1AEYA

Alpha-spectrin src homology 3 domain, solution nmr, 15 structures
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
58
structure length
58
Chain Sequence
GKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-SPECTRIN
publication title 1H and 15N NMR assignment and solution structure of the SH3 domain of spectrin: comparison of unrefined and refined structure sets with the crystal structure.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cytoskeleton
total genus 13
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 1997-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1aeyA00
3EGUA 1X6GA 1UHCA 2FRWA 3SHWA 1VYTA 3M0PA 4GBQA 2LMJA 4OMOA 1WLPB 2FPDA 2DA9A 2YUQA 1X2KA 4Z8AA 1WXUA 1T3LA 4F14A 3TVTA 1AEYA 1T3SA 1GCQC 2B86A 3EG2A 4JZ4A 3KFVA 1UTIA 3UF4A 3QWXX 2D8JA 1G2BA 1SRMA 3RNJA 2LP5A 2YDLA 1V1CA 1KFZA 2A08A 2KBTA 1HSQA 2J6KA 1JQQA 2L3QA 1WYXA 5IHIA 2BZ8A 2FG0A 1GFCA 3I35A 1H92A 1NEGA 1MV3A 2AKKA 3H0HA 5GJWB 3H0FA 3A98A 4LNPA 4RTZA 4JPBW 1QCFA 2ROLA 2LQWA 2DMOA 2L3SA 4LE9A 1OV3A 2DL5A 4AFQC 2BZYA 1YWOA 2RNAA 3QWYA 1AWJA 2L2PA 1Z9QA 2HSPA 4D8KA 1YWPA 4FSSA 1UJYA 4D8DA 1I0CA 1LCKA 2D0NA 2EBPA 4J9FA 4KRTA 1Y0MA 4RTVA 2ENMA 2LX7A 1AWXA 1B07A 1WX6A 1GCQA 4ORZA 4LUDA 1QKXA 4Y92A 4AG1C 2KE9A 1Y57A 3SEMA 2KGTA 1GRIA 5IHKA 1KJWA 3THKA 1SHFA 3TSWA 1J3TA 1AD5A 2DL4A 1MV0B 1JXOA 2FPFA 1PKSA 1RLQC 1PHTA 2C0IA 3VRZA 3REAB 4Z88A 2RQTA 1ZUYA 1NM7A 4OMMA 2NUZA 2A37A 1EFNA 3R6NA 3PVLA 2DX1A 5GJVB 3TSZA 1K1ZA 1H8KA 3ZL7C 1WIEA 4E6RA 2EYYA 2CH4A 2J05A 4A63B 1UE9A 4AG2C 5L23A 2AKLA 3O5ZA 2JMCA 2ECZA 3JV3A 2AZVA 2KT8A 4OMQA 1I07A 1QWFA 4OMLA 1U3OA 2F2VA 4R0KA 3NPFA 2BZXA 4DEYA 2LJ0A 2XMFA 4RTWA 1K4US 1W70A 1QWEA 1X69A 1TUDA 1WFWA 5IXFA 3EG3A 2VKNA 2YUOA 2VWFA 3FJ5A 3EHQA 2RQRA 2DE0X 2EYZA 1I1JA 3VS3A 2K6DA 1W1FA 4J9EA 2JM8A 4CC3A 1CSKA 3PE0A 4J9BA 3REBB 3VS4A 5I22A 2X3WD 1ZLMA 3ULRB 2J6OA 2EKHA 4JJCA 2O9VA 3U23A 1NEBA 3VS2A 1SRLA 2EGAA 3M0TA 2DILA 4J9HA 1ZUUA 1G83A 3NMZC 1ZUKA 2C0OA 2BTTA 1KIKA 2DL8A 2DRKA 4AFZC 1PWTA 1AOJA 5IXBA 2F2XA 1JEGA 1M27C 2EGCA 4OMPA 2CT3A 2V1RA 1BU1A 1AZGB 2FO0A 1B3QA 1JXMA 1WXTA 2J7IA 1VA7A 1JO8A 1YNZA 2JT4A 1AWOA 1NYGA 4DEXA 2DRMA 2DYBA 3UA7A 4HCKA 2KT1A 2SEMA 2X3XD 1UDLA 2LQNA 1OPLA 1M8MA 1U06A 2DBKA 2YT6A 1VYVA 4J9DA 2RPNA 2LZ6B 4JZ3A 1AWWA 2L3PA 1RUWA 2MCNA 1BBZA 4J9IA 1PKTA 4RTUA 1IO6A 2F2WA 4LUEA 1SEMA 3H41A 1X43A 4IIMA 3M0UA 5FW9A 1YCSB 2KXDA 4CC7A 5IHNA 2DNUA 2MIOA 1WXBA 2GTOA 2KNBB 1WI7A 2EW3A 2M51A 2DL3A 1M30A 2MOXA 2CREA 4J9GA 2CSQA 4RUGA 2DBMA 1OEBA 2RQUA 1QLYA 2FEIA 2JXBA 1X6BA 3M0RA 3VS0A 1UG1A 4J9CA 3VRYA 3VS1A 1SHGA 4CC4B 1ARKA 2PTKA 5ECAA 1M3CA 1BK2A 2QDLA 2SRCA 2CUDA 2KYBA 1ABQA 1N5ZA 1BB9A 1NLPC 1PNJA 1UHFA 4HXJA 1GCPA 2DLPA 2DL7A 2GBQA 1W6XA 2IIMA 5FWCA 1VYUA 4RTXA 4ZNXA 4ESRA 1AZEA 2JTEA 4CC2A 1UUEA 4M4ZA 3LH5A 2LCSA 3NHNA 4IIOA 1K0SA 3M0QA 2LJ1A 4HVUA 1CKAA 1NLOC 2VVKA 4OMNA 2K79A 2HDAA 1KSWA 1UJ0A 2PZ1A 2GQIA 3I9QA 1GBQA 1OPKA 4K11A 3EHRA 1A0NB 1T0JA 2V1QA 5HCKA 1QKWA 1U5SA 1WDXA 1M3BA 4RTTA 2YSQA 1HJDA 4RTYA 3C0CA 4HVWA 2YUPA 1E6HA 2KRSA 4HVVA 1H3HA 2DF6A 3H0IA 2KR3A 1PRMC 3NGPA 5IH2A 2A28A 2KROA 4AFUC 3VS7A 1UECA 2E5KA 2FRYA 1MUZA 4JJBA 3VS5A 5I11A 1E6GA 2CT4A 2DM1A 5EC7A 1UGVA 1K76A 2JS2A 1GL5A 4AFSC 1AVZC 1TG0A 1JU5C 1HD3A 2EQIA 1ZBJA 2L0AA 2OAWA 2O88A 4GLMA 2D1XA 2KEAA 2YUNA 1T0HA 4X1VA 3UA6A 2W10A 2LJ3A 1X27A 2PNIA 4JJDA 2KXCA 1E7OA 2ED1A 3GBQA 2EYXA 1Z9ZA 1K9AA 2A36A 4EIKA 2H8HA 1FYNA 2ROTA 1PRLC 2FPEA 3EG0A 1ABOA 2KRMA 1FMKA 1CKBA 2HCKA 4QT7A 2CH4W 2GTJA 2EGEA 1K0XA 2EVRA 2CUBA 1TUCA 2GNCA 2ESWA 1NYFA 3UATA 1UFFA 1RLPC 2W0ZA 2P4RA 4F17A 2K7AA 2D8HA 1GBRA 2RQVA 2OJ2A 2K9GA 2JW4A 1SPKA 3PVQA 4F16A 2I0NA 4Z89A 3CQTA 1YP5A 2DJQA 3M0SA 2RF0A 2LNHB 3EG1A 1X2QA 5FWBA 2AZSA 2JS0A 1NG2A 2HBWA 2ED0A 1RI9A 2O9SA 1ZX6A 3IQLA 2JM9A 2KYMA 3RBBB 2O2OA 2HEQA 2NWMA 2K3BA 1WA7A 2RMOA 2M0YA 4WCIA 2RQWA 2ABLA 2JMAA 2RN8A 2G6FX 2K2MA 2EPDA 3VS6A 1SSHA 1XOVA 1S1NA 2C0TA 3I5RA 2AK5A 1YN8A 3I5SA 2O31A 2OI3A 4LN2A 2J06A 2DVJA 1GFDA 1OOTA 2EYWA 1M3AA 2CSIA 2CDTA 1ZSGA 2J6FA 2KRNA 2GGRA
chains in the Genus database with same CATH superfamily
3RDVA 4C0DB 2CP0A 3BW1A 3SHWA 4N0AA 1WLPB 3JB9G 1K73U 5GAMf 3HKSA 3LGLA 2YUQA 1X2KA 4F14A 3EG2A 3CMEQ 3EG9A 3KFVA 5GAN8 1NPRA 1M1KU 4C0DC 1SRMA 4MZMA 2V8KA 3DLMA 3UWNA 1V1CA 2KBTA 3VUBA 4ELYC 1TS9A 2L3QA 5GANd 1GFCA 3I35A 3META 1YITQ 4J7FA 5HK0A 3V8KA 4KH1B 1QMCA 1KQSS 2AIRB 3OA6A 1YJWQ 5CKHA 5LJ5j 2BZYA 2RH2A 4FM4B 3S3OA 3CXCS 2EJ9A 1PD1A 4JRIA 4D8DA 2EBPA 4KRTA 4KULA 2PU9B 2HBPA 2ENMA 2VGNA 1KC8U 2K5LA 1NJIC 1B07A 2X4WA 3GLXA 5GMKj 1K9MC 2VC8A 3P8HA 4LUDA 1RAEB 1Q81R 3SD4A 3I55T 1KJWA 3THKA 3TSWA 2QTVA 1AD5A 2DL4A 3QZ5B 2FPFA 1PHTA 2C0IA 3VRZA 5J39A 4A4HA 2A37A 3CEYA 2YXYA 1ZA1B 3FC3A 3CC7T 4WF2A 3QYHB 1R77A 4C8QB 2WSCE 1I81A 2J05A 2EYQA 4AG2C 4C5IA 3LGFA 4M78F 2QQBA 1PSEA 2O4XA 2JMCA 4X9CA 2AZVA 2CP6A 5C0MA 4IUPA 4EMKA 5KYYA 4FT4A 1MNEA 3H9NA 4R0KA 3NPFA 3OB9A 3QJYA 4KBMB 2K5IA 5GAN2 3CCQQ 1QCOA 1IGQA 4M78A 4JRQA 1W70A 2VXEA 3GPLA 4C8QC 1YBYA 2DIQA 3EG3A 1G3SA 1WPYA 2DERA 3FJ5A 3MEAA 5DY9A 1VQ7Q 2QTXA 2RQRA 3L2RA 2DE0X 1BI3A 3KXTA 2K6DA 2D0QB 3URGA 3M53A 4M7AD 2PUOB 2JM8A 2CZ1B 2JZ2A 4J9EA 1H3ZA 4CC3A 2JNGA 4DQ2A 1VQMT 3U23A 4IUQA 4B9WA 2QQ9A 1SRLA 2V26A 1ZUUA 3NMZC 2BTTA 2DL8A 3OYFA 1RI0A 3I56Q 1AOJA 5GAN3 3CC2Q 3GOXA 2MK5A 1WQ7A 4HCZA 2MYSA 3EFRA 2J7IA 1YNZA 4DEXA 1VQ8T 2DRMA 2DYBA 4MDWA 3EFOB 1RAIB 4M75E 4HCKA 2FVUA 4J7IA 2KT1A 3M59A 3HPWA 2DEQA 1ZSZB 1OPLA 1TUGB 2YT6A 2DKGA 1VYVA 2RPNA 3LYIA 4XU1A 2DD4A 3QBYA 3G4SA 5CIUA 3G71T 1BBZA 1TSFA 4J9IA 4ZN1A 3CCRA 2VB6A 1YJNQ 2F2WA 4DBFA 1SEMA 1X43A 3M0UA 5GAOl 3JRZA 2DD5A 1VQ5A 3OSSC 4FW2A 3M5AA 1ZSZC 4PNOA 2QEXT 4QQGA 4FYXB 2M51A 1Q86R 2CREA 5GAN7 4HT9A 2DBMA 1OEBA 2ZPIB 4DBQA 2F69A 3I55Q 2I2LA 1VQPA 3VS0A 2VYTA 4J9CA 3CCMT 4M77B 2RJEA 6AT1B 4UC4A 4XQ3A 2F1LA 2E41A 3CC7Q 3JAME 1VQLT 2CZ7B 2K57A 2EAYA 1UHFA 2R5AA 3JCMV 1VYUA 1RAAB 2RJFA 3MHXA 1HYOA 1N27A 1LOJA 4M77C 1IREB 4IIOA 5LJ5d 4II1A 2DTHA 3BE3A 1D0YA 3LX7A 3NTKA 2K79A 1KQSP 1UJ0A 2DPPB 2DXBA 3G7ZA 3I9QA 1GBQA 4C92F 3QKJA 4RKUE 3EHRA 1T0JA 3HTRA 