVGHQWQDIATKTQASAQEAWAPVQSALQEAAEKTKEAAANLQNSIQSAVQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular structure of an apolipoprotein determined at 2.5-A resolution.
pubmed doi rcsb
source organism Locusta migratoria
molecule tags Lipoprotein
molecule keywords APOLIPOPHORIN III
total genus 63
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 1992-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1aepA00
2KC3A 1NFNA 1OR2A 3R2PA 1NFOA 3S84A 1AEPA 1B68A 1LPEA 1YA9A 1LS4A 1EA8A 1EQ1A 1BZ4A 1LE2A 1LE4A 1GS9A 1H7IA 1OR3A
chains in the Genus database with same CATH superfamily
3IQ6A 4YT5A 1E84A 4YL0A 1UFBA 3IQTA 3PHF2 2V3CC 4DRIB 1TR2A 2NUPB 1O5HA 4LDKA 4NY3A 2M64A 3QVZA 5JSLA 2VCBA 4CJOA 3GWLA 1FTSA 1FFTC 1ZYRF 1R5ID 1YARO 1TFOB 3K66A 3LEOA 3GEEA 4MW3A 1FFHA 1RKEA 2M4EA 3S29A 2OU6A 4KNVA 4XQ1A 2KGOA 1Z5ZA 1HW2A 2CNWA 5KYWB 2LK4A 3K7DA 1D0YA 4JKVA 4NTAA 1LKXA 2XM0A 4P9FA 1F1MA 4AL1A 4AX2A 1BR1A 2HV7A 1G4WR 2LP4A 1Z7Qc 1VYKA 3U8VA 2VCAA 4K1OA 4PFOA 3RH3A 4AE4A 1ORYA 1Y4CA 5AC4A 3GORA 4PJJA 4XPYA 4YJWA 3ABMC 2ASRA 3W8IA 1YVIA 3EG9B 4GQHA 1MNDA 2J7PD 2JPUA 5KYUA 4E0IA 5L0FA 3EHNA 3M79A 4YT4A 4MVMA 2VB6A 3EGDA 1WGWA 1MMDA 3DM9B 4JE9A 3EQLF 1EA8A 2B0HA 3AG1C 3C62A 1C02A 3PCVA 5FZTA 4EWCA 3FHDA 3GWNA 1D1AA 3S84A 3HTKC 4MTFA 2R7RA 1HMOA 3C63A 4JCZA 2BE5F 3FXHA 3R7CA 4X0RA 2NUTA 4IAQA 3TK0A 3RW0A 3RIPA 4BJ1A 1OKKD 4K0DA 1HMDA 1OKKA 2IXOA 3ZDLA 1HE1A 4Z9HA 3AGTA 5A6KA 1E85A 5KYXB 3SXZA 4G7HF 3HJCA 2PP4A 4PACA 4MTGA 3W2WA 4PR9A 5CI9A 1G5ZA 2YZSA 1BDJB 1PV3A 2HJMA 2R9RB 3B71A 5EK0A 3C7JA 3KMIA 5JT4A 5HV9A 1TFKB 2XLWA 4W8KA 4Z9IA 4P9TA 4BEJA 4ER9A 4BJ6A 1Y6DA 1BBHA 2J0XA 4XLNF 2J46A 1ORJA 4QDLA 3I5PA 4JTDB 4N4WA 2Q4FA 3RQEA 2LFFA 4OINF 2AVKA 3BEHA 2XL8A 4C3DA 2F22A 3ASNC 2CYDA 1BZ4A 4JIOA 4A4AA 3KL4A 3RFYA 2R02A 1V54C 2X51A 3F47A 2YHSA 1U0BB 3WHNA 5KYYB 2DB4A 2CNWD 4Q4ZF 4CSAC 5D91A 3JSZA 3KYIA 2XRHA 3DI5A 3SZRA 4OIOF 3O39A 3C8ZA 4YL3A 4QI2A 1G8XA 1YZAA 1FAPB 2O9XA 5B3SC 3TOLA 2VCCA 4U5BE 2Q9AA 2G3KA 1VB5A 3JZ0A 3QMKA 2OCCC 3M4CA 3Q6NA 3M4BA 4EIYA 3O10A 1MNEA 4I1MA 3WG7C 2XL4A 2IOQA 1RXQA 3NG1A 4MVZA 1VLSA 3K6BA 3H2VA 3NKDA 1L7CA 3E9VA 3MFNA 2Y3GA 2YL3A 3NDBB 1VMAA 3US6A 1RJ9B 1U6HA 1OXKA 4RBNA 3AG4C 4ONSA 5BQGA 5KYNA 4JJFA 2KJGA 3IQCA 1UG7A 1WOLA 4BJ6C 4HEAJ 4CS9C 1VK5A 1M2VA 2R05A 2XLEA 5KYWA 1JPJA 2H7OA 1LI5A 2A6HF 2YLGA 2LSEA 3C8GA 3B0UX 1H6GA 3EFOB 1H9GA 3PMRA 2D4UA 4JEAA 