3CXCP 2KQWA 2XKOC 1YI2A 3SWNB 1WDXA 4C5HA 5IAYA 3ZFJA 2YSQA 3OW2S 4HVWA 2YUPA 3CPWS 4HVVA 1VQMQ 4C92A 2DF6A 2ZCFB 1OI1A 4AFUC 3JCMJ 4ELZC 1MUZA 3CCJA 3V8LA 5FRNA 3CCEA 3JCMb 1GL5A 2LCLA 1TG0A 3SWNC 2L0AA 2BE9B 2OAWA 2E64A 3A8MB 4DOVA 2KEAA 2YUNA 2OTLA 1T0HA 1O75A 1X27A 3CCUT 4M7DG 5C6SA 1VQ8Q 2E4HA 1E7OA 1K8AU 3GBQA 3L42A 4AT1B 4LD9K 4Y28E 2ZZDA 4EIKA 4A4EA 1HK9A 1PRLC 3QO3A 2XD0A 2YWWA 4XU0A 3G71Q 2VXFA 5CVIA 1TUCA 1KQ1A 2D9TA 2GNCA 1KD1R 1BI2A 4M75G 3EH2A 2BKDN 3JB9I 1YJ9Q 1XQHA 2QASA 2RQVA 4LDVA 4NS5A 5CCAA 5GAMg 1U1TA 5KYXB 3QHSA 2QEXQ 3MPUB 3JB9D 2I0NA 3CQTA 1YP5A 4LDWA 2M0OA 2AZSA 1VIFA 2JS0A 2NUPA 4HCCA 2ED0A 1M5Q1 1ZX6A 4F7UF 5I2SA 3OYGA 3A5ZB 2JM9A 4NL3A 2FHDA 1D3BB 3CCMQ 1Q86C 2K3BA 2RQWA 2BE7D 3CD6A 4F7UA 1VQLQ 1Q7YC 1SSHA 2NUTB 1S72T 2AK5A 2HL3A 2M16A 3HSBA 3L2QA 4XU3A 4ZN3A 4J83A 2J06A 1JJ2S 3CCVA 2DVJA 3P8DA 2M9UA 3MJXA 1OOTA 1VQ9Q 3OYBA 5LJ3f 2CDTA 2R58A 1Q82R 2KRNA 4RCBA 4PJOF 1X6GA 4PKCC 3LLRA 1VYTA 3G6ET 5GAMh 1BYMA 4OMOA 4MZPA 2M02A 2DA9A 2MWOA 4Z8AA 2XDDA 3OYHA 1WXUA 4PJOA 4M7AB 1T3SA 2FL7A 2JUFA 5CK9A 1N9SA 1UTIA 2RJDA 2D8JA 2XI9A 4OP0A 4PK4A 2QQSA 3DLLA 1B34A 4DOWA 1Y96A 3CC4T 3QYGB 2JVVA 3OMGA 4M75B 1KFZA 1M8VA 2J6KA 3OYDA 1N8RR 4M7AC 1JQQA 3EGDA 5IHIA 1H92A 1MV3A 1V29B 3GF5A 5GJWB 3RUXA 3H0FA 4R55A 4ZGDB 4RTZA 2QA4T 1QVPA 1F1BB 2P0PA 2ROLA 3A1PA 2LQWA 3CCUQ 2DL5A 5GMKm 1I5OB 4M75C 2IVWA 2AT1B 3LH0A 1TH7A 5I21A 3CCLQ 4FSSA 1UJYA 1W4SA 1I0CA 4RTVA 1PC0A 2LX7A 1AWXA 2XK0A 1IXDA 3QG1A 4P5NA 5GAOp 5KCHA 1KQSA 1EX4A 4Y92A 4AG1C 3GIBA 1NJIU 2XDPA 2KGTA 1GRIA 1K9MU 3CXCA 3FDRA 1SHFA 3PIPA 1J3TA 4QVDA 3RESA 1PKSA 1RLQC 4L59A 5D7UA 1ZUYA 1NM7A 1OU9A 2NUZA 3PVLA 1KD1C 2DX1A 1YHQT 4KT0E 3TSZA 2XHCA 1K1ZA 1UB4A 1WIEA 4E6RA 3OW2P 1FMVA 3CPWP 1UE9A 2CYZB 3O5ZA 1MMAA 1VQKA 3HP9A 2YRDA 1HXDA 4D6WA 2OAUA 1OU8A 3L2ZA 2DXTA 1PD0A 2LX9A 1YITA 2BZXA 2XMFA 4A4GA 3BDUA 1K4US 4BI3A 1QWEA 1X69A 1M90U 1WFWA 1PSFA 5IXFA 4FYVB 2YUOA 4OB0B 3KUFA 1WNLA 2RK1A 5DLOA 2P84A 2K2VA 1I1JA 1QP2A 2VV5A 3JCMX 1OX8A 1VQ4Q 1CSKA 3G6EQ 3VKIA 3ULRB 4JJCA 2O9VA 1NEBA 3M0TA 1Q82C 1WHHA 2HNIA 2MI6A 3OYCA 1KIKA 3CBPA 1VQ6Q 3OYIA 4AFZC 4MDXA 1M9SA 3BDLA 1PWTA 1JEGA 2RK2A 2R57A 4OMPA 4C8QF 4BACA 1BU1A 3CC4Q 2FO0A 4OVAA 1WXTA 1JXMA 3PMIA 2COZA 5KYNA 5J3BA 2X51A 2X3XD 2LQNA 1M8MA 1U06A 2DBKA 4C8QA 3V8JA 1AWWA 3E19A 2K3YA 3A8GB 5A0DA 2KDSA 3CCQA 3JCMW 1PCXA 5LL6S 1N8RC 1WZOA 1OYXA 4PFZA 1VQOT 1PKTA 4RTUA 2LQ8A 3QXEB 2LT4A 3WVDB 1VQ7A 3H41A 1TTHB 5FW9A 4JDSA 4BI8B 3CMAQ 2F5KA 5IHNA 1JJ2P 2DNUA 5CKFA 2RD1A 1WXBA 2GTOA 3EG9B 1YIJA 3J7AF 1WI7A 2EW3A 2QI2A 2DL3A 4DBRA 1QLYA 3E1SA 2XICA 2JXBA 3M0RA 1UG1A 2LNVA 1N9RA 4E7ZA 3I56A 1SHGA 3CC2A 1ARKA 1WHMA 2X4JA 4HT8A 1YHQQ 4B9XA 3JCMc 4GY5A 4IKFA 2YRCA 4N4GA 1G5VA 2KYBA 4LDUA 1ABQA 1Q81U 5GANf 3JCMg 2DL7A 2GBQA 2MMPA 1W6XA 1D1CA 2IIMA 2QYZA 4RTXA 5FWCA 1W2BS 2JTEA 5KYWB 3ME9A 3G4ST 3OYMA 2X4XA 3HFNA 1BIBA 4F04B 3M0QA 5GAMe 5D6YA 1ZSZA 2YLBA 1Y7XA 1QQJA 1VQ5T 1YJNA 2HDAA 2KSSA 4ANJA 4J6XA 4JJNK 1MNDA 2FZKB 2PZ1A 2DFUA 1OPKA 1A0NB 2PVOB 2V1QA 5HY6A 1D1BA 5HCKA 2L89A 1WHJA 2FZCB 2RI5A 3M57A 5FU6B 4M7DE 2Z0WA 1HJDA 4RTYA 4M75D 3JCMP 2CZ6B 1VQPT 1Q95G 2ATCB 2KRSA 3FJPA 3FEOA 4XTVA 3NGPA 4FYYB 2VUBA 4O6JA 2A28A 2KROA 3I55A 3VS7A 2FRYA 4M77F 1IHVA 3DB3A 5EC7A 3JCMh 1UGVA 2DK3A 2QQAA 1AVZC 3UT1A 4CRIA 5KYYB 1C0MA 3OW2A 2LRQA 3CPWA 2EQIA 3CC7A 5FU6C 2D1XA 3G1JA 2ZGWA 4M77A 4X1VA 3UA6A 2LJ3A 4JJDA 2KXCA 3WXMB 2MAMA 2ED1A 2MF2A 2E5QA 2EYXA 4AMCA 2DXCA 5M9OA 2FPEA 1KC8C 4QT7A 3MKDA 3MEUA 9ATCB 1IZ6A 1VQOQ 5LJ5h 5LJ3g 4KGZB 1NYFA 1VQNA 3UATA 1QW1A 2P4RA 4F17A 2PQWA 2OJ2A 2K9GA 2JW4A 5CKEA 4FSXA 1SPKA 1Q7YR 4F16A 2JOYA 3EFSA 4Z89A 4PJOE 4N4IA 3MEWA 4C0GA 3OS1A 1AT1B 4JS4A 2QDYB 3MEVA 4IUTA 5FWBA 4Q5WA 3HRUA 3FIFA 1NG2A 2HBWA 3CCJT 2GFAA 3IQLA 3CCET 3SWNA 4R56A 1UGRB 5AT1B 1IRXA 3X26B 1EZZB 2O2OA 1OZ2A 3L2VA 4WCIA 2M0YA 4LDYA 2ABLA 2RN8A 2ZPGB 2K2MA 4N4HA 3VS6A 2KI7A 1Q86U 1XOVA 3I5RA 4ME7A 3PT9A 2XG8D 2X9HA 4A4FA 1OZ3A 4PFOA 1VQ8A 1KHCA 4C92G 1M3AA 5LJ3h 5GAMj 2J6FA 3BFMA 4KUDK 4BE1A 2HKQB 1GXIE 2RM4A 1UHCA 3M0PA 1IGUA 2LMJA 2FPDA 3VYHB 3G71A 2EKOA 1VQ5Q 5KCOA 3L2UA 1JJ2A 1T3LA 2RHZA 3RMSA 3TVTA 4BUGA 1GCQC 1YJ9A 2B86A 3ER0A 4EPCA 2V8IA 3CCST 1M2VB 2QEXA 3SDZA 3TREA 3EAEA 4C0FA 2EWNA 2DJZA 2E6ZA 1VQPQ 1UGQB 3RNJA 3JCMf 2OX7A 2YDLA 5KYXA 1NPPA 2A08A 3RR6A 1HSQA 2NYSA 4KH0B 5IN1A 2KAFA 4BD3A 3S3MA 2GFUA 2KY9A 3CD6T 1WYXA 2FG0A 1ZHIA 2AKKA 4EMHA 3AHUA 1QCNA 3A98A 3OS2A 4A4KA 1D3BA 7AT1B 3CCVT 4JPBW 1QCFA 3C4SA 4FL6A 1JB0E 2DMOA 2L3SA 4LE9A 3X24B 4AFQC 1G3WA 4L5GA 1YWOA 3CPFA 2EQMA 2L2PA 1YWPA 1VQ9A 1LCKA 4J9FA 1LVKA 1X6OA 5LJ5f 1FXXA 4PJJA 1WX6A 2LCCA 1W2BP 4PFPA 1ZA2B 1QKXA 2KE9A 3QUIA 1XTDA 1Y57A 4F7UG 3SEMA 4FCYA 2YHTA 5DM7R 4M7AF 2E3HA 1MV0B 1U1SA 4O5VA 1YCYA 3REAB 2HD0A 2H3EB 2RB6A 4BDYA 4OMMA 1EFNA 3R6NA 2Y4XA 5IT9E 4FIBA 4M7AA 5GJVB 4BB7A 4LXCA 4BE2A 2V8JA 1VOMA 3ZL7C 1RACB 3CCJQ 2CH4A 1KD1U 1FWZA 4EMGA 5GAN6 4XK8E 4FYWB 2KMTA 4PJOG 2ECZA 2CZ0B 2KT8A 1BKBA 4OMQA 1QWFA 4OMLA 3D7SB 3V7SA 3OYLA 3MP1A 4DEYA 2LJ0A 3KBGA 4RTWA 1TUDA 3CCUA 2RI2A 1D0ZA 3MP8A 2D6FA 4E7IA 3EHQA 2ZPEB 3CCLA 4M7DB 1JBMA 3VS3A 2VASA 1RAFB 1M4ZA 1W1FA 1NBEB 3PE0A 4J9BA 3VS4A 2X3WD 3OSVA 1ZLMA 2XU8A 3H6ZA 2HMAA 2J6OA 4FW1A 2EKHA 2EJFA 4RCCA 5KYUB 5GAN5 2EGAA 2NUPB 2DILA 2RHIA 3J81E 1G83A 1ZUKA 2C06A 2XIDA 3GNGA 4J8OA 1WGSA 3CCSQ 4BY6B 4M7DC 2DTIA 4L6V5 1SSFA 3JCMe 1Q82U 2RHXA 3RIRA 1LPLA 1VUBA 3M54A 3OS5A 2F2XA 5GAOr 2A0FB 1VQKT 4X34A 2RHYA 1VA7A 3HHTB 1JO8A 4ZTFA 1NYGA 1AWOA 3SB2A 2OTJA 1BIAA 3VJPA 1MMNA 3UA7A 1YITT 2QK0A 1QP3A 1UDLA 2E70A 4ZGEB 4BY6C 2COYA 4J9DA 2LZ6B 3QJ6A 1EIFA 3M4YA 2L3PA 4M78E 5GANg 1RUWA 2MCNA 1G3TA 1M1GA 3A8OB 5LJ5e 1IO6A 5GAMd 1B7TA 4LUEA 2RJCA 1G8XA 4IIMA 1N8RU 1YCSB 1V76A 4CC7A 2KNBB 3T9NA 2G3RA 1WJSA 3GNFB 2MOXA 1M30A 3CMEA 1VQ4A 4J9GA 3G6EA 4RUGA 1B34B 5CO7A 3PNWC 2DVEA 2FEIA 4IURA 3S6WA 1X6BA 3EGXB 1P92A 3TCJA 3OYYA 4ZTJA 1VQ6A 1WHGA 4E2FB 3EH1A 3VS1A 4CC4B 2PTKA 4RMOA 1OQKA 2QDLA 2SRCA 3JB9J 1K73R 4Y91A 3CC4A 1KQ2A 4MMKA 5GMKl 1N5ZA 4JLIA 3GP8A 2K5FA 1NLPC 1M2OA 5GANh 2ZPFB 3PFSA 1GCPA 1S72Q 1H641 4ESRA 4ZNXA 1YJWA 