2EPKX 4XEVA 5FCLA 1FMWA 2HSQA 3LEVA 3TOMA 4RD9A 1Z23A 4N6CA 3VAYA 4BJ5A 1JR8A 1YJGA 4CSAA 3DD7A 3LNMB 4ZLCA 1T6IA 2J7PA 3HNIA 3UGPA 2Q3TA 3MLGA 5JP7A 1YYJA 1R4TA 2YLIA 5GPGB 2YRFA 3RF3A 2ZXRA 4JC7A 3T9OA 4IB4A 4DRJB 3DAGA 2JD3A 2ICWG 3KPHA 3V5YA 4CJGA 3S90A 1Q0DA 3EPVA 4O6NA 4PJLA 3U2MA 3JYYA 2HV6A 4BJ5C 5DLJA 2KNHA 1YAUO 4HFKB 3DJNB 3PDMP 3EG9A 5KYUB 5T3WA 4D4NA 3GM1A 4J7YA 4FESA 2YWAA 3RQFA 1D1CA 4JVSA 3RVYA 4D4XA 1DOVA 4E17A 2CCYA 3EH1A 4U5HA 3ECSA 3ZWIA 2XLVA 1J8YF 2LD6A 2VH3A 1S05A 2Y3HA 2IM8A 3AQCA 1NZEA 3W8HA 2H7BA 2A1DD 5JS5A 1GM5A 2AWYA 4H54A 2PFDA 2OQMA 4R32A 1LVKA 1T01A 4IRUA 1V74B 2LQGA 3DXJF 4WABA 1XZPA 2D5RB 2NUTB 4CBEA 2KC3A 3B0PA 1WTYA 3IEEA 1TQGA 2XL6A 4XPWA 2A69F 5DQTA 2ZXWC 4CX9A 5B3IA 3W4YA 5COGA 5KYXA 1ZHWA 2QY9A 2YLDA 4LLEA 5TJ5E 1TKNA 2YEVA 1CGME 5F5FA 4AK9A 3DZAA 3N24A 4O79A 3V5ZA 4F4BA 2I8BA 1H9TA 3G4ZA 3A9CA 1EKYA 1FR0A 3SXKA 3V7OA 3JTLO 3T6JA 3UNGC 3ZTMA 3ZSUA 4WGZA 4BPMA 2BC5A 3K1IC 1E2XA 3J06A 3T6GB 1ZU4A 3L8IA 3Q6MA 3AG2C 2ETSA 4FAPB 2XXAB 4C7OA 1OR2A 1QKRA 3NMJA 2WVNA 2L6GA 4BJTA 3CQZA 1OQCA 1T6UA 4ULVA 3WAQA 1Q0KA 2EPMX 3EGXB 5DS5A 3U5SA 1AEPA 3KH2A 4YT8A 3ITFA 2GWWA 2DYRC 3M15A 1JPNA 3ATPA 1A7EA 3VYWA 2A6EF 4WGYA 4XPXA 3AG3C 1ZZPA 4ANJA 1Q0GA 1K04A 1LS1A 3B9QA 5JRAA 4XLPF 1WASA 4Q7CA 1D0XA 2NUPA 3F46A 1OW6A 3HKKA 4K7BA 3I4UA 5COFA 4JURI 4KC9A 5E3AA 1APCA 3JRTA 1TWAA 4E7SA 4YWQA 2PX3A 4YN0B 3TJ5A 3HNLA 4B6IA 5L3QA 1WN0A 5B1BC 1RKEB 3DJUB 2H8AA 1SYQA 3IPMO 3FDQA 4DOZA 2R7OA 3TULA 4KNWA 2HZ8A 2DI3A 2HUJA 1KU2A 2ZPAA 3I5QA 2IXNA 2PX0A 1XZQA 2G3VA 4PJNA 3S28A 2L6HA 3S27A 2AU5A 2Y39A 1O87A 4JTCB 3ZTZA 5HSWA 3G4XA 2YL1A 2WZFA 3VRCA 3C8GB 2HMQA 4JZAA 3EFOA 3B29A 3FVYA 2J9WA 1HY5A 3N0TA 4I3MA 5B1AC 5BQHA 4PK4A 3FAPB 5DS6A 2W45A 1ZVZA 4DXWA 3GEIA 2QTVA 1VTMP 2R7TA 2J0WA 3LS0A 4DRHB 3EZIA 2P61A 3Q7LA 2GAQA 2RD9A 3AOUA 3LAYA 4G78A 4MTOA 1QPUA 5JLIA 1Z6AA 5JUAA 4XTKA 4FX5A 1JRAA 1YLMA 1ZHZA 3NRHA 3KYJA 2YVKA 3OEOA 4JJGA 3CEXA 4NTBA 3L1MA 3TD7A 3LLIA 4CDYA 3QW1A 2R25A 2UUHA 1K40A 1M56C 3DE9A 3QVYA 4MVSA 4MVRA 2J9VA 2MYSA 4DVYP 1J8MF 1T9KA 5DS4A 4CIHA 4YK5A 1HW1A 1IW7F 5K0IA 4BEMJ 4C3BA 1W2WA 5L0DA 3SXYA 1A7DA 1ST6A 1YA9A 2AP3A 2C03A 2CDQA 2CGEA 2R7QA 4U5EE 3ZIBA 1M6TA 1V4AA 1YDIA 2QUPA 3IHUA 1OCZC 2L9JA 3NMIA 4LLCA 3SXMA 3T4RA 2HMZA 4PFPA 4ULWA 5F5HA 4O6YA 1ZHTA 5EGYA 4U5CE 2LIGA 1I5NA 1FNTc 4OIQF 4J30B 1XWJA 4MQ9F 2YL7A 4NQFA 3QW0A 4U9DA 4WJ0A 