1AZEA 5LJ3e 1UUEA 4M4ZA 3CCQT 3LH5A 2DZCA 3MCAB 3RKWA 3ZBDA 1M1KR 5AYFA 4HVUA 4XU2A 1NLOC 2VVKA 3V7CA 5FU7B 1UGPB 3RERA 1YIJT 2GQIA 1W2BA 4K11A 1QVGA 8AT1B 5KH6A 3CMAA 3HRTA 1QKWA 1R8OB 1U5SA 3M9QA 4C8QG 3C0CA 5GMKi 1FX7A 1E6HA 1LJOA 1H3HA 3JB9F 2EQKA 2E3IA 3I56T 3CC2T 5FU7C 2E5KA 1NZ9A 4JJBA 2EQJA 5I11A 4XAXB 1K76A 1KC8R 1JU5C 1HD3A 1ZBJA 1VQKQ 1YHQA 2O88A 4XTUA 1R0BG 5HK3A 4KGVB 3JSCA 2W10A 3LWIA 2PNIA 2QA4Q 2LC4A 4PLLA 4C5EA 2DO3A 2X35A 2RHUA 2PVGB 1Z9ZA 4QKUA 1QVFA 2A36A 1MGQA 2WSFE 2ROTA 3FRNA 3C95A 1ABOA 1MMDA 4PJNA 2KRMA 1FMKA 3PTAA 1YJNT 2YRVA 2HCKA 3OY9A 2CH4W 4BE0A 4C92D 2EGEA 1K0XA 2CUBA 5KYWA 3HFOA 3A8HB 5GAN4 2ESWA 3OBYA 2DIGA 3ASKA 1UFFA 1RLPC 1R0CB 2K7AA 3UPUA 2MWPA 1GBRA 3CBMA 1WHKA 4DA4A 4N0AC 2LTOA 5L8RE 4XTXA 4M78G 1RAGB 3PVQA 5KE2A 3VU3C 2DJQA 3M0SA 3QZ9B 4QVCA 4C92E 3EG1A 3LWHA 3MP6A 4QVZA 2HQHA 2DYIA 4J6WA 5A0LA 1RI9A 1ZQ1A 4JRPA 2E65A 3OS0A 2KYMA 3RBBB 2HEQA 4OF1A 2KK4A 3TU4K 2LVMA 4A53A 1NE8A 2DAQA 2YLCA 2E12A 2G6FX 4E7SA 5KE3A 1SG5A 1S1NA 4E7LA 1QVGS 3DB4A 5LJ3j 1YN8A 4OGCA 3CCRT 4RG2A 3O8VA 3I5SA 5D6XA 1Y71A 4M7DD 2NLUA 3EFOA 5A0GA 2JTFA 4BDZA 1GFDA 2EYWA 2HSEB 3H8ZA 1M90C 3TEEA 4IUVA 1TU0B 2M1HA 4PJLA 2CSIA 1K73C 1ZSGA 4LD6A 3EGUA 1VQNT 3E2UA 3F70A 2FRWA 4GBQA 5D6WA 3OBWA 1VQOA 2H3JA 5LJ5g 2AHJB 4M77G 1YIJQ 1AEYA 4PL6A 4VUBA 1M1KC 2FZGB 3S3NA 3J80E 4JZ4A 5GAOm 3UF4A 3SFMA 3QWXX 3AT1B 2RO0A 2HAXA 1G2BA 1ACMB 2HQXA 1QVFS 2O4XB 1N6AA 2LP5A 4EMKB 1G3YA 4M7AE 3QDFA 4TVRA 2Y4YA 2P0QA 2BZ8A 4M78B 3WVEB 1NEGA 1M1FA 3H0HA 4F7UE 1D09B 5CQYA 3FLGA 1TOVA 2EIFA 2CKKA 4LNPA 1AHJB 2HQEA 3OYAA 4GLKA 1OV3A 4OGEA 5FRMA 4PJOD 2RNAA 3QWYA 1AWJA 4EMKC 3ZEHA 1XJWB 4QW2A 1Z9QA 2HSPA 4PLIA 4D8KA 5A2QE 1UGSB 4OB1B 2D0NA 1Y0MA 4M78C 2EJGA 1YI2T 2F5TX 1GCQA 4ORZA 2COWA 1YJ9T 5GAOn 3LW5E 5IHKA 5GMKh 2X4YA 2HZYA 2O01E 1JXOA 1VQMA 4Z88A 2RQTA 3P8BB 3R6OA 2JJ9A 4J5YA 2DEUA 1DJ7B 1OX9A 3JCMd 1H8KA 2BIVA 2OTLT 4QQ6A 4JRKA 1PM3A 3OYKA 2EYYA 4NL2A 1M2VA 1I4K1 4A63B 3OYNA 5J26A 5GANe 5L23A 2AKLA 1OULA 3VUZA 1Q81C 2MPXC 4XTZA 1I8FA 3JV3A 3M58A 1I07A 3E9FA 5GAOq 1Q7YU 1X75C 1U3OA 2F2VA 2JN0A 1VIEA 4PJMA 3M56A 2CP2A 3G4SQ 2PVDB 2DETA 3CCRQ 2KVQG 1VQ9T 3JB9H 1Y07A 2VKNA 1O9SA 4IUUA 2HKNA 2VWFA 1ZBXA 3FB9A 1SKUB 4E7JA 1D0XA 2CP3A 2EYZA 2LT1A 2IPOB 1KG1A 4EDUA 3X25B 3E9GA 1VQNQ 3REBB 5I22A 1RADB 2QXFA 1LNXA 2LDMA 3VS2A 2FYKA 4J9HA 3QSUA 1KK7A 4E7HA 2C0OA 1K8AR 2DRKA 4B6MA 3QIIA 1X01A 2L8DA 3VV0A 5IXBA 4KUIA 2GCXA 3MO8A 3L2WA 3HRSA 1M27C 1SF9A 3CCMA 3OMCA 2EGCA 2CT3A 2V1RA 2DZ9A 4DBHA 1AZGB 1B3QA 2JT4A 5CKDA 1VQLA 3NTHA 3DKMA 2SEMA 2P4TA 4X9DA 5HKCA 4CI0C 1IHWA 4JZ3A 5LJ3d 2NUTA 4XTYA 3BY7A 4Z02A 3CCLT 2P0KA 4M7AG 4OB2B 2GQVA 2E1HA 1QVGP 1WQWA 4M7DF 2L3RA 2KXDA 4C92B 1IB8A 2A3LA 4HA8A 1YI2Q 5CAIA 2MIOA 2R5MA 4HCBA 3PMTA 4JS5A 1BCOA 2CSQA 4M7DA 3Q1JA 2CP7A 2RQUA 1RAHB 4WTOB 1D1AA 3X28B 1BCMA 2K4YA 4M75F 4C8QD 2E10A 3VRYA 3CCSA 1FMWA 3CCEQ 3QPHA 5KYUA 4C92C 4A54A 5ECAA 1M3CA 5GANj 1BK2A 2L5QA 2QAZA 4J6YA 2CUDA 2OTJT 2OTLQ 4M75A 2EFIA 2K3XA 1BB9A 1PNJA 1C1AA 2HL5C 2Y90A 4HXJA 2QGFB 1QVFP 2DLPA 3VYGA 3C12A 3INZA 4C8QE 4FT2A 1BI0A 2CP5A 4FU6A 5CR2A 4CC2A 1YFNA 2LCSA 3NHNA 2QGGA 1JRIA 2RA2A 2QQRA 1K0SA 2LJ1A 4E47A 4C0ZA 1CKAA 4OMNA 2CGHA 1RABB 2A7YA 1PG5B 3PIOA 1WJRA 1KSWA 2GF7A 1UEBA 3N5BB 2PUKB 1VQ4T 3CMET 5EG2A 8ATCB 2FB7A 1M3BA 4RTTA 4ATOA 3RKXA 3NTIA 3H0IA 2KR3A 1VQ6T 2LQKA 3JCMQ 1PRMC 5IH2A 4JUVA 4F7UB 4M78D 4QQDA 1C6VX 1UECA 4LDXA 4RG8A 2WSEE 3VS5A 1E6GA 2CT4A 2DM1A 2XDBA 2JS2A 3OYEA 3CD6Q 5DLQE 4AFSC 3QDRB 4OMFB 1KHIA 3EGXA 4GLMA 1U8RA 1K8AC 1RL2A 1NJIR 1YJWT 4YTLA 1MMGA 1WJQA 1K9MR 2B8AA 3X20B 3CCVQ 3OQ5A 3OYJA 1S72A 4OB3B 2IG0A 4C5GA 1K9AA 5CKBA 2BUDA 2H8HA 3A8LB 1FYNA 2DXUA 3EG0A 1TWBA 4PJOB 1CKBA 3C94A 5FLXE 2GTJA 2EVRA 4MZTA 2QG9B 2ZAEA 2WACA 3CMAT 5GMKe 4XTWA 3L1AA 3UDCA 2W0ZA 4HKEA 3RKYA 2D8HA 2JTMA 1Y96B 4ZGJB 4NOYA 3V7RA 4BI4A 4KGXB 5FROA 1BI1A 3PGGA 3RMQA 2RF0A 4PJOC 2DTOA 3EGDB 2LNHB 4JLGA 1WHLA 4M77D 1X2QA 4V2SA 4E7KA 5CQXA 2O9SA 1M90R 2ZPBB 2EQUA 4MMLA 5I2MA 1XNIA 2NWMA 2ZPHB 1WA7A 2RMOA 2JMAA 2EPDA 2E6NA 4M77E 2OTJQ 3TQ7P 2C0TA 3HL8A 2O31A 2OI3A 3CBOA 4LN2A 1MHNA 2CS7A 2QA4A 2VGMA 2RI3A 1VQ7T 3NFCA 3M55A 1TXQA 3M4GA 1I5LA 2GGRA
chains in the Genus database with same CATH topology
3EGUA 1X6GA 1UHCA 2FRWA 3SHWA 1VYTA 3M0PA 4GBQA 2LMJA 4OMOA 1WLPB 2FPDA 2DA9A 2YUQA 1X2KA 4Z8AA 1WXUA 1T3LA 4F14A 3TVTA 1AEYA 1T3SA 1GCQC 2B86A 3EG2A 4JZ4A 3KFVA 1UTIA 3UF4A 3QWXX 2D8JA 1G2BA 1SRMA 3RNJA 2LP5A 2YDLA 1V1CA 1KFZA 2A08A 2KBTA 1HSQA 2J6KA 1JQQA 2L3QA 1WYXA 5IHIA 2BZ8A 2FG0A 1GFCA 3I35A 1H92A 1NEGA 1MV3A 2AKKA 3H0HA 5GJWB 3H0FA 3A98A 4LNPA 4RTZA 4JPBW 1QCFA 2ROLA 2LQWA 2DMOA 2L3SA 4LE9A 1OV3A 2DL5A 4AFQC 2BZYA 1YWOA 2RNAA 3QWYA 1AWJA 2L2PA 1Z9QA 2HSPA 4D8KA 1YWPA 4FSSA 1UJYA 4D8DA 1I0CA 1LCKA 2D0NA 2EBPA 4J9FA 4KRTA 1Y0MA 4RTVA 2ENMA 2LX7A 1AWXA 1B07A 1WX6A 1GCQA 4ORZA 4LUDA 1QKXA 4Y92A 4AG1C 2KE9A 1Y57A 3SEMA 2KGTA 1GRIA 5IHKA 1KJWA 3THKA 1SHFA 3TSWA 1J3TA 1AD5A 2DL4A 1MV0B 1JXOA 2FPFA 1PKSA 1RLQC 1PHTA 2C0IA 3VRZA 3REAB 4Z88A 2RQTA 1ZUYA 1NM7A 4OMMA 2NUZA 2A37A 1EFNA 3R6NA 3PVLA 2DX1A 5GJVB 3TSZA 1K1ZA 1H8KA 3ZL7C 1WIEA 4E6RA 2EYYA 2CH4A 2J05A 4A63B 1UE9A 4AG2C 5L23A 2AKLA 3O5ZA 2JMCA 2ECZA 3JV3A 2AZVA 2KT8A 4OMQA 1I07A 1QWFA 4OMLA 1U3OA 2F2VA 4R0KA 3NPFA 2BZXA 4DEYA 2LJ0A 2XMFA 4RTWA 1K4US 1W70A 1QWEA 1X69A 1TUDA 1WFWA 5IXFA 3EG3A 2VKNA 2YUOA 2VWFA 3FJ5A 3EHQA 2RQRA 2DE0X 2EYZA 1I1JA 3VS3A 2K6DA 1W1FA 4J9EA 2JM8A 4CC3A 1CSKA 3PE0A 4J9BA 3REBB 3VS4A 5I22A 2X3WD 1ZLMA 3ULRB 2J6OA 2EKHA 4JJCA 2O9VA 3U23A 1NEBA 3VS2A 1SRLA 2EGAA 3M0TA 2DILA 4J9HA 1ZUUA 1G83A 3NMZC 1ZUKA 2C0OA 2BTTA 1KIKA 2DL8A 2DRKA 4AFZC 1PWTA 1AOJA 5IXBA 2F2XA 1JEGA 1M27C 2EGCA 4OMPA 2CT3A 2V1RA 1BU1A 1AZGB 2FO0A 1B3QA 1JXMA 1WXTA 2J7IA 1VA7A 1JO8A 1YNZA 2JT4A 1AWOA 1NYGA 4DEXA 2DRMA 2DYBA 3UA7A 4HCKA 2KT1A 2SEMA 2X3XD 1UDLA 2LQNA 1OPLA 1M8MA 1U06A 2DBKA 2YT6A 1VYVA 4J9DA 2RPNA 2LZ6B 4JZ3A 1AWWA 2L3PA 1RUWA 2MCNA 1BBZA 4J9IA 1PKTA 4RTUA 1IO6A 2F2WA 4LUEA 1SEMA 3H41A 1X43A 4IIMA 3M0UA 5FW9A 1YCSB 2KXDA 4CC7A 5IHNA 2DNUA 2MIOA 1WXBA 2GTOA 2KNBB 1WI7A 2EW3A 2M51A 