1ZU5A 3U9JA 4EBKA 2A68F 3X2QC 1YA7O 3EZHA 4E7ZA 5A6JA 2P1AA 3MYFA 4HFFB 2L81A 1V55C 2X0CA 2WZGA 4HE8D 2LCHA 3W2VA 3AGUA 3AJMA 4H4KC 4NTFA 2TMVP 3RKOF 1JAFA 1G4US 2EIMC 2GA0A 2L6FA 4YT2A 1GQAA 2QLAA 2FGYA 4Z9JA 4NCQA 3S9OA 3UGOA 256BA 3EGDB 4GYTA 1I4ZA 4U9EA 3SNHA 4DVZA 5A6BD 1ZHYA 2HS5A 1A41A 3A11A 3O55A 5A6AA 1A7VA 4JEBA 3NMKA 3QZCA 4E0HA 3DAFA 4JRZA 3V5XA 3T6BA 5CI8A 4PJMA 1LS4A 2H7VC 2Q9CA 2EIKC 2NPUA 3UMIA 2IYLD 2P7VA 4CS7A 1H7IA 5CIVA 1PCXA 2XLOA 2XLDA 4LDQA 2W4MA 1LM3B 2BL2A 2Q7RA 1CGOA 2ZXPA 2OEXA 4OD4A 2R7XA 2EPLX 1VOMA 2L7AA 1CGNA 2FAPB 2P0NA 3VF0A 3DM5A 4C3EA 5A69A 3U3FA 4L6RA 1NU7D 2QNLA 2QE9A 2EINC 2YKZA 3LJBA 3H65A 4JCHA 1S7ZA 2R7VA 2W9YA 2XS1A 3GM2A 3RQGA 1PD0A 1NFNA 2R03A 1OCOC 3K1HA 1NFOA 3OWTA 5E2QA 5F28E 4CS8A 2RSEB 1QSPA 2ZXOA 3HNJA 3QTHA 4P6IC 1LIHA 2Z15A 3LESA 4A2NB 5EHHA 3N2ZB 3WODF 4Q5SF 4JTAB 3ZVRA 2PF4E 2IXPA 4CS9A 1VLTA 4G7OF 1NBBA 1NG1A 1EI7A 3JCUQ 3JSEO 4MVUA 4CS8C 3UR3C 2UUIA 3FOOA 1M2VB 3L0IA 3K33A 3R2PA 1DOWA 2OKUA 4CDAA 2LFDA 2GFHA 4M63A 1Q0MA 4N6HA 1RCPA 1GGQA 2MWQA 3ABKC 2OJQA 3U3BA 1OXBA 1T5OA 2Y3DA 5AGFA 2NSGA 2OEVA 3CSKA 2KSFA 3CZ6A 3G50A 4IJJA 1B68A 4W8PA 1RMVA 2OJED 2YQYA 3HLZA 1CPRA 2HFIA 1OW7A 3JYHA 5T1DB 1AUEA 3ZC4A 4DBQA 3U2LA 1WWPA 4DJ9A 4AL0A 4I44A 5L0IA 3K1IA 2B0JA 4DBRA 3SYNA 2KQ9A 5L0HA 2CW0F 2XS8A 1MMAA 2NG1A 4XEKA 5DQZA 3BRJA 5E33A 5A6BA 3IQ5A 3GM3A 2JX0A 2A0UA 2OOCA 4EBJA 2R7SA 5COMA 3ZG1A 3MYIA 4CIPA 2NSFA 3U8PA 4UDVA 1RJ9A 4IGGA 3LUTB 2KK1A 3NYLA 4EUKB 4ZLDA 2EILC 2P6VA 2R7WA 3H2UA 2XLMA 3SP1A 3TJ6A 1MMNA 4U5GA 3FMSA 1NLXA 4KBLA 5L0CA 2DYSC 2EIJC 4BG0A 3EHMA 3POVA 1Z63A 3SEOA 2WVOA 3U9MA 5DVWA 3OA1A 2IBFA 4G0HA 1M2OA 3MX3A 4FWVA 4O7GA 4CDVA 4EKWA 2J8WA 5BUOA 1GS9A 1KNYA 1C17M 1K05A 3MBGA 1BR2A 4O6MA 5L0GA 3ASOC 1QVXA 3C18A 3UMKA 4AE4B 3JT1A 2YL0A 4EHPA 3S0XA 2VASA 3C8GD 3LLKA 4MNDA 4IWBA 2XLHA 5BQIA 2E87A 1M57C 1QQ3A 2PNOA 1ZW3A 3L34A 2Y3BA 3RVZA 2EPOA 5E3CA 3B0VC 1TWHA 2Q9BA 4J32B 1L3PA 2C04A 2WVQA 1OCRC 1NU9C 3L8JA 2I15A 1LE2A 1MMGA 1ZHXA 1D0ZA 1LI7A 1OCCC 2WL8A 2FFHA 5IY5C 3DKAA 5AC5A 2DGJA 5L3VA 1JOGA 3O6XA 1CPQA 5D92A 2XXAA 3E70C 3NKEA 3FOPA 3ZQYA 1RKCA 2V26A 4OIPF 3M1CB 2J9UA 2G62A 1AVOB 3FAJA 1E86A 1TWGA 1YYXA 1E83A 2ZD9A 1ZW2A 1BR4A 2WZLA 3CAXA 1ORSC 3EGXA 3GEHA 2HKVA 4OIRF 4GEHA 3U0CA 1Z3IX 3AQBA 3DMDA 1VYIA 3X1OA 2GDCA 1D1BA 1QLEC 3JRMO 1C03A 1LPEA 3HNKA 2PBEA 4LERA 4MW8A 4OD5A 4XWJA 4MVOA 1SMYF 4XEFA 1MQVA 