2DL3A 1M30A 2MOXA 2CREA 4J9GA 2CSQA 4RUGA 2DBMA 1OEBA 2RQUA 1QLYA 2FEIA 2JXBA 1X6BA 3M0RA 3VS0A 1UG1A 4J9CA 3VRYA 3VS1A 1SHGA 4CC4B 1ARKA 2PTKA 5ECAA 1M3CA 1BK2A 2QDLA 2SRCA 2CUDA 2KYBA 1ABQA 1N5ZA 1BB9A 1NLPC 1PNJA 1UHFA 4HXJA 1GCPA 2DLPA 2DL7A 2GBQA 1W6XA 2IIMA 5FWCA 1VYUA 4RTXA 4ZNXA 4ESRA 1AZEA 2JTEA 4CC2A 1UUEA 4M4ZA 3LH5A 2LCSA 3NHNA 4IIOA 1K0SA 3M0QA 2LJ1A 4HVUA 1CKAA 1NLOC 2VVKA 4OMNA 2K79A 2HDAA 1KSWA 1UJ0A 2PZ1A 2GQIA 3I9QA 1GBQA 1OPKA 4K11A 3EHRA 1A0NB 1T0JA 2V1QA 5HCKA 1QKWA 1U5SA 1WDXA 1M3BA 4RTTA 2YSQA 1HJDA 4RTYA 3C0CA 4HVWA 2YUPA 1E6HA 2KRSA 4HVVA 1H3HA 2DF6A 3H0IA 2KR3A 1PRMC 3NGPA 5IH2A 2A28A 2KROA 4AFUC 3VS7A 1UECA 2E5KA 2FRYA 1MUZA 4JJBA 3VS5A 5I11A 1E6GA 2CT4A 2DM1A 5EC7A 1UGVA 1K76A 2JS2A 1GL5A 4AFSC 1AVZC 1TG0A 1JU5C 1HD3A 2EQIA 1ZBJA 2L0AA 2OAWA 2O88A 4GLMA 2D1XA 2KEAA 2YUNA 1T0HA 4X1VA 3UA6A 2W10A 2LJ3A 1X27A 2PNIA 4JJDA 2KXCA 1E7OA 2ED1A 3GBQA 2EYXA 1Z9ZA 1K9AA 2A36A 4EIKA 2H8HA 1FYNA 2ROTA 1PRLC 2FPEA 3EG0A 1ABOA 2KRMA 1FMKA 1CKBA 2HCKA 4QT7A 2CH4W 2GTJA 2EGEA 1K0XA 2EVRA 2CUBA 1TUCA 2GNCA 2ESWA 1NYFA 3UATA 1UFFA 1RLPC 2W0ZA 2P4RA 4F17A 2K7AA 2D8HA 1GBRA 2RQVA 2OJ2A 2K9GA 2JW4A 1SPKA 3PVQA 4F16A 2I0NA 4Z89A 3CQTA 1YP5A 2DJQA 3M0SA 2RF0A 2LNHB 3EG1A 1X2QA 5FWBA 2AZSA 2JS0A 1NG2A 2HBWA 2ED0A 1RI9A 2O9SA 1ZX6A 3IQLA 2JM9A 2KYMA 3RBBB 2O2OA 2HEQA 2NWMA 2K3BA 1WA7A 2RMOA 2M0YA 4WCIA 2RQWA 2ABLA 2JMAA 2RN8A 2G6FX 2K2MA 2EPDA 3VS6A 1SSHA 1XOVA 1S1NA 2C0TA 3I5RA 2AK5A 1YN8A 3I5SA 2O31A 2OI3A 4LN2A 2J06A 2DVJA 1GFDA 1OOTA 2EYWA 1M3AA 2CSIA 2CDTA 1ZSGA 2J6FA 2KRNA 2GGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EGU A;  1X6G A;  1UHC A;  2FRW A;  3SHW A;  1VYT A;  3M0P A;  4GBQ A;  2LMJ A;  4OMO A;  1WLP B;  2FPD A;  2DA9 A;  2YUQ A;  1X2K A;  4Z8A A;  1WXU A;  1T3L A;  4F14 A;  3TVT A;  1AEY A;  1T3S A;  1GCQ C;  2B86 A;  3EG2 A;  4JZ4 A;  3KFV A;  1UTI A;  3UF4 A;  3QWX X;  2D8J A;  1G2B A;  1SRM A;  3RNJ A;  2LP5 A;  2YDL A;  1V1C A;  1KFZ A;  2A08 A;  2KBT A;  1HSQ A;  2J6K A;  1JQQ A;  2L3Q A;  1WYX A;  5IHI A;  2BZ8 A;  2FG0 A;  1GFC A;  3I35 A;  1H92 A;  1NEG A;  1MV3 A;  2AKK A;  3H0H A;  5GJW B;  3H0F A;  3A98 A;  4LNP A;  4RTZ A;  4JPB W;  1QCF A;  2ROL A;  2LQW A;  2DMO A;  2L3S A;  4LE9 A;  1OV3 A;  2DL5 A;  4AFQ C;  2BZY A;  1YWO A;  2RNA A;  3QWY A;  1AWJ A;  2L2P A;  1Z9Q A;  2HSP A;  4D8K A;  1YWP A;  4FSS A;  1UJY A;  4D8D A;  1I0C A;  1LCK A;  2D0N A;  2EBP A;  4J9F A;  4KRT A;  1Y0M A;  4RTV A;  2ENM A;  2LX7 A;  1AWX A;  1B07 A;  1WX6 A;  1GCQ A;  4ORZ A;  4LUD A;  1QKX A;  4Y92 A;  4AG1 C;  2KE9 A;  1Y57 A;  3SEM A;  2KGT A;  1GRI A;  5IHK A;  1KJW A;  3THK A;  1SHF A;  3TSW A;  1J3T A;  1AD5 A;  2DL4 A;  1MV0 B;  1JXO A;  2FPF A;  1PKS A;  1RLQ C;  1PHT A;  2C0I A;  3VRZ A;  3REA B;  4Z88 A;  2RQT A;  1ZUY A;  1NM7 A;  4OMM A;  2NUZ A;  2A37 A;  1EFN A;  3R6N A;  3PVL A;  2DX1 A;  5GJV B;  3TSZ A;  1K1Z A;  1H8K A;  3ZL7 C;  1WIE A;  4E6R A;  2EYY A;  2CH4 A;  2J05 A;  4A63 B;  1UE9 A;  4AG2 C;  5L23 A;  2AKL A;  3O5Z A;  2JMC A;  2ECZ A;  3JV3 A;  2AZV A;  2KT8 A;  4OMQ A;  1I07 A;  1QWF A;  4OML A;  1U3O A;  2F2V A;  4R0K A;  3NPF A;  2BZX A;  4DEY A;  2LJ0 A;  2XMF A;  4RTW A;  1K4U S;  1W70 A;  1QWE A;  1X69 A;  1TUD A;  1WFW A;  5IXF A;  3EG3 A;  2VKN A;  2YUO A;  2VWF A;  3FJ5 A;  3EHQ A;  2RQR A;  2DE0 X;  2EYZ A;  1I1J A;  3VS3 A;  2K6D A;  1W1F A;  4J9E A;  2JM8 A;  4CC3 A;  1CSK A;  3PE0 A;  4J9B A;  3REB B;  3VS4 A;  5I22 A;  2X3W D;  1ZLM A;  3ULR B;  2J6O A;  2EKH A;  4JJC A;  2O9V A;  3U23 A;  1NEB A;  3VS2 A;  1SRL A;  2EGA A;  3M0T A;  2DIL A;  4J9H A;  1ZUU A;  1G83 A;  3NMZ C;  1ZUK A;  2C0O A;  2BTT A;  1KIK A;  2DL8 A;  2DRK A;  4AFZ C;  1PWT A;  1AOJ A;  5IXB A;  2F2X A;  1JEG A;  1M27 C;  2EGC A;  4OMP A;  2CT3 A;  2V1R A;  1BU1 A;  1AZG B;  2FO0 A;  1B3Q A;  1JXM A;  1WXT A;  2J7I A;  1VA7 A;  1JO8 A;  1YNZ A;  2JT4 A;  1AWO A;  1NYG A;  4DEX A;  2DRM A;  2DYB A;  3UA7 A;  4HCK A;  2KT1 A;  2SEM A;  2X3X D;  1UDL A;  2LQN A;  1OPL A;  1M8M A;  1U06 A;  2DBK A;  2YT6 A;  1VYV A;  4J9D A;  2RPN A;  2LZ6 B;  4JZ3 A;  1AWW A;  2L3P A;  1RUW A;  2MCN A;  1BBZ A;  4J9I A;  1PKT A;  4RTU A;  1IO6 A;  2F2W A;  4LUE A;  1SEM A;  3H41 A;  1X43 A;  4IIM A;  3M0U A;  5FW9 A;  1YCS B;  2KXD A;  4CC7 A;  5IHN A;  2DNU A;  2MIO A;  1WXB A;  2GTO A;  2KNB B;  1WI7 A;  2EW3 A;  2M51 A;  2DL3 A;  1M30 A;  2MOX A;  2CRE A;  4J9G A;  2CSQ A;  4RUG A;  2DBM A;  1OEB A;  2RQU A;  1QLY A;  2FEI A;  2JXB A;  1X6B A;  3M0R A;  3VS0 A;  1UG1 A;  4J9C A;  3VRY A;  3VS1 A;  1SHG A;  4CC4 B;  1ARK A;  2PTK A;  5ECA A;  1M3C A;  1BK2 A;  2QDL A;  2SRC A;  2CUD A;  2KYB A;  1ABQ A;  1N5Z A;  1BB9 A;  1NLP C;  1PNJ A;  1UHF A;  4HXJ A;  1GCP A;  2DLP A;  2DL7 A;  2GBQ A;  1W6X A;  2IIM A;  5FWC A;  1VYU A;  4RTX A;  4ZNX A;  4ESR A;  1AZE A;  2JTE A;  4CC2 A;  1UUE A;  4M4Z A;  3LH5 A;  2LCS A;  3NHN A;  4IIO A;  1K0S A;  3M0Q A;  2LJ1 A;  4HVU A;  1CKA A;  1NLO C;  2VVK A;  4OMN A;  2K79 A;  2HDA A;  1KSW A;  1UJ0 A;  2PZ1 A;  2GQI A;  3I9Q A;  1GBQ A;  1OPK A;  4K11 A;  3EHR A;  1A0N B;  1T0J A;  2V1Q A;  5HCK A;  1QKW A;  1U5S A;  1WDX A;  1M3B A;  4RTT A;  2YSQ A;  1HJD A;  4RTY A;  3C0C A;  4HVW A;  2YUP A;  1E6H A;  2KRS A;  4HVV A;  1H3H A;  2DF6 A;  3H0I A;  2KR3 A;  1PRM C;  3NGP A;  5IH2 A;  2A28 A;  2KRO A;  4AFU C;  3VS7 A;  1UEC A;  2E5K A;  2FRY A;  1MUZ A;  4JJB A;  3VS5 A;  5I11 A;  1E6G A;  2CT4 A;  2DM1 A;  5EC7 A;  1UGV A;  1K76 A;  2JS2 A;  1GL5 A;  4AFS C;  1AVZ C;  1TG0 A;  1JU5 C;  1HD3 A;  2EQI A;  1ZBJ A;  2L0A A;  2OAW A;  2O88 A;  4GLM A;  2D1X A;  2KEA A;  2YUN A;  1T0H A;  4X1V A;  3UA6 A;  2W10 A;  2LJ3 A;  1X27 A;  2PNI A;  4JJD A;  2KXC A;  1E7O A;  2ED1 A;  3GBQ A;  2EYX A;  1Z9Z A;  1K9A A;  2A36 A;  4EIK A;  2H8H A;  1FYN A;  2ROT A;  1PRL C;  2FPE A;  3EG0 A;  1ABO A;  2KRM A;  1FMK A;  1CKB A;  2HCK A;  4QT7 A;  2CH4 W;  2GTJ A;  2EGE A;  1K0X A;  2EVR A;  2CUB A;  1TUC A;  2GNC A;  2ESW A;  1NYF A;  3UAT A;  1UFF A;  1RLP C;  2W0Z A;  2P4R A;  4F17 A;  2K7A A;  2D8H A;  1GBR A;  2RQV A;  2OJ2 A;  2K9G A;  2JW4 A;  1SPK A;  3PVQ A;  4F16 A;  2I0N A;  4Z89 A;  3CQT A;  1YP5 A;  2DJQ A;  3M0S A;  2RF0 A;  2LNH B;  3EG1 A;  1X2Q A;  5FWB A;  2AZS A;  2JS0 A;  1NG2 A;  2HBW A;  2ED0 A;  1RI9 A;  2O9S A;  1ZX6 A;  3IQL A;  2JM9 A;  2KYM A;  3RBB B;  2O2O A;  2HEQ A;  2NWM A;  2K3B A;  1WA7 A;  2RMO A;  2M0Y A;  4WCI A;  2RQW A;  2ABL A;  2JMA A;  2RN8 A;  2G6F X;  2K2M A;  2EPD A;  3VS6 A;  1SSH A;  1XOV A;  1S1N A;  2C0T A;  3I5R A;  2AK5 A;  1YN8 A;  3I5S A;  2O31 A;  2OI3 A;  4LN2 A;  2J06 A;  2DVJ A;  1GFD A;  1OOT A;  2EYW A;  1M3A A;  2CSI A;  2CDT A;  1ZSG A;  2J6F A;  2KRN A;  2GGR A; 
#chains in the Genus database with same CATH topology
 3RDV A;  4C0D B;  2CP0 A;  3BW1 A;  3SHW A;  4N0A A;  1WLP B;  3JB9 G;  1K73 U;  5GAM f;  3HKS A;  3LGL A;  2YUQ A;  1X2K A;  4F14 A;  3EG2 A;  3CME Q;  3EG9 A;  3KFV A;  5GAN 8;  1NPR A;  1M1K U;  4C0D C;  1SRM A;  4MZM A;  2V8K A;  3DLM A;  3UWN A;  1V1C A;  2KBT A;  3VUB A;  4ELY C;  1TS9 A;  2L3Q A;  5GAN d;  1GFC A;  3I35 A;  3MET A;  1YIT Q;  4J7F A;  5HK0 A;  3V8K A;  4KH1 B;  1QMC A;  1KQS S;  2AIR B;  3OA6 A;  1YJW Q;  5CKH A;  5LJ5 j;  2BZY A;  2RH2 A;  4FM4 B;  3S3O A;  3CXC S;  2EJ9 A;  1PD1 A;  4JRI A;  4D8D A;  2EBP A;  4KRT A;  4KUL A;  2PU9 B;  2HBP A;  2ENM A;  2VGN A;  1KC8 U;  2K5L A;  1NJI C;  1B07 A;  2X4W A;  3GLX A;  5GMK j;  1K9M C;  2VC8 A;  3P8H A;  4LUD A;  1RAE B;  1Q81 R;  3SD4 A;  3I55 T;  1KJW A;  3THK A;  3TSW A;  2QTV A;  1AD5 A;  2DL4 A;  3QZ5 B;  2FPF A;  1PHT A;  2C0I A;  3VRZ A;  5J39 A;  4A4H A;  2A37 A;  3CEY A;  2YXY A;  1ZA1 B;  3FC3 A;  3CC7 T;  4WF2 A;  3QYH B;  1R77 A;  4C8Q B;  2WSC E;  1I81 A;  2J05 A;  2EYQ A;  4AG2 C;  4C5I A;  3LGF A;  4M78 F;  2QQB A;  1PSE A;  2O4X A;  2JMC A;  4X9C A;  2AZV A;  2CP6 A;  5C0M A;  4IUP A;  4EMK A;  5KYY A;  4FT4 A;  1MNE A;  3H9N A;  4R0K A;  3NPF A;  3OB9 A;  3QJY A;  4KBM B;  2K5I A;  5GAN 2;  3CCQ Q;  1QCO A;  1IGQ A;  4M78 A;  4JRQ A;  1W70 A;  2VXE A;  3GPL A;  4C8Q C;  1YBY A;  2DIQ A;  3EG3 A;  1G3S A;  1WPY A;  2DER A;  3FJ5 A;  3MEA A;  5DY9 A;  1VQ7 Q;  2QTX A;  2RQR A;  3L2R A;  2DE0 X;  1BI3 A;  3KXT A;  2K6D A;  2D0Q B;  3URG A;  3M53 A;  4M7A D;  2PUO B;  2JM8 A;  2CZ1 B;  2JZ2 A;  4J9E A;  1H3Z A;  4CC3 A;  2JNG A;  4DQ2 A;  1VQM T;  3U23 A;  4IUQ A;  4B9W A;  2QQ9 A;  1SRL A;  2V26 A;  1ZUU A;  3NMZ C;  2BTT A;  2DL8 A;  3OYF A;  1RI0 A;  3I56 Q;  1AOJ A;  5GAN 3;  3CC2 Q;  3GOX A;  2MK5 A;  1WQ7 A;  4HCZ A;  2MYS A;  3EFR A;  2J7I A;  1YNZ A;  4DEX A;  1VQ8 T;  2DRM A;  2DYB A;  4MDW A;  3EFO B;  1RAI B;  4M75 E;  4HCK A;  2FVU A;  4J7I A;  2KT1 A;  3M59 A;  3HPW A;  2DEQ A;  1ZSZ B;  1OPL A;  1TUG B;  2YT6 A;  2DKG A;  1VYV A;  2RPN A;  3LYI A;  4XU1 A;  2DD4 A;  3QBY A;  3G4S A;  5CIU A;  3G71 T;  1BBZ A;  1TSF A;  4J9I A;  4ZN1 A;  3CCR A;  2VB6 A;  1YJN Q;  2F2W A;  4DBF A;  1SEM A;  1X43 A;  3M0U A;  5GAO l;  3JRZ A;  2DD5 A;  1VQ5 A;  3OSS C;  4FW2 A;  3M5A A;  1ZSZ C;  4PNO A;  2QEX T;  4QQG A;  4FYX B;  2M51 A;  1Q86 R;  2CRE A;  5GAN 7;  4HT9 A;  2DBM A;  1OEB A;  2ZPI B;  4DBQ A;  2F69 A;  3I55 Q;  2I2L A;  1VQP A;  3VS0 A;  2VYT A;  4J9C A;  3CCM T;  4M77 B;  2RJE A;  6AT1 B;  4UC4 A;  4XQ3 A;  2F1L A;  2E41 A;  3CC7 Q;  3JAM E;  1VQL T;  2CZ7 B;  2K57 A;  2EAY A;  1UHF A;  2R5A A;  3JCM V;  1VYU A;  1RAA B;  2RJF A;  3MHX A;  1HYO A;  1N27 A;  1LOJ A;  4M77 C;  1IRE B;  4IIO A;  5LJ5 d;  4II1 A;  2DTH A;  3BE3 A;  1D0Y A;  3LX7 A;  3NTK A;  2K79 A;  1KQS P;  1UJ0 A;  2DPP B;  2DXB A;  3G7Z A;  3I9Q A;  1GBQ A;  4C92 F;  3QKJ A;  4RKU E;  3EHR A;  1T0J A;  3HTR A;  3CXC P;  2KQW A;  2XKO C;  1YI2 A;  3SWN B;  1WDX A;  4C5H A;  5IAY A;  3ZFJ A;  2YSQ A;  3OW2 S;  4HVW A;  2YUP A;  3CPW S;  4HVV A;  1VQM Q;  4C92 A;  2DF6 A;  2ZCF B;  1OI1 A;  4AFU C;  3JCM J;  4ELZ C;  1MUZ A;  3CCJ A;  3V8L A;  5FRN A;  3CCE A;  3JCM b;  1GL5 A;  2LCL A;  1TG0 A;  3SWN C;  2L0A A;  2BE9 B;  2OAW A;  2E64 A;  3A8M B;  4DOV A;  2KEA A;  2YUN A;  2OTL A;  1T0H A;  1O75 A;  1X27 A;  3CCU T;  4M7D G;  5C6S A;  1VQ8 Q;  2E4H A;  1E7O A;  1K8A U;  3GBQ A;  3L42 A;  4AT1 B;  4LD9 K;  4Y28 E;  2ZZD A;  4EIK A;  4A4E A;  1HK9 A;  1PRL C;  3QO3 A;  2XD0 A;  2YWW A;  4XU0 A;  3G71 Q;  2VXF A;  5CVI A;  1TUC A;  1KQ1 A;  2D9T A;  2GNC A;  1KD1 R;  1BI2 A;  4M75 G;  3EH2 A;  2BKD N;  3JB9 I;  1YJ9 Q;  1XQH A;  2QAS A;  2RQV A;  4LDV A;  4NS5 A;  5CCA A;  5GAM g;  1U1T A;  5KYX B;  3QHS A;  2QEX Q;  3MPU B;  3JB9 D;  2I0N A;  3CQT A;  1YP5 A;  4LDW A;  2M0O A;  2AZS A;  1VIF A;  2JS0 A;  2NUP A;  4HCC A;  2ED0 A;  1M5Q 1;  1ZX6 A;  4F7U F;  5I2S A;  3OYG A;  3A5Z B;  2JM9 A;  4NL3 A;  2FHD A;  1D3B B;  3CCM Q;  1Q86 C;  2K3B A;  2RQW A;  2BE7 D;  3CD6 A;  4F7U A;  1VQL Q;  1Q7Y C;  1SSH A;  2NUT B;  1S72 T;  2AK5 A;  2HL3 A;  2M16 A;  3HSB A;  3L2Q A;  4XU3 A;  4ZN3 A;  4J83 A;  2J06 A;  1JJ2 S;  3CCV A;  2DVJ A;  3P8D A;  2M9U A;  3MJX A;  1OOT A;  1VQ9 Q;  3OYB A;  5LJ3 f;  2CDT A;  2R58 A;  1Q82 R;  2KRN A;  4RCB A;  4PJO F;  1X6G A;  4PKC C;  3LLR A;  1VYT A;  3G6E T;  5GAM h;  1BYM A;  4OMO A;  4MZP A;  2M02 A;  2DA9 A;  2MWO A;  4Z8A A;  2XDD A;  3OYH A;  1WXU A;  4PJO A;  4M7A B;  1T3S A;  2FL7 A;  2JUF A;  5CK9 A;  1N9S A;  1UTI A;  2RJD A;  2D8J A;  2XI9 A;  4OP0 A;  4PK4 A;  2QQS A;  3DLL A;  1B34 A;  4DOW A;  1Y96 A;  3CC4 T;  3QYG B;  2JVV A;  3OMG A;  4M75 B;  1KFZ A;  1M8V A;  2J6K A;  3OYD A;  1N8R R;  4M7A C;  1JQQ A;  3EGD A;  5IHI A;  1H92 A;  1MV3 A;  1V29 B;  3GF5 A;  5GJW B;  3RUX A;  3H0F A;  4R55 A;  4ZGD B;  4RTZ A;  2QA4 T;  1QVP A;  1F1B B;  2P0P A;  2ROL A;  3A1P A;  2LQW A;  3CCU Q;  2DL5 A;  5GMK m;  1I5O B;  4M75 C;  2IVW A;  2AT1 B;  3LH0 A;  1TH7 A;  5I21 A;  3CCL Q;  4FSS A;  1UJY A;  1W4S A;  1I0C A;  4RTV A;  1PC0 A;  2LX7 A;  1AWX A;  2XK0 A;  1IXD A;  3QG1 A;  4P5N A;  5GAO p;  5KCH A;  1KQS A;  1EX4 A;  4Y92 A;  4AG1 C;  3GIB A;  1NJI U;  2XDP A;  2KGT A;  1GRI A;  1K9M U;  3CXC A;  3FDR A;  1SHF A;  3PIP