3TQOA 3DWWA 3ZQVA 5JVEA 3KKBA 1HE9A 2MHRA 1U89A 1FMVA 2A0BA 3ABLC 1N1CA 2XM4A 2IXMA 1NSGB 2Q00A 3GANA 1PD1A 4MVQA 4QI0A 2J9BA 2W4BA 4IARA 1JMWA 2VC9A 4YL1A 2J45A 4EBBA 2R7UA 2OG2A 4U5DE 3RYLA 1TWCA 3LS1A 1SF8A 2AWCA 1SR2A 1LE4A 4LACB 4U5FE 1Q0FA 5T3TA 1KTMA 1WATA 1QZXA 2XSEA 4C7OB 3NYJA 1YZCA 1IZMA 3EJNA 1OW8A 2KYHA 4N06A 4NC3A 3GODA 3Q7GA 4G7ZF 4E18A 4KI2A 2HJ3A 4I1OB 1T6QA 2KW3C 4JW1A 5KYYA 4MS2A 1EQ1A 4J7TA 3NYMA 1A0BA 1O3UA 1OR3A 3DE8A 4LDRA 2EPNA 4RDAA 3LNRA 4IAOA 2Y69C 2WB7A 1SZIA 3VM6A 3UMHA 3EH2A 2HSBA 1I4YA 5L0JA
chains in the Genus database with same CATH topology
2KC3A 1NFNA 1OR2A 3R2PA 1NFOA 3S84A 1AEPA 1B68A 1LPEA 1YA9A 1LS4A 1EA8A 1EQ1A 1BZ4A 1LE2A 1LE4A 1GS9A 1H7IA 1OR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KC3 A;  1NFN A;  1OR2 A;  3R2P A;  1NFO A;  3S84 A;  1AEP A;  1B68 A;  1LPE A;  1YA9 A;  1LS4 A;  1EA8 A;  1EQ1 A;  1BZ4 A;  1LE2 A;  1LE4 A;  1GS9 A;  1H7I A;  1OR3 A; 
#chains in the Genus database with same CATH topology
 3IQ6 A;  4YT5 A;  1E84 A;  4YL0 A;  1UFB A;  3IQT A;  3PHF 2;  2V3C C;  4DRI B;  1TR2 A;  2NUP B;  1O5H A;  4LDK A;  4NY3 A;  2M64 A;  3QVZ A;  5JSL A;  2VCB A;  4CJO A;  3GWL A;  1FTS A;  1FFT C;  1ZYR F;  1R5I D;  1YAR O;  1TFO B;  3K66 A;  3LEO A;  3GEE A;  4MW3 A;  1FFH A;  1RKE A;  2M4E A;  3S29 A;  2OU6 A;  4KNV A;  4XQ1 A;  2KGO A;  1Z5Z A;  1HW2 A;  2CNW A;  5KYW B;  2LK4 A;  3K7D A;  1D0Y A;  4JKV A;  4NTA A;  1LKX A;  2XM0 A;  4P9F A;  1F1M A;  4AL1 A;  4AX2 A;  1BR1 A;  2HV7 A;  1G4W R;  2LP4 A;  1Z7Q c;  1VYK A;  3U8V A;  2VCA A;  4K1O A;  4PFO A;  3RH3 A;  4AE4 A;  1ORY A;  1Y4C A;  5AC4 A;  3GOR A;  4PJJ A;  4XPY A;  4YJW A;  3ABM C;  2ASR A;  3W8I A;  1YVI A;  3EG9 B;  4GQH A;  1MND A;  2J7P D;  2JPU A;  5KYU A;  4E0I A;  5L0F A;  3EHN A;  3M79 A;  4YT4 A;  4MVM A;  2VB6 A;  3EGD A;  1WGW A;  1MMD A;  3DM9 B;  4JE9 A;  3EQL F;  1EA8 A;  2B0H A;  3AG1 C;  3C62 A;  1C02 A;  3PCV A;  5FZT A;  4EWC A;  3FHD A;  3GWN A;  1D1A A;  3S84 A;  3HTK C;  4MTF A;  2R7R A;  1HMO A;  3C63 A;  4JCZ A;  2BE5 F;  3FXH A;  3R7C A;  4X0R A;  2NUT A;  4IAQ A;  3TK0 A;  3RW0 A;  3RIP A;  4BJ1 A;  1OKK D;  4K0D A;  1HMD A;  1OKK A;  2IXO A;  3ZDL A;  1HE1 A;  4Z9H A;  3AGT A;  5A6K A;  1E85 A;  5KYX B;  3SXZ A;  4G7H F;  3HJC A;  2PP4 A;  4PAC A;  4MTG A;  3W2W A;  4PR9 A;  5CI9 A;  1G5Z A;  2YZS A;  1BDJ B;  1PV3 A;  2HJM