A;  1J3T A;  4QVD A;  3RES A;  1PKS A;  1RLQ C;  4L59 A;  5D7U A;  1ZUY A;  1NM7 A;  1OU9 A;  2NUZ A;  3PVL A;  1KD1 C;  2DX1 A;  1YHQ T;  4KT0 E;  3TSZ A;  2XHC A;  1K1Z A;  1UB4 A;  1WIE A;  4E6R A;  3OW2 P;  1FMV A;  3CPW P;  1UE9 A;  2CYZ B;  3O5Z A;  1MMA A;  1VQK A;  3HP9 A;  2YRD A;  1HXD A;  4D6W A;  2OAU A;  1OU8 A;  3L2Z A;  2DXT A;  1PD0 A;  2LX9 A;  1YIT A;  2BZX A;  2XMF A;  4A4G A;  3BDU A;  1K4U S;  4BI3 A;  1QWE A;  1X69 A;  1M90 U;  1WFW A;  1PSF A;  5IXF A;  4FYV B;  2YUO A;  4OB0 B;  3KUF A;  1WNL A;  2RK1 A;  5DLO A;  2P84 A;  2K2V A;  1I1J A;  1QP2 A;  2VV5 A;  3JCM X;  1OX8 A;  1VQ4 Q;  1CSK A;  3G6E Q;  3VKI A;  3ULR B;  4JJC A;  2O9V A;  1NEB A;  3M0T A;  1Q82 C;  1WHH A;  2HNI A;  2MI6 A;  3OYC A;  1KIK A;  3CBP A;  1VQ6 Q;  3OYI A;  4AFZ C;  4MDX A;  1M9S A;  3BDL A;  1PWT A;  1JEG A;  2RK2 A;  2R57 A;  4OMP A;  4C8Q F;  4BAC A;  1BU1 A;  3CC4 Q;  2FO0 A;  4OVA A;  1WXT A;  1JXM A;  3PMI A;  2COZ A;  5KYN A;  5J3B A;  2X51 A;  2X3X D;  2LQN A;  1M8M A;  1U06 A;  2DBK A;  4C8Q A;  3V8J A;  1AWW A;  3E19 A;  2K3Y A;  3A8G B;  5A0D A;  2KDS A;  3CCQ A;  3JCM W;  1PCX A;  5LL6 S;  1N8R C;  1WZO A;  1OYX A;  4PFZ A;  1VQO T;  1PKT A;  4RTU A;  2LQ8 A;  3QXE B;  2LT4 A;  3WVD B;  1VQ7 A;  3H41 A;  1TTH B;  5FW9 A;  4JDS A;  4BI8 B;  3CMA Q;  2F5K A;  5IHN A;  1JJ2 P;  2DNU A;  5CKF A;  2RD1 A;  1WXB A;  2GTO A;  3EG9 B;  1YIJ A;  3J7A F;  1WI7 A;  2EW3 A;  2QI2 A;  2DL3 A;  4DBR A;  1QLY A;  3E1S A;  2XIC A;  2JXB A;  3M0R A;  1UG1 A;  2LNV A;  1N9R A;  4E7Z A;  3I56 A;  1SHG A;  3CC2 A;  1ARK A;  1WHM A;  2X4J A;  4HT8 A;  1YHQ Q;  4B9X A;  3JCM c;  4GY5 A;  4IKF A;  2YRC A;  4N4G A;  1G5V A;  2KYB A;  4LDU A;  1ABQ A;  1Q81 U;  5GAN f;  3JCM g;  2DL7 A;  2GBQ A;  2MMP A;  1W6X A;  1D1C A;  2IIM A;  2QYZ A;  4RTX A;  5FWC A;  1W2B S;  2JTE A;  5KYW B;  3ME9 A;  3G4S T;  3OYM A;  2X4X A;  3HFN A;  1BIB A;  4F04 B;  3M0Q A;  5GAM e;  5D6Y A;  1ZSZ A;  2YLB A;  1Y7X A;  1QQJ A;  1VQ5 T;  1YJN A;  2HDA A;  2KSS A;  4ANJ A;  4J6X A;  4JJN K;  1MND A;  2FZK B;  2PZ1 A;  2DFU A;  1OPK A;  1A0N B;  2PVO B;  2V1Q A;  5HY6 A;  1D1B A;  5HCK A;  2L89 A;  1WHJ A;  2FZC B;  2RI5 A;  3M57 A;  5FU6 B;  4M7D E;  2Z0W A;  1HJD A;  4RTY A;  4M75 D;  3JCM P;  2CZ6 B;  1VQP T;  1Q95 G;  2ATC B;  2KRS A;  3FJP A;  3FEO A;  4XTV A;  3NGP A;  4FYY B;  2VUB A;  4O6J A;  2A28 A;  2KRO A;  3I55 A;  3VS7 A;  2FRY A;  4M77 F;  1IHV A;  3DB3 A;  5EC7 A;  3JCM h;  1UGV A;  2DK3 A;  2QQA A;  1AVZ C;  3UT1 A;  4CRI A;  5KYY B;  1C0M A;  3OW2 A;  2LRQ A;  3CPW A;  2EQI A;  3CC7 A;  5FU6 C;  2D1X A;  3G1J A;  2ZGW A;  4M77 A;  4X1V A;  3UA6 A;  2LJ3 A;  4JJD A;  2KXC A;  3WXM B;  2MAM A;  2ED1 A;  2MF2 A;  2E5Q A;  2EYX A;  4AMC A;  2DXC A;  5M9O A;  2FPE A;  1KC8 C;  4QT7 A;  3MKD A;  3MEU A;  9ATC B;  1IZ6 A;  1VQO Q;  5LJ5 h;  5LJ3 g;  4KGZ B;  1NYF A;  1VQN A;  3UAT A;  1QW1 A;  2P4R A;  4F17 A;  2PQW A;  2OJ2 A;  2K9G A;  2JW4 A;  5CKE A;  4FSX A;  1SPK A;  1Q7Y R;  4F16 A;  2JOY A;  3EFS A;  4Z89 A;  4PJO E;  4N4I A;  3MEW A;  4C0G A;  3OS1 A;  1AT1 B;  4JS4 A;  2QDY B;  3MEV A;  4IUT A;  5FWB A;  4Q5W A;  3HRU A;  3FIF A;  1NG2 A;  2HBW A;  3CCJ T;  2GFA A;  3IQL A;  3CCE T;  3SWN A;  4R56 A;  1UGR B;  5AT1 B;  1IRX A;  3X26 B;  1EZZ B;  2O2O A;  1OZ2 A;  3L2V A;  4WCI A;  2M0Y A;  4LDY A;  2ABL A;  2RN8 A;  2ZPG B;  2K2M A;  4N4H A;  3VS6 A;  2KI7 A;  1Q86 U;  1XOV A;  3I5R A;  4ME7 A;  3PT9 A;  2XG8 D;  2X9H A;  4A4F A;  1OZ3 A;  4PFO A;  1VQ8 A;  1KHC A;  4C92 G;  1M3A A;  5LJ3 h;  5GAM j;  2J6F A;  3BFM A;  4KUD K;  4BE1 A;  2HKQ B;  1GXI E;  2RM4 A;  1UHC A;  3M0P A;  1IGU A;  2LMJ A;  2FPD A;  3VYH B;  3G71 A;  2EKO A;  1VQ5 Q;  5KCO A;  3L2U A;  1JJ2 A;  1T3L A;  2RHZ A;  3RMS A;  3TVT A;  4BUG A;  1GCQ C;  1YJ9 A;  2B86 A;  3ER0 A;  4EPC A;  2V8I A;  3CCS T;  1M2V B;  2QEX A;  3SDZ A;  3TRE A;  3EAE A;  4C0F A;  2EWN A;  2DJZ A;  2E6Z A;  1VQP Q;  1UGQ B;  3RNJ A;  3JCM f;  2OX7 A;  2YDL A;  5KYX A;  1NPP A;  2A08 A;  3RR6 A;  1HSQ A;  2NYS A;  4KH0 B;  5IN1 A;  2KAF A;  4BD3 A;  3S3M A;  2GFU A;  2KY9 A;  3CD6 T;  1WYX A;  2FG0 A;  1ZHI A;  2AKK A;  4EMH A;  3AHU A;  1QCN A;  3A98 A;  3OS2 A;  4A4K A;  1D3B A;  7AT1 B;  3CCV T;  4JPB W;  1QCF A;  3C4S A;  4FL6 A;  1JB0 E;  2DMO A;  2L3S A;  4LE9 A;  3X24 B;  4AFQ C;  1G3W A;  4L5G A;  1YWO A;  3CPF A;  2EQM A;  2L2P A;  1YWP A;  1VQ9 A;  1LCK A;  4J9F A;  1LVK A;  1X6O A;  5LJ5 f;  1FXX A;  4PJJ A;  1WX6 A;  2LCC A;  1W2B P;  4PFP A;  1ZA2 B;  1QKX A;  2KE9 A;  3QUI A;  1XTD A;  1Y57 A;  4F7U G;  3SEM A;  4FCY A;  2YHT A;  5DM7 R;  4M7A F;  2E3H A;  1MV0 B;  1U1S A;  4O5V A;  1YCY A;  3REA B;  2HD0 A;  2H3E B;  2RB6 A;  4BDY A;  4OMM A;  1EFN A;  3R6N A;  2Y4X A;  5IT9 E;  4FIB A;  4M7A A;  5GJV B;  4BB7 A;  4LXC A;  4BE2 A;  2V8J A;  1VOM A;  3ZL7 C;  1RAC B;  3CCJ Q;  2CH4 A;  1KD1 U;  1FWZ A;  4EMG A;  5GAN 6;  4XK8 E;  4FYW B;  2KMT A;  4PJO G;  2ECZ A;  2CZ0 B;  2KT8 A;  1BKB A;  4OMQ A;  1QWF A;  4OML A;  3D7S B;  3V7S A;  3OYL A;  3MP1 A;  4DEY A;  2LJ0 A;  3KBG A;  4RTW A;  1TUD A;  3CCU A;  2RI2 A;  1D0Z A;  3MP8 A;  2D6F A;  4E7I A;  3EHQ A;  2ZPE B;  3CCL A;  4M7D B;  1JBM A;  3VS3 A;  2VAS A;  1RAF B;  1M4Z A;  1W1F A;  1NBE B;  3PE0 A;  4J9B A;  3VS4 A;  2X3W D;  3OSV A;  1ZLM A;  2XU8 A;  3H6Z A;  2HMA A;  2J6O A;  4FW1 A;  2EKH A;  2EJF A;  4RCC A;  5KYU B;  5GAN 5;  2EGA A;  2NUP B;  2DIL A;  2RHI A;  3J81 E;  1G83 A;  1ZUK A;  2C06 A;  2XID A;  3GNG A;  4J8O A;  1WGS A;  3CCS Q;  4BY6 B;  4M7D C;  2DTI A;  4L6V 5;  1SSF A;  3JCM e;  1Q82 U;  2RHX A;  3RIR A;  1LPL A;  1VUB A;  3M54 A;  3OS5 A;  2F2X A;  5GAO r;  2A0F B;  1VQK T;  4X34 A;  2RHY A;  1VA7 A;  3HHT B;  1JO8 A;  4ZTF A;  1NYG A;  1AWO A;  3SB2 A;  2OTJ A;  1BIA A;  3VJP A;  1MMN A;  3UA7 A;  1YIT T;  2QK0 A;  1QP3 A;  1UDL A;  2E70 A;  4ZGE B;  4BY6 C;  2COY A;  4J9D A;  2LZ6 B;  3QJ6 A;  1EIF A;  3M4Y A;  2L3P A;  4M78 E;  5GAN g;  1RUW A;  2MCN A;  1G3T A;  1M1G A;  3A8O B;  5LJ5 e;  