A;  2R9R B;  3B71 A;  5EK0 A;  3C7J A;  3KMI A;  5JT4 A;  5HV9 A;  1TFK B;  2XLW A;  4W8K A;  4Z9I A;  4P9T A;  4BEJ A;  4ER9 A;  4BJ6 A;  1Y6D A;  1BBH A;  2J0X A;  4XLN F;  2J46 A;  1ORJ A;  4QDL A;  3I5P A;  4JTD B;  4N4W A;  2Q4F A;  3RQE A;  2LFF A;  4OIN F;  2AVK A;  3BEH A;  2XL8 A;  4C3D A;  2F22 A;  3ASN C;  2CYD A;  1BZ4 A;  4JIO A;  4A4A A;  3KL4 A;  3RFY A;  2R02 A;  1V54 C;  2X51 A;  3F47 A;  2YHS A;  1U0B B;  3WHN A;  5KYY B;  2DB4 A;  2CNW D;  4Q4Z F;  4CSA C;  5D91 A;  3JSZ A;  3KYI A;  2XRH A;  3DI5 A;  3SZR A;  4OIO F;  3O39 A;  3C8Z A;  4YL3 A;  4QI2 A;  1G8X A;  1YZA A;  1FAP B;  2O9X A;  5B3S C;  3TOL A;  2VCC A;  4U5B E;  2Q9A A;  2G3K A;  1VB5 A;  3JZ0 A;  3QMK A;  2OCC C;  3M4C A;  3Q6N A;  3M4B A;  4EIY A;  3O10 A;  1MNE A;  4I1M A;  3WG7 C;  2XL4 A;  2IOQ A;  1RXQ A;  3NG1 A;  4MVZ A;  1VLS A;  3K6B A;  3H2V A;  3NKD A;  1L7C A;  3E9V A;  3MFN A;  2Y3G A;  2YL3 A;  3NDB B;  1VMA A;  3US6 A;  1RJ9 B;  1U6H A;  1OXK A;  4RBN A;  3AG4 C;  4ONS A;  5BQG A;  5KYN A;  4JJF A;  2KJG A;  3IQC A;  1UG7 A;  1WOL A;  4BJ6 C;  4HEA J;  4CS9 C;  1VK5 A;  1M2V A;  2R05 A;  2XLE A;  5KYW A;  1JPJ A;  2H7O A;  1LI5 A;  2A6H F;  2YLG A;  2LSE A;  3C8G A;  3B0U X;  1H6G A;  3EFO B;  1H9G A;  3PMR A;  2D4U A;  4JEA A;  2EPK X;  4XEV A;  5FCL A;  1FMW A;  2HSQ A;  3LEV A;  3TOM A;  4RD9 A;  1Z23 A;  4N6C A;  3VAY A;  4BJ5 A;  1JR8 A;  1YJG A;  4CSA A;  3DD7 A;  3LNM B;  4ZLC A;  1T6I A;  2J7P A;  3HNI A;  3UGP A;  2Q3T A;  3MLG A;  5JP7 A;  1YYJ A;  1R4T A;  2YLI A;  5GPG B;  2YRF A;  3RF3 A;  2ZXR A;  4JC7 A;  3T9O A;  4IB4 A;  4DRJ B;  3DAG A;  2JD3 A;  2ICW G;  3KPH A;  3V5Y A;  4CJG A;  3S90 A;  1Q0D A;  3EPV A;  4O6N A;  4PJL A;  3U2M A;  3JYY A;  2HV6 A;  4BJ5 C;  5DLJ A;  2KNH A;  1YAU O;  4HFK B;  3DJN B;  3PDM P;  3EG9 A;  5KYU B;  5T3W A;  4D4N A;  3GM1 A;  4J7Y A;  4FES A;  2YWA A;  3RQF A;  1D1C A;  4JVS A;  3RVY A;  4D4X A;  1DOV A;  4E17 A;  2CCY A;  3EH1 A;  4U5H A;  3ECS A;  3ZWI A;  2XLV A;  1J8Y F;  2LD6 A;  2VH3 A;  1S05 A;  2Y3H A;  2IM8 A;  3AQC A;  1NZE A;  3W8H A;  2H7B A;  2A1D D;  5JS5 A;  1GM5 A;  2AWY A;  4H54 A;  2PFD A;  2OQM A;  4R32 A;  1LVK A;  1T01 A;  4IRU A;  1V74 B;  2LQG A;  3DXJ F;  4WAB A;  1XZP A;  2D5R B;  2NUT B;  4CBE A;  2KC3 A;  3B0P A;  1WTY A;  3IEE A;  1TQG A;  2XL6 A;  4XPW A;  2A69 F;  5DQT A;  2ZXW C;  4CX9 A;  5B3I A;  3W4Y A;  5COG A;  5KYX A;  1ZHW A;  2QY9 A;  2YLD A;  4LLE A;  5TJ5 E;  1TKN A;  2YEV A;  1CGM E;  5F5F A;  4AK9 A;  3DZA A;  3N24 A;  4O79 A;  3V5Z A;  4F4B A;  2I8B A;  1H9T A;  3G4Z A;  3A9C A;  1EKY A;  1FR0 A;  3SXK A;  3V7O A;  3JTL O;  3T6J A;  3UNG C;  3ZTM A;  3ZSU A;  4WGZ A;  4BPM A;  2BC5 A;  3K1I C;  1E2X A;  3J06 A;  3T6G B;  1ZU4 A;  3L8I A;  3Q6M A;  3AG2 C;  2ETS A;  4FAP B;  2XXA B;  4C7O A;  1OR2 A;  1QKR A;  3NMJ A;  2WVN A;  2L6G A;  4BJT A;  3CQZ A;  1OQC A;  1T6U A;  4ULV A;  3WAQ A;  1Q0K A;  2EPM X;  3EGX B;  5DS5 A;  3U5S A;  1AEP A;  3KH2 A;  4YT8 A;  3ITF A;  2GWW A;  2DYR C;  3M15 A;  1JPN A;  3ATP A;  1A7E A;  3VYW A;  2A6E F;  4WGY A;  4XPX A;  3AG3 C;  1ZZP A;  4ANJ A;  1Q0G A;  1K04 A;  1LS1 A;  3B9Q A;  5JRA A;  4XLP F;  1WAS A;  4Q7C A;  1D0X A;  2NUP A;  3F46 A;  1OW6 A;  3HKK A;  4K7B A;  3I4U A;  5COF A;  4JUR I;  4KC9 A;  5E3A A;  1APC A;  3JRT A;  1TWA A;  4E7S A;  4YWQ A;  2PX3 A;  4YN0 B;  3TJ5 A;  3HNL A;  4B6I A;  5L3Q A;  1WN0 A;  5B1B C;  1RKE B;  3DJU B;  2H8A A;  1SYQ A;  3IPM O;  3FDQ A;  4DOZ A;  2R7O A;  3TUL A;  4KNW A;  2HZ8 A;  2DI3 A;  2HUJ A;  1KU2 A;  2ZPA A;  3I5Q A;  2IXN A;  2PX0 A;  1XZQ A;  2G3V A;  4PJN A;  3S28 A;  2L6H A;  3S27 A;  2AU5 A;  2Y39 A;  1O87 A;  4JTC B;  3ZTZ A;  5HSW A;  3G4X A;  2YL1 A;  2WZF A;  3VRC A;  3C8G B;  2HMQ A;  4JZA A;  3EFO A;  3B29 A;  3FVY A;  2J9W A;  1HY5 A;  3N0T A;  4I3M A;  5B1A C;  5BQH A;  4PK4 A;  3FAP B;  5DS6 A;  2W45 A;  1ZVZ A;  4DXW A;  3GEI A;  2QTV A;  1VTM P;  2R7T A;  2J0W A;  3LS0 A;  4DRH B;  3EZI A;  2P61 A;  3Q7L A;  2GAQ A;  2RD9 A;  3AOU A;  3LAY A;  4G78 A;  4MTO A;  1QPU A;  5JLI A;  1Z6A A;  5JUA A;  4XTK A;  4FX5 A;  1JRA A;  1YLM A;  1ZHZ A;  3NRH A;  3KYJ A;  2YVK A;  3OEO A;  4JJG A;  3CEX A;  4NTB A;  3L1M A;  3TD7 A;  3LLI A;  4CDY A;  3QW1 A;  2R25 A;  2UUH A;  1K40 A;  1M56 C;  3DE9 A;  3QVY A;  4MVS A;  4MVR A;  2J9V A;  2MYS A;  4DVY P;  1J8M F;  1T9K A;  5DS4 A;  4CIH A;  4YK5 A;  1HW1 A;  1IW7 F;  5K0I A;  4BEM J;  4C3B A;  1W2W A;  5L0D A;  3SXY A;  1A7D A;  1ST6 A;  1YA9 A;  2AP3 A;  2C03 A;  2CDQ A;  2CGE A;  2R7Q A;  4U5E E;  3ZIB A;  1M6T A;  1V4A A;  1YDI A;  2QUP A;  3IHU A;  1OCZ C;  2L9J A;  3NMI A;  4LLC A;  3SXM A;  3T4R A;  2HMZ A;  4PFP A;  4ULW A;  5F5H A;  4O6Y A;  1ZHT A;  5EGY A;  4U5C E;  2LIG A;  1I5N A;  1FNT