1IO6 A;  5GAM d;  1B7T A;  4LUE A;  2RJC A;  1G8X A;  4IIM A;  1N8R U;  1YCS B;  1V76 A;  4CC7 A;  2KNB B;  3T9N A;  2G3R A;  1WJS A;  3GNF B;  2MOX A;  1M30 A;  3CME A;  1VQ4 A;  4J9G A;  3G6E A;  4RUG A;  1B34 B;  5CO7 A;  3PNW C;  2DVE A;  2FEI A;  4IUR A;  3S6W A;  1X6B A;  3EGX B;  1P92 A;  3TCJ A;  3OYY A;  4ZTJ A;  1VQ6 A;  1WHG A;  4E2F B;  3EH1 A;  3VS1 A;  4CC4 B;  2PTK A;  4RMO A;  1OQK A;  2QDL A;  2SRC A;  3JB9 J;  1K73 R;  4Y91 A;  3CC4 A;  1KQ2 A;  4MMK A;  5GMK l;  1N5Z A;  4JLI A;  3GP8 A;  2K5F A;  1NLP C;  1M2O A;  5GAN h;  2ZPF B;  3PFS A;  1GCP A;  1S72 Q;  1H64 1;  4ESR A;  4ZNX A;  1YJW A;  1AZE A;  5LJ3 e;  1UUE A;  4M4Z A;  3CCQ T;  3LH5 A;  2DZC A;  3MCA B;  3RKW A;  3ZBD A;  1M1K R;  5AYF A;  4HVU A;  4XU2 A;  1NLO C;  2VVK A;  3V7C A;  5FU7 B;  1UGP B;  3RER A;  1YIJ T;  2GQI A;  1W2B A;  4K11 A;  1QVG A;  8AT1 B;  5KH6 A;  3CMA A;  3HRT A;  1QKW A;  1R8O B;  1U5S A;  3M9Q A;  4C8Q G;  3C0C A;  5GMK i;  1FX7 A;  1E6H A;  1LJO A;  1H3H A;  3JB9 F;  2EQK A;  2E3I A;  3I56 T;  3CC2 T;  5FU7 C;  2E5K A;  1NZ9 A;  4JJB A;  2EQJ A;  5I11 A;  4XAX B;  1K76 A;  1KC8 R;  1JU5 C;  1HD3 A;  1ZBJ A;  1VQK Q;  1YHQ A;  2O88 A;  4XTU A;  1R0B G;  5HK3 A;  4KGV B;  3JSC A;  2W10 A;  3LWI A;  2PNI A;  2QA4 Q;  2LC4 A;  4PLL A;  4C5E A;  2DO3 A;  2X35 A;  2RHU A;  2PVG B;  1Z9Z A;  4QKU A;  1QVF A;  2A36 A;  1MGQ A;  2WSF E;  2ROT A;  3FRN A;  3C95 A;  1ABO A;  1MMD A;  4PJN A;  2KRM A;  1FMK A;  3PTA A;  1YJN T;  2YRV A;  2HCK A;  3OY9 A;  2CH4 W;  4BE0 A;  4C92 D;  2EGE A;  1K0X A;  2CUB A;  5KYW A;  3HFO A;  3A8H B;  5GAN 4;  2ESW A;  3OBY A;  2DIG A;  3ASK A;  1UFF A;  1RLP C;  1R0C B;  2K7A A;  3UPU A;  2MWP A;  1GBR A;  3CBM A;  1WHK A;  4DA4 A;  4N0A C;  2LTO A;  5L8R E;  4XTX A;  4M78 G;  1RAG B;  3PVQ A;  5KE2 A;  3VU3 C;  2DJQ A;  3M0S A;  3QZ9 B;  4QVC A;  4C92 E;  3EG1 A;  3LWH A;  3MP6 A;  4QVZ A;  2HQH A;  2DYI A;  4J6W A;  5A0L A;  1RI9 A;  1ZQ1 A;  4JRP A;  2E65 A;  3OS0 A;  2KYM A;  3RBB B;  2HEQ A;  4OF1 A;  2KK4 A;  3TU4 K;  2LVM A;  4A53 A;  1NE8 A;  2DAQ A;  2YLC A;  2E12 A;  2G6F X;  4E7S A;  5KE3 A;  1SG5 A;  1S1N A;  4E7L A;  1QVG S;  3DB4 A;  5LJ3 j;  1YN8 A;  4OGC A;  3CCR T;  4RG2 A;  3O8V A;  3I5S A;  5D6X A;  1Y71 A;  4M7D D;  2NLU A;  3EFO A;  5A0G A;  2JTF A;  4BDZ A;  1GFD A;  2EYW A;  2HSE B;  3H8Z A;  1M90 C;  3TEE A;  4IUV A;  1TU0 B;  2M1H A;  4PJL A;  2CSI A;  1K73 C;  1ZSG A;  4LD6 A;  3EGU A;  1VQN T;  3E2U A;  3F70 A;  2FRW A;  4GBQ A;  5D6W A;  3OBW A;  1VQO A;  2H3J A;  5LJ5 g;  2AHJ B;  4M77 G;  1YIJ Q;  1AEY A;  4PL6 A;  4VUB A;  1M1K C;  2FZG B;  3S3N A;  3J80 E;  4JZ4 A;  5GAO m;  3UF4 A;  3SFM A;  3QWX X;  3AT1 B;  2RO0 A;  2HAX A;  1G2B A;  1ACM B;  2HQX A;  1QVF S;  2O4X B;  1N6A A;  2LP5 A;  4EMK B;  1G3Y A;  4M7A E;  3QDF A;  4TVR A;  2Y4Y A;  2P0Q A;  2BZ8 A;  4M78 B;  3WVE B;  1NEG A;  1M1F A;  3H0H A;  4F7U E;  1D09 B;  5CQY A;  3FLG A;  1TOV A;  2EIF A;  2CKK A;  4LNP A;  1AHJ B;  2HQE A;  3OYA A;  4GLK A;  1OV3 A;  4OGE A;  5FRM A;  4PJO D;  2RNA A;  3QWY A;  1AWJ A;  4EMK C;  3ZEH A;  1XJW B;  4QW2 A;  1Z9Q A;  2HSP A;  4PLI A;  4D8K A;  5A2Q E;  1UGS B;  4OB1 B;  2D0N A;  1Y0M A;  4M78 C;  2EJG A;  1YI2 T;  2F5T X;  1GCQ A;  4ORZ A;  2COW A;  1YJ9 T;  5GAO n;  3LW5 E;  5IHK A;  5GMK h;  2X4Y A;  2HZY A;  2O01 E;  1JXO A;  1VQM A;  4Z88 A;  2RQT A;  3P8B B;  3R6O A;  2JJ9 A;  4J5Y A;  2DEU A;  1DJ7 B;  1OX9 A;  3JCM d;  1H8K A;  2BIV A;  2OTL T;  4QQ6 A;  4JRK A;  1PM3 A;  3OYK A;  2EYY A;  4NL2 A;  1M2V A;  1I4K 1;  4A63 B;  3OYN A;  5J26 A;  5GAN e;  5L23 A;  2AKL A;  1OUL A;  3VUZ A;  1Q81 C;  2MPX C;  4XTZ A;  1I8F A;  3JV3 A;  3M58 A;  1I07 A;  3E9F A;  5GAO q;  1Q7Y U;  1X75 C;  1U3O A;  2F2V A;  2JN0 A;  1VIE A;  4PJM A;  3M56 A;  2CP2 A;  3G4S Q;  2PVD B;  2DET A;  3CCR Q;  2KVQ G;  1VQ9 T;  3JB9 H;  1Y07 A;  2VKN A;  1O9S A;  4IUU A;  2HKN A;  2VWF A;  1ZBX A;  3FB9 A;  1SKU B;  4E7J A;  1D0X A;  2CP3 A;  2EYZ A;  2LT1 A;  2IPO B;  1KG1 A;  4EDU A;  3X25 B;  3E9G A;  1VQN Q;  3REB B;  5I22 A;  1RAD B;  2QXF A;  1LNX A;  2LDM A;  3VS2 A;  2FYK A;  4J9H A;  3QSU A;  1KK7 A;  4E7H A;  2C0O A;  1K8A R;  2DRK A;  4B6M A;  3QII A;  1X01 A;  2L8D A;  3VV0 A;  5IXB A;  4KUI A;  2GCX A;  3MO8 A;  3L2W A;  3HRS A;  1M27 C;  1SF9 A;  3CCM A;  3OMC A;  2EGC A;  2CT3 A;  2V1R A;  2DZ9 A;  4DBH A;  1AZG B;  1B3Q A;  2JT4 A;  5CKD A;  1VQL A;  3NTH A;  3DKM A;  2SEM A;  2P4T A;  4X9D A;  5HKC A;  4CI0 C;  1IHW A;  4JZ3 A;  5LJ3 d;  2NUT A;  4XTY A;  3BY7 A;  4Z02 A;  3CCL T;  2P0K A;  4M7A G;  4OB2 B;  2GQV A;  2E1H A;  1QVG P;  1WQW A;  4M7D F;  2L3R A;  2KXD A;  4C92 B;  1IB8 A;  2A3L A;  4HA8 A;  1YI2 Q;  5CAI A;  2MIO A;  2R5M A;  4HCB A;  3PMT A;  4JS5 A;  1BCO A;  2CSQ A;  4M7D A;  3Q1J A;  2CP7 A;  2RQU A;  1RAH B;  4WTO B;  1D1A A;  3X28 B;  1BCM A;  2K4Y A;  4M75 F;  4C8Q D;  2E10 A;  3VRY A;  3CCS A;  1FMW A;  3CCE Q;  3QPH A;  5KYU A;  4C92 C;  4A54 A;  5ECA A;  1M3C A;  5GAN j;  1BK2 A;  2L5Q A;  2QAZ A;  4J6Y A;  2CUD A;  2OTJ T;  2OTL Q;  4M75 A;  2EFI A;  2K3X A;  1BB9 A;  1PNJ A;  1C1A A;  2HL5 C;  2Y90 A;  4HXJ A;  2QGF B;  1QVF P;  2DLP A;  3VYG A;  3C12 A;  3INZ A;  4C8Q E;  4FT2 A;  1BI0 A;  2CP5 A;  4FU6 A;  5CR2 A;  4CC2 A;  1YFN A;  2LCS A;  3NHN A;  2QGG A;  1JRI A;  2RA2 A;  2QQR A;  1K0S A;  2LJ1 A;  4E47 A;  4C0Z A;  1CKA A;  4OMN A;  2CGH A;  1RAB B;  2A7Y A;  1PG5 B;  3PIO A;  1WJR A;  1KSW A;  2GF7 A;  1UEB A;  3N5B B;  2PUK B;  1VQ4 T;  3CME T;  5EG2 A;  8ATC B;  2FB7 A;  1M3B A;  4RTT A;  4ATO A;  3RKX A;  3NTI A;  3H0I A;  2KR3 A;  1VQ6 T;  2LQK A;  3JCM Q;  1PRM C;  5IH2 A;  4JUV A;  4F7U B;  4M78 D;  4QQD A;  1C6V X;  1UEC A;  4LDX A;  4RG8 A;  2WSE E;  3VS5 A;  1E6G A;  2CT4 A;  2DM1 A;  2XDB A;  2JS2 A;  3OYE A;  3CD6 Q;  5DLQ E;  4AFS C;  3QDR B;  4OMF B;  1KHI A;  3EGX A;  4GLM A;  1U8R A;  1K8A C;  1RL2 A;  1NJI R;  1YJW T;  4YTL A;  1MMG A;  1WJQ A;  1K9M R;  2B8A A;  3X20 B;  3CCV Q;  3OQ5 A;  3OYJ A;  1S72 A;  4OB3 B;  2IG0 A;  4C5G A;  1K9A A;  5CKB A;  2BUD A;  2H8H A;  3A8L B;  1FYN A;  2DXU A;  3EG0 A;  1TWB A;  4PJO B;  1CKB A;  3C94 A;  5FLX E;  2GTJ A;  2EVR A;  4MZT A;  2QG9 B;  2ZAE A;  2WAC A;  3CMA T;  5GMK e;  4XTW A;  3L1A A;  3UDC A;  2W0Z A;  4HKE A;  3RKY A;  2D8H A;  2JTM A;  1Y96 B;  4ZGJ B;  4NOY A;  3V7R A;  4BI4 A;  4KGX B;  5FRO A;  1BI1 A;  3PGG A;  3RMQ A;  2RF0 A;  4PJO C;  2DTO A;  3EGD B;  2LNH B;  4JLG A;  1WHL A;  4M77 D;  1X2Q A;  4V2S A;  4E7K A;  5CQX A;  2O9S A;  1M90 R;  2ZPB B;  2EQU A;  4MML A;  5I2M A;  1XNI A;  2NWM A;  2ZPH B;  1WA7 A;  2RMO A;  2JMA A;  2EPD A;  2E6N A;  4M77 E;  2OTJ Q;  3TQ7 P;  2C0T A;  3HL8 A;  2O31 A;  2OI3 A;  3CBO A;  4LN2 A;  1MHN A;  2CS7 A;  2QA4 A;  2VGM A;  2RI3 A;  1VQ7 T;  3NFC A;  3M55 A;  1TXQ A;  3M4G A;  1I5L A;  2GGR A; 
#chains in the Genus database with same CATH homology
 3EGU A;  1X6G A;  1UHC A;  2FRW A;  3SHW A;  1VYT A;  3M0P A;  4GBQ A;  2LMJ A;  4OMO A;  1WLP B;  2FPD A;  2DA9 A;  2YUQ A;  1X2K A;  4Z8A A;  1WXU A;  1T3L A;  4F14 A;  3TVT A;  1AEY A;  1T3S A;  1GCQ C;  2B86 A;  3EG2 A;  4JZ4 A;  3KFV A;  1UTI A;  3UF4 A;  3QWX X;  2D8J A;  1G2B A;  1SRM A;  3RNJ A;  2LP5 A;  2YDL A;  1V1C A;  1KFZ A;  2A08 A;  2KBT A;  1HSQ A;  2J6K A;  1JQQ A;  2L3Q A;  1WYX A;  5IHI A;  2BZ8 A;  2FG0 A;  1GFC A;  3I35 A;  1H92 A;  1NEG A;  1MV3 A;  2AKK A;  3H0H A;  5GJW B;  3H0F A;  3A98 A;  4LNP A;  4RTZ A;  4JPB W;  1QCF A;  2ROL A;  2LQW A;  2DMO A;  2L3S A;  4LE9 A;  1OV3 A;  2DL5 A;  4AFQ C;  2BZY A;  1YWO A;  2RNA A;  3QWY A;  1AWJ A;  2L2P A;  1Z9Q A;  2HSP A;  4D8K A;  1YWP A;  4FSS A;  1UJY A;  4D8D A;  1I0C A;  1LCK A;  2D0N A;  2EBP A;  4J9F A;  4KRT A;  1Y0M A;  4RTV A;  2ENM A;  2LX7 A;  1AWX A;  1B07 A;  1WX6 A;  1GCQ A;  4ORZ A;  4LUD A;  1QKX A;  4Y92 A;  4AG1 C;  2KE9 A;  1Y57 A;  3SEM A;  2KGT A;  1GRI A;  5IHK A;  1KJW A;  3THK A;  1SHF A;  3TSW A;  1J3T A;  1AD5 A;  2DL4 A;  1MV0 B;  1JXO A;  2FPF A;  1PKS A;  1RLQ C;  1PHT A;  2C0I A;  3VRZ A;  3REA B;  4Z88 A;  2RQT A;  1ZUY A;  1NM7 A;  4OMM A;  2NUZ A;  2A37 A;  1EFN A;  3R6N A;  3PVL A;  2DX1 A;  5GJV B;  3TSZ A;  1K1Z A;  1H8K A;  3ZL7 C;  1WIE A;  4E6R A;  2EYY A;  2CH4 A;  2J05 A;  4A63 B;  1UE9 A;  4AG2 C;  5L23 A;  2AKL A;  3O5Z A;  2JMC A;  2ECZ A;  3JV3 A;  2AZV A;  2KT8 A;  4OMQ A;  1I07 A;  1QWF A;  4OML A;  1U3O A;  2F2V A;  4R0K A;  3NPF A;  2BZX A;  4DEY A;  2LJ0 A;  2XMF A;  4RTW A;  1K4U S;  1W70 A;  1QWE A;  1X69 A;  1TUD A;  1WFW A;  5IXF A;  3EG3 A;  2VKN A;  2YUO A;  2VWF A;  3FJ5 A;  3EHQ A;  2RQR A;  2DE0 X;  2EYZ A;  1I1J A;  3VS3 A;  2K6D A;  1W1F A;  4J9E A;  2JM8 A;  4CC3 A;  1CSK A;  3PE0 A;  4J9B A;  3REB B;  3VS4 A;  5I22 A;  2X3W D;  1ZLM A;  3ULR B;  2J6O A;  2EKH A;  4JJC A;  2O9V A;  3U23 A;  1NEB A;  3VS2 A;  1SRL A;  2EGA A;  3M0T A;  2DIL A;  4J9H A;  1ZUU A;  1G83 A;  3NMZ C;  1ZUK A;  2C0O A;  2BTT A;  1KIK A;  2DL8 A;  2DRK A;  4AFZ C;  1PWT A;  1AOJ A;  5IXB A;  2F2X A;  1JEG A;  1M27 C;  2EGC A;  4OMP A;  2CT3 A;  2V1R A;  1BU1 A;  1AZG B;  2FO0 A;  1B3Q A;  1JXM A;  1WXT A;  2J7I A;  1VA7 A;  1JO8 A;  1YNZ A;  2JT4 A;  1AWO A;  1NYG A;  4DEX A;  2DRM A;  2DYB A;  3UA7 A;  4HCK A;  2KT1 A;  2SEM A;  2X3X D;  1UDL A;  2LQN A;  1OPL A;  1M8M A;  1U06 A;  2DBK A;  2YT6 A;  1VYV A;  4J9D A;  2RPN A;  2LZ6 B;  4JZ3 A;  1AWW A;  2L3P A;  1RUW A;  2MCN A;  1BBZ A;  4J9I A;  1PKT A;  4RTU A;  1IO6 A;  2F2W A;  4LUE A;  1SEM A;  3H41 A;  1X43 A;  4IIM A;  3M0U A;  5FW9 A;  1YCS B;  2KXD A;  4CC7 A;  5IHN A;  2DNU A;  2MIO A;  1WXB A;  2GTO A;  2KNB B;  1WI7 A;  2EW3 A;  2M51 A;  2DL3 A;  1M30 A;  2MOX A;  2CRE A;  4J9G A;  2CSQ A;  4RUG A;  2DBM A;  1OEB A;  2RQU A;  1QLY A;  2FEI A;  2JXB A;  1X6B A;  3M0R A;  3VS0 A;  1UG1 A;  4J9C A;  3VRY A;  3VS1 A;  1SHG A;  4CC4 B;  1ARK A;  2PTK A;  5ECA A;  1M3C A;  1BK2 A;  2QDL A;  2SRC A;  2CUD A;  2KYB A;  1ABQ A;  1N5Z A;  1BB9 A;  1NLP C;  1PNJ A;  1UHF A;  4HXJ A;  1GCP A;  2DLP A;  2DL7 A;  2GBQ A;  1W6X A;  2IIM A;  5FWC A;  1VYU A;  4RTX A;  4ZNX A;  4ESR A;  1AZE A;  2JTE A;  4CC2 A;  1UUE A;  4M4Z A;  3LH5 A;  2LCS A;  3NHN A;  4IIO A;  1K0S A;  3M0Q A;  2LJ1 A;  4HVU A;  1CKA A;  1NLO C;  2VVK A;  4OMN A;  2K79 A;  2HDA A;  1KSW A;  1UJ0 A;  2PZ1 A;  2GQI A;  3I9Q A;  1GBQ A;  1OPK A;  4K11 A;  3EHR A;  1A0N B;  1T0J A;  2V1Q A;  5HCK A;  1QKW A;  1U5S A;  1WDX A;  1M3B A;  4RTT A;  2YSQ A;  1HJD A;  4RTY A;  3C0C A;  4HVW A;  2YUP A;  1E6H A;  2KRS A;  4HVV A;  1H3H A;  2DF6 A;  3H0I A;  2KR3 A;  1PRM C;  3NGP A;  5IH2 A;  2A28 A;  2KRO A;  4AFU C;  3VS7 A;  1UEC A;  2E5K A;  2FRY A;  1MUZ A;  4JJB A;  3VS5 A;  5I11 A;  1E6G A;  2CT4 A;  2DM1 A;  5EC7 A;  1UGV A;  1K76 A;  2JS2 A;  1GL5 A;  4AFS C;  1AVZ C;  1TG0 A;  1JU5 C;  1HD3 A;  2EQI A;  1ZBJ A;  2L0A A;  2OAW A;  2O88 A;  4GLM A;  2D1X A;  2KEA A;  2YUN A;  1T0H A;  4X1V A;  3UA6 A;  2W10 A;  2LJ3 A;  1X27 A;  2PNI A;  4JJD A;  2KXC A;  1E7O A;  2ED1 A;  3GBQ A;  2EYX A;  1Z9Z A;  1K9A A;  2A36 A;  4EIK A;  2H8H A;  1FYN A;  2ROT A;  1PRL C;  2FPE A;  3EG0 A;  1ABO A;  2KRM A;  1FMK A;  1CKB A;  2HCK A;  4QT7 A;  2CH4 W;  2GTJ A;  2EGE A;  1K0X A;  2EVR A;  2CUB A;  1TUC A;  2GNC A;  2ESW A;  1NYF A;  3UAT A;  1UFF A;  1RLP C;  2W0Z A;  2P4R A;  4F17 A;  2K7A A;  2D8H A;  1GBR A;  2RQV A;  2OJ2 A;  2K9G A;  2JW4 A;  1SPK A;  3PVQ A;  4F16 A;  2I0N A;  4Z89 A;  3CQT A;  1YP5 A;  2DJQ A;  3M0S A;  2RF0 A;  2LNH B;  3EG1 A;  1X2Q A;  5FWB A;  2AZS A;  2JS0 A;  1NG2 A;  2HBW A;  2ED0 A;  1RI9 A;  2O9S A;  1ZX6 A;  3IQL A;  2JM9 A;  2KYM A;  3RBB B;  2O2O A;  2HEQ A;  2NWM A;  2K3B A;  1WA7 A;  2RMO A;  2M0Y A;  4WCI A;  2RQW A;  2ABL A;  2JMA A;  2RN8 A;  2G6F X;  2K2M A;  2EPD A;  3VS6 A;  1SSH A;  1XOV A;  1S1N A;  2C0T A;  3I5R A;  2AK5 A;  1YN8 A;  3I5S A;  2O31 A;  2OI3 A;  4LN2 A;  2J06 A;  2DVJ A;  1GFD A;  1OOT A;  2EYW A;  1M3A A;  2CSI A;  2CDT A;  1ZSG A;  2J6F A;  2KRN A;  2GGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...