c;  4OIQ F;  4J30 B;  1XWJ A;  4MQ9 F;  2YL7 A;  4NQF A;  3QW0 A;  4U9D A;  4WJ0 A;  1ZU5 A;  3U9J A;  4EBK A;  2A68 F;  3X2Q C;  1YA7 O;  3EZH A;  4E7Z A;  5A6J A;  2P1A A;  3MYF A;  4HFF B;  2L81 A;  1V55 C;  2X0C A;  2WZG A;  4HE8 D;  2LCH A;  3W2V A;  3AGU A;  3AJM A;  4H4K C;  4NTF A;  2TMV P;  3RKO F;  1JAF A;  1G4U S;  2EIM C;  2GA0 A;  2L6F A;  4YT2 A;  1GQA A;  2QLA A;  2FGY A;  4Z9J A;  4NCQ A;  3S9O A;  3UGO A;  256B A;  3EGD B;  4GYT A;  1I4Z A;  4U9E A;  3SNH A;  4DVZ A;  5A6B D;  1ZHY A;  2HS5 A;  1A41 A;  3A11 A;  3O55 A;  5A6A A;  1A7V A;  4JEB A;  3NMK A;  3QZC A;  4E0H A;  3DAF A;  4JRZ A;  3V5X A;  3T6B A;  5CI8 A;  4PJM A;  1LS4 A;  2H7V C;  2Q9C A;  2EIK C;  2NPU A;  3UMI A;  2IYL D;  2P7V A;  4CS7 A;  1H7I A;  5CIV A;  1PCX A;  2XLO A;  2XLD A;  4LDQ A;  2W4M A;  1LM3 B;  2BL2 A;  2Q7R A;  1CGO A;  2ZXP A;  2OEX A;  4OD4 A;  2R7X A;  2EPL X;  1VOM A;  2L7A A;  1CGN A;  2FAP B;  2P0N A;  3VF0 A;  3DM5 A;  4C3E A;  5A69 A;  3U3F A;  4L6R A;  1NU7 D;  2QNL A;  2QE9 A;  2EIN C;  2YKZ A;  3LJB A;  3H65 A;  4JCH A;  1S7Z A;  2R7V A;  2W9Y A;  2XS1 A;  3GM2 A;  3RQG A;  1PD0 A;  1NFN A;  2R03 A;  1OCO C;  3K1H A;  1NFO A;  3OWT A;  5E2Q A;  5F28 E;  4CS8 A;  2RSE B;  1QSP A;  2ZXO A;  3HNJ A;  3QTH A;  4P6I C;  1LIH A;  2Z15 A;  3LES A;  4A2N B;  5EHH A;  3N2Z B;  3WOD F;  4Q5S F;  4JTA B;  3ZVR A;  2PF4 E;  2IXP A;  4CS9 A;  1VLT A;  4G7O F;  1NBB A;  1NG1 A;  1EI7 A;  3JCU Q;  3JSE O;  4MVU A;  4CS8 C;  3UR3 C;  2UUI A;  3FOO A;  1M2V B;  3L0I A;  3K33 A;  3R2P A;  1DOW A;  2OKU A;  4CDA A;  2LFD A;  2GFH A;  4M63 A;  1Q0M A;  4N6H A;  1RCP A;  1GGQ A;  2MWQ A;  3ABK C;  2OJQ A;  3U3B A;  1OXB A;  1T5O A;  2Y3D A;  5AGF A;  2NSG A;  2OEV A;  3CSK A;  2KSF A;  3CZ6 A;  3G50 A;  4IJJ A;  1B68 A;  4W8P A;  1RMV A;  2OJE D;  2YQY A;  3HLZ A;  1CPR A;  2HFI A;  1OW7 A;  3JYH A;  5T1D B;  1AUE A;  3ZC4 A;  4DBQ A;  3U2L A;  1WWP A;  4DJ9 A;  4AL0 A;  4I44 A;  5L0I A;  3K1I A;  2B0J A;  4DBR A;  3SYN A;  2KQ9 A;  5L0H A;  2CW0 F;  2XS8 A;  1MMA A;  2NG1 A;  4XEK A;  5DQZ A;  3BRJ A;  5E33 A;  5A6B A;  3IQ5 A;  3GM3 A;  2JX0 A;  2A0U A;  2OOC A;  4EBJ A;  2R7S A;  5COM A;  3ZG1 A;  3MYI A;  4CIP A;  2NSF A;  3U8P A;  4UDV A;  1RJ9 A;  4IGG A;  3LUT B;  2KK1 A;  3NYL A;  4EUK B;  4ZLD A;  2EIL C;  2P6V A;  2R7W A;  3H2U A;  2XLM A;  3SP1 A;  3TJ6 A;  1MMN A;  4U5G A;  3FMS A;  1NLX A;  4KBL A;  5L0C A;  2DYS C;  2EIJ C;  4BG0 A;  3EHM A;  3POV A;  1Z63 A;  3SEO A;  2WVO A;  3U9M A;  5DVW A;  3OA1 A;  2IBF A;  4G0H A;  1M2O A;  3MX3 A;  4FWV A;  4O7G A;  4CDV A;  4EKW A;  2J8W A;  5BUO A;  1GS9 A;  1KNY A;  1C17 M;  1K05 A;  3MBG A;  1BR2 A;  4O6M A;  5L0G A;  3ASO C;  1QVX A;  3C18 A;  3UMK A;  4AE4 B;  3JT1 A;  2YL0 A;  4EHP A;  3S0X A;  2VAS A;  3C8G D;  3LLK A;  4MND A;  4IWB A;  2XLH A;  5BQI A;  2E87 A;  1M57 C;  1QQ3 A;  2PNO A;  1ZW3 A;  3L34 A;  2Y3B A;  3RVZ A;  2EPO A;  5E3C A;  3B0V C;  1TWH A;  2Q9B A;  4J32 B;  1L3P A;  2C04 A;  2WVQ A;  1OCR C;  1NU9 C;  3L8J A;  2I15 A;  1LE2 A;  1MMG A;  1ZHX A;  1D0Z A;  1LI7 A;  1OCC C;  2WL8 A;  2FFH A;  5IY5 C;  3DKA A;  5AC5 A;  2DGJ A;  5L3V A;  1JOG A;  3O6X A;  1CPQ A;  5D92 A;  2XXA A;  3E70 C;  3NKE A;  3FOP A;  3ZQY A;  1RKC A;  2V26 A;  4OIP F;  3M1C B;  2J9U A;  2G62 A;  1AVO B;  3FAJ A;  1E86 A;  1TWG A;  1YYX A;  1E83 A;  2ZD9 A;  1ZW2 A;  1BR4 A;  2WZL A;  3CAX A;  1ORS C;  3EGX A;  3GEH A;  2HKV A;  4OIR F;  4GEH A;  3U0C A;  1Z3I X;  3AQB A;  3DMD A;  1VYI A;  3X1O A;  2GDC A;  1D1B A;  1QLE C;  3JRM O;  1C03 A;  1LPE A;  3HNK A;  2PBE A;  4LER A;  4MW8 A;  4OD5 A;  4XWJ A;  4MVO A;  1SMY F;  4XEF A;  1MQV A;  3TQO A;  3DWW A;  3ZQV A;  5JVE A;  3KKB A;  1HE9 A;  2MHR A;  1U89 A;  1FMV A;  2A0B A;  3ABL C;  1N1C A;  2XM4 A;  2IXM A;  1NSG B;  2Q00 A;  3GAN A;  1PD1 A;  4MVQ A;  4QI0 A;  2J9B A;  2W4B A;  4IAR A;  1JMW A;  2VC9 A;  4YL1 A;  2J45 A;  4EBB A;  2R7U A;  2OG2 A;  4U5D E;  3RYL A;  1TWC A;  3LS1 A;  1SF8 A;  2AWC A;  1SR2 A;  1LE4 A;  4LAC B;  4U5F E;  1Q0F A;  5T3T A;  1KTM A;  1WAT A;  1QZX A;  2XSE A;  4C7O B;  3NYJ A;  1YZC A;  1IZM A;  3EJN A;  1OW8 A;  2KYH A;  4N06 A;  4NC3 A;  3GOD A;  3Q7G A;  4G7Z F;  4E18 A;  4KI2 A;  2HJ3 A;  4I1O B;  1T6Q A;  2KW3 C;  4JW1 A;  5KYY A;  4MS2 A;  1EQ1 A;  4J7T A;  3NYM A;  1A0B A;  1O3U A;  1OR3 A;  3DE8 A;  4LDR A;  2EPN A;  4RDA A;  3LNR A;  4IAO A;  2Y69 C;  2WB7 A;  1SZI A;  3VM6 A;  3UMH A;  3EH2 A;  2HSB A;  1I4Y A;  5L0J A; 
#chains in the Genus database with same CATH homology
 2KC3 A;  1NFN A;  1OR2 A;  3R2P A;  1NFO A;  3S84 A;  1AEP A;  1B68 A;  1LPE A;  1YA9 A;  1LS4 A;  1EA8 A;  1EQ1 A;  1BZ4 A;  1LE2 A;  1LE4 A;  1GS9 A;  1H